BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21871_g2_i1 len=2761 path=[658:0-630 1289:631-690 10256:691-694
2042:695-725 2073:726-1914 1334:1915-2760]

Length=2761
                                                                      Score     E

ref|XP_007210891.1|  hypothetical protein PRUPE_ppa001838mg             362   1e-107   
ref|XP_008390304.1|  PREDICTED: transcription factor bHLH157-like       335   2e-97    
ref|XP_009773770.1|  PREDICTED: transcription factor bHLH155-like...    322   9e-93    
ref|XP_009612748.1|  PREDICTED: transcription factor bHLH155-like...    317   4e-91    
ref|XP_009773769.1|  PREDICTED: transcription factor bHLH155-like...    318   4e-91    
ref|XP_009612747.1|  PREDICTED: transcription factor bHLH155-like...    314   7e-90    
ref|XP_006343800.1|  PREDICTED: transcription factor bHLH157-like       303   6e-86    
ref|XP_010676868.1|  PREDICTED: transcription factor bHLH157            292   1e-82    
ref|XP_002518886.1|  bhlh transcription factor, putative                293   1e-82    Ricinus communis
ref|XP_004246087.1|  PREDICTED: transcription factor bHLH157 isof...    293   4e-82    
ref|XP_010325331.1|  PREDICTED: transcription factor bHLH157 isof...    288   5e-81    
ref|XP_010325330.1|  PREDICTED: transcription factor bHLH157 isof...    289   7e-81    
ref|XP_010325329.1|  PREDICTED: transcription factor bHLH157 isof...    288   2e-80    
emb|CDP20971.1|  unnamed protein product                                246   1e-65    
ref|XP_011070367.1|  PREDICTED: transcription factor LHW isoform X2     243   3e-65    
ref|XP_011070366.1|  PREDICTED: transcription factor LHW isoform X1     243   2e-64    
emb|CBI34563.3|  unnamed protein product                                225   3e-58    
gb|EYU33490.1|  hypothetical protein MIMGU_mgv1a002692mg                221   6e-58    
ref|XP_008239218.1|  PREDICTED: transcription factor bHLH157            222   9e-58    
ref|XP_002299440.2|  hypothetical protein POPTR_0001s11170g             222   1e-57    Populus trichocarpa [western balsam poplar]
ref|XP_006368796.1|  hypothetical protein POPTR_0001s11170g             218   3e-56    
ref|XP_011026816.1|  PREDICTED: transcription factor LHW                217   8e-56    
ref|XP_008806930.1|  PREDICTED: uncharacterized protein LOC103719...    216   3e-55    
ref|XP_010659858.1|  PREDICTED: transcription factor LHW                216   3e-55    
ref|XP_002303679.1|  hypothetical protein POPTR_0003s14480g             207   2e-52    Populus trichocarpa [western balsam poplar]
ref|XP_011022438.1|  PREDICTED: uncharacterized protein LOC105124216    206   3e-52    
ref|XP_010933832.1|  PREDICTED: uncharacterized protein LOC105054...    207   4e-52    
ref|XP_010933833.1|  PREDICTED: uncharacterized protein LOC105054...    206   4e-52    
ref|XP_008790524.1|  PREDICTED: uncharacterized protein LOC103707...    205   1e-51    
ref|XP_010919293.1|  PREDICTED: uncharacterized protein LOC105043446    205   2e-51    
gb|KDP25239.1|  hypothetical protein JCGZ_20395                         204   2e-51    
ref|XP_008790523.1|  PREDICTED: uncharacterized protein LOC103707...    204   3e-51    
ref|XP_008806929.1|  PREDICTED: uncharacterized protein LOC103719...    204   3e-51    
ref|XP_009358669.1|  PREDICTED: transcription factor bHLH155-like       199   4e-50    
ref|XP_010252756.1|  PREDICTED: uncharacterized protein LOC104594...    199   7e-50    
ref|XP_010252749.1|  PREDICTED: uncharacterized protein LOC104594...    199   8e-50    
ref|XP_004310273.1|  PREDICTED: transcription factor bHLH157-like       197   1e-49    
ref|XP_002446947.1|  hypothetical protein SORBIDRAFT_06g025650          198   1e-49    Sorghum bicolor [broomcorn]
ref|XP_009359586.1|  PREDICTED: transcription factor EMB1444-like       196   7e-49    
gb|KDO76670.1|  hypothetical protein CISIN_1g038975mg                   188   1e-48    
ref|XP_006439262.1|  hypothetical protein CICLE_v10018834mg             195   2e-48    
ref|XP_004298280.1|  PREDICTED: uncharacterized protein LOC101304963    192   3e-48    
ref|XP_004976520.1|  PREDICTED: transcription factor bHLH157-like       193   6e-48    
dbj|BAJ91406.1|  predicted protein                                      185   7e-48    
ref|XP_006476318.1|  PREDICTED: transcription factor LHW-like           192   3e-47    
ref|XP_004953425.1|  PREDICTED: transcription factor bHLH155-like       191   3e-47    
gb|KEH42888.1|  bHLH transcription factor-like protein                  190   3e-47    
ref|XP_009400444.1|  PREDICTED: transcription factor bHLH157-like...    189   3e-47    
ref|XP_004146200.1|  PREDICTED: transcription factor bHLH157-like       190   4e-47    
ref|XP_009382310.1|  PREDICTED: uncharacterized protein LOC103970308    191   4e-47    
ref|XP_009400443.1|  PREDICTED: transcription factor LHW-like iso...    189   4e-47    
ref|XP_010235810.1|  PREDICTED: transcription factor EMB1444-like...    189   4e-47    
ref|XP_009400440.1|  PREDICTED: transcription factor LHW-like iso...    189   5e-47    
ref|XP_008448575.1|  PREDICTED: uncharacterized protein LOC103490712    190   5e-47    
ref|XP_009389438.1|  PREDICTED: transcription factor LHW-like iso...    189   6e-47    
ref|XP_009389431.1|  PREDICTED: transcription factor LHW-like iso...    189   7e-47    
ref|NP_001146644.1|  putative HLH DNA-binding domain superfamily ...    187   9e-47    Zea mays [maize]
ref|XP_003570083.1|  PREDICTED: transcription factor EMB1444-like...    189   1e-46    
ref|XP_010106138.1|  hypothetical protein L484_003641                   189   1e-46    
ref|XP_006647675.1|  PREDICTED: transcription factor LHW-like           189   1e-46    
gb|KCW77335.1|  hypothetical protein EUGRSUZ_D01696                     184   2e-46    
ref|XP_002454491.1|  hypothetical protein SORBIDRAFT_04g032060          187   3e-46    Sorghum bicolor [broomcorn]
ref|XP_008644112.1|  PREDICTED: putative HLH DNA-binding domain s...    187   3e-46    
ref|XP_008644113.1|  PREDICTED: putative HLH DNA-binding domain s...    186   3e-46    
gb|AFW59164.1|  putative HLH DNA-binding domain superfamily protein     188   4e-46    
ref|NP_001169943.1|  putative HLH DNA-binding domain superfamily ...    186   5e-46    Zea mays [maize]
ref|NP_001047714.1|  Os02g0673500                                       187   6e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009398085.1|  PREDICTED: transcription factor LHW-like           186   7e-46    
ref|XP_008644109.1|  PREDICTED: putative HLH DNA-binding domain s...    186   8e-46    
ref|XP_008644111.1|  PREDICTED: putative HLH DNA-binding domain s...    186   9e-46    
ref|XP_007145951.1|  hypothetical protein PHAVU_006G000400g             185   3e-45    
ref|XP_007039440.1|  Serine/threonine-protein kinase WNK-related,...    183   1e-44    
ref|XP_007039441.1|  Serine/threonine-protein kinase WNK-related,...    183   1e-44    
ref|XP_007039438.1|  Serine/threonine-protein kinase WNK-related,...    183   2e-44    
ref|XP_010053090.1|  PREDICTED: transcription factor bHLH157            182   2e-44    
ref|XP_004495499.1|  PREDICTED: transcription factor LHW-like           171   8e-44    
gb|EMT18281.1|  Putative basic helix-loop-helix protein                 179   2e-43    
ref|XP_006857834.1|  hypothetical protein AMTR_s00069p00042170          180   4e-43    
ref|XP_010267512.1|  PREDICTED: transcription factor EMB1444-like...    177   7e-43    
ref|XP_010267508.1|  PREDICTED: transcription factor EMB1444-like...    177   8e-43    
ref|XP_008230230.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    179   1e-42    
gb|AFW59166.1|  putative HLH DNA-binding domain superfamily protein     175   1e-42    
ref|XP_007208256.1|  hypothetical protein PRUPE_ppa016557mg             178   2e-42    
gb|ABN06178.1|  Helix-loop-helix DNA-binding                            174   2e-42    Medicago truncatula
ref|XP_007015675.1|  Transcription factor-related, putative isofo...    177   2e-42    
gb|KHN05001.1|  Putative basic helix-loop-helix protein                 176   3e-42    
ref|XP_006606416.1|  PREDICTED: transcription factor bHLH157-like       176   3e-42    
ref|XP_009629479.1|  PREDICTED: transcription factor LHW-like           176   4e-42    
ref|XP_009760053.1|  PREDICTED: transcription factor LHW-like           176   5e-42    
emb|CBI24427.3|  unnamed protein product                                176   6e-42    
ref|XP_004139141.1|  PREDICTED: transcription factor LHW-like           176   6e-42    
ref|XP_002298267.2|  transcription factor-related family protein        173   7e-42    Populus trichocarpa [western balsam poplar]
ref|XP_008450292.1|  PREDICTED: transcription factor LHW isoform X1     176   7e-42    
gb|KHG26450.1|  hypothetical protein F383_09948                         176   7e-42    
ref|XP_010089791.1|  hypothetical protein L484_022306                   176   7e-42    
gb|EYU28511.1|  hypothetical protein MIMGU_mgv1a003404mg                172   8e-42    
ref|XP_002513717.1|  expressed protein, putative                        176   8e-42    Ricinus communis
gb|KEH38995.1|  bHLH transcription factor-like protein                  175   9e-42    
gb|KEH29771.1|  bHLH transcription factor-like protein                  175   9e-42    
ref|XP_010651650.1|  PREDICTED: transcription factor LHW-like iso...    174   1e-41    
ref|XP_009376366.1|  PREDICTED: transcription factor LHW-like           174   1e-41    
ref|XP_010031564.1|  PREDICTED: transcription factor LHW-like iso...    174   1e-41    
ref|XP_002274971.1|  PREDICTED: transcription factor LHW-like iso...    175   1e-41    Vitis vinifera
ref|XP_007161572.1|  hypothetical protein PHAVU_001G080900g             173   1e-41    
ref|XP_007150023.1|  hypothetical protein PHAVU_005G119400g             175   1e-41    
gb|KHN19923.1|  Putative basic helix-loop-helix protein                 175   2e-41    
ref|XP_003539152.1|  PREDICTED: transcription factor LHW-like           175   2e-41    
ref|XP_006589237.1|  PREDICTED: transcription factor bHLH155-like...    174   2e-41    
ref|XP_010533556.1|  PREDICTED: transcription factor bHLH157-like...    172   2e-41    
ref|XP_011088969.1|  PREDICTED: transcription factor LHW                174   2e-41    
gb|KDP23204.1|  hypothetical protein JCGZ_00320                         174   2e-41    
ref|XP_004251101.1|  PREDICTED: transcription factor LHW-like           174   2e-41    
ref|XP_006362846.1|  PREDICTED: transcription factor LHW-like           174   2e-41    
ref|XP_009373889.1|  PREDICTED: transcription factor LHW-like iso...    174   2e-41    
ref|XP_007132495.1|  hypothetical protein PHAVU_011G098900g             174   2e-41    
ref|XP_010031563.1|  PREDICTED: transcription factor LHW-like iso...    174   2e-41    
gb|KHG29075.1|  hypothetical protein F383_03858                         174   2e-41    
ref|XP_009373890.1|  PREDICTED: transcription factor LHW-like iso...    174   2e-41    
gb|KEH29770.1|  bHLH transcription factor-like protein                  174   2e-41    
ref|XP_010533555.1|  PREDICTED: transcription factor bHLH157-like...    171   3e-41    
ref|XP_006424092.1|  hypothetical protein CICLE_v10029797mg             174   3e-41    
gb|KDO46593.1|  hypothetical protein CISIN_1g036631mg                   174   3e-41    
ref|XP_004242114.1|  PREDICTED: transcription factor LHW-like iso...    173   4e-41    
ref|XP_004293110.1|  PREDICTED: transcription factor LHW-like           173   4e-41    
ref|XP_006494896.1|  PREDICTED: transcription factor LHW-like           173   4e-41    
ref|XP_009804416.1|  PREDICTED: transcription factor LHW-like iso...    173   5e-41    
ref|XP_008450293.1|  PREDICTED: transcription factor LHW isoform X2     173   5e-41    
ref|XP_006361093.1|  PREDICTED: transcription factor LHW-like           173   6e-41    
gb|KCW50923.1|  hypothetical protein EUGRSUZ_J00573                     172   6e-41    
ref|XP_006378984.1|  hypothetical protein POPTR_0009s02270g             172   7e-41    
gb|KHN21191.1|  Putative basic helix-loop-helix protein                 172   9e-41    
ref|XP_003540817.1|  PREDICTED: transcription factor LHW-like           172   9e-41    
ref|XP_006592778.1|  PREDICTED: transcription factor LHW-like iso...    172   9e-41    
ref|XP_008361584.1|  PREDICTED: transcription factor LHW-like iso...    172   9e-41    
ref|XP_004487450.1|  PREDICTED: transcription factor LHW-like iso...    171   1e-40    
ref|XP_010685440.1|  PREDICTED: transcription factor LHW-like           172   1e-40    
ref|XP_009804415.1|  PREDICTED: transcription factor LHW-like iso...    172   1e-40    
ref|XP_010247165.1|  PREDICTED: transcription factor LHW-like iso...    172   1e-40    
ref|XP_010931062.1|  PREDICTED: transcription factor LHW-like           172   1e-40    
emb|CAN76581.1|  hypothetical protein VITISV_034321                     172   1e-40    Vitis vinifera
ref|XP_004506222.1|  PREDICTED: transcription factor LHW-like           172   1e-40    
ref|XP_008799711.1|  PREDICTED: transcription factor LHW-like           172   1e-40    
ref|XP_008338609.1|  PREDICTED: transcription factor LHW-like           171   1e-40    
ref|XP_010263009.1|  PREDICTED: transcription factor LHW-like           172   1e-40    
ref|XP_011003843.1|  PREDICTED: transcription factor LHW-like           172   2e-40    
ref|XP_011010233.1|  PREDICTED: transcription factor LHW-like           171   2e-40    
ref|XP_011021433.1|  PREDICTED: transcription factor LHW-like iso...    171   2e-40    
ref|XP_010247149.1|  PREDICTED: transcription factor LHW-like iso...    171   2e-40    
ref|XP_006589236.1|  PREDICTED: transcription factor bHLH155-like...    171   2e-40    
gb|EYU36027.1|  hypothetical protein MIMGU_mgv1a020569mg                164   2e-40    
ref|XP_011021434.1|  PREDICTED: transcription factor LHW-like iso...    171   2e-40    
ref|XP_009625579.1|  PREDICTED: transcription factor LHW isoform X1     171   3e-40    
ref|XP_009625580.1|  PREDICTED: transcription factor LHW isoform X2     171   3e-40    
emb|CDP15550.1|  unnamed protein product                                170   5e-40    
ref|XP_008784115.1|  PREDICTED: transcription factor LHW-like           170   5e-40    
ref|XP_010322443.1|  PREDICTED: transcription factor LHW-like iso...    170   5e-40    
ref|XP_010247158.1|  PREDICTED: transcription factor LHW-like iso...    170   6e-40    
ref|XP_002441863.1|  hypothetical protein SORBIDRAFT_08g003770          169   6e-40    Sorghum bicolor [broomcorn]
ref|XP_004977333.1|  PREDICTED: transcription factor LHW-like           168   2e-39    
ref|XP_009401173.1|  PREDICTED: transcription factor LHW-like iso...    168   2e-39    
ref|XP_009401172.1|  PREDICTED: transcription factor LHW-like iso...    168   2e-39    
ref|XP_006594923.1|  PREDICTED: transcription factor LHW-like iso...    167   2e-39    
ref|XP_009368308.1|  PREDICTED: transcription factor LHW-like           168   3e-39    
ref|XP_009337709.1|  PREDICTED: transcription factor LHW-like           168   3e-39    
ref|XP_008662493.1|  PREDICTED: transcription factor LHW-like           167   4e-39    
gb|KHN36498.1|  Putative basic helix-loop-helix protein                 167   5e-39    
ref|XP_003541959.2|  PREDICTED: transcription factor LHW-like iso...    167   5e-39    
ref|XP_003578882.1|  PREDICTED: transcription factor LHW isoform X1     166   6e-39    
ref|XP_010912383.1|  PREDICTED: uncharacterized protein LOC105038...    167   7e-39    
ref|XP_009420898.1|  PREDICTED: transcription factor LHW-like           166   8e-39    
ref|XP_010912384.1|  PREDICTED: uncharacterized protein LOC105038...    166   1e-38    
ref|XP_006846364.1|  hypothetical protein AMTR_s00012p00261730          164   2e-38    
ref|XP_010544940.1|  PREDICTED: transcription factor bHLH157-like       162   2e-38    
gb|ABA96530.2|  expressed protein                                       165   2e-38    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066215.1|  Os12g0160400                                       164   2e-38    Oryza sativa Japonica Group [Japonica rice]
gb|EAY82345.1|  hypothetical protein OsI_37555                          164   2e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_009403680.1|  PREDICTED: transcription factor LHW-like           164   3e-38    
ref|XP_004978745.1|  PREDICTED: transcription factor LHW-like           164   3e-38    
ref|XP_008674450.1|  PREDICTED: transcription factor LHW-like iso...    163   6e-38    
ref|NP_001065807.1|  Os11g0158500                                       158   6e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664356.1|  PREDICTED: transcription factor LHW-like           163   7e-38    
ref|XP_010045177.1|  PREDICTED: transcription factor LHW-like iso...    162   1e-37    
ref|XP_010045178.1|  PREDICTED: uncharacterized protein LOC104433...    162   1e-37    
ref|XP_006854628.1|  hypothetical protein AMTR_s00030p00176130          162   1e-37    
ref|XP_006662753.1|  PREDICTED: transcription factor LHW-like           162   2e-37    
ref|XP_002449032.1|  hypothetical protein SORBIDRAFT_05g003740          162   2e-37    Sorghum bicolor [broomcorn]
ref|XP_008679687.1|  PREDICTED: transcription factor LHW                161   2e-37    
gb|EPS62249.1|  hypothetical protein M569_12542                         150   2e-37    
dbj|BAK06575.1|  predicted protein                                      161   2e-37    
gb|KHG17321.1|  hypothetical protein F383_21887                         161   2e-37    
ref|NP_001044899.2|  Os01g0865600                                       161   3e-37    Oryza sativa Japonica Group [Japonica rice]
gb|EAY76601.1|  hypothetical protein OsI_04550                          161   4e-37    Oryza sativa Indica Group [Indian rice]
gb|EEE55720.1|  hypothetical protein OsJ_04192                          160   4e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523120.1|  PREDICTED: transcription factor LHW                159   5e-37    
gb|ABA91568.2|  expressed protein                                       159   9e-37    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002271475.2|  PREDICTED: transcription factor LHW                158   1e-36    Vitis vinifera
gb|EMT30779.1|  Putative basic helix-loop-helix protein                 159   1e-36    
gb|KFK32958.1|  hypothetical protein AALP_AA6G311800                    156   1e-36    
ref|XP_006646502.1|  PREDICTED: transcription factor LHW-like           159   1e-36    
gb|AFW65580.1|  putative HLH DNA-binding domain superfamily protein     158   2e-36    
dbj|BAF01612.1|  hypothetical protein                                   151   2e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010557442.1|  PREDICTED: transcription factor LHW-like iso...    156   3e-36    
tpg|DAA39099.1|  TPA: putative HLH DNA-binding domain superfamily...    157   4e-36    
gb|KFK33154.1|  hypothetical protein AALP_AA6G337700                    155   4e-36    
dbj|BAK00701.1|  predicted protein                                      157   5e-36    
ref|XP_011006385.1|  PREDICTED: transcription factor EMB1444-like...    155   7e-36    
ref|XP_011006384.1|  PREDICTED: transcription factor EMB1444-like...    155   8e-36    
ref|XP_010544333.1|  PREDICTED: transcription factor LHW-like           154   9e-36    
ref|XP_006293814.1|  hypothetical protein CARUB_v10022796mg             154   9e-36    
ref|XP_006408683.1|  hypothetical protein EUTSA_v10001928mg             154   2e-35    
ref|XP_002309084.1|  hypothetical protein POPTR_0006s09100g             154   2e-35    Populus trichocarpa [western balsam poplar]
gb|KDO48150.1|  hypothetical protein CISIN_1g005301mg                   152   5e-35    
ref|XP_010510794.1|  PREDICTED: transcription factor LHW-like iso...    151   5e-35    
ref|XP_006493563.1|  PREDICTED: transcription factor EMB1444-like       152   6e-35    
gb|KDO48148.1|  hypothetical protein CISIN_1g005301mg                   152   6e-35    
gb|KDO48153.1|  hypothetical protein CISIN_1g005301mg                   151   7e-35    
ref|NP_565640.1|  transcription factor LHW                              152   7e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002533696.1|  basic helix-loop-helix-containing protein, p...    152   7e-35    Ricinus communis
gb|EMT30797.1|  Putative basic helix-loop-helix protein                 153   8e-35    
ref|XP_002986361.1|  hypothetical protein SELMODRAFT_157919             144   9e-35    
dbj|BAH19848.1|  AT2G27230                                              151   9e-35    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417875.1|  PREDICTED: transcription factor LHW-like           151   1e-34    
ref|XP_010510793.1|  PREDICTED: transcription factor LHW-like iso...    151   1e-34    
ref|XP_002879076.1|  hypothetical protein ARALYDRAFT_481620             151   1e-34    
ref|XP_006429166.1|  hypothetical protein CICLE_v10011164mg             151   2e-34    
emb|CDX71466.1|  BnaC04g17010D                                          150   2e-34    
ref|XP_010473116.1|  PREDICTED: transcription factor LHW                150   2e-34    
ref|XP_006391596.1|  hypothetical protein EUTSA_v10023398mg             149   2e-34    
ref|XP_007026935.1|  Basic helix-loop-helix DNA-binding superfami...    150   5e-34    
gb|KDP24564.1|  hypothetical protein JCGZ_25128                         150   5e-34    
ref|XP_009785130.1|  PREDICTED: transcription factor bHLH157-like       149   8e-34    
ref|XP_010256798.1|  PREDICTED: transcription factor bHLH155-like...    148   2e-33    
ref|XP_010256799.1|  PREDICTED: transcription factor LHW-like iso...    148   2e-33    
ref|XP_010325716.1|  PREDICTED: prf interactor 30137 isoform X2         148   2e-33    
ref|XP_010325715.1|  PREDICTED: prf interactor 30137 isoform X1         148   2e-33    
ref|XP_009112852.1|  PREDICTED: transcription factor bHLH157-like       145   2e-33    
ref|XP_009103583.1|  PREDICTED: transcription factor LHW-like           146   3e-33    
ref|XP_010256801.1|  PREDICTED: transcription factor bHLH155-like...    147   3e-33    
emb|CDY04483.1|  BnaA07g13090D                                          146   3e-33    
ref|XP_002988707.1|  hypothetical protein SELMODRAFT_46989              136   4e-33    
ref|XP_009112862.1|  PREDICTED: transcription factor bHLH157-like       145   4e-33    
ref|XP_007026936.1|  Basic helix-loop-helix DNA-binding superfami...    145   5e-33    
emb|CDY53900.1|  BnaA09g53070D                                          145   5e-33    
ref|XP_007026930.1|  Basic helix-loop-helix DNA-binding superfami...    145   6e-33    
ref|XP_006341000.1|  PREDICTED: transcription factor EMB1444-like       146   7e-33    
ref|XP_010262623.1|  PREDICTED: transcription factor bHLH155-like...    146   7e-33    
ref|XP_007026929.1|  Basic helix-loop-helix DNA-binding superfami...    146   7e-33    
ref|XP_009140783.1|  PREDICTED: transcription factor LHW                145   9e-33    
ref|XP_010430608.1|  PREDICTED: transcription factor bHLH157            144   1e-32    
emb|CDX77102.1|  BnaC04g38970D                                          145   1e-32    
emb|CDY30564.1|  BnaA04g15690D                                          145   1e-32    
ref|XP_010262621.1|  PREDICTED: transcription factor bHLH155-like...    145   1e-32    
ref|XP_010262624.1|  PREDICTED: transcription factor EMB1444-like...    144   1e-32    
ref|NP_001234845.1|  Prf interactor 30137                               145   2e-32    
ref|XP_010920506.1|  PREDICTED: transcription factor bHLH155 isof...    144   2e-32    
ref|XP_008801631.1|  PREDICTED: transcription factor bHLH155-like...    144   2e-32    
ref|XP_010920505.1|  PREDICTED: transcription factor bHLH155 isof...    145   2e-32    
ref|XP_009597648.1|  PREDICTED: transcription factor EMB1444-like       144   3e-32    
ref|XP_008801630.1|  PREDICTED: transcription factor EMB1444-like...    144   3e-32    
ref|NP_001185310.1|  transcription factor bHLH157                       142   4e-32    
ref|XP_008801632.1|  PREDICTED: transcription factor EMB1444-like...    143   5e-32    
ref|NP_001117547.1|  transcription factor bHLH157                       141   5e-32    Arabidopsis thaliana [mouse-ear cress]
ref|NP_849917.2|  transcription factor bHLH157                          141   6e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274807.1|  PREDICTED: transcription factor EMB1444-like...    143   6e-32    
ref|XP_006302121.1|  hypothetical protein CARUB_v10020122mg             141   7e-32    
ref|XP_010274805.1|  PREDICTED: transcription factor EMB1444-like...    143   7e-32    
dbj|BAE98793.1|  putative protein kinase                                140   8e-32    Arabidopsis thaliana [mouse-ear cress]
gb|EPS58800.1|  hypothetical protein M569_16012                         132   1e-31    
ref|XP_009388603.1|  PREDICTED: transcription factor bHLH155-like...    142   1e-31    
ref|XP_006443867.1|  hypothetical protein CICLE_v10018993mg             142   1e-31    
ref|XP_004161538.1|  PREDICTED: transcription factor EMB1444-like       142   1e-31    
ref|XP_006443866.1|  hypothetical protein CICLE_v10018993mg             142   1e-31    
gb|KDO68474.1|  hypothetical protein CISIN_1g004499mg                   142   1e-31    
gb|KDO68473.1|  hypothetical protein CISIN_1g004499mg                   142   1e-31    
ref|XP_004146986.1|  PREDICTED: transcription factor EMB1444-like       142   1e-31    
ref|XP_008451262.1|  PREDICTED: transcription factor EMB1444            142   2e-31    
gb|KDO68475.1|  hypothetical protein CISIN_1g004499mg                   142   2e-31    
gb|KDO68478.1|  hypothetical protein CISIN_1g004499mg                   140   2e-31    
ref|XP_007200308.1|  hypothetical protein PRUPE_ppa001930mg             142   2e-31    
ref|XP_010652360.1|  PREDICTED: transcription factor EMB1444 isof...    141   2e-31    
ref|XP_003632423.1|  PREDICTED: transcription factor EMB1444 isof...    141   3e-31    
gb|KCW49779.1|  hypothetical protein EUGRSUZ_K03270                     140   4e-31    
ref|XP_010274806.1|  PREDICTED: transcription factor EMB1444-like...    140   4e-31    
emb|CBI37092.3|  unnamed protein product                                141   4e-31    
ref|XP_009402943.1|  PREDICTED: transcription factor bHLH157-like...    140   5e-31    
ref|XP_010037987.1|  PREDICTED: transcription factor EMB1444            140   7e-31    
emb|CDY61366.1|  BnaA09g53110D                                          138   8e-31    
gb|AAF19679.1|AC009519_13  F1N19.20                                     141   9e-31    
ref|XP_008235702.1|  PREDICTED: transcription factor bHLH155-like...    139   1e-30    
ref|XP_008235701.1|  PREDICTED: transcription factor bHLH155-like...    139   1e-30    
gb|EEC73767.1|  hypothetical protein OsI_08440                          140   1e-30    
ref|XP_010088594.1|  hypothetical protein L484_016987                   139   1e-30    
ref|XP_009402942.1|  PREDICTED: transcription factor LHW-like iso...    139   1e-30    
ref|XP_011080299.1|  PREDICTED: transcription factor EMB1444            139   1e-30    
ref|XP_009402945.1|  PREDICTED: transcription factor EMB1444-like...    138   2e-30    
gb|KDP26554.1|  hypothetical protein JCGZ_17712                         139   2e-30    
ref|XP_011026006.1|  PREDICTED: transcription factor bHLH155-like       138   3e-30    
gb|KHN10729.1|  Putative basic helix-loop-helix protein                 138   3e-30    
ref|XP_003520595.1|  PREDICTED: transcription factor EMB1444-like...    138   3e-30    
ref|XP_006383698.1|  basic helix-loop-helix family protein              137   5e-30    
ref|XP_007050338.1|  Basic helix-loop-helix DNA-binding superfami...    137   5e-30    
gb|KHG15432.1|  hypothetical protein F383_17833                         137   6e-30    
ref|XP_007050336.1|  Basic helix-loop-helix-containing protein, p...    137   6e-30    
ref|XP_007050337.1|  Basic helix-loop-helix DNA-binding superfami...    137   6e-30    
ref|XP_002532375.1|  basic helix-loop-helix-containing protein, p...    137   6e-30    
ref|XP_010475341.1|  PREDICTED: transcription factor EMB1444-like...    137   9e-30    
ref|XP_007205276.1|  hypothetical protein PRUPE_ppa006504mg             133   9e-30    
emb|CDP06574.1|  unnamed protein product                                136   1e-29    
ref|XP_008382880.1|  PREDICTED: transcription factor bHLH155-like       136   1e-29    
ref|XP_004137928.1|  PREDICTED: uncharacterized protein LOC101203710    134   1e-29    
ref|XP_003553489.1|  PREDICTED: transcription factor EMB1444-like       136   1e-29    
ref|XP_009354929.1|  PREDICTED: transcription factor bHLH155-like       136   1e-29    
ref|XP_004302716.1|  PREDICTED: transcription factor EMB1444-like       135   2e-29    
ref|XP_008442512.1|  PREDICTED: transcription factor bHLH155-like       135   2e-29    
ref|XP_004496010.1|  PREDICTED: uncharacterized protein LOC101509177    132   2e-29    
ref|XP_009369499.1|  PREDICTED: transcription factor bHLH155-like       135   2e-29    
gb|KGN58841.1|  hypothetical protein Csa_3G733950                       135   2e-29    
ref|XP_002887869.1|  predicted protein                                  136   3e-29    
ref|XP_010522161.1|  PREDICTED: transcription factor bHLH155-like       135   3e-29    
gb|KHN02518.1|  Putative basic helix-loop-helix protein                 135   3e-29    
emb|CDP03728.1|  unnamed protein product                                135   3e-29    
ref|XP_004292200.1|  PREDICTED: transcription factor bHLH155-like       135   4e-29    
ref|XP_007162529.1|  hypothetical protein PHAVU_001G159600g             134   4e-29    
ref|XP_007162528.1|  hypothetical protein PHAVU_001G159600g             134   4e-29    
ref|XP_011028788.1|  PREDICTED: transcription factor bHLH155-like...    134   5e-29    
ref|XP_008363882.1|  PREDICTED: transcription factor EMB1444-like...    134   5e-29    
ref|XP_008363881.1|  PREDICTED: transcription factor EMB1444-like...    134   6e-29    
ref|XP_011028787.1|  PREDICTED: transcription factor bHLH155-like...    134   7e-29    
emb|CDY19071.1|  BnaA04g18110D                                          134   7e-29    
ref|XP_010111900.1|  hypothetical protein L484_009784                   134   7e-29    
ref|XP_008240519.1|  PREDICTED: transcription factor EMB1444-like       134   8e-29    
ref|XP_010679225.1|  PREDICTED: transcription factor EMB1444            134   8e-29    
ref|NP_001184921.1|  conserved peptide upstream open reading frame 8    134   9e-29    
ref|XP_004493767.1|  PREDICTED: transcription factor EMB1444-like       134   9e-29    
gb|EYU18994.1|  hypothetical protein MIMGU_mgv1a007015mg                130   1e-28    
gb|KCW85999.1|  hypothetical protein EUGRSUZ_B02705                     132   1e-28    
ref|XP_009141146.1|  PREDICTED: transcription factor bHLH155-like       132   2e-28    
ref|XP_006386235.1|  hypothetical protein POPTR_0002s04160g             130   2e-28    
ref|XP_010473730.1|  PREDICTED: transcription factor bHLH157-like       129   2e-28    
gb|KEH23901.1|  bHLH transcription factor-like protein                  131   3e-28    
gb|KEH23902.1|  bHLH transcription factor-like protein                  131   3e-28    
gb|KEH23903.1|  bHLH transcription factor-like protein                  129   3e-28    
ref|XP_010043993.1|  PREDICTED: transcription factor bHLH155-like...    131   4e-28    
ref|NP_172105.4|  transcription factor EMB1444                          132   4e-28    
emb|CDY24733.1|  BnaC04g13380D                                          130   4e-28    
emb|CDY10779.1|  BnaA05g11570D                                          130   4e-28    
ref|XP_010262289.1|  PREDICTED: transcription factor EMB1444-like...    131   5e-28    
ref|XP_009144244.1|  PREDICTED: transcription factor bHLH155-like...    130   7e-28    
ref|XP_009144245.1|  PREDICTED: transcription factor bHLH155-like...    129   8e-28    
emb|CDY15406.1|  BnaC04g42170D                                          129   1e-27    
ref|XP_006410260.1|  hypothetical protein EUTSA_v10016331mg             129   2e-27    
ref|XP_010542740.1|  PREDICTED: transcription factor bHLH155            130   2e-27    
ref|XP_009346410.1|  PREDICTED: transcription factor EMB1444-like       128   3e-27    
ref|XP_006306144.1|  hypothetical protein CARUB_v10011638mg             129   4e-27    
gb|KEH42563.1|  bHLH transcription factor-like protein                  127   7e-27    
gb|KHG17187.1|  hypothetical protein F383_21231                         126   1e-26    
ref|XP_004495112.1|  PREDICTED: transcription factor bHLH155-like...    126   1e-26    
ref|XP_004495111.1|  PREDICTED: transcription factor bHLH155-like...    126   1e-26    
ref|XP_011090482.1|  PREDICTED: transcription factor LHW-like           127   2e-26    
ref|XP_008350445.1|  PREDICTED: transcription factor EMB1444-like...    126   2e-26    
ref|XP_008387809.1|  PREDICTED: transcription factor EMB1444-like...    126   2e-26    
ref|XP_008350444.1|  PREDICTED: transcription factor EMB1444-like...    126   2e-26    
ref|XP_008387807.1|  PREDICTED: transcription factor EMB1444-like...    125   2e-26    
ref|XP_009358761.1|  PREDICTED: uncharacterized protein LOC103949378    125   3e-26    
ref|XP_011094905.1|  PREDICTED: transcription factor LHW-like           125   4e-26    
gb|KEH22991.1|  bHLH transcription factor-like protein                  124   5e-26    
dbj|BAD94375.1|  hypothetical protein                                   119   6e-26    
gb|KEH22990.1|  bHLH transcription factor-like protein                  124   6e-26    
ref|XP_010475342.1|  PREDICTED: transcription factor EMB1444-like...    124   6e-26    
gb|KFK31230.1|  hypothetical protein AALP_AA6G085400                    124   6e-26    
ref|XP_010469739.1|  PREDICTED: transcription factor bHLH155-like       124   8e-26    
ref|XP_010414147.1|  PREDICTED: transcription factor bHLH155-like...    124   8e-26    
ref|XP_010510215.1|  PREDICTED: transcription factor bHLH155 isof...    124   9e-26    
ref|XP_010414148.1|  PREDICTED: transcription factor bHLH155-like...    124   9e-26    
ref|XP_006293452.1|  hypothetical protein CARUB_v10022732mg             124   9e-26    
emb|CAN69972.1|  hypothetical protein VITISV_001452                     124   1e-25    
ref|XP_010485665.1|  PREDICTED: transcription factor EMB1444-like       124   2e-25    
ref|NP_180686.2|  uncharacterized protein                               122   2e-25    
gb|AAO86853.1|  hypothetical protein                                    122   2e-25    
ref|XP_006351645.1|  PREDICTED: transcription factor bHLH155-like...    122   3e-25    
ref|XP_002892322.1|  hypothetical protein ARALYDRAFT_311694             123   3e-25    
ref|XP_006351643.1|  PREDICTED: transcription factor bHLH155-like...    122   3e-25    
ref|XP_010510216.1|  PREDICTED: transcription factor bHLH155 isof...    122   4e-25    
gb|KHN03867.1|  Putative basic helix-loop-helix protein                 122   4e-25    
ref|XP_004516433.1|  PREDICTED: transcription factor bHLH155-like       122   5e-25    
ref|XP_010326443.1|  PREDICTED: transcription factor EMB1444-like...    122   5e-25    
ref|XP_006588678.1|  PREDICTED: transcription factor EMB1444-like       122   5e-25    
gb|AAM97767.1|  hypothetical protein                                    121   6e-25    
ref|XP_007144920.1|  hypothetical protein PHAVU_007G194600g             121   8e-25    
ref|XP_007144919.1|  hypothetical protein PHAVU_007G194600g             121   9e-25    
gb|KHN40269.1|  Putative basic helix-loop-helix protein                 120   1e-24    
ref|NP_001031454.1|  uncharacterized protein                            120   1e-24    
ref|XP_002879316.1|  predicted protein                                  120   2e-24    
gb|EPS66447.1|  prf interactor 30137                                    112   2e-24    
ref|XP_007140475.1|  hypothetical protein PHAVU_008G115700g             119   2e-24    
gb|EMS67677.1|  hypothetical protein TRIUR3_13313                       118   7e-24    
ref|XP_010037793.1|  PREDICTED: transcription factor LHW-like           117   2e-23    
ref|XP_004987278.1|  PREDICTED: transcription factor EMB1444-like       115   3e-23    
ref|NP_001136463.1|  uncharacterized protein LOC100216574               107   3e-23    
ref|XP_010228485.1|  PREDICTED: transcription factor EMB1444-like...    115   4e-23    
ref|XP_010228486.1|  PREDICTED: transcription factor EMB1444-like...    115   4e-23    
ref|XP_010535518.1|  PREDICTED: transcription factor bHLH157-like       107   4e-23    
ref|XP_003551499.1|  PREDICTED: transcription factor LHW-like           115   4e-23    
ref|XP_008674454.1|  PREDICTED: transcription factor LHW-like iso...    115   4e-23    
ref|XP_009589476.1|  PREDICTED: transcription factor EMB1444-like...    115   5e-23    
ref|XP_009589477.1|  PREDICTED: transcription factor EMB1444-like...    115   6e-23    
gb|KHN04065.1|  Putative basic helix-loop-helix protein                 114   1e-22    
ref|XP_008651889.1|  PREDICTED: transcription factor EMB1444-like       111   6e-22    
ref|XP_009803238.1|  PREDICTED: transcription factor EMB1444-like       111   8e-22    
ref|XP_006657383.1|  PREDICTED: transcription factor EMB1444-like...    108   5e-21    
ref|XP_006657380.1|  PREDICTED: transcription factor EMB1444-like...    108   7e-21    
ref|XP_010510217.1|  PREDICTED: transcription factor bHLH155 isof...    108   7e-21    
ref|XP_010689422.1|  PREDICTED: transcription factor LHW-like iso...    107   2e-20    
ref|XP_010689424.1|  PREDICTED: transcription factor LHW-like iso...    106   2e-20    
ref|NP_001031453.1|  uncharacterized protein                            107   3e-20    
ref|XP_008361589.1|  PREDICTED: transcription factor LHW-like iso...    106   6e-20    
ref|XP_010689430.1|  PREDICTED: uncharacterized protein LOC104903...    104   8e-20    
ref|XP_010689428.1|  PREDICTED: uncharacterized protein LOC104903...    104   1e-19    
tpg|DAA59302.1|  TPA: putative HLH DNA-binding domain superfamily...    103   2e-19    
ref|NP_001058676.1|  Os07g0101300                                       103   2e-19    
ref|XP_010043994.1|  PREDICTED: transcription factor bHLH155-like...    100   3e-18    
gb|KDO68476.1|  hypothetical protein CISIN_1g004499mg                 98.6    8e-18    
gb|KCW49539.1|  hypothetical protein EUGRSUZ_K03061                   97.4    2e-17    
ref|XP_006351644.1|  PREDICTED: transcription factor bHLH155-like...  95.1    1e-16    
ref|XP_010326445.1|  PREDICTED: transcription factor bHLH155-like...  94.7    1e-16    
gb|EPS63700.1|  hypothetical protein M569_11086                       89.0    1e-16    
ref|XP_010274809.1|  PREDICTED: transcription factor EMB1444-like...  94.0    3e-16    
ref|XP_010912385.1|  PREDICTED: uncharacterized protein LOC105038...  93.2    6e-16    
ref|XP_009388604.1|  PREDICTED: transcription factor bHLH155-like...  90.9    2e-15    
ref|XP_007015676.1|  Transcription factor-related, putative isofo...  89.4    7e-15    
ref|XP_002967052.1|  hypothetical protein SELMODRAFT_439913           87.0    6e-14    
ref|XP_006576937.1|  PREDICTED: transcription factor EMB1444-like...  83.2    6e-13    
ref|XP_006424094.1|  hypothetical protein CICLE_v10029996mg           79.3    9e-13    
ref|XP_010238692.1|  PREDICTED: transcription factor LHW isoform X2   81.3    3e-12    
gb|KCW50920.1|  hypothetical protein EUGRSUZ_J00569                   80.5    4e-12    
ref|XP_003596884.1|  Transcription factor ABA-INDUCIBLE bHLH-TYPE     77.4    5e-12    
gb|KDO68477.1|  hypothetical protein CISIN_1g004499mg                 76.6    5e-11    
ref|XP_007206554.1|  hypothetical protein PRUPE_ppa019994mg           72.8    6e-11    
ref|XP_010274810.1|  PREDICTED: transcription factor EMB1444-like...  74.3    3e-10    
ref|XP_009601282.1|  PREDICTED: transcription factor LHW-like         69.7    5e-10    
ref|XP_010262290.1|  PREDICTED: transcription factor EMB1444-like...  73.6    5e-10    
ref|XP_010274811.1|  PREDICTED: transcription factor EMB1444-like...  73.2    6e-10    
ref|XP_008674451.1|  PREDICTED: transcription factor LHW-like iso...  73.2    8e-10    
gb|AFW56113.1|  putative HLH DNA-binding domain superfamily protein   72.8    1e-09    
gb|KFK27005.1|  hypothetical protein AALP_AA8G322100                  70.5    3e-09    
ref|NP_200201.3|  Serine/threonine-protein kinase-like protein        67.8    2e-08    
gb|KDO48151.1|  hypothetical protein CISIN_1g005301mg                 68.6    2e-08    
ref|NP_001078618.1|  serine/threonine-protein kinase WNK-like pro...  63.2    3e-08    
gb|AFK43019.1|  unknown                                               63.2    4e-08    
ref|XP_002866002.1|  hypothetical protein ARALYDRAFT_495469           66.2    5e-08    
gb|KDO48152.1|  hypothetical protein CISIN_1g005301mg                 67.0    6e-08    
emb|CDM84575.1|  unnamed protein product                              66.2    8e-08    
gb|ABA93307.2|  expressed protein                                     63.9    1e-07    
dbj|BAJ95510.1|  predicted protein                                    65.9    1e-07    
ref|XP_003564398.2|  PREDICTED: uncharacterized protein LOC100834889  65.1    1e-07    
ref|XP_010446180.1|  PREDICTED: uncharacterized protein LOC104728...  64.7    2e-07    
dbj|BAM62866.1|  rice salt sensitive 3                                64.7    2e-07    
ref|XP_010442961.1|  PREDICTED: uncharacterized protein LOC104725...  64.3    2e-07    
ref|XP_006663418.1|  PREDICTED: uncharacterized protein LOC102700475  64.3    3e-07    
ref|XP_004970253.1|  PREDICTED: uncharacterized protein LOC101786...  64.3    3e-07    
ref|XP_010465473.1|  PREDICTED: transcription factor LHW-like         63.9    3e-07    
ref|NP_001146020.1|  hypothetical protein                             64.3    3e-07    
gb|KHG24777.1|  hypothetical protein F383_09868                       63.9    3e-07    
gb|EPS62250.1|  hypothetical protein M569_12543                       60.1    4e-07    
ref|XP_011043828.1|  PREDICTED: transcription factor LHW-like         63.9    4e-07    
ref|XP_009596195.1|  PREDICTED: uncharacterized protein LOC104092325  63.5    4e-07    
ref|XP_008806377.1|  PREDICTED: uncharacterized protein LOC103719083  63.9    4e-07    
ref|XP_002316886.2|  hypothetical protein POPTR_0011s11720g           63.5    4e-07    
ref|XP_002458633.1|  hypothetical protein SORBIDRAFT_03g037090        63.9    4e-07    
ref|XP_006370229.1|  hypothetical protein POPTR_0001s40830g           63.5    5e-07    
ref|XP_009792262.1|  PREDICTED: uncharacterized protein LOC104239344  63.5    5e-07    
ref|XP_008789736.1|  PREDICTED: uncharacterized protein LOC103707137  63.2    6e-07    
ref|XP_009127132.1|  PREDICTED: uncharacterized protein LOC103852...  62.8    6e-07    
ref|XP_010928834.1|  PREDICTED: uncharacterized protein LOC105050483  63.2    6e-07    
ref|XP_002882922.1|  hypothetical protein ARALYDRAFT_478955           62.8    7e-07    
ref|XP_011082699.1|  PREDICTED: uncharacterized protein LOC105165...  62.8    7e-07    
emb|CDP05942.1|  unnamed protein product                              62.8    7e-07    
gb|EYU26369.1|  hypothetical protein MIMGU_mgv1a018756mg              62.4    7e-07    
ref|XP_009397203.1|  PREDICTED: transcription factor EMB1444-like     62.4    8e-07    
dbj|BAK01793.1|  predicted protein                                    62.8    8e-07    
emb|CDY28811.1|  BnaA02g10030D                                        62.4    1e-06    
ref|XP_006401648.1|  hypothetical protein EUTSA_v10013822mg           62.0    1e-06    
ref|NP_001078158.1|  serine/threonine-protein kinase WNK (With No...  62.0    1e-06    
ref|XP_010675494.1|  PREDICTED: uncharacterized protein LOC104891...  62.0    1e-06    
ref|XP_011029506.1|  PREDICTED: uncharacterized protein LOC105129...  62.0    1e-06    
ref|XP_006451800.1|  hypothetical protein CICLE_v10008806mg           61.6    1e-06    
emb|CBI20269.3|  unnamed protein product                              61.6    1e-06    
ref|XP_010537031.1|  PREDICTED: uncharacterized protein LOC104811873  62.0    1e-06    
ref|XP_002285119.1|  PREDICTED: uncharacterized protein LOC100264152  62.0    1e-06    
emb|CDX97642.1|  BnaA05g24370D                                        61.6    1e-06    
ref|XP_009417203.1|  PREDICTED: transcription factor LHW              62.0    1e-06    
emb|CDX98537.1|  BnaC05g38380D                                        61.6    1e-06    
ref|XP_010260282.1|  PREDICTED: uncharacterized protein LOC104599441  62.0    1e-06    
gb|KCW69989.1|  hypothetical protein EUGRSUZ_F03300                   61.6    2e-06    
ref|XP_009146275.1|  PREDICTED: transcription factor LHW              61.6    2e-06    
gb|KDO62554.1|  hypothetical protein CISIN_1g015459mg                 61.6    2e-06    
ref|XP_006464788.1|  PREDICTED: uncharacterized protein LOC102611022  61.6    2e-06    
ref|XP_010487343.1|  PREDICTED: transcription factor LHW-like         61.6    2e-06    
gb|KDP45873.1|  hypothetical protein JCGZ_15317                       61.6    2e-06    
ref|XP_010062854.1|  PREDICTED: uncharacterized protein LOC104450118  61.6    2e-06    



>ref|XP_007210891.1| hypothetical protein PRUPE_ppa001838mg [Prunus persica]
 gb|EMJ12090.1| hypothetical protein PRUPE_ppa001838mg [Prunus persica]
Length=758

 Score =   362 bits (928),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 284/778 (37%), Positives = 396/778 (51%), Gaps = 140/778 (18%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M +    +V +  L+SLC  NGWSY VFW F+++NS+ LT+ DAYYEE MG ++D ML Q
Sbjct  1     MGEAGKSSVIRETLESLCVSNGWSYGVFWRFDKRNSMLLTMGDAYYEEHMGAVMDSMLPQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNS-VWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             V++LG G++GQ AFT  H+WM SD  S  W S + L     ++ QDD SE   QFS GIK
Sbjct  61    VHMLGEGIIGQTAFTGKHRWMHSDAPSGEWSSCNSL--ESQDMFQDD-SELRCQFSSGIK  117

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF--------------------QGT-D  1898
             TIA ISVEP GV+QFGS +K+ ER E +DETK+LF                     GT D
Sbjct  118   TIATISVEPRGVIQFGSTKKIMERSEVLDETKRLFWEMESLDGLIPLENVPSCLNNGTND  177

Query  1897  IETIFAQ--SSSSSANGDV-FGLSGSLASSICNSSYFMSPEALPSPDF------------  1763
             +  +FA   SS +S NGDV + L         N +  M+  +  S D             
Sbjct  178   LNELFASLISSGNSYNGDVTWTLGDKFKELRGNDTSAMNLHSTSSDDIGSADKTPWFSTW  237

Query  1762  ---------VDPIM---------NMVQSFPVE-----------AFSLFDD--QFQNGGVE  1676
                       DP +         + +  FPVE            F   DD  Q+     E
Sbjct  238   STESSYLTSFDPQLTSEIRMDNQHSLHGFPVEFNPTDFTTNISKFCQVDDLSQWFAASPE  297

Query  1675  TQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCTNTVQ  1496
                N  +       S V  +E +S +S       G +  D    F   P   E+  N++ 
Sbjct  298   QNINGMATTLNDDLSQV--MESTSGSS-------GLVKGD---RFIDAP--IEHPDNSMH  343

Query  1495  NVLERPVMTSTHE---LGQSAFDEVLDG----FGC-KMPEKSDNIRKPAATSGQQWDFGT  1340
             + +  P     HE     Q+A + + DG    FGC ++ E  ++I  PA  SG   + GT
Sbjct  344   SSITNPFNAGGHENSVFIQNAENGLFDGLGPDFGCGQVGECWEDIMVPAV-SGGYLNTGT  402

Query  1339  SISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIE-  1163
             +++ C SE  +GS   P   LFS+LGL+ LL+   +++ S   SS  D  S+T+KR+ E 
Sbjct  403   ALTKCFSEPEVGSMTAPRKGLFSELGLEELLNGISTTTSSVFKSSLEDLSSTTRKRKSEC  462

Query  1162  --------------------HPLASEREVTKLETIV-------------------SLIGE  1100
                                 H       + K  ++V                   S+   
Sbjct  463   SSVNSNQVQFARLAGSSGSMHSTEPLYNLDKTNSLVPKKDFFPKSQVGLWIDDSYSVNAR  522

Query  1099  NCSTNVMNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLL  920
             + + +     +    +   + +    TRP PKDR +  +R+ ELR +IP+GGK SID LL
Sbjct  523   SAAQDKQQQAEEHTKTTRKRARPGESTRPRPKDRQQIQDRMKELRGIIPSGGKCSIDSLL  582

Query  919   HQTIKQLLFLQSVTRLAEGLKKTEELK---DKKGRKDSNSNSNTNGVTWACEIENQTMIC  749
              +TIK +LFLQSVT+ A+ LK+  E K    + G    ++N+ + G TWA  +E QT++C
Sbjct  583   DRTIKYMLFLQSVTKYADKLKQAHEPKLIGKENGVVLKDNNNRSAGNTWALAVEGQTVVC  642

Query  748   PLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPE  569
             P++VEDL  PGQMLIE+LC+EQGFFLEI DIIRGFGLNILKG ME RE KIWA FIV  E
Sbjct  643   PIIVEDLSPPGQMLIEMLCEEQGFFLEIADIIRGFGLNILKGEMESREDKIWARFIV--E  700

Query  568   ANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISL  395
             AN  V+R ++F SLL+LLQ +  + +   +   N+ D+G P   S C + ++P PISL
Sbjct  701   ANRHVTRIDVFWSLLRLLQQTTNNVVDPTNLPTNIVDSGVPILDS-CQQQSLPPPISL  757



>ref|XP_008390304.1| PREDICTED: transcription factor bHLH157-like [Malus domestica]
Length=792

 Score =   335 bits (859),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 276/802 (34%), Positives = 398/802 (50%), Gaps = 154/802 (19%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M++    +V +  L+SLC  NGWSY VFW F+ +NS+ LT+ DAYYE+ +G +I++ML Q
Sbjct  1     MAQMGESSVVRERLRSLCVSNGWSYGVFWCFDHRNSMLLTMGDAYYEDHVGAVIENMLPQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDEL----LQDDDSEFYGQFSC  2024
             V++LG G++GQ AFT  H+WM SD      +H G  + C  L    +  D SEF  QFS 
Sbjct  61    VHVLGEGIIGQTAFTGKHRWMHSD------AHGGGWNPCSSLENQDMFQDYSEFSCQFSS  114

Query  2023  GIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF---------------------Q  1907
             GIKTIA+ISVEP G++Q GS +K+ E +E +DETK+LF                     +
Sbjct  115   GIKTIAIISVEPRGLIQLGSTKKIMETLEVLDETKRLFRELENLDGLIPLENAPSSMNNE  174

Query  1906  GTDIETIFAQ--SSSSSANGDVF--------GLSGSLASSICNSSY----FMSPEALPSP  1769
              +D+  +FA   SS +S NGDV            G++ S++   S       S +  P  
Sbjct  175   TSDLNELFASLISSGNSYNGDVNLNPGDKCDEHRGNIISAVGFQSTSFDDIGSADKTPWS  234

Query  1768  DFVDPIMNMVQSFPVEAFS--LFDDQFQN-----GGVETQTNFSSYG-FQPSCSSVWGLE  1613
                    +++ SF     S  +  D F++     G ++  + F+S   F+       G +
Sbjct  235   STWSTESSLLTSFEPHLASEIILHDSFESCRDTAGNIQLDSAFTSLADFEKPIQGSCGYQ  294

Query  1612  GSSLTSLQGNIL---PGAIS---------QDCDNAFCALPDQ-FEYCTNTVQ--------  1496
               +  SL G  +   P  +S          D    F A P+Q F   T T+         
Sbjct  295   MDNQQSLHGFPVECNPADLSIDLSRLYQLDDLSQWFTASPEQKFNAMTTTLNNDFSQVIE  354

Query  1495  ------------NVLERPVMTS--------THELGQSAFD-----EVLDG----FGCKMP  1403
                         N++  P+ T         T+  G    D     + +DG    F C   
Sbjct  355   STSVSSSLVKGDNLIHVPIQTPANSIQSSVTNPFGAEGHDKSVIIQSVDGLGPDFACGQV  414

Query  1402  EKSDNIRKPAATSGQQWDFGTSISGCTSEHSI-GSKDWPSNRLFSKLGLDHLLSDNPsss  1226
              K        ATSG     GT+++ C SE  I GS   P   LFS+LGL+ LL+     S
Sbjct  415   GKCWEDAIMPATSGGYLAAGTALTKCFSESEITGSMPGPRKGLFSELGLEELLNGK---S  471

Query  1225  csfvgsSCN--DQLSSTKKRR----------IEHPLASEREVTK--------LETIVSL-  1109
              +     CN  DQ S+T+KR+          ++ P  +  + +K        L+   SL 
Sbjct  472   NTSSSVKCNLEDQSSTTRKRKSECLSVNSNQVQLPWLTGLDTSKHSAKSFYNLDRANSLG  531

Query  1108  --------------IGENCSTNVMN-TKDHEkpskavkkkakPGTR------PIPKDRVR  992
                           I ++ S N  +  +D ++ S+   K  K   R      P PKDR +
Sbjct  532   PKKDFFPKSQVGLWIDDSYSVNARSAVQDKQQKSEVHPKNTKKRARPGESTRPRPKDRQQ  591

Query  991   TYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKGRK  821
               +R+ EL+ +IP GGK SID LL +TIK ++FLQSVT+ A+ LK+T E K    + G  
Sbjct  592   IQDRIKELKGIIPTGGKCSIDSLLDRTIKYMVFLQSVTKYADKLKQTHEPKLIGKENGVV  651

Query  820   DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFG  641
               ++++   G T A  +E QT++CP++VEDL  PGQMLIE+LC++QGFFLEI DIIRGFG
Sbjct  652   LKDNSTKCGGNTRALAVEGQTVVCPIIVEDLDQPGQMLIEMLCEKQGFFLEIADIIRGFG  711

Query  640   LNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVR  461
             LNILKG ME RE KIWA FIV  EA   V+R ++F SL++ LQ +    +   ++L NV 
Sbjct  712   LNILKGVMESREDKIWARFIV--EATRHVTRLDVFWSLVRFLQQATTGVVDPTNRLSNVV  769

Query  460   DNGRPSTSSNCSESAVPFPISL  395
             D G P     C +  +P P+SL
Sbjct  770   DGGVPPILDGCQQQILPPPVSL  791



>ref|XP_009773770.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Nicotiana 
sylvestris]
Length=784

 Score =   322 bits (826),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 205/366 (56%), Positives = 245/366 (67%), Gaps = 40/366 (11%)
 Frame = -1

Query  1366  SGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLS  1187
             SGQ  D+ TS  G  S  +   +  P NRLFSKLG+D LL D  + SCSF GS  NDQLS
Sbjct  417   SGQYPDYSTSNRGWNSSQANELRSRPDNRLFSKLGIDQLLDDALNGSCSFAGSVSNDQLS  476

Query  1186  STKKRR----------------------------------IEHPLASEREVTKLETIVSL  1109
              T KRR                                  I +  A    +TKL+   +L
Sbjct  477   VTNKRRRIGSSSGCNYLAMPPRFSNFDKITKLPECSLDRAISNLEAKSEVITKLDA-STL  535

Query  1108  IGENCSTNVMNT----KDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGK  941
             IG+ CS N  NT    K ++K SK  KKKAKPGTRPIPKDR   YERL+ELRELIPNG K
Sbjct  536   IGDRCSINACNTILPVKGNQKSSKPTKKKAKPGTRPIPKDRQLIYERLSELRELIPNGEK  595

Query  940   MSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEIENQ  761
             MSIDRLLH+TIK LLFLQ VT+ AEGLKKTE+LKD K R + +  +N NGVTWACEI +Q
Sbjct  596   MSIDRLLHRTIKHLLFLQGVTKHAEGLKKTEDLKDAKIRLEKSKTNNGNGVTWACEIGDQ  655

Query  760   TMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFI  581
             TM+CPL+VEDL TPGQMLIEILC+EQGFFLE+VDIIRGFGLNILKG +E RETK+WAHF+
Sbjct  656   TMVCPLIVEDLSTPGQMLIEILCKEQGFFLEMVDIIRGFGLNILKGVIESRETKMWAHFV  715

Query  580   VEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPI  401
             VE E N  V+RHE+FSSL+QLL L+  SE+   +QL N+   GR +  ++C +SAVP   
Sbjct  716   VEAEGNRLVTRHEIFSSLVQLLHLTSTSEVGLNNQLQNIT-GGRTALINDCPKSAVPISG  774

Query  400   SLPEGL  383
             +LPE +
Sbjct  775   NLPETI  780


 Score =   223 bits (567),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 194/330 (59%), Gaps = 40/330 (12%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + K +++AK  LK LC  +GWSY VFWGF+Q+NSL LTL+DAYYEE+MG +ID+MLLQ
Sbjct  1     MCERKFDSMAKESLKILCRSHGWSYGVFWGFDQRNSLLLTLQDAYYEEQMGAVIDEMLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             V+ILG+G++G+ AFTK HKWM SD N+  Q   G ++N +  L  DD EF  QFS GIKT
Sbjct  61    VHILGAGIIGKTAFTKKHKWMFSDANNGKQISIGSSNNSN--LFQDDVEFEQQFSTGIKT  118

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET--IFAQSSSSSANGDVFG-  1841
             IAVISVEPLGV+QFGS  KLPER  FV++ +KLF G ++E     +Q + SS++G++ G 
Sbjct  119   IAVISVEPLGVLQFGSTSKLPERTGFVEQARKLFLGIEVEAGKFPSQLTPSSSSGEICGL  178

Query  1840  LSGSLASSICNSSYFMSPEALPSPD---------FVDPIM--NMVQSFPVEAFSLFDDQF  1694
             L GS  SSI  + +F++    P+ +          ++ ++  + + +      SL ++Q 
Sbjct  179   LGGSSNSSIWENLHFVNSNVPPTANDETFMKESCLLEELIADDQIMTSDAATSSLSENQL  238

Query  1693  QN-------GGVETQTN---FSSYG----FQPSCSSVWGLEGSSLTSLQGNILPGAISQD  1556
             QN       G  +TQ     F S G    FQ SC          LTS   ++      QD
Sbjct  239   QNVQFNSCSGQFDTQLQQPMFQSAGLFTSFQDSC----------LTSTWEDLTSNMSIQD  288

Query  1555  CDNAFCALPDQFEYCTNTVQNVLERPVMTS  1466
              D    + P+ FEYC +  Q+  E    +S
Sbjct  289   FDYVLSSEPNNFEYCADATQSFHESTAFSS  318



>ref|XP_009612748.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Nicotiana 
tomentosiformis]
Length=760

 Score =   317 bits (813),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 203/357 (57%), Positives = 244/357 (68%), Gaps = 31/357 (9%)
 Frame = -1

Query  1366  SGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLS  1187
             SG   DF TS  G  S  +   +  P NRLFSKLG+D LL D  + SCSF GS  +DQLS
Sbjct  402   SGHYPDFSTSNCGWNSGQANELRSRPDNRLFSKLGIDQLLDDALNGSCSFAGSVSDDQLS  461

Query  1186  STKKRR------------IEHPLASEREVTKLETIV-------------SLIGENCSTNV  1082
              T KRR            +    +S  ++TKL++ +             +LIG+ CS N 
Sbjct  462   VTNKRRRIGSSSGCNYLAMPPSFSSFDKITKLDSNLEAKSEAITKLDASTLIGDRCSINA  521

Query  1081  MNT----KDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQ  914
              NT    K ++K SK  KKKAKPGTRPIPKDR   YERL+ELRELIPNG KMSIDRLLH+
Sbjct  522   CNTILPVKGNQKSSKPTKKKAKPGTRPIPKDRQLIYERLSELRELIPNGEKMSIDRLLHR  581

Query  913   TIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVE  734
             TIK LLFLQ VT+ AEGLK+TE+LKD K R +  S +N NGVTWACEI +QTM+CPL+VE
Sbjct  582   TIKHLLFLQGVTKHAEGLKRTEDLKDAKIRLEM-SKTNGNGVTWACEIGDQTMVCPLIVE  640

Query  733   DLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFV  554
             DL TPGQMLIEILC EQGFFLE+VDIIRGFGLNILKG ME RETK+WAHF+VE E N  V
Sbjct  641   DLSTPGQMLIEILCNEQGFFLEMVDIIRGFGLNILKGVMESRETKMWAHFVVEAEGNRLV  700

Query  553   SRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             +RHE+FSSL QLL L+  SE+   +QL N+   G  +  ++C +SA+P   SLPE +
Sbjct  701   TRHEIFSSLFQLLHLTNTSEVGLNNQLQNIT-GGTTALKNDCPKSALPISSSLPETI  756


 Score =   223 bits (568),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 180/315 (57%), Gaps = 23/315 (7%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M +GK +++AK  LK LC  +GWSY VFWGF+ +NSL LTL+DAYYEE+MG +ID+MLLQ
Sbjct  1     MCEGKFDSMAKETLKILCRSHGWSYGVFWGFDHRNSLLLTLQDAYYEEQMGAVIDEMLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             V+I+G+G++GQ AFTK HKWM SD N   Q   G ++N +  L  D +EF  QFS GIKT
Sbjct  61    VHIVGAGIIGQAAFTKKHKWMFSDANHEKQISIGSSNNSN--LFQDAAEFEQQFSTGIKT  118

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET--IFAQSSSSSANGDVFGL  1838
             IAVISVEPLGV+QFGS  KLPER  FVD+ +KLFQGT ++     +Q S S +  +    
Sbjct  119   IAVISVEPLGVLQFGSTTKLPERTCFVDQARKLFQGTVVKAGNFPSQHSPSCSVWENLHF  178

Query  1837  SGSLASSICNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAFSLFDDQFQN-------GGV  1679
               S A    N+  FM    L      D   + + +      SL ++QFQN       G  
Sbjct  179   VNSNALPTANNESFMKESCLLEDLIAD---DQIMTSDAATSSLSENQFQNVQFNSCSGQF  235

Query  1678  ET---QTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCT  1508
             +T   Q+ F S GF        G + S LTS   ++      QD D      P+ F Y  
Sbjct  236   DTQLQQSTFQSAGF------FTGFQDSCLTSTWEDLTSDMSIQDFDYVLSTEPNHFGYGA  289

Query  1507  NTVQNVLERPVMTST  1463
             +  QN LE    +S+
Sbjct  290   DATQNFLESTAFSSS  304



>ref|XP_009773769.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Nicotiana 
sylvestris]
Length=785

 Score =   318 bits (814),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 245/367 (67%), Gaps = 41/367 (11%)
 Frame = -1

Query  1366  SGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLS  1187
             SGQ  D+ TS  G  S  +   +  P NRLFSKLG+D LL D  + SCSF GS  NDQLS
Sbjct  417   SGQYPDYSTSNRGWNSSQANELRSRPDNRLFSKLGIDQLLDDALNGSCSFAGSVSNDQLS  476

Query  1186  STKKRR----------------------------------IEHPLASEREVTKLETIVSL  1109
              T KRR                                  I +  A    +TKL+   +L
Sbjct  477   VTNKRRRIGSSSGCNYLAMPPRFSNFDKITKLPECSLDRAISNLEAKSEVITKLDA-STL  535

Query  1108  IGENCSTNVMNT----KDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGK  941
             IG+ CS N  NT    K ++K SK  KKKAKPGTRPIPKDR   YERL+ELRELIPNG K
Sbjct  536   IGDRCSINACNTILPVKGNQKSSKPTKKKAKPGTRPIPKDRQLIYERLSELRELIPNGEK  595

Query  940   MSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK-DKKGRKDSNSNSNTNGVTWACEIEN  764
             MSIDRLLH+TIK LLFLQ VT+ AEGLKKTE+LK D K R + +  +N NGVTWACEI +
Sbjct  596   MSIDRLLHRTIKHLLFLQGVTKHAEGLKKTEDLKQDAKIRLEKSKTNNGNGVTWACEIGD  655

Query  763   QTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHF  584
             QTM+CPL+VEDL TPGQMLIEILC+EQGFFLE+VDIIRGFGLNILKG +E RETK+WAHF
Sbjct  656   QTMVCPLIVEDLSTPGQMLIEILCKEQGFFLEMVDIIRGFGLNILKGVIESRETKMWAHF  715

Query  583   IVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFP  404
             +VE E N  V+RHE+FSSL+QLL L+  SE+   +QL N+   GR +  ++C +SAVP  
Sbjct  716   VVEAEGNRLVTRHEIFSSLVQLLHLTSTSEVGLNNQLQNIT-GGRTALINDCPKSAVPIS  774

Query  403   ISLPEGL  383
              +LPE +
Sbjct  775   GNLPETI  781


 Score =   223 bits (567),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 194/330 (59%), Gaps = 40/330 (12%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + K +++AK  LK LC  +GWSY VFWGF+Q+NSL LTL+DAYYEE+MG +ID+MLLQ
Sbjct  1     MCERKFDSMAKESLKILCRSHGWSYGVFWGFDQRNSLLLTLQDAYYEEQMGAVIDEMLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             V+ILG+G++G+ AFTK HKWM SD N+  Q   G ++N +  L  DD EF  QFS GIKT
Sbjct  61    VHILGAGIIGKTAFTKKHKWMFSDANNGKQISIGSSNNSN--LFQDDVEFEQQFSTGIKT  118

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET--IFAQSSSSSANGDVFG-  1841
             IAVISVEPLGV+QFGS  KLPER  FV++ +KLF G ++E     +Q + SS++G++ G 
Sbjct  119   IAVISVEPLGVLQFGSTSKLPERTGFVEQARKLFLGIEVEAGKFPSQLTPSSSSGEICGL  178

Query  1840  LSGSLASSICNSSYFMSPEALPSPD---------FVDPIM--NMVQSFPVEAFSLFDDQF  1694
             L GS  SSI  + +F++    P+ +          ++ ++  + + +      SL ++Q 
Sbjct  179   LGGSSNSSIWENLHFVNSNVPPTANDETFMKESCLLEELIADDQIMTSDAATSSLSENQL  238

Query  1693  QN-------GGVETQTN---FSSYG----FQPSCSSVWGLEGSSLTSLQGNILPGAISQD  1556
             QN       G  +TQ     F S G    FQ SC          LTS   ++      QD
Sbjct  239   QNVQFNSCSGQFDTQLQQPMFQSAGLFTSFQDSC----------LTSTWEDLTSNMSIQD  288

Query  1555  CDNAFCALPDQFEYCTNTVQNVLERPVMTS  1466
              D    + P+ FEYC +  Q+  E    +S
Sbjct  289   FDYVLSSEPNNFEYCADATQSFHESTAFSS  318



>ref|XP_009612747.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Nicotiana 
tomentosiformis]
Length=761

 Score =   314 bits (804),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 200/357 (56%), Positives = 241/357 (68%), Gaps = 30/357 (8%)
 Frame = -1

Query  1366  SGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLS  1187
             SG   DF TS  G  S  +   +  P NRLFSKLG+D LL D  + SCSF GS  +DQLS
Sbjct  402   SGHYPDFSTSNCGWNSGQANELRSRPDNRLFSKLGIDQLLDDALNGSCSFAGSVSDDQLS  461

Query  1186  STKKRR------------IEHPLASEREVTKLETIV-------------SLIGENCSTNV  1082
              T KRR            +    +S  ++TKL++ +             +LIG+ CS N 
Sbjct  462   VTNKRRRIGSSSGCNYLAMPPSFSSFDKITKLDSNLEAKSEAITKLDASTLIGDRCSINA  521

Query  1081  MNT----KDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQ  914
              NT    K ++K SK  KKKAKPGTRPIPKDR   YERL+ELRELIPNG KMSIDRLLH+
Sbjct  522   CNTILPVKGNQKSSKPTKKKAKPGTRPIPKDRQLIYERLSELRELIPNGEKMSIDRLLHR  581

Query  913   TIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVE  734
             TIK LLFLQ VT+ AEGLK+TE+LK     +   S +N NGVTWACEI +QTM+CPL+VE
Sbjct  582   TIKHLLFLQGVTKHAEGLKRTEDLKQDAKIRLEMSKTNGNGVTWACEIGDQTMVCPLIVE  641

Query  733   DLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFV  554
             DL TPGQMLIEILC EQGFFLE+VDIIRGFGLNILKG ME RETK+WAHF+VE E N  V
Sbjct  642   DLSTPGQMLIEILCNEQGFFLEMVDIIRGFGLNILKGVMESRETKMWAHFVVEAEGNRLV  701

Query  553   SRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             +RHE+FSSL QLL L+  SE+   +QL N+   G  +  ++C +SA+P   SLPE +
Sbjct  702   TRHEIFSSLFQLLHLTNTSEVGLNNQLQNIT-GGTTALKNDCPKSALPISSSLPETI  757


 Score =   223 bits (568),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 137/315 (43%), Positives = 180/315 (57%), Gaps = 23/315 (7%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M +GK +++AK  LK LC  +GWSY VFWGF+ +NSL LTL+DAYYEE+MG +ID+MLLQ
Sbjct  1     MCEGKFDSMAKETLKILCRSHGWSYGVFWGFDHRNSLLLTLQDAYYEEQMGAVIDEMLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             V+I+G+G++GQ AFTK HKWM SD N   Q   G ++N +  L  D +EF  QFS GIKT
Sbjct  61    VHIVGAGIIGQAAFTKKHKWMFSDANHEKQISIGSSNNSN--LFQDAAEFEQQFSTGIKT  118

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET--IFAQSSSSSANGDVFGL  1838
             IAVISVEPLGV+QFGS  KLPER  FVD+ +KLFQGT ++     +Q S S +  +    
Sbjct  119   IAVISVEPLGVLQFGSTTKLPERTCFVDQARKLFQGTVVKAGNFPSQHSPSCSVWENLHF  178

Query  1837  SGSLASSICNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAFSLFDDQFQN-------GGV  1679
               S A    N+  FM    L      D   + + +      SL ++QFQN       G  
Sbjct  179   VNSNALPTANNESFMKESCLLEDLIAD---DQIMTSDAATSSLSENQFQNVQFNSCSGQF  235

Query  1678  ET---QTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCT  1508
             +T   Q+ F S GF        G + S LTS   ++      QD D      P+ F Y  
Sbjct  236   DTQLQQSTFQSAGF------FTGFQDSCLTSTWEDLTSDMSIQDFDYVLSTEPNHFGYGA  289

Query  1507  NTVQNVLERPVMTST  1463
             +  QN LE    +S+
Sbjct  290   DATQNFLESTAFSSS  304



>ref|XP_006343800.1| PREDICTED: transcription factor bHLH157-like [Solanum tuberosum]
Length=769

 Score =   303 bits (776),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 202/355 (57%), Positives = 236/355 (66%), Gaps = 41/355 (12%)
 Frame = -1

Query  1342  TSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRR--  1169
             TS SG T  ++   +  P+NRLFSKLGLD  L    SSS SF GS  + QLS T KRR  
Sbjct  417   TSNSGWTYSNANELRSRPANRLFSKLGLDQFLDGALSSSYSFAGSVSDGQLSETNKRRRI  476

Query  1168  --------IEHPLA------------------------SEREV-TKLETIVSLIGENCST  1088
                     +++PL                         ++ EV TKL+   +LIG+ CS 
Sbjct  477   GSSSECNYLQNPLGFSNFDKNAKLVQPECGLDRTSNLEAKSEVNTKLDA-STLIGDRCSI  535

Query  1087  NVMNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTI  908
             N  N K +EK SK  KKKAKPGTRPIPKDR   YERL+ELR LIPNG KMSIDRLLH+T+
Sbjct  536   N--NCKGNEKSSKPTKKKAKPGTRPIPKDRQLIYERLSELRGLIPNGEKMSIDRLLHRTV  593

Query  907   KQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDL  728
             K LLFLQ VT+ AEGLKK E LKD K R   NS SN NGVTWACEI +QTM+CPL+VEDL
Sbjct  594   KHLLFLQGVTKHAEGLKKAESLKDSKTRL--NSKSNGNGVTWACEIGDQTMVCPLIVEDL  651

Query  727   CTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              TPGQMLIEILC EQGFFLE+VDIIRGFGLNILKG ME RETK+WAHF+VE E N  V+R
Sbjct  652   STPGQMLIEILCNEQGFFLEMVDIIRGFGLNILKGVMESRETKMWAHFVVEAEGNRLVTR  711

Query  547   HElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             HE+FSSL+QLL L+  SE+   +QL      GR +  ++C  SAVP    LPE +
Sbjct  712   HEIFSSLVQLLHLTSASEVGLNNQL-QYTSGGRNTLINDCPNSAVPISGCLPETI  765


 Score =   202 bits (514),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 140/345 (41%), Positives = 183/345 (53%), Gaps = 54/345 (16%)
 Frame = -1

Query  2353  ETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGS  2174
             +++AK  LKSLC  +GWSY VFWGF+Q NSL LTL+DAYYEE+MG +ID+MLLQV+ILG 
Sbjct  3     DSMAKETLKSLCRSHGWSYGVFWGFDQTNSLLLTLQDAYYEEQMGSVIDEMLLQVHILGR  62

Query  2173  GVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             G++GQ AFTK HKWM S  N   Q   G + N + LL  DD+EF  QFS GIKTIAVISV
Sbjct  63    GMIGQTAFTKKHKWMFSAANHERQISIGSSHNSNLLL--DDNEFEQQFSAGIKTIAVISV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSI  1814
             EPLGV+QFGS  KL E   FVD+ + +FQ                     G+ GS  SSI
Sbjct  121   EPLGVLQFGSTNKLQESTCFVDQARTIFQ---------------------GIGGSPTSSI  159

Query  1813  CNSSYFMSPEALPSPDFVDPIM-------NMVQSFPVEAFS-----------LFDDQFQ-  1691
             C + +F++    P+ +  + +M       +++QS    A S           L ++QFQ 
Sbjct  160   CENLHFVNSTVFPTAN-NESLMKDSRFLEDLIQSVTCNAESQIMNSDVATTFLTENQFQD  218

Query  1690  -----NGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAIS-QDCDNAFCALP  1529
                  N   +  T      F PS     G   SSLTS   + LP  +S QD         
Sbjct  219   VNQFNNCSSQFDTQLQQAMF-PSAGLFTGFHDSSLTSTWED-LPSDMSIQDFGYVLPTGT  276

Query  1528  DQFEYCTNTVQNVLERPVMTSTHELGQSAFDEV---LDGFGCKMP  1403
             +QFEY T   Q+  E     S    G  A ++    L+G+  + P
Sbjct  277   NQFEYGTGATQSFHESTTFGSLGGFGVFANEDTTGPLNGYIVQCP  321



>ref|XP_010676868.1| PREDICTED: transcription factor bHLH157 [Beta vulgaris subsp. 
vulgaris]
Length=689

 Score =   292 bits (747),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 243/723 (34%), Positives = 351/723 (49%), Gaps = 100/723 (14%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M     E+  K +L+SLC  +GW+Y VFW F+ +N + LT+ D Y E     L++ ML+Q
Sbjct  1     MGMENGESCIKKILRSLCLSHGWTYGVFWRFDPRNHMMLTMEDGYCEGHAANLMESMLVQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             +++LG G++G+VA     +WML             A +  E+L+D  S+F  QFSCGIKT
Sbjct  61    LHMLGEGIIGEVALEGKQRWML-------------AYSSKEILED--SQFGFQFSCGIKT  105

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDI----ETIFAQSSSSSANGDVF  1844
             IAVI +E  GVVQFGS +++ E  EF+D+ +K  Q   +    +   + S  +S N    
Sbjct  106   IAVIPIEMRGVVQFGSTKEIFEAQEFLDQARKCLQDQSLDESGQNRLSASVIASQNPFFD  165

Query  1843  GLSGSLASSICNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAFSLFDDQFQNGGVETQTN  1664
              +S S  + I NS  F S    P     DP      S   +A  +F + F+         
Sbjct  166   DVSTSWGNGIENSLLFDSLH-FPGDLITDPSSG---SLVKDAVDVFTEHFEPAHFPASLL  221

Query  1663  FSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFE-----YCTNTV  1499
              +    Q    S W L  SS   + G  L   +S D  +      + F          + 
Sbjct  222   ETC---QTDDFSQW-LADSSKLCVSGLDLEAMLSDDMSSDLGGSNNIFSNIQGSQSACSS  277

Query  1498  QNVLERPVMTSTHELGQSAF----DEVLDGFGCKMPEKS-DNIRKPAATSGQQW--DFGT  1340
             Q+ L   V+ S  E   S      +E+L  FG  +  +   ++          W  D G 
Sbjct  278   QSSLTHNVLDSCKEGKPSVVGANNNELLTEFGIDLGSRELGDVINTVEDKINPWPIDTGM  337

Query  1339  SISGCTSE------HSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTK  1178
               S C SE      HSI +   P   LFS+LGL+HLL D      S + S   DQ  S+K
Sbjct  338   RFSECISEVVGGRGHSIAA---PKKGLFSELGLEHLLKDG-----STIKSCIEDQWPSSK  389

Query  1177  KRRIE------------------------------HPLASERE-VTKLETIVSLIGENCS  1091
             KRR+E                                  S +E + K ++  S+  ++C 
Sbjct  390   KRRVEAYEMVNDQIQQTYHSWGVKYMQPSSTSVQMQDFGSLKECMEKAQSSYSIDAKSCI  449

Query  1090  TNV---MNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLL  920
             ++V   M   +    +   + +    TRP PKDR    +R+ +LR+LIPNG K+SID LL
Sbjct  450   SSVNAKMRKTEEPPKASKKRARPGESTRPRPKDRQLIADRIKDLRDLIPNGAKLSIDALL  509

Query  919   HQTIKQLLFLQSVTRLAEGLKKTEE---------LKDKKGRKDSNSNSNTNGVTWACEIE  767
              +TIK +LFLQ++ +  + LK+ +E         L  K      +S  +  G TWA E+ 
Sbjct  510   GRTIKHMLFLQNLNKHGDKLKQADEPKLIDQSNGLIQKGSSASISSGGSGRGATWAYEVG  569

Query  766   NQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAH  587
                ++CP++VEDL  PGQMLIE+LC+E+G+FLEI DIIRGFGL ILKG ME R  KIWAH
Sbjct  570   GSNLLCPIIVEDLNEPGQMLIEMLCEERGYFLEIADIIRGFGLTILKGVMESRNDKIWAH  629

Query  586   FIVEPEANAFVSRHElfssllqllqlSGPSE-LHARDQLGNVRDNGRPSTSSNCSESAVP  410
             FIV  E N  V+R ++F SL+ LLQ +  SE ++   +  N+  +  P    N  +  VP
Sbjct  630   FIV--EGNKHVTRMDVFVSLMHLLQGTNTSEVVNTACEPTNIVSDAAP-LWGNFQQHMVP  686

Query  409   FPI  401
              PI
Sbjct  687   LPI  689



>ref|XP_002518886.1| bhlh transcription factor, putative [Ricinus communis]
 gb|EEF43419.1| bhlh transcription factor, putative [Ricinus communis]
Length=725

 Score =   293 bits (749),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 240/730 (33%), Positives = 344/730 (47%), Gaps = 166/730 (23%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGV  2168
             V K  LK LCC NGWSY VFW F+Q+NS+ LT+ DAYYEEEMG L+++ML QV+I+G G+
Sbjct  4     VLKDSLKDLCCSNGWSYGVFWCFDQRNSMLLTVEDAYYEEEMGTLVNNMLQQVHIIGEGI  63

Query  2167  VGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEP  1988
             VGQ A +  ++W+ SD  +  ++    +   + + Q               TIAVI VE 
Sbjct  64    VGQAALSGKNQWIFSDAKNGGRTSAS-SSRSNHIYQ---------------TIAVIPVES  107

Query  1987  LGVVQFGSNQKLPERMEFVDETKKLF---------------------QGTDIETIFAQSS  1871
              GV+QFGS +K+ E  +F+D+ K+LF                     +G D+   FA   
Sbjct  108   RGVIQFGSTRKIFETPQFLDQAKRLFSEMENVSGIASLNNPPSSLNHEGCDLNEWFA---  164

Query  1870  SSSANGDVFGLSGSLASSICNSSY----FMSPEALPSPDF----VDPI----------MN  1745
              S  NG++  +     S +   +Y    F    A  S DF    +DP+          M 
Sbjct  165   -SFCNGNITPMQSGSCSELMEVAYSSVNFTQSSAFTS-DFQQEKMDPLCLESCHLTNSMQ  222

Query  1744  MVQSFPVEAFSLFDDQFQNGGVETQTNFSS--YGFQPSCSSVWGLEGSSLTSLQGNILPG  1571
                   V   S  + QF+   V  Q+ FSS     +  C S WG EGS LTSL+      
Sbjct  223   TGTEAQVVLTSNPNTQFEQ--VALQSAFSSEKSASKTPCISTWGNEGSMLTSLESQFASN  280

Query  1570  AISQDCDNAF---------CALPDQ-FEYCTN--------------TVQNVLER----PV  1475
                Q+  N F         C    Q F++ ++               V+NV +     PV
Sbjct  281   MGVQNSLNVFSTKENAPVSCGCIKQDFQWGSSGTSFYSTGGKMAPIMVENVSQSAGVTPV  340

Query  1474  MTS-----THEL-----GQSAFDEVLDGFGCKMPEKS-----------------------  1394
              +S     TH++       S    + D + C   EK+                       
Sbjct  341   SSSLVGDVTHDIPLAQPSNSMQSSITDSYFCTRQEKTIDTGNDLFVHLGLHYGCEQDANC  400

Query  1393  -DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsf  1217
              +N+ K   ++G        +S C SE  + S+  P   LFS+LGL+ LL +  ++S   
Sbjct  401   QENMMKRGTSNGN-LAISNGVSECISELDVNSEVGPRKGLFSELGLEELL-NGGNNSSYT  458

Query  1216  vgsSCNDQLSSTKK----------------RRIEHP---------LASEREVTKLETIVS  1112
               SS +DQ S+ K                  +I  P         L  ++E+     +  
Sbjct  459   TNSSIDDQFSTAKSVSHNQAQSGSIACSSGSKITQPSYYKDKASNLLPKKEMFPKSQVGL  518

Query  1111  LIGENCSTN---VMNTK----DHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIP  953
              I ++ S N    + TK    +    +   + +    TRP PKDR +  + + EL+ +IP
Sbjct  519   WIDDSYSINDGSALPTKPKKPEEPTKATRKRARPGESTRPRPKDRQQFQDCIKELKGIIP  578

Query  952   NGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACE  773
             +G K SID LL  TIK +LFLQSVT+ A+ LK+ +E       K  +  S   G TWA E
Sbjct  579   DGEKCSIDALLDHTIKYMLFLQSVTKYADKLKQADE------PKVYSCTSGGGGATWALE  632

Query  772   IENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIW  593
             + +Q+  CP++VEDL  PG MLIE+LC+++GFFLEI D+IRGFGLNILKG ME RE KIW
Sbjct  633   VGDQSTACPIIVEDLSPPGLMLIEMLCEDRGFFLEIADVIRGFGLNILKGVMETREDKIW  692

Query  592   AHFIVEPEAN  563
             AHFIVE + +
Sbjct  693   AHFIVEAKTH  702



>ref|XP_004246087.1| PREDICTED: transcription factor bHLH157 isoform X2 [Solanum lycopersicum]
Length=769

 Score =   293 bits (749),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 270/453 (60%), Gaps = 71/453 (16%)
 Frame = -1

Query  1573  GAISQDCDN---------AFCALPDQFEYCTNTVQNVLERPVMTSTHEL-------GQSA  1442
             GA+S   DN         A   + +QF + +++  +V  +  +T+  E          SA
Sbjct  328   GAVSTISDNILDTTGIISASAGINEQFRFNSDSDASVSIQSSITNAFETVEKANCSNMSA  387

Query  1441  FDEVLDGFGCKMPEKS----DNIRKPA-ATSGQQWDFGTSISGCTSEHSIGSKDWPSNRL  1277
              +++ +  G K   K      ++  P  +TS  +W +       ++ + + S+  P+NRL
Sbjct  388   IEKMTNLVGVKHDSKKPCNWGDVSNPVVSTSNSEWTY-------SNANELRSR--PANRL  438

Query  1276  FSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRR----------IEHPL---------  1154
             FSKLGLD  L    SSS SF GS  + QLS T KRR          ++ PL         
Sbjct  439   FSKLGLDQFLDGALSSSYSFAGSFSDGQLSETNKRRRVGSSSECNYLQKPLGFSNFDKNA  498

Query  1153  ----------------ASEREVTKLETIVSLIGENCSTNVMNTKDHEkpskavkkkakPG  1022
                             A    +TKL+   +LIG+ CS N  N + +EK SK  KKKAKPG
Sbjct  499   KLVQPECGLDRTSNLEAKSEIITKLDA-STLIGDRCSIN--NCRGNEKSSKPTKKKAKPG  555

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRPIPKDR   YERL+ELR LIPNG KMSIDRLLH+T+K LLFLQ VT+ AEGLKK E L
Sbjct  556   TRPIPKDRQLIYERLSELRGLIPNGEKMSIDRLLHRTVKHLLFLQGVTKHAEGLKKAESL  615

Query  841   KDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
             KD + R   NS SN NGVTWACEI +QTM+CPL+VEDL TPGQMLIEIL  EQGFFLE+V
Sbjct  616   KDSETRL--NSKSNGNGVTWACEIGDQTMVCPLIVEDLSTPGQMLIEILYNEQGFFLEMV  673

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHAR  482
             DIIRGFGLNILKG M+ RETK+WAHF+VE E N  V+RHE+FSSL+QLL L+  S++   
Sbjct  674   DIIRGFGLNILKGVMQSRETKMWAHFVVEAEGNRLVTRHEIFSSLVQLLHLTSASKVGLN  733

Query  481   DQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             +QL      GR +  ++C  SAVP    LPE +
Sbjct  734   NQL-QYTSGGRNTLINDCPNSAVPISGCLPETI  765


 Score =   181 bits (458),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 176/345 (51%), Gaps = 54/345 (16%)
 Frame = -1

Query  2353  ETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGS  2174
             +++AK  LK LC  +GWSY VFWGF+Q NSL L L+D YYEE+MG +ID+MLLQV+ILG 
Sbjct  3     DSMAKETLKRLCRSHGWSYGVFWGFDQTNSLLLALQDVYYEEQMGSVIDEMLLQVHILGR  62

Query  2173  GVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             G++GQ AF+K +KWM +  N   Q     ++N +  L  DD+EF  QFS GIKTIAV+SV
Sbjct  63    GIIGQTAFSKKYKWMFTAANHERQISIRSSNNSNLFL--DDNEFEQQFSAGIKTIAVLSV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSI  1814
             EPLGV+QFGS  KL E   FV++ + LFQ                     G+ GS  SS 
Sbjct  121   EPLGVLQFGSTNKLQESTCFVEQARTLFQ---------------------GIGGSPTSSS  159

Query  1813  CNSSYFMSPEALPSPDFVDPIM-------NMVQSFPVEAFS-----------LFDDQFQ-  1691
             C + +F++    P+ +  + +M       N++QS    A S           L ++QFQ 
Sbjct  160   CENLHFVNSTVFPTAN-NESLMKESHFLENLIQSVTCNAESQIMNSDVATAFLSENQFQD  218

Query  1690  -----NGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAIS-QDCDNAFCALP  1529
                  N   +  T      F PS         S LTS   + LP  +S QD         
Sbjct  219   VNQFNNCSSQFDTQLQQAMF-PSAGLFTSFHDSCLTSTWED-LPSDMSIQDFSYVLPTGI  276

Query  1528  DQFEYCTNTVQNVLERPVMTSTHELGQSAFDEV---LDGFGCKMP  1403
             +QFEY T   Q+  +     S    G  A ++    L+G+  + P
Sbjct  277   NQFEYGTGATQSFHDNTTFGSLGGFGVLANEDTTGPLNGYIVQCP  321



>ref|XP_010325331.1| PREDICTED: transcription factor bHLH157 isoform X4 [Solanum lycopersicum]
Length=725

 Score =   288 bits (738),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 270/454 (59%), Gaps = 72/454 (16%)
 Frame = -1

Query  1573  GAISQDCDN---------AFCALPDQFEYCTNTVQNVLERPVMTSTHEL-------GQSA  1442
             GA+S   DN         A   + +QF + +++  +V  +  +T+  E          SA
Sbjct  283   GAVSTISDNILDTTGIISASAGINEQFRFNSDSDASVSIQSSITNAFETVEKANCSNMSA  342

Query  1441  FDEVLDGFGCKMPEKS----DNIRKPA-ATSGQQWDFGTSISGCTSEHSIGSKDWPSNRL  1277
              +++ +  G K   K      ++  P  +TS  +W +       ++ + + S+  P+NRL
Sbjct  343   IEKMTNLVGVKHDSKKPCNWGDVSNPVVSTSNSEWTY-------SNANELRSR--PANRL  393

Query  1276  FSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRR----------IEHPL---------  1154
             FSKLGLD  L    SSS SF GS  + QLS T KRR          ++ PL         
Sbjct  394   FSKLGLDQFLDGALSSSYSFAGSFSDGQLSETNKRRRVGSSSECNYLQKPLGFSNFDKNA  453

Query  1153  ----------------ASEREVTKLETIVSLIGENCSTNVMNTKDHEkpskavkkkakPG  1022
                             A    +TKL+   +LIG+ CS N  N + +EK SK  KKKAKPG
Sbjct  454   KLVQPECGLDRTSNLEAKSEIITKLDA-STLIGDRCSIN--NCRGNEKSSKPTKKKAKPG  510

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRPIPKDR   YERL+ELR LIPNG KMSIDRLLH+T+K LLFLQ VT+ AEGLKK E L
Sbjct  511   TRPIPKDRQLIYERLSELRGLIPNGEKMSIDRLLHRTVKHLLFLQGVTKHAEGLKKAESL  570

Query  841   K-DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K D + R   NS SN NGVTWACEI +QTM+CPL+VEDL TPGQMLIEIL  EQGFFLE+
Sbjct  571   KQDSETRL--NSKSNGNGVTWACEIGDQTMVCPLIVEDLSTPGQMLIEILYNEQGFFLEM  628

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHA  485
             VDIIRGFGLNILKG M+ RETK+WAHF+VE E N  V+RHE+FSSL+QLL L+  S++  
Sbjct  629   VDIIRGFGLNILKGVMQSRETKMWAHFVVEAEGNRLVTRHEIFSSLVQLLHLTSASKVGL  688

Query  484   RDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
              +QL      GR +  ++C  SAVP    LPE +
Sbjct  689   NNQL-QYTSGGRNTLINDCPNSAVPISGCLPETI  721


 Score =   121 bits (304),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 102/302 (34%), Positives = 143/302 (47%), Gaps = 54/302 (18%)
 Frame = -1

Query  2224  MGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSE  2045
             MG +ID+MLLQV+ILG G++GQ AF+K +KWM +  N   Q     ++N +  L  DD+E
Sbjct  1     MGSVIDEMLLQVHILGRGIIGQTAFSKKYKWMFTAANHERQISIRSSNNSNLFL--DDNE  58

Query  2044  FYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSS  1865
             F  QFS GIKTIAV+SVEPLGV+QFGS  KL E   FV++ + LFQ              
Sbjct  59    FEQQFSAGIKTIAVLSVEPLGVLQFGSTNKLQESTCFVEQARTLFQ--------------  104

Query  1864  SANGDVFGLSGSLASSICNSSYFMSPEALPSPDFVDPIM-------NMVQSFPVEAFS--  1712
                    G+ GS  SS C + +F++    P+ +  + +M       N++QS    A S  
Sbjct  105   -------GIGGSPTSSSCENLHFVNSTVFPTAN-NESLMKESHFLENLIQSVTCNAESQI  156

Query  1711  ---------LFDDQFQ------NGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNIL  1577
                      L ++QFQ      N   +  T      F PS         S LTS   + L
Sbjct  157   MNSDVATAFLSENQFQDVNQFNNCSSQFDTQLQQAMF-PSAGLFTSFHDSCLTSTWED-L  214

Query  1576  PGAIS-QDCDNAFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDEV---LDGFGCK  1409
             P  +S QD         +QFEY T   Q+  +     S    G  A ++    L+G+  +
Sbjct  215   PSDMSIQDFSYVLPTGINQFEYGTGATQSFHDNTTFGSLGGFGVLANEDTTGPLNGYIVQ  274

Query  1408  MP  1403
              P
Sbjct  275   CP  276



>ref|XP_010325330.1| PREDICTED: transcription factor bHLH157 isoform X3 [Solanum lycopersicum]
Length=750

 Score =   289 bits (739),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 270/454 (59%), Gaps = 72/454 (16%)
 Frame = -1

Query  1573  GAISQDCDN---------AFCALPDQFEYCTNTVQNVLERPVMTSTHEL-------GQSA  1442
             GA+S   DN         A   + +QF + +++  +V  +  +T+  E          SA
Sbjct  308   GAVSTISDNILDTTGIISASAGINEQFRFNSDSDASVSIQSSITNAFETVEKANCSNMSA  367

Query  1441  FDEVLDGFGCKMPEKS----DNIRKPA-ATSGQQWDFGTSISGCTSEHSIGSKDWPSNRL  1277
              +++ +  G K   K      ++  P  +TS  +W +       ++ + + S+  P+NRL
Sbjct  368   IEKMTNLVGVKHDSKKPCNWGDVSNPVVSTSNSEWTY-------SNANELRSR--PANRL  418

Query  1276  FSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRR----------IEHPL---------  1154
             FSKLGLD  L    SSS SF GS  + QLS T KRR          ++ PL         
Sbjct  419   FSKLGLDQFLDGALSSSYSFAGSFSDGQLSETNKRRRVGSSSECNYLQKPLGFSNFDKNA  478

Query  1153  ----------------ASEREVTKLETIVSLIGENCSTNVMNTKDHEkpskavkkkakPG  1022
                             A    +TKL+   +LIG+ CS N  N + +EK SK  KKKAKPG
Sbjct  479   KLVQPECGLDRTSNLEAKSEIITKLDA-STLIGDRCSIN--NCRGNEKSSKPTKKKAKPG  535

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRPIPKDR   YERL+ELR LIPNG KMSIDRLLH+T+K LLFLQ VT+ AEGLKK E L
Sbjct  536   TRPIPKDRQLIYERLSELRGLIPNGEKMSIDRLLHRTVKHLLFLQGVTKHAEGLKKAESL  595

Query  841   K-DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K D + R   NS SN NGVTWACEI +QTM+CPL+VEDL TPGQMLIEIL  EQGFFLE+
Sbjct  596   KQDSETRL--NSKSNGNGVTWACEIGDQTMVCPLIVEDLSTPGQMLIEILYNEQGFFLEM  653

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHA  485
             VDIIRGFGLNILKG M+ RETK+WAHF+VE E N  V+RHE+FSSL+QLL L+  S++  
Sbjct  654   VDIIRGFGLNILKGVMQSRETKMWAHFVVEAEGNRLVTRHEIFSSLVQLLHLTSASKVGL  713

Query  484   RDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
              +QL      GR +  ++C  SAVP    LPE +
Sbjct  714   NNQL-QYTSGGRNTLINDCPNSAVPISGCLPETI  746


 Score =   138 bits (348),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 109/314 (35%), Positives = 152/314 (48%), Gaps = 54/314 (17%)
 Frame = -1

Query  2260  FLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLAD  2081
              L L+D YYEE+MG +ID+MLLQV+ILG G++GQ AF+K +KWM +  N   Q     ++
Sbjct  14    LLALQDVYYEEQMGSVIDEMLLQVHILGRGIIGQTAFSKKYKWMFTAANHERQISIRSSN  73

Query  2080  NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGT  1901
             N +  L  DD+EF  QFS GIKTIAV+SVEPLGV+QFGS  KL E   FV++ + LFQ  
Sbjct  74    NSNLFL--DDNEFEQQFSAGIKTIAVLSVEPLGVLQFGSTNKLQESTCFVEQARTLFQ--  129

Query  1900  DIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDFVDPIM-------NM  1742
                                G+ GS  SS C + +F++    P+ +  + +M       N+
Sbjct  130   -------------------GIGGSPTSSSCENLHFVNSTVFPTAN-NESLMKESHFLENL  169

Query  1741  VQSFPVEAFS-----------LFDDQFQ------NGGVETQTNFSSYGFQPSCSSVWGLE  1613
             +QS    A S           L ++QFQ      N   +  T      F PS        
Sbjct  170   IQSVTCNAESQIMNSDVATAFLSENQFQDVNQFNNCSSQFDTQLQQAMF-PSAGLFTSFH  228

Query  1612  GSSLTSLQGNILPGAIS-QDCDNAFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFD  1436
              S LTS   + LP  +S QD         +QFEY T   Q+  +     S    G  A +
Sbjct  229   DSCLTSTWED-LPSDMSIQDFSYVLPTGINQFEYGTGATQSFHDNTTFGSLGGFGVLANE  287

Query  1435  EV---LDGFGCKMP  1403
             +    L+G+  + P
Sbjct  288   DTTGPLNGYIVQCP  301



>ref|XP_010325329.1| PREDICTED: transcription factor bHLH157 isoform X1 [Solanum lycopersicum]
Length=770

 Score =   288 bits (737),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 212/454 (47%), Positives = 270/454 (59%), Gaps = 72/454 (16%)
 Frame = -1

Query  1573  GAISQDCDN---------AFCALPDQFEYCTNTVQNVLERPVMTSTHEL-------GQSA  1442
             GA+S   DN         A   + +QF + +++  +V  +  +T+  E          SA
Sbjct  328   GAVSTISDNILDTTGIISASAGINEQFRFNSDSDASVSIQSSITNAFETVEKANCSNMSA  387

Query  1441  FDEVLDGFGCKMPEKS----DNIRKPA-ATSGQQWDFGTSISGCTSEHSIGSKDWPSNRL  1277
              +++ +  G K   K      ++  P  +TS  +W +       ++ + + S+  P+NRL
Sbjct  388   IEKMTNLVGVKHDSKKPCNWGDVSNPVVSTSNSEWTY-------SNANELRSR--PANRL  438

Query  1276  FSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRR----------IEHPL---------  1154
             FSKLGLD  L    SSS SF GS  + QLS T KRR          ++ PL         
Sbjct  439   FSKLGLDQFLDGALSSSYSFAGSFSDGQLSETNKRRRVGSSSECNYLQKPLGFSNFDKNA  498

Query  1153  ----------------ASEREVTKLETIVSLIGENCSTNVMNTKDHEkpskavkkkakPG  1022
                             A    +TKL+   +LIG+ CS N  N + +EK SK  KKKAKPG
Sbjct  499   KLVQPECGLDRTSNLEAKSEIITKLDA-STLIGDRCSIN--NCRGNEKSSKPTKKKAKPG  555

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRPIPKDR   YERL+ELR LIPNG KMSIDRLLH+T+K LLFLQ VT+ AEGLKK E L
Sbjct  556   TRPIPKDRQLIYERLSELRGLIPNGEKMSIDRLLHRTVKHLLFLQGVTKHAEGLKKAESL  615

Query  841   K-DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K D + R   NS SN NGVTWACEI +QTM+CPL+VEDL TPGQMLIEIL  EQGFFLE+
Sbjct  616   KQDSETRL--NSKSNGNGVTWACEIGDQTMVCPLIVEDLSTPGQMLIEILYNEQGFFLEM  673

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHA  485
             VDIIRGFGLNILKG M+ RETK+WAHF+VE E N  V+RHE+FSSL+QLL L+  S++  
Sbjct  674   VDIIRGFGLNILKGVMQSRETKMWAHFVVEAEGNRLVTRHEIFSSLVQLLHLTSASKVGL  733

Query  484   RDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
              +QL      GR +  ++C  SAVP    LPE +
Sbjct  734   NNQL-QYTSGGRNTLINDCPNSAVPISGCLPETI  766


 Score =   181 bits (458),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 128/345 (37%), Positives = 176/345 (51%), Gaps = 54/345 (16%)
 Frame = -1

Query  2353  ETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGS  2174
             +++AK  LK LC  +GWSY VFWGF+Q NSL L L+D YYEE+MG +ID+MLLQV+ILG 
Sbjct  3     DSMAKETLKRLCRSHGWSYGVFWGFDQTNSLLLALQDVYYEEQMGSVIDEMLLQVHILGR  62

Query  2173  GVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             G++GQ AF+K +KWM +  N   Q     ++N +  L  DD+EF  QFS GIKTIAV+SV
Sbjct  63    GIIGQTAFSKKYKWMFTAANHERQISIRSSNNSNLFL--DDNEFEQQFSAGIKTIAVLSV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSI  1814
             EPLGV+QFGS  KL E   FV++ + LFQ                     G+ GS  SS 
Sbjct  121   EPLGVLQFGSTNKLQESTCFVEQARTLFQ---------------------GIGGSPTSSS  159

Query  1813  CNSSYFMSPEALPSPDFVDPIM-------NMVQSFPVEAFS-----------LFDDQFQ-  1691
             C + +F++    P+ +  + +M       N++QS    A S           L ++QFQ 
Sbjct  160   CENLHFVNSTVFPTAN-NESLMKESHFLENLIQSVTCNAESQIMNSDVATAFLSENQFQD  218

Query  1690  -----NGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAIS-QDCDNAFCALP  1529
                  N   +  T      F PS         S LTS   + LP  +S QD         
Sbjct  219   VNQFNNCSSQFDTQLQQAMF-PSAGLFTSFHDSCLTSTWED-LPSDMSIQDFSYVLPTGI  276

Query  1528  DQFEYCTNTVQNVLERPVMTSTHELGQSAFDEV---LDGFGCKMP  1403
             +QFEY T   Q+  +     S    G  A ++    L+G+  + P
Sbjct  277   NQFEYGTGATQSFHDNTTFGSLGGFGVLANEDTTGPLNGYIVQCP  321



>emb|CDP20971.1| unnamed protein product [Coffea canephora]
Length=817

 Score =   246 bits (629),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 183/383 (48%), Positives = 223/383 (58%), Gaps = 51/383 (13%)
 Frame = -1

Query  1420  FGCKMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSD  1241
              G K P   +++ +    SG    F  S S C SE  + SK   SN LFS+LGL   L  
Sbjct  430   MGSKNPGDWEDVMRSMDISGH-LHFCASSSDCMSEQYLESKLRTSNTLFSQLGLYQRLDA  488

Query  1240  NPssscsfvgsSCNDQLSSTKKRR-IEHPLASEREVTKLETIVSLIG-------------  1103
                 SCS   S   D+ SST KRR IE PL S  EV+ L   V  +              
Sbjct  489   IGRGSCSVANSDFRDEWSSTAKRRKIESPLLSSNEVSCLPEFVGTVNSLQPVHHLNSTSN  548

Query  1102  ------------------ENCST----NVMNTKDHEkpskavkkkakPGTRPIPKDRVRT  989
                               +NCS      V++    E P+K +KKKAKPGT+P P+DR + 
Sbjct  549   FESKDKVIRKKEAGSCNDDNCSIIAEDTVLSPNKLELPAKTIKKKAKPGTKPRPRDRQQI  608

Query  988   YERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNS  809
             ++RL ELR+LIPNG KMSIDRLLH TIK LLFLQ VTR A+   +T+EL  K G   +  
Sbjct  609   HDRLLELRDLIPNGEKMSIDRLLHLTIKHLLFLQCVTRHAKRFVQTDEL--KSGTVGNGY  666

Query  808   NSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIE----------ILCQEQGFFLEIVD  659
              ++  GVTWACE+ +QTM CPL+VEDL  PGQMLIE          ILC+EQGFFLEIVD
Sbjct  667   PNSGKGVTWACEVGDQTMFCPLIVEDLSVPGQMLIEASEKQFHLYIILCEEQGFFLEIVD  726

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEAN-AFVSRHElfssllqllqlSGPSELHAR  482
             IIRGFGL + KG ME+RETKIWA F VE E N   V+RHE+FSSL+QLLQL+G + +H  
Sbjct  727   IIRGFGLTVFKGVMEVRETKIWARFNVEAEENRQHVTRHEIFSSLVQLLQLTGSTRIHES  786

Query  481   DQLGNVRDNGRPSTSSNCSESAV  413
             DQL NV D G     S C +SA+
Sbjct  787   DQLDNVMDGGAAFLKS-CQQSAL  808


 Score =   194 bits (494),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 132/192 (69%), Gaps = 5/192 (3%)
 Frame = -1

Query  2353  ETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGS  2174
             +++ K  L+SL C NGWSY  FWGF+Q+NSL LTL+D Y EE +G +IDDML+QV++LG 
Sbjct  3     DSIVKETLESLSCNNGWSYGAFWGFDQKNSLLLTLQDVYCEEHLGVVIDDMLVQVHMLGQ  62

Query  2173  GVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             GV+GQ AF+KNH+WM+SD++S   S  G   N D L   D S F+ QFS GIKTI VISV
Sbjct  63    GVIGQSAFSKNHRWMISDSHSGKLSPSGSLQNSDAL--QDYSAFHCQFSNGIKTIVVISV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSS--SANGDVFGLSGSLAS  1820
             EPLGVVQFGS QKL ER+EFV +T++LFQ  +I    A S     S   D +  SG  AS
Sbjct  121   EPLGVVQFGSTQKLAERLEFVTQTRELFQSIEILQGLALSEIEPLSLQNDAWEASGLFAS  180

Query  1819  SI-CNSSYFMSP  1787
              I C S + ++P
Sbjct  181   LISCQSPHSVTP  192



>ref|XP_011070367.1| PREDICTED: transcription factor LHW isoform X2 [Sesamum indicum]
Length=686

 Score =   243 bits (619),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 230/380 (61%), Gaps = 42/380 (11%)
 Frame = -1

Query  1417  GCKMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDN  1238
             GCK P   +    P   +G    F T +S C SE  +GS    SN LFSKLGLD LL D 
Sbjct  309   GCKKPLGWNEPLIPVV-NGNDLSFCTDVSSCISEKYVGSNIRSSNSLFSKLGLDQLL-DG  366

Query  1237  PssscsfvgsSCNDQLSSTKKRRIEHPLASEREV-------------------------T  1133
              SS  S   +        +K+R+I++   S  +V                         T
Sbjct  367   ISSGSSSSFAKSRFDGQYSKRRKIDNYSWSHDDVKTQGIPSFDGKMKLMDPVYGPSTSNT  426

Query  1132  KLETIVS------LIGENCST---NVMNTKDHEkpskavkkkakPGTRPIPKDRVRTYER  980
             +L T  S       I +N +T   N +++K  ++PSK  KKKAKPGTRP PKDR    +R
Sbjct  427   ELNTEASKKIPGACISDNRTTSAGNTISSKGQDEPSKTGKKKAKPGTRPRPKDRQMIQDR  486

Query  979   LAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSN  800
             LAELRELIPNG KMSIDRLL +TI+ L F+QS+T+ AE LK+ ++LK  +  K   S+ +
Sbjct  487   LAELRELIPNGEKMSIDRLLERTIRHLNFMQSLTKHAESLKQIDKLKSGEAPKKHASD-D  545

Query  799   TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGT  620
               G TWA  +E+QTM CPL+VEDL TPGQMLIEILC+EQGFFLEI+D+IRGFGL ILKG 
Sbjct  546   GGGATWA--VEDQTMFCPLMVEDLRTPGQMLIEILCEEQGFFLEIIDVIRGFGLTILKGV  603

Query  619   MELRETKIWAHFIVEPEANAF-VSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPS  443
             ME+RET IW +FIVE +     V+RHE+FSSL+QLLQ++G    HA D + N      P 
Sbjct  604   MEVRETNIWGNFIVESDKGTRPVTRHEIFSSLIQLLQMTGQDATHASDGIANTIGTAVP-  662

Query  442   TSSNCSESAVPFPISLPEGL  383
               +NC + AVPFP++L + L
Sbjct  663   LFNNC-QQAVPFPVNLADTL  681



>ref|XP_011070366.1| PREDICTED: transcription factor LHW isoform X1 [Sesamum indicum]
Length=840

 Score =   243 bits (621),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 230/380 (61%), Gaps = 42/380 (11%)
 Frame = -1

Query  1417  GCKMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDN  1238
             GCK P   +    P   +G    F T +S C SE  +GS    SN LFSKLGLD LL D 
Sbjct  463   GCKKPLGWNEPLIPVV-NGNDLSFCTDVSSCISEKYVGSNIRSSNSLFSKLGLDQLL-DG  520

Query  1237  PssscsfvgsSCNDQLSSTKKRRIEHPLASEREV-------------------------T  1133
              SS  S   +        +K+R+I++   S  +V                         T
Sbjct  521   ISSGSSSSFAKSRFDGQYSKRRKIDNYSWSHDDVKTQGIPSFDGKMKLMDPVYGPSTSNT  580

Query  1132  KLETIVS------LIGENCST---NVMNTKDHEkpskavkkkakPGTRPIPKDRVRTYER  980
             +L T  S       I +N +T   N +++K  ++PSK  KKKAKPGTRP PKDR    +R
Sbjct  581   ELNTEASKKIPGACISDNRTTSAGNTISSKGQDEPSKTGKKKAKPGTRPRPKDRQMIQDR  640

Query  979   LAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSN  800
             LAELRELIPNG KMSIDRLL +TI+ L F+QS+T+ AE LK+ ++LK  +  K   S+ +
Sbjct  641   LAELRELIPNGEKMSIDRLLERTIRHLNFMQSLTKHAESLKQIDKLKSGEAPKKHASD-D  699

Query  799   TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGT  620
               G TWA  +E+QTM CPL+VEDL TPGQMLIEILC+EQGFFLEI+D+IRGFGL ILKG 
Sbjct  700   GGGATWA--VEDQTMFCPLMVEDLRTPGQMLIEILCEEQGFFLEIIDVIRGFGLTILKGV  757

Query  619   MELRETKIWAHFIVEPEANAF-VSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPS  443
             ME+RET IW +FIVE +     V+RHE+FSSL+QLLQ++G    HA D + N      P 
Sbjct  758   MEVRETNIWGNFIVESDKGTRPVTRHEIFSSLIQLLQMTGQDATHASDGIANTIGTAVP-  816

Query  442   TSSNCSESAVPFPISLPEGL  383
               +NC + AVPFP++L + L
Sbjct  817   LFNNC-QQAVPFPVNLADTL  835


 Score =   194 bits (494),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M   K +++ K  L+SLCC NGW Y +FWGF+Q+NSL LTL+D YYEE+MG LID MLLQ
Sbjct  1     MCTEKRDSMIKETLRSLCCSNGWCYGIFWGFDQRNSLLLTLKDDYYEEQMGALIDSMLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             V++ G GV+GQ AFTK H WM SD     Q+  G  ++  E+LQ DDSEFY QFS GIKT
Sbjct  61    VHVFGGGVIGQAAFTKKHHWMYSDAYQERQNSLGSFESL-EVLQ-DDSEFYCQFSVGIKT  118

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDI--ETIFAQSSSSS  1862
             IA+ISVEP GVVQ GS QK+PE  +F+D+ K+LF+  D   E  F ++ ++S
Sbjct  119   IALISVEPWGVVQLGSTQKIPETKDFIDQVKELFREMDTRQEIKFCENGTAS  170



>emb|CBI34563.3| unnamed protein product [Vitis vinifera]
Length=868

 Score =   225 bits (573),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 162/378 (43%), Positives = 215/378 (57%), Gaps = 29/378 (8%)
 Frame = -1

Query  1441  FDEVLDGFGCKMPEKS-DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKL  1265
             FD +   FG ++  +S ++   P    GQ     T +S C SE  +GS   P   LFS+L
Sbjct  494   FDGLGLDFGFELAGESWEDFIMPLFNDGQS-TLSTGVSECISELDVGSMAVPRKGLFSEL  552

Query  1264  GLDHLLSDNPssscsfvgsSCNDQLSSTKKRRI---------EHPLASEREVTKLETIVS  1112
             GLD LL D   +S S   S+  DQ SSTK+RR+          + L  ++EV     +  
Sbjct  553   GLDQLLDDIVGNSSSVTKSNSEDQFSSTKRRRLGSSSVNSNQTNSLVPKKEVIPKSQVGL  612

Query  1111  LIGENCSTNVMNTKDHE-------kpskavkkkakPGTRPIPKDRVRTYERLAELRELIP  953
              I ++ S N   +   +         +   + K    TRP PKDR +  +RL ELR +IP
Sbjct  613   WIDDSYSINAGGSVAAQPKRPVEPAKATKKRAKPGESTRPRPKDRQQIKDRLEELRGIIP  672

Query  952   NGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--------DKKGRKDSNSNSNT  797
             NG K SID LL ++IK +LFLQSVT+ A+ LK+ +E K          K      S ++ 
Sbjct  673   NGSKCSIDVLLDRSIKHMLFLQSVTKYADKLKQVDEPKLIGHENGVVLKDNSSGGSGNSG  732

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
              G TWA E+  QTM+CP+ VEDL  PGQMLIE+LC+EQGFFLEI DIIR FGLNILKG M
Sbjct  733   GGATWAFEVSGQTMVCPIRVEDLNPPGQMLIEMLCEEQGFFLEIADIIRSFGLNILKGVM  792

Query  616   ELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTS  437
             E+RE KIWA FIV  EAN  V+R ++F SL+QLLQ +  + +   +Q  NV D+G P   
Sbjct  793   EVRENKIWARFIV--EANRHVTRMDIFLSLVQLLQETATTGVSPTNQPSNVIDSGVPPF-  849

Query  436   SNCSESAVPFPISLPEGL  383
             +N  + + P PISL E L
Sbjct  850   NNYQQPSGPLPISLAETL  867


 Score =   189 bits (479),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 141/388 (36%), Positives = 202/388 (52%), Gaps = 51/388 (13%)
 Frame = -1

Query  2359  KSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNIL  2180
             K E+V K  LKSLCC NGW+Y VFW F+++NS+ LT  DAYY+E+MG +ID ML +V+ L
Sbjct  6     KMESVLKKTLKSLCCSNGWTYGVFWRFDERNSMLLTSEDAYYDEQMGVVIDSMLSKVHTL  65

Query  2179  GSGVVGQVAFTKNHKWMLSDTNS-VWQSHHGLADNCDELLQDDDSEFYGQFSCG-IKTIA  2006
               G++GQVAFT  H W+ SD  S  W S   L     E +  DDSE + QFS G IKTIA
Sbjct  66    REGIIGQVAFTGKHCWVFSDAQSGEWNS---LCSIDGEDISQDDSEIHRQFSSGIIKTIA  122

Query  2005  VISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD-IETIFAQSSSSSA-NGDVFGLSG  1832
             VI VEP GVVQFGSNQK+ ER+EF+D TK+LF+  + I+ +   S++ SA N +++  SG
Sbjct  123   VIPVEPRGVVQFGSNQKIVERLEFLDLTKRLFREMENIDGLMVLSNAPSALNSEIYDPSG  182

Query  1831  -------------------------------SLASSICNSSYF---MSPEALPSP-DFVD  1757
                                            S ++++  SS F   M  E + S      
Sbjct  183   FFSSLISSGSSNLGNIKSEHGNGHKELIEKASASTNLTQSSSFTPEMQHERITSMISSTS  242

Query  1756  PIMNMVQSFPVEAFSLFDD----QFQNGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQ  1589
              + N +Q+  +EA  +  D    Q Q   +++ ++ ++   +  C S W  EGS+LTSL+
Sbjct  243   HLRNQLQTAGLEAQFMLSDQPNSQIQQMFLQSASSVNNPAARTPCISTWSSEGSTLTSLE  302

Query  1588  GNILPGAISQDCDNAFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDEVLDGFGCK  1409
               +     +Q   NA    P+      N VQ+     + TS  E  +   DE  D F C+
Sbjct  303   RQLSSEMRAQVSQNAVPGKPNTVALWGNLVQDSQVDSMFTSL-ESTERLIDEEKD-FQCR  360

Query  1408  MPEKSDNIRKPA---ATSGQQWDFGTSI  1334
             + +  +N        AT G+  +  TSI
Sbjct  361   LGKSVNNQYAAPFIHATEGELLEQSTSI  388



>gb|EYU33490.1| hypothetical protein MIMGU_mgv1a002692mg [Erythranthe guttata]
Length=646

 Score =   221 bits (562),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 155/328 (47%), Positives = 208/328 (63%), Gaps = 40/328 (12%)
 Frame = -1

Query  1309  IGSKDWPSNRLFSKLGLDHLL----SDNPssscsfvgsSCNDQLSSTKKRRIEHPLASER  1142
             +G K+ PSN LF+K+GLD +L    SDN     S          S  K+R+I++ +  E 
Sbjct  335   VGPKNRPSNSLFTKIGLDRILDGIASDNRYEDRSSYS-------SIAKRRKIDNGVKIEG  387

Query  1141  EVTKLETIVSLIGE-NCSTN-----------VMNTKDHEkpskavkkkakPGTRPIPKDR  998
              V   +  +S I E NC  +             +++  ++ +K  KKKAK G++P PKDR
Sbjct  388   VVHSFDGRMSSIEEVNCEGSRNSNSCTDAGPTSSSRKLDEQAKPSKKKAKAGSKPRPKDR  447

Query  997   VRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKD  818
                 +RLAELRELIPNG KMSIDRLL +TIK + F+QS+ R    LK+ ++ K K+    
Sbjct  448   QMIQDRLAELRELIPNGEKMSIDRLLERTIKHMNFMQSLQRHTVSLKQLDKTKAKQ----  503

Query  817   SNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGL  638
                   +N VTWACE+ +QTM+CPL+VEDL TPGQMLIE+LC+EQGFFLEIVD+IRGFGL
Sbjct  504   ------SNEVTWACEVGDQTMVCPLIVEDLTTPGQMLIEMLCEEQGFFLEIVDVIRGFGL  557

Query  637   NILKGTMELRET-KIWAHFIVEPEANAFVSRHElfssllqllqlSGPSEL--HARDQLGN  467
              +LKG ME+RET KIWAHF+VE E N  V+RHE+FSSL+QLLQ+SG +     + D   N
Sbjct  558   IVLKGVMEVRETNKIWAHFMVEAEGNRLVTRHEIFSSLIQLLQMSGQTSATNTSSDGFSN  617

Query  466   VRDNGRPSTSSNCSESAVPFPISLPEGL  383
             V  +  PS S+N   S   FP++  + +
Sbjct  618   VISSAMPS-SNNYQPS---FPVNFADAI  641


 Score =   102 bits (254),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 89/158 (56%), Gaps = 36/158 (23%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             MS  K +++ K  LK LCC NGW Y +FWGF+Q NSL LT++D YYEE+M  LID++LLQ
Sbjct  1     MSAEKCDSIIKEALKILCCSNGWCYGIFWGFHQTNSLLLTVKDTYYEEQMALLIDNLLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
             V+++G GV+GQVAF KNH+W+ SD                          Y Q       
Sbjct  61    VHVVGGGVIGQVAFAKNHQWIHSDA-------------------------YNQ-----SL  90

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD  1898
              +++S E L  +Q       PE  EFV + K++F GTD
Sbjct  91    NSLVSFESLEFLQN------PETKEFVSQVKRVFGGTD  122



>ref|XP_008239218.1| PREDICTED: transcription factor bHLH157 [Prunus mume]
Length=796

 Score =   222 bits (566),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 163/427 (38%), Positives = 236/427 (55%), Gaps = 55/427 (13%)
 Frame = -1

Query  1522  FEYCTNTVQNVLERPVMTSTHE---LGQSAFDEVLDG----FGC-KMPEKSDNIRKPAAT  1367
              E+  N++ + +  P     HE   + Q+A + + DG    FGC ++ E  ++I  PA  
Sbjct  373   IEHPDNSMHSSITNPFNAGGHENSVIIQNAENVLFDGLGPDFGCGQVGECWEDIMVPAV-  431

Query  1366  SGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLS  1187
             SG     GT+++ C SE  +GS   P   LFS+LGL+ LL+   ++S S   SS  D  S
Sbjct  432   SGGYLTAGTALTKCFSEPEVGSMTAPRKGLFSELGLEELLNGISTTSSSVFKSSLEDLSS  491

Query  1186  STKKRRIE---------------------HPLASEREVTKLETIV---------------  1115
             +T+KR+ E                     H +     + K  ++V               
Sbjct  492   TTRKRKSECSSVNSNQVQFARLAGSSGSMHSMEPLYNLDKTNSLVPKKDFFPKSQVGLWI  551

Query  1114  ----SLIGENCSTNVMNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNG  947
                 S+  ++ + +     +    +   + +    TRP PKDR +  +R+ ELR +IP+G
Sbjct  552   DDSYSVNAKSAAQDKQQQAEEYTKTTRKRARPGESTRPRPKDRQQIQDRMKELRGIIPSG  611

Query  946   GKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKGRKDSNSNSNTNGVTWAC  776
             GK SID LL +TIK +LFLQSVT+ A+ LK+  E K    + G    ++N+ + G TWA 
Sbjct  612   GKCSIDSLLDRTIKYMLFLQSVTKYADKLKQAHEPKLIGKENGVVLKDNNNRSAGNTWAL  671

Query  775   EIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKI  596
              +E QT++CP++VEDL  PGQMLIE+LC+EQGFFLEI DIIRGFGLNILKG ME RE KI
Sbjct  672   AVEGQTVVCPIIVEDLSPPGQMLIEMLCEEQGFFLEIADIIRGFGLNILKGVMESREDKI  731

Query  595   WAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESA  416
             WA FIV  EAN  V+R ++F SLL+LLQ +  + +   +   N+ D+G P   S C + +
Sbjct  732   WARFIV--EANRHVTRIDVFWSLLRLLQQTTNNVVDPTNLPTNIVDSGVPMLDS-CQQQS  788

Query  415   VPFPISL  395
             +P PISL
Sbjct  789   LPPPISL  795


 Score =   175 bits (444),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 125/199 (63%), Gaps = 27/199 (14%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M +    +V +  L+SLC  NGWSY VFW F+Q+NS+ LT+ DAYYEE MG ++D ML Q
Sbjct  1     MGEAGKSSVIRETLESLCVSNGWSYGVFWRFDQRNSMLLTMGDAYYEEHMGAVMDSMLSQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNS-VWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             V++LG G++GQ AFT  H+WM SD +S  W S + L     ++ Q DDSEF  QFS GIK
Sbjct  61    VHMLGEGIIGQTAFTGKHRWMHSDASSGEWNSCNSL--ESQDMFQ-DDSEFRCQFSSGIK  117

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF--------------------QGT-D  1898
             TIA ISVEP GV+QFGS +K+ ER E +DETK+LF                     GT D
Sbjct  118   TIATISVEPRGVIQFGSTKKIMERSEVLDETKRLFWEMENLDGLIPLENVPSCLNNGTND  177

Query  1897  IETIFAQ--SSSSSANGDV  1847
             +  +FA   SS +S NGDV
Sbjct  178   LNELFASLISSGNSYNGDV  196



>ref|XP_002299440.2| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
 gb|EEE84245.2| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
Length=819

 Score =   222 bits (566),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 150/373 (40%), Positives = 213/373 (57%), Gaps = 42/373 (11%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfv  1214
             +++  P A SGQ     T +S C SE  +GSK  P   LFS+LGL+ LL D+ S+S    
Sbjct  452   EDMMMPVARSGQ-ITASTGVSECISELDVGSKVGPQKGLFSELGLEELL-DSVSNSSYVT  509

Query  1213  gsSCNDQLSSTKKRRIEHPLAS--------------------------------EREVTK  1130
               S +DQLS+ K+RR+E+ L S                                ++EV  
Sbjct  510   KYSIDDQLSNAKRRRVENSLVSSDKLQLVNASYPTSSRMMQPAYNLDKTKNLPSKQEVFP  569

Query  1129  LETIVSLIGENCSTNV----MNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRE  962
                +   I ++ S N     +   +        + +    TRP PKDR +  +R+ EL++
Sbjct  570   KSQVSLWIDDSYSVNTGSSGLPKPEELAKPTKKRARPGESTRPRPKDRQQIQDRIKELKQ  629

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTW  782
             +IP+G K SID LL +TIK +LFLQSVT+ AE LK+ +E K+ +     N+ S + G TW
Sbjct  630   IIPDGAKCSIDALLDRTIKHMLFLQSVTKYAERLKQADEPKENRLLLKDNTTS-SGGATW  688

Query  781   ACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRET  602
             A E+ +Q+M+CP++VEDL  PG MLIE+LC+++GFFLE  D+I+GFGLNILKG ME RE 
Sbjct  689   ALEVADQSMVCPIIVEDLSQPGLMLIEMLCEDRGFFLETADVIKGFGLNILKGLMESREN  748

Query  601   KIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSE  422
             KIWA FIV  EAN  ++R E+F  LLQLL+ +G S + +  Q  N   +GR    S+   
Sbjct  749   KIWARFIV--EANVHITRVEVFWYLLQLLERTGTSVMDSTKQPSNSM-HGRIPELSSYQL  805

Query  421   SAVPFPISLPEGL  383
              A+P P+SL E +
Sbjct  806   PALPCPVSLTETI  818


 Score =   168 bits (425),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 4/148 (3%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V K  LKSLCC NGWSY VFW F+Q NS+ LT+ DAYYEEEMG +++ ML + +ILG G
Sbjct  4     SVLKQKLKSLCCSNGWSYGVFWCFDQINSMLLTMEDAYYEEEMGAVVNSMLSEAHILGEG  63

Query  2170  VVGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             +VGQ A T  H+W+ SD ++  W S   +     ++ Q DDSE + QFS GIKTIA+ISV
Sbjct  64    IVGQAASTGKHQWIFSDASDGGWDSAASIGGQ--DIFQ-DDSEIHRQFSSGIKTIAIISV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E  GVVQFGS  K+ ER EF+D+TK+LF
Sbjct  121   ESHGVVQFGSTLKILERDEFLDQTKRLF  148



>ref|XP_006368796.1| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
 gb|ERP65365.1| hypothetical protein POPTR_0001s11170g [Populus trichocarpa]
Length=823

 Score =   218 bits (555),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 151/378 (40%), Positives = 215/378 (57%), Gaps = 48/378 (13%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfv  1214
             +++  P A SGQ     T +S C SE  +GSK  P   LFS+LGL+ LL D+ S+S    
Sbjct  452   EDMMMPVARSGQ-ITASTGVSECISELDVGSKVGPQKGLFSELGLEELL-DSVSNSSYVT  509

Query  1213  gsSCNDQLSSTKKRRIEHPLAS--------------------------------EREVTK  1130
               S +DQLS+ K+RR+E+ L S                                ++EV  
Sbjct  510   KYSIDDQLSNAKRRRVENSLVSSDKLQLVNASYPTSSRMMQPAYNLDKTKNLPSKQEVFP  569

Query  1129  LETIVSLIGENCSTNV----MNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRE  962
                +   I ++ S N     +   +        + +    TRP PKDR +  +R+ EL++
Sbjct  570   KSQVSLWIDDSYSVNTGSSGLPKPEELAKPTKKRARPGESTRPRPKDRQQIQDRIKELKQ  629

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK-----DKKGRKDSNSNSNT  797
             +IP+G K SID LL +TIK +LFLQSVT+ AE LK+ +E K     ++   KD+ ++S  
Sbjct  630   IIPDGAKCSIDALLDRTIKHMLFLQSVTKYAERLKQADEPKLIGQENRLLLKDNTTSSG-  688

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
              G TWA E+ +Q+M+CP++VEDL  PG MLIE+LC+++GFFLE  D+I+GFGLNILKG M
Sbjct  689   -GATWALEVADQSMVCPIIVEDLSQPGLMLIEMLCEDRGFFLETADVIKGFGLNILKGLM  747

Query  616   ELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTS  437
             E RE KIWA FIV  EAN  ++R E+F  LLQLL+ +G S + +  Q  N   +GR    
Sbjct  748   ESRENKIWARFIV--EANVHITRVEVFWYLLQLLERTGTSVMDSTKQPSNSM-HGRIPEL  804

Query  436   SNCSESAVPFPISLPEGL  383
             S+    A+P P+SL E +
Sbjct  805   SSYQLPALPCPVSLTETI  822


 Score =   168 bits (425),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 106/148 (72%), Gaps = 4/148 (3%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V K  LKSLCC NGWSY VFW F+Q NS+ LT+ DAYYEEEMG +++ ML + +ILG G
Sbjct  4     SVLKQKLKSLCCSNGWSYGVFWCFDQINSMLLTMEDAYYEEEMGAVVNSMLSEAHILGEG  63

Query  2170  VVGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             +VGQ A T  H+W+ SD ++  W S   +     ++ Q DDSE + QFS GIKTIA+ISV
Sbjct  64    IVGQAASTGKHQWIFSDASDGGWDSAASIGGQ--DIFQ-DDSEIHRQFSSGIKTIAIISV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E  GVVQFGS  K+ ER EF+D+TK+LF
Sbjct  121   ESHGVVQFGSTLKILERDEFLDQTKRLF  148



>ref|XP_011026816.1| PREDICTED: transcription factor LHW [Populus euphratica]
Length=823

 Score =   217 bits (552),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 150/378 (40%), Positives = 215/378 (57%), Gaps = 48/378 (13%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfv  1214
             +++  P A SGQ     T +S C +E  +GSK  P   LFS+LGL+ LL D+ S+S    
Sbjct  452   EDMMMPVARSGQ-ITASTGVSECIAELDVGSKVGPQKGLFSELGLEELL-DSVSNSSYVT  509

Query  1213  gsSCNDQLSSTKKRRIEHPLA--------------------------------SEREVTK  1130
               S +DQLS+ K+RR+E+ L                                 S++EV  
Sbjct  510   KYSIDDQLSNAKRRRVENSLVISDKLQLVNVSYPTSSRMMQPAYNLDKTKDLPSKQEVFP  569

Query  1129  LETIVSLIGENCSTNV----MNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRE  962
                +   I ++ S N     +   +        + +    TRP PKDR +  +R+ EL++
Sbjct  570   KSQVSLWIDDSYSVNTGSSGLPKPEELAKPTKKRARPGESTRPRPKDRQQIQDRIKELKQ  629

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK-----DKKGRKDSNSNSNT  797
             +IP+G K SID LL +TIK +LFLQSVT+ AE LK+ +E K     ++   KD+ ++S  
Sbjct  630   IIPDGAKCSIDALLDRTIKHMLFLQSVTKYAERLKQADEPKLIGQENRLLLKDNTTSSG-  688

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
              G TWA E+ +Q+M+CP++VEDL  PG MLIE+LC+++GFFLE  D+I+GFGLNILKG M
Sbjct  689   -GATWALEVADQSMVCPIIVEDLSQPGLMLIEMLCEDRGFFLETADVIKGFGLNILKGLM  747

Query  616   ELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTS  437
             E RE KIWA FIV  EAN  ++R E+F  LLQLL+ +G S + +  Q  N   +GR    
Sbjct  748   ESRENKIWARFIV--EANVHITRVEVFWYLLQLLERTGTSVMDSTKQPSNSL-HGRIPEL  804

Query  436   SNCSESAVPFPISLPEGL  383
             S+    A+P P+SL E +
Sbjct  805   SSYQLPALPCPVSLTETI  822


 Score =   167 bits (422),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 106/148 (72%), Gaps = 4/148 (3%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V K  LKSLCC +GWSY VFW F+Q NS+ LT+ DAYYEEEMG +++ ML + +ILG G
Sbjct  4     SVLKQKLKSLCCSHGWSYGVFWCFDQINSMLLTMEDAYYEEEMGAVVNRMLSEAHILGEG  63

Query  2170  VVGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             +VGQ A T  H+W+ SD ++  W S   + D   ++ Q DDSE + QFS GIKTIAVISV
Sbjct  64    IVGQAASTGKHQWIFSDASDGGWDSAASIGDQ--DIFQ-DDSEIHRQFSSGIKTIAVISV  120

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E  GVVQFGS  K+ ER EF+D+TK LF
Sbjct  121   ESQGVVQFGSTLKILERDEFLDQTKILF  148



>ref|XP_008806930.1| PREDICTED: uncharacterized protein LOC103719457 isoform X2 [Phoenix 
dactylifera]
Length=903

 Score =   216 bits (550),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 157/365 (43%), Positives = 220/365 (60%), Gaps = 35/365 (10%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLL-----------  1247
             D+I  P   SG   +   ++S C SE  +GS       LFS  GL+ LL           
Sbjct  547   DDIIMPVG-SGSCSNLSANVSECISELDMGSTAGAEKGLFSDSGLEQLLDAIVGESGNKA  605

Query  1246  SDNPssscsfvgsSCNDQL----SSTKKRRIEHPLASEREVTKLETIVSLIGENCSTN--  1085
             S + S++ +    +C D      +ST+  +I H   S +E      + S I ++CS N  
Sbjct  606   STHNSAAINVDPIACLDSKHKFSTSTRVEKIMH--GSPKEPLSKSRVSSWIDDSCSMNAG  663

Query  1084  ---VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLL  920
                +   K  E+  K VKK+A+PG  TRP PKDR +  +R+ ELRE++PNG K SID LL
Sbjct  664   SAMINQPKKPEEAVKVVKKRARPGESTRPRPKDRQQIQDRVKELREIVPNGAKCSIDALL  723

Query  919   HQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSNTNGVTWACEIENQTM  755
              +TIK +LFLQSVT+ A+ +K+ +E K   ++ G   KD+++  ++ G TWA E+  QTM
Sbjct  724   DRTIKHMLFLQSVTKYADKIKQADEPKMIGEESGVVLKDNSNGGSSGGATWAYEVAGQTM  783

Query  754   ICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             +CP++VEDL  PGQML+E+LC+E+GFFLEI DIIRGFGL ILKG ME+ ++KIWA F+V 
Sbjct  784   VCPIIVEDLTPPGQMLVEMLCEERGFFLEIADIIRGFGLTILKGVMEIHDSKIWARFLV-  842

Query  574   PEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISL  395
              EAN  V+R ++F SL+QLLQ +  S   + DQ   V D G P T +N  +S V  PISL
Sbjct  843   -EANRGVTRMDIFLSLVQLLQQT--SSARSSDQPAKVIDKGAP-TFTNYQQSPVSIPISL  898

Query  394   PEGLY  380
              + L+
Sbjct  899   EDRLH  903


 Score =   116 bits (291),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             + +L  LC G  WSY V W  ++ +   L + D Y+EE + G++D +L QV+++G G++G
Sbjct  8     RGVLGGLCTGGVWSYGVLWRVDRCDPRLLMVEDCYFEERVQGVLDKILNQVHMVGEGIIG  67

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
                 +  H+W+ SD   +  S     DN D      ++E+  QF+ GIKTI +IS+  LG
Sbjct  68    GAVISGKHQWIYSDIYGIDLSPTNSTDNPDVF--QSNAEWQHQFTAGIKTIVIISLPSLG  125

Query  1981  VVQFGSNQKLPERMEFVDETK  1919
             V QFGS +K+PE +EFV++ K
Sbjct  126   VAQFGSPEKIPENLEFVNQVK  146



>ref|XP_010659858.1| PREDICTED: transcription factor LHW [Vitis vinifera]
 emb|CAN74602.1| hypothetical protein VITISV_028112 [Vitis vinifera]
Length=893

 Score =   216 bits (549),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 162/403 (40%), Positives = 215/403 (53%), Gaps = 54/403 (13%)
 Frame = -1

Query  1441  FDEVLDGFGCKMPEKS-DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKL  1265
             FD +   FG ++  +S ++   P    GQ     T +S C SE  +GS   P   LFS+L
Sbjct  494   FDGLGLDFGFELAGESWEDFIMPLFNDGQS-TLSTGVSECISELDVGSMAVPRKGLFSEL  552

Query  1264  GLDHLLSDNPssscsfvgsSCNDQLSSTKKRRI---------------------------  1166
             GLD LL D   +S S   S+  DQ SSTK+RR+                           
Sbjct  553   GLDQLLDDIVGNSSSVTKSNSEDQFSSTKRRRLGSSSVNSNQVQSAGLSSCFSGSMNVMQ  612

Query  1165  -------EHPLASEREVTKLETIVSLIGENCSTNVMNTKDHE-------kpskavkkkak  1028
                     + L  ++EV     +   I ++ S N   +   +         +   + K  
Sbjct  613   PVYNLDKTNSLVPKKEVIPKSQVGLWIDDSYSINAGGSVAAQPKRPVEPAKATKKRAKPG  672

Query  1027  PGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTE  848
               TRP PKDR +  +RL ELR +IPNG K SID LL ++IK +LFLQSVT+ A+ LK+ +
Sbjct  673   ESTRPRPKDRQQIKDRLEELRGIIPNGSKCSIDVLLDRSIKHMLFLQSVTKYADKLKQVD  732

Query  847   ELK--------DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILC  692
             E K          K      S ++  G TWA E+  QTM+CP+ VEDL  PGQMLIE+LC
Sbjct  733   EPKLIGHENGVVLKDNSSGGSGNSGGGATWAFEVSGQTMVCPIRVEDLNPPGQMLIEMLC  792

Query  691   QEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllq  512
             +EQGFFLEI DIIR FGLNILKG ME+RE KIWA FIV  EAN  V+R ++F SL+QLLQ
Sbjct  793   EEQGFFLEIADIIRSFGLNILKGVMEVRENKIWARFIV--EANRHVTRMDIFLSLVQLLQ  850

Query  511   lSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
              +  + +   +Q  NV D+G P   +N  + + P PISL E L
Sbjct  851   ETATTGVSPTNQPSNVIDSGVPPF-NNYQQPSGPLPISLAETL  892


 Score =   189 bits (479),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 141/388 (36%), Positives = 202/388 (52%), Gaps = 51/388 (13%)
 Frame = -1

Query  2359  KSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNIL  2180
             K E+V K  LKSLCC NGW+Y VFW F+++NS+ LT  DAYY+E+MG +ID ML +V+ L
Sbjct  6     KMESVLKKTLKSLCCSNGWTYGVFWRFDERNSMLLTSEDAYYDEQMGVVIDSMLSKVHTL  65

Query  2179  GSGVVGQVAFTKNHKWMLSDTNS-VWQSHHGLADNCDELLQDDDSEFYGQFSCG-IKTIA  2006
               G++GQVAFT  H W+ SD  S  W S   L     E +  DDSE + QFS G IKTIA
Sbjct  66    REGIIGQVAFTGKHCWVFSDAQSGEWNS---LCSIDGEDISQDDSEIHRQFSSGIIKTIA  122

Query  2005  VISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD-IETIFAQSSSSSA-NGDVFGLSG  1832
             VI VEP GVVQFGSNQK+ ER+EF+D TK+LF+  + I+ +   S++ SA N +++  SG
Sbjct  123   VIPVEPRGVVQFGSNQKIVERLEFLDLTKRLFREMENIDGLMVLSNAPSALNSEIYDPSG  182

Query  1831  -------------------------------SLASSICNSSYF---MSPEALPSP-DFVD  1757
                                            S ++++  SS F   M  E + S      
Sbjct  183   FFSSLISSGSSNLGNIKSEHGNGHKELIEKASASTNLTQSSSFTPEMQHERITSMISSTS  242

Query  1756  PIMNMVQSFPVEAFSLFDD----QFQNGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQ  1589
              + N +Q+  +EA  +  D    Q Q   +++ ++ ++   +  C S W  EGS+LTSL+
Sbjct  243   HLRNQLQTAGLEAQFMLSDQPNSQIQQMFLQSASSVNNPAARTPCISTWSSEGSTLTSLE  302

Query  1588  GNILPGAISQDCDNAFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDEVLDGFGCK  1409
               +     +Q   NA    P+      N VQ+     + TS  E  +   DE  D F C+
Sbjct  303   RQLSSEMRAQVSQNAVPGKPNTVALWGNLVQDSQVDSMFTSL-ESTERLIDEEKD-FQCR  360

Query  1408  MPEKSDNIRKPA---ATSGQQWDFGTSI  1334
             + +  +N        AT G+  +  TSI
Sbjct  361   LGKSVNNQYAAPFIHATEGELLEQSTSI  388



>ref|XP_002303679.1| hypothetical protein POPTR_0003s14480g [Populus trichocarpa]
 gb|EEE78658.1| hypothetical protein POPTR_0003s14480g [Populus trichocarpa]
Length=831

 Score =   207 bits (526),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 160/388 (41%), Positives = 228/388 (59%), Gaps = 61/388 (16%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfv  1214
             ++I  P A+SG      T IS C SE  + SK  P   LFS+L LD + + N        
Sbjct  453   EDIMVPVASSGHT-TASTGISECISELDVDSKVGPRKGLFSEL-LDSVSNSN-----YVT  505

Query  1213  gsSCNDQLSSTKKRRIEHP--------------------------------LASEREVTK  1130
              SS +DQLS+ K+RR+E+                                 L S++E+  
Sbjct  506   KSSSDDQLSNAKRRRVENSSVNGNQLQLVNASCPTSSRVMQPAYNFDKTKNLLSKQEMFP  565

Query  1129  LETIVSLIGENCSTN-----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAE  971
                 V  I ++ S N     +  +K  E+P+KA KK+A+PG  TRP PKDR +  +R+ E
Sbjct  566   KAQTVLWIDDSYSVNTGSSGLTKSKKPEEPAKANKKRARPGESTRPRPKDRQQIQDRIKE  625

Query  970   LRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK-----DKKGRKDSNSN  806
             L+++IP+G K SID LL +TIK +LFLQSVT+ AE LK+ +E K     ++   KD++++
Sbjct  626   LKQIIPDGAKCSIDALLDRTIKHMLFLQSVTKYAEKLKQADEPKLIGQHNRLLPKDNSTS  685

Query  805   SNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILK  626
             S   G TWA E+ +Q+M+CP++VEDL  PG MLIE+LC+++GFFLEI D+I+GFGLNILK
Sbjct  686   SG--GATWALEVADQSMVCPIIVEDLSQPGLMLIEMLCEDRGFFLEIADVIKGFGLNILK  743

Query  625   GTMELRETKIWAHFIVEP-------EANAFVSRHElfssllqllqlSGPSELHARDQLGN  467
             G ME RE KIWA FIVE        +AN  ++R E+F SLLQLL+ +G S + + +Q  N
Sbjct  744   GLMESREDKIWARFIVEVAHQNLDFKANMQITRVEVFWSLLQLLERTGASVMDSTNQPSN  803

Query  466   VRDNGRPSTSSNCSESAVPFPISLPEGL  383
             V  +GR    ++    A+P P+SL E +
Sbjct  804   VM-HGRIPELNSYQLPALPCPVSLTETI  830


 Score =   169 bits (427),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 111/303 (37%), Positives = 161/303 (53%), Gaps = 38/303 (13%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGV  2168
             V K  LKSLCC NGWSY VFW F+Q+NS+ LT+ DAYYEEEMG ++++ML +  +LG G+
Sbjct  4     VLKEKLKSLCCSNGWSYGVFWCFDQRNSMLLTMEDAYYEEEMGVVVNNMLSEARMLGEGI  63

Query  2167  VGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             VGQ A T  H+W+ SD ++  W S   +     ++ Q DDSE + QFS GIKTIAVISVE
Sbjct  64    VGQAASTGKHQWIFSDASDGGWNSAASIGGQ--DIFQ-DDSEIHRQFSSGIKTIAVISVE  120

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLF-QGTDIETIFAQSSSSSA---------------  1859
               G+VQFGS QK+ E  EF+ +TK+LF +  +I  + + S S S+               
Sbjct  121   SQGLVQFGSTQKILESEEFLGQTKRLFGKMENINGLTSNSDSPSSLNCESYDLNEWFDSF  180

Query  1858  -NGDVFGLSGSLASSICNSSY----FMSPEALPSPDFVDPIMNMV--QSFPVEAFSLFDD  1700
              NG++  + G   + +   +Y    F  P A+ S    D ++ +    S P       + 
Sbjct  181   CNGNITPMLGDNCNELMEIAYSSMNFTQPSAITSVVEQDRMIPLCLDSSHPTNQLKTSEA  240

Query  1699  QF----------QNGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCD  1550
             Q           Q+   ++ +   +    P C+S W   GS+LTSL+  +    + QD  
Sbjct  241   QMILSCNPKTQSQHLSSQSPSMNKTTALTP-CTSTWSNAGSNLTSLESKLGYEMVVQDSP  299

Query  1549  NAF  1541
               F
Sbjct  300   TVF  302



>ref|XP_011022438.1| PREDICTED: uncharacterized protein LOC105124216 [Populus euphratica]
Length=819

 Score =   206 bits (524),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 159/381 (42%), Positives = 224/381 (59%), Gaps = 56/381 (15%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfv  1214
             ++I  P A+SG      T IS C SE  + SK  P   LFS+L LD + + N        
Sbjct  450   EDIMVPVASSGHT-TASTGISECISELDVDSKVGPRKGLFSEL-LDSVSNSN-----YVT  502

Query  1213  gsSCNDQLSSTKKRRIEHP--------------------------------LASEREVTK  1130
              SS +DQLS+ K+RR+E+                                 L S++E+  
Sbjct  503   KSSSDDQLSNAKRRRVENSSVNGNQLQLVNASCPTSSRVMQPAYNFDKTKNLLSKQEMFP  562

Query  1129  LETIVSLIGENCSTN-----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAE  971
                 V  I ++ S N     +  +K  E+P+KA KK+A+PG  TRP PKDR +  +R+ E
Sbjct  563   KAPTVLWIDDSYSVNTGSSGLTKSKKTEEPAKATKKRARPGESTRPRPKDRQQIQDRIKE  622

Query  970   LRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK-----DKKGRKDSNSN  806
             L+++IP+G K SID LL +TIK +LFLQSVT+ AE LK+ +E K     ++   KD++++
Sbjct  623   LKQIIPDGAKCSIDALLDRTIKHMLFLQSVTKYAEKLKQADEPKLIGQHNRLLPKDNSTS  682

Query  805   SNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILK  626
             S   G TWA E+ +Q+M+CP++VEDL  PG MLIE+LC+++GFFLEI D+I+GFGLNILK
Sbjct  683   SG--GATWALEVADQSMVCPIIVEDLSQPGLMLIEMLCEDRGFFLEIADVIKGFGLNILK  740

Query  625   GTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRP  446
             G ME RE KIWA FIV  EAN  ++R E+F SLLQLL+ +G S + + +Q  N      P
Sbjct  741   GLMESREDKIWARFIV--EANMQITRVEVFWSLLQLLERTGSSVMDSTNQPSNAMHGKIP  798

Query  445   STSSNCSESAVPFPISLPEGL  383
               +S    S +P P+SL E +
Sbjct  799   ELNSYQLPS-LPCPVSLTETI  818


 Score =   165 bits (417),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 111/299 (37%), Positives = 154/299 (52%), Gaps = 33/299 (11%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGV  2168
             V K  LKSLCC NGWSY VFW F+Q+NS+ LT+ DAYYEEEMG ++ +ML   ++LG G+
Sbjct  4     VLKEKLKSLCCSNGWSYGVFWCFDQRNSMLLTMEDAYYEEEMGVVVTNMLSDAHMLGEGI  63

Query  2167  VGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             VGQ A T  H+W+ SD ++  W S   +     +L Q DDSE + QFS GIKTIAVISVE
Sbjct  64    VGQAASTGKHQWIFSDASDGGWNSAASIGGQ--DLFQ-DDSEIHRQFSFGIKTIAVISVE  120

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLF-QGTDIETIFAQSSSSSA---------------  1859
               G+VQFGS QK+ E  EF+ +TK+LF +  +I  + + S S S+               
Sbjct  121   SQGLVQFGSTQKILESEEFLGQTKRLFGKMENINGLTSNSDSPSSLNCESYDLNEWFDSF  180

Query  1858  -NGDVFGLSGSLASSICNSSY----FMSPEALPS--------PDFVDPIMNMVQSFPVEA  1718
              NG++  + G   + +   +Y    F  P A+ +        P  +D      Q    EA
Sbjct  181   CNGNITPMLGDNCNELMEIAYSSMNFTQPSAITTVVEQDRMIPLCLDSSHPTNQMKTSEA  240

Query  1717  FSLFDDQFQNGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAF  1541
              S               + +       C+S W   GS+LTSL+  +    + QD    F
Sbjct  241   HSSNPKTQSQYSSPQSPSMNKTKALTPCTSTWSNTGSNLTSLESKLGYEMVVQDSPTVF  299



>ref|XP_010933832.1| PREDICTED: uncharacterized protein LOC105054104 isoform X1 [Elaeis 
guineensis]
Length=937

 Score =   207 bits (526),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 181/275 (66%), Gaps = 19/275 (7%)
 Frame = -1

Query  1171  RIEHPLASEREVTKLETIVSLIGENCSTNVMNT-----KDHEkpskavkkkakPG--TRP  1013
             +I H   S +E   +  + S I ++CS NV +      K  E+  K VKK+A+PG  TRP
Sbjct  669   KIMH--GSPKEALSVSHVSSWIDDSCSMNVGSAVINEPKKPEEAVKVVKKRARPGESTRP  726

Query  1012  IPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--  839
              PKDR +  +R+ ELRE++PN  K SID LL +TIK +LFLQSVT+ A+ LK+T+E K  
Sbjct  727   RPKDRQQIQDRVKELREIVPNCAKCSIDALLDRTIKHMLFLQSVTKYADKLKQTDEPKMI  786

Query  838   -DKKG--RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              ++ G   KD++S     G TWA E+  QTM+CP++VEDL  PGQML+E+LC+E GFFLE
Sbjct  787   VEESGVVLKDNSSGGTGAGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEEHGFFLE  846

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELH  488
             I DIIRGFGL ILKG ME+ ++KIWA F+V  EAN  V+R ++F SL+QLLQ +  S   
Sbjct  847   IADIIRGFGLTILKGVMEIHDSKIWARFLV--EANRDVTRMDIFLSLVQLLQQT--SSTR  902

Query  487   ARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             + DQL  + D G P T +N   S +  PISL + L
Sbjct  903   SSDQLAKIMDKGAP-TFANYQHSPMSIPISLADRL  936


 Score =   124 bits (311),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             + +L  LC G GW+Y V W  ++++   LT+ D YYEE++ G++D +L QV+++G G++G
Sbjct  8     REVLGRLCGGGGWAYGVLWRVDRRDPRLLTVEDCYYEEQVRGVLDKILHQVHMVGEGIIG  67

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
                  + H+W+ SD+  +  S     DN D  +   D+E+  QF+ GIKTIA+IS+   G
Sbjct  68    GAVINEKHQWVYSDSYGINLSPTSSTDNPD--IFQSDAEWQHQFTPGIKTIAIISLRSSG  125

Query  1981  VVQFGSNQKLPERMEFVDETK  1919
             VVQFGS +K+ E +EFV+E K
Sbjct  126   VVQFGSPEKILENLEFVNEVK  146



>ref|XP_010933833.1| PREDICTED: uncharacterized protein LOC105054104 isoform X2 [Elaeis 
guineensis]
Length=897

 Score =   206 bits (525),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 135/275 (49%), Positives = 181/275 (66%), Gaps = 19/275 (7%)
 Frame = -1

Query  1171  RIEHPLASEREVTKLETIVSLIGENCSTNVMNT-----KDHEkpskavkkkakPG--TRP  1013
             +I H   S +E   +  + S I ++CS NV +      K  E+  K VKK+A+PG  TRP
Sbjct  629   KIMH--GSPKEALSVSHVSSWIDDSCSMNVGSAVINEPKKPEEAVKVVKKRARPGESTRP  686

Query  1012  IPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--  839
              PKDR +  +R+ ELRE++PN  K SID LL +TIK +LFLQSVT+ A+ LK+T+E K  
Sbjct  687   RPKDRQQIQDRVKELREIVPNCAKCSIDALLDRTIKHMLFLQSVTKYADKLKQTDEPKMI  746

Query  838   -DKKG--RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              ++ G   KD++S     G TWA E+  QTM+CP++VEDL  PGQML+E+LC+E GFFLE
Sbjct  747   VEESGVVLKDNSSGGTGAGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEEHGFFLE  806

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELH  488
             I DIIRGFGL ILKG ME+ ++KIWA F+V  EAN  V+R ++F SL+QLLQ +  S   
Sbjct  807   IADIIRGFGLTILKGVMEIHDSKIWARFLV--EANRDVTRMDIFLSLVQLLQQT--SSTR  862

Query  487   ARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             + DQL  + D G P T +N   S +  PISL + L
Sbjct  863   SSDQLAKIMDKGAP-TFANYQHSPMSIPISLADRL  896


 Score =   124 bits (311),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 91/141 (65%), Gaps = 2/141 (1%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             + +L  LC G GW+Y V W  ++++   LT+ D YYEE++ G++D +L QV+++G G++G
Sbjct  8     REVLGRLCGGGGWAYGVLWRVDRRDPRLLTVEDCYYEEQVRGVLDKILHQVHMVGEGIIG  67

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
                  + H+W+ SD+  +  S     DN D  +   D+E+  QF+ GIKTIA+IS+   G
Sbjct  68    GAVINEKHQWVYSDSYGINLSPTSSTDNPD--IFQSDAEWQHQFTPGIKTIAIISLRSSG  125

Query  1981  VVQFGSNQKLPERMEFVDETK  1919
             VVQFGS +K+ E +EFV+E K
Sbjct  126   VVQFGSPEKILENLEFVNEVK  146



>ref|XP_008790524.1| PREDICTED: uncharacterized protein LOC103707709 isoform X2 [Phoenix 
dactylifera]
Length=904

 Score =   205 bits (522),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 153/346 (44%), Positives = 208/346 (60%), Gaps = 27/346 (8%)
 Frame = -1

Query  1351  DFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLS----DNPssscsfvgsSCNDQLSS  1184
             +   +IS C +E  +GS       LF   GL+ LL       PS   + V  +    +S+
Sbjct  564   NLSANISECIAELDMGSMAGAEKGLFLDSGLEQLLDAIVVGGPSLYRNQVAPAGLPSIST  623

Query  1183  TKKRRIEH------PLASEREVTKLETIVSLIGENCSTN----VMN-TKDHEkpskavkk  1037
                  + H         S +E   +  + S I + CS N    V+N  K  E+  K VKK
Sbjct  624   KSDVLLPHCDSEKIMHGSPKEALSVSHVSSWIDDGCSMNAGSAVLNQPKKPEEAIKVVKK  683

Query  1036  kakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEG  863
             +A+PG  TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK +LFLQSVT+ A+ 
Sbjct  684   RARPGESTRPRPKDRQQIQDRVKELREIVPNCAKCSIDALLDRTIKHMLFLQSVTKYADK  743

Query  862   LKKTEELK---DKKG--RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEI  698
             LK+T+E K   ++ G   KD++S     G TWA E+  QTM+CP++VEDL  PGQML+E+
Sbjct  744   LKQTDEPKMIVEESGVVLKDNSSGGTGGGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEM  803

Query  697   LCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllql  518
             LC+E+GFFLEI DIIRGFGL ILKG ME+ ++KIWA F+V  EAN  V+R ++F SL+QL
Sbjct  804   LCEERGFFLEIADIIRGFGLTILKGVMEIHDSKIWARFLV--EANRDVTRMDIFLSLVQL  861

Query  517   lqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY  380
             LQ +  S   +RDQL  V D G  ST +N   S +  PISL + L+
Sbjct  862   LQQT--SSTRSRDQLAKVIDKGA-STFANYQHSPMSTPISLADRLH  904


 Score =   130 bits (327),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 92/141 (65%), Gaps = 2/141 (1%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             + +L  LC G GW+Y V W  ++++   LT+ D YYEE++ G++D +L Q +I+G G++G
Sbjct  8     REVLGRLCGGGGWAYGVLWRVDRRDPRLLTVEDCYYEEQVRGVLDKILNQAHIVGEGIIG  67

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
                  +NH+W+ SD+  +  S     DN D  +   D+E+  QF+ GIKTIA+IS+   G
Sbjct  68    GAVINENHQWVYSDSYRINLSPTNSTDNPD--IFQSDAEWQHQFTAGIKTIAIISLPSSG  125

Query  1981  VVQFGSNQKLPERMEFVDETK  1919
             VVQFGS +K+PE +EFV+E K
Sbjct  126   VVQFGSPKKIPENLEFVNEVK  146



>ref|XP_010919293.1| PREDICTED: uncharacterized protein LOC105043446 [Elaeis guineensis]
Length=935

 Score =   205 bits (521),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/219 (53%), Positives = 153/219 (70%), Gaps = 9/219 (4%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ +E 
Sbjct  721   TRPRPKDRQQIQDRVKELREIVPNGAKCSIDALLDRTIKHMLFLQSVTKYADKLKQADEP  780

Query  841   K---DKKG--RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGF  677
             K   ++ G   KD++S  +  G TWA E+  QTM+CP++VEDL  PGQML+E+LC+E+GF
Sbjct  781   KMIGEESGVVLKDNSSGGSNGGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEERGF  840

Query  676   FLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPS  497
             FLEI DIIRGFGL ILKG ME+R++KIWA F+V  EAN  V+R ++F SL+QLLQ +  S
Sbjct  841   FLEIADIIRGFGLTILKGVMEIRDSKIWARFLV--EANRGVTRMDIFLSLVQLLQQT--S  896

Query  496   ELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY  380
                + DQ   V D G P+ S+      V  PISL   L+
Sbjct  897   SARSSDQPAKVIDKGVPTFSNYQQSPPVSIPISLEGRLH  935


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 80/129 (62%), Gaps = 2/129 (2%)
 Frame = -1

Query  2305  WSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWML  2126
             WSY V W  ++++   L + D YYE+ + GL+D +L QV+++G G++G    +  H+W+ 
Sbjct  20    WSYGVLWRVDRRDPGLLMVEDCYYEKRVQGLLDKILNQVHMIGEGIIGGAVISGKHQWIY  79

Query  2125  SDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPE  1946
             SD   +  S     DN D  +   ++E+  QF  GIKTIA+IS+  LGV QFGS QK+PE
Sbjct  80    SDIYGIDLSPTNSTDNPD--IFQSNAEWQHQFHAGIKTIAIISLPSLGVAQFGSLQKIPE  137

Query  1945  RMEFVDETK  1919
              +EF ++ K
Sbjct  138   NLEFANQVK  146



>gb|KDP25239.1| hypothetical protein JCGZ_20395 [Jatropha curcas]
Length=864

 Score =   204 bits (518),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 157/402 (39%), Positives = 228/402 (57%), Gaps = 56/402 (14%)
 Frame = -1

Query  1444  AFDEVLDGFGCKMP-----EKSDNIRKPAATSGQQWDFGTSISG--CTSEHSIGSKDWPS  1286
             A +++ +G G +       +  +N+ KP  + G      TS  G  C SE    S   P 
Sbjct  470   AGNDLFEGLGLEYGKGEAGDSQENMMKPTVSVGH---LATSTCGSECVSELDDNSAVGPR  526

Query  1285  NRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEHPLASEREV----------  1136
               LFS+LG++ LL +  ++S      S +DQ S+ K+RR++  L S+ ++          
Sbjct  527   KGLFSELGIEKLL-NGSNNSSYITNPSIDDQFSTAKRRRLDSSLLSQVQLGGFSCSSGSM  585

Query  1135  --------TKLETIVS-----------------LIGENCSTNVMNTKDHEkpskavkkka  1031
                      K   ++S                  I E+  T +  +K  E+P+KA +K+A
Sbjct  586   TIQPAYHKDKASNLLSKREEFPKSQAGLWIDDGYIIEDGGTALGKSKKPEEPTKATRKRA  645

Query  1030  kPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLK  857
             +PG  TRP PKDR +  +R+ EL+ +IP+GGK SID LL +TIK +LFLQSVT+ A+ LK
Sbjct  646   RPGESTRPRPKDRQQIQDRMKELKGIIPDGGKCSIDALLDRTIKYMLFLQSVTKYADKLK  705

Query  856   KTEELK----DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQ  689
             + ++ K    + K     NS S   G TWA E+ +Q+M+CP++VEDL  PG M IE+LC+
Sbjct  706   QADDPKLISEENKTVPKHNSTSG-GGATWALEVGDQSMVCPIIVEDLSPPGLMRIEMLCE  764

Query  688   EQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllql  509
             ++GFFLEI D+IRGFGLNILKG ME RE KIWA FIV  EAN  ++R ++  SL+QLLQL
Sbjct  765   DRGFFLEIADVIRGFGLNILKGLMETREDKIWARFIV--EANTNITRIDILWSLVQLLQL  822

Query  508   SGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             +  S + + +Q  NV  NGR    +N  + A+P  I + E L
Sbjct  823   TSTSGIDSTNQPSNVM-NGRVPLLNNYQQPALPCSIGVAEAL  863


 Score =   151 bits (382),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 113/336 (34%), Positives = 167/336 (50%), Gaps = 44/336 (13%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V K  LKSLCC NGWSY VFW  +Q+NS+ LT+ DAYYEEEMG  +++MLLQ ++LG G
Sbjct  3     SVLKETLKSLCCSNGWSYGVFWRLDQRNSMLLTMEDAYYEEEMGAAVNNMLLQAHMLGEG  62

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             +VG+ A +   +W+ SD N+  +S    +     + Q DD E   Q S G+KTIAVI VE
Sbjct  63    LVGRAALSGKCQWIFSDANN-GESSSASSIGGQAMCQ-DDYEIQQQVSSGLKTIAVIPVE  120

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLFQGTD-IETIFAQSSSSS----------------  1862
               GV+QFGS +K  +  EF+D+TK+ F   D I+ + +Q S SS                
Sbjct  121   SRGVIQFGSTKKNLQTPEFLDQTKRSFSEMDNIDVLASQGSPSSPFNYKNCDLNEWFASF  180

Query  1861  ANGDVFGLSGSLASSICNSSY----------FMS--PEALPSPDFVD--PIMNMVQSFPV  1724
              N ++  + G  +S +   +Y          F S   +   +P ++D  P+ N +Q+   
Sbjct  181   CNANITPMHGGSSSDLMEMAYTSMNLTQSSGFASDFQQEKINPLYLDSSPLTNQLQTAYT  240

Query  1723  EAFSLFDD----QFQNGGVETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAIS-Q  1559
             EA  +       QFQ    +     S++  + S +      GS +TSL+   LP  I   
Sbjct  241   EAQVILSSNPTTQFQKASSQ-----SAFSVEKSAAKTPFNGGSIITSLESQ-LPSEIGVP  294

Query  1558  DCDNAFCALPDQFEYCTNTVQNVLERPVMTSTHELG  1451
             D         D   +C  T Q+      +TS +  G
Sbjct  295   DSSYVLSTKEDTPVFCVPTKQDYQGDSTVTSLYRSG  330



>ref|XP_008790523.1| PREDICTED: uncharacterized protein LOC103707709 isoform X1 [Phoenix 
dactylifera]
Length=938

 Score =   204 bits (520),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 138/276 (50%), Positives = 184/276 (67%), Gaps = 19/276 (7%)
 Frame = -1

Query  1171  RIEHPLASEREVTKLETIVSLIGENCSTN----VMN-TKDHEkpskavkkkakPG--TRP  1013
             +I H   S +E   +  + S I + CS N    V+N  K  E+  K VKK+A+PG  TRP
Sbjct  670   KIMH--GSPKEALSVSHVSSWIDDGCSMNAGSAVLNQPKKPEEAIKVVKKRARPGESTRP  727

Query  1012  IPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--  839
              PKDR +  +R+ ELRE++PN  K SID LL +TIK +LFLQSVT+ A+ LK+T+E K  
Sbjct  728   RPKDRQQIQDRVKELREIVPNCAKCSIDALLDRTIKHMLFLQSVTKYADKLKQTDEPKMI  787

Query  838   -DKKG--RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              ++ G   KD++S     G TWA E+  QTM+CP++VEDL  PGQML+E+LC+E+GFFLE
Sbjct  788   VEESGVVLKDNSSGGTGGGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEERGFFLE  847

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELH  488
             I DIIRGFGL ILKG ME+ ++KIWA F+V  EAN  V+R ++F SL+QLLQ +  S   
Sbjct  848   IADIIRGFGLTILKGVMEIHDSKIWARFLV--EANRDVTRMDIFLSLVQLLQQT--SSTR  903

Query  487   ARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY  380
             +RDQL  V D G  ST +N   S +  PISL + L+
Sbjct  904   SRDQLAKVIDKGA-STFANYQHSPMSTPISLADRLH  938


 Score =   130 bits (328),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             + +L  LC G GW+Y V W  ++++   LT+ D YYEE++ G++D +L Q +I+G G++G
Sbjct  8     REVLGRLCGGGGWAYGVLWRVDRRDPRLLTVEDCYYEEQVRGVLDKILNQAHIVGEGIIG  67

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
                  +NH+W+ SD+  +  S     DN D  +   D+E+  QF+ GIKTIA+IS+   G
Sbjct  68    GAVINENHQWVYSDSYRINLSPTNSTDNPD--IFQSDAEWQHQFTAGIKTIAIISLPSSG  125

Query  1981  VVQFGSNQKLPERMEFVDETKKLFQGTDIETIF  1883
             VVQFGS +K+PE +EFV+E K   +   +E+I 
Sbjct  126   VVQFGSPKKIPENLEFVNEVKHSLE--QVESIV  156



>ref|XP_008806929.1| PREDICTED: uncharacterized protein LOC103719457 isoform X1 [Phoenix 
dactylifera]
Length=934

 Score =   204 bits (519),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 184/283 (65%), Gaps = 19/283 (7%)
 Frame = -1

Query  1192  LSSTKKRRIEHPLASEREVTKLETIVSLIGENCSTN-----VMNTKDHEkpskavkkkak  1028
             L      +I H   S +E      + S I ++CS N     +   K  E+  K VKK+A+
Sbjct  659   LPHCNSEKIMH--GSPKEPLSKSRVSSWIDDSCSMNAGSAMINQPKKPEEAVKVVKKRAR  716

Query  1027  PG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK  854
             PG  TRP PKDR +  +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ +K+
Sbjct  717   PGESTRPRPKDRQQIQDRVKELREIVPNGAKCSIDALLDRTIKHMLFLQSVTKYADKIKQ  776

Query  853   TEELK---DKKG--RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQ  689
              +E K   ++ G   KD+++  ++ G TWA E+  QTM+CP++VEDL  PGQML+E+LC+
Sbjct  777   ADEPKMIGEESGVVLKDNSNGGSSGGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCE  836

Query  688   EQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllql  509
             E+GFFLEI DIIRGFGL ILKG ME+ ++KIWA F+V  EAN  V+R ++F SL+QLLQ 
Sbjct  837   ERGFFLEIADIIRGFGLTILKGVMEIHDSKIWARFLV--EANRGVTRMDIFLSLVQLLQQ  894

Query  508   SGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY  380
             +  S   + DQ   V D G P T +N  +S V  PISL + L+
Sbjct  895   T--SSARSSDQPAKVIDKGAP-TFTNYQQSPVSIPISLEDRLH  934


 Score =   116 bits (291),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             + +L  LC G  WSY V W  ++ +   L + D Y+EE + G++D +L QV+++G G++G
Sbjct  8     RGVLGGLCTGGVWSYGVLWRVDRCDPRLLMVEDCYFEERVQGVLDKILNQVHMVGEGIIG  67

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
                 +  H+W+ SD   +  S     DN D      ++E+  QF+ GIKTI +IS+  LG
Sbjct  68    GAVISGKHQWIYSDIYGIDLSPTNSTDNPDVF--QSNAEWQHQFTAGIKTIVIISLPSLG  125

Query  1981  VVQFGSNQKLPERMEFVDETK  1919
             V QFGS +K+PE +EFV++ K
Sbjct  126   VAQFGSPEKIPENLEFVNQVK  146



>ref|XP_009358669.1| PREDICTED: transcription factor bHLH155-like [Pyrus x bretschneideri]
Length=790

 Score =   199 bits (507),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 148/212 (70%), Gaps = 5/212 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  +R+ ELR +IP GGK SID LL +TIK ++FLQ+V + A+ LK+T E 
Sbjct  580   TRPRPKDRQQIQDRIKELRGIIPTGGKCSIDSLLDRTIKYMVFLQNVMKYADKLKQTHEP  639

Query  841   K---DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFL  671
             K    + G    ++++   G TWA  +E QT++CP++VEDL  PGQMLIE+LC+EQGFFL
Sbjct  640   KLIGKENGVVLKDNSTKCGGNTWALAVEGQTVVCPIIVEDLDQPGQMLIEMLCEEQGFFL  699

Query  670   EIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSEL  491
             EI DIIRGFGLNILKG ME RE KIWA FIV  EA   V+R ++F SL++LLQ +    +
Sbjct  700   EIADIIRGFGLNILKGVMESREDKIWARFIV--EATRHVTRLDVFWSLVRLLQQTTTGVV  757

Query  490   HARDQLGNVRDNGRPSTSSNCSESAVPFPISL  395
                ++L NV D+G P    +C + ++P P+SL
Sbjct  758   DPTNRLSNVVDSGVPPLLDSCQQQSLPPPVSL  789


 Score =   175 bits (444),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 120/302 (40%), Positives = 159/302 (53%), Gaps = 37/302 (12%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V +  L+SLC GNGWSY VFW F+  NS+ LT+ DAYYE+ +G +I++ML QV+ILG G
Sbjct  5     SVVRERLRSLCVGNGWSYGVFWRFDHINSMLLTMGDAYYEDHVGAVIENMLSQVHILGEG  64

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDEL----LQDDDSEFYGQFSCGIKTIAV  2003
             V+GQ AF   H+WM SD       H G  + C  L    +  D SEF  QFS GIKTIA 
Sbjct  65    VIGQTAFAGKHQWMHSDV------HGGGWNPCTSLESQDMFQDCSEFGSQFSSGIKTIAA  118

Query  2002  ISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD--IETIFAQSSSSSANGDVFGLSGS  1829
             ISVEP GV+Q GS +K+ ER+E VDETKKLFQ  D     I  +++ SS N +   L+  
Sbjct  119   ISVEPQGVIQLGSTEKIMERLEVVDETKKLFQEMDNLDGLIPLENAPSSMNNETSDLNEL  178

Query  1828  LASSICNSSYFMSPEAL-PSPDFVDPIMNMVQSFPVEAFSLFDDQFQNGGVETQTNFSSY  1652
              AS I   +      AL P     D   N++ +   ++ S  D     G  +T   FS+ 
Sbjct  179   FASLISPENSNNGDVALNPDDKCNDHRGNIISAVGFQSTSSDD----IGATDTTPWFST-  233

Query  1651  GFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCTNTVQNVLERPVM  1472
                      W +E S LTS +  +    I          + D FE C +T QN+      
Sbjct  234   ---------WSIESSILTSFEPQLASEII----------VHDSFESCRDTAQNIQVDSAF  274

Query  1471  TS  1466
             TS
Sbjct  275   TS  276



>ref|XP_010252756.1| PREDICTED: uncharacterized protein LOC104594230 isoform X2 [Nelumbo 
nucifera]
Length=878

 Score =   199 bits (507),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 154/385 (40%), Positives = 206/385 (54%), Gaps = 68/385 (18%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSD---------  1241
             D+I  P  +SG      T IS C SE  +GSK       FS+ G++ LL+D         
Sbjct  505   DDIIMPPESSGCS-SLSTIISECISELDVGSKTGARKSFFSEFGIEQLLNDVCNSNSVVK  563

Query  1240  ----NPssscsfvgsSCNDQLS-----------------------STKKRRIEHPLASER  1142
                 NPSS+ +   +      S                       ST +R   H   SE+
Sbjct  564   PSTENPSSTSTVTRTGSTSGYSNQVQLAGLSCLGGSMDVMLPEPESTLERMKIH--GSEK  621

Query  1141  EVTKLETIVSLIGENCSTN----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYER  980
             E      +   I ++ S N    V  TK  E+P+K  +K+A+PG  TRP PKDR +  +R
Sbjct  622   EPVSKPQVGRWIDDSYSINTESAVNQTKRPEEPAKVTRKRARPGETTRPRPKDRQQIQDR  681

Query  979   LAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDS  815
             + ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LKK +E K   ++ G   KD 
Sbjct  682   VKELREIVPNGAKCSIDALLDRTIKHMLFLQSVTKYADKLKKVDEPKMIGEENGVVLKD-  740

Query  814   NSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLN  635
             NS+ +  G TWA E+  QTM+CP++VEDL  PGQML+E+LC+E+G FLEI DIIRGFGL 
Sbjct  741   NSSGSGGGTTWAFEVGGQTMVCPIIVEDLSPPGQMLVEMLCEERGLFLEIADIIRGFGLT  800

Query  634   ILKGTMELRETKIWAHFIVEPEANAFVSRHE-----lfssllqllqlSGPSELHARDQLG  470
             ILKG ME R+ KIWA F+V  EAN  V+R +     +           GPS+        
Sbjct  801   ILKGVMEARDDKIWARFVV--EANRDVTRMDIFLSLVQLLQQTTTGGIGPSK--------  850

Query  469   NVRDNGRPSTSSNCSESAVPFPISL  395
              V D G P   +N  ++ +P PISL
Sbjct  851   -VIDIGVPPF-TNYQQTPMPLPISL  873


 Score =   169 bits (429),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 110/300 (37%), Positives = 161/300 (54%), Gaps = 15/300 (5%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGV  2168
             + K  LK+LC  NGWSY VFW  N+ NS+ LT+ D+Y+EE +  ++D ML QV++LG G+
Sbjct  5     LIKEELKTLCSSNGWSYGVFWRMNRPNSMLLTVEDSYFEEPISMVVDKMLQQVHMLGQGI  64

Query  2167  VGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEP  1988
             +G+ AFT  H+W+ SDT      + G  DN +     D+SEF+ QFS GIKTIAV+SV P
Sbjct  65    IGETAFTGKHRWLFSDTYFEEWGYPGSVDNENTF--QDNSEFHHQFSSGIKTIAVVSVAP  122

Query  1987  LGVVQFGSNQKLPERMEFVDETKKLFQ--GTDIETIFAQSSSSSANGDVFGLSGSLASSI  1814
             LGV+QFGS +K+ E +EFVD  + LF+  G+    I + SS +  N ++   SGS AS +
Sbjct  123   LGVLQFGSMEKILESLEFVDHAQSLFRQLGSHDGLILSGSSWTPLNSEICDQSGSFASVV  182

Query  1813  CNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAF---SLFDDQFQNGGVETQTNFSSYGFQ  1643
                + F + E + S    +    + Q+  +E     + F  + QNG + T    S   F 
Sbjct  183   LPGNSFPNSENMNSLLVDNSCKRLTQTNSLEILPQSTSFTSEMQNGSMTTLIGNS---FH  239

Query  1642  PSCS-SVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCTNTVQNVLERPVMTS  1466
             P     V G E     S   ++    +    ++A  ++P      TNT     E P M S
Sbjct  240   PKNKFQVAGPEAQVTLSTSTHLTQALLQSTNNSAHNSIPQN----TNTSIWSEENPTMPS  295



>ref|XP_010252749.1| PREDICTED: uncharacterized protein LOC104594230 isoform X1 [Nelumbo 
nucifera]
Length=879

 Score =   199 bits (507),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 154/385 (40%), Positives = 206/385 (54%), Gaps = 68/385 (18%)
 Frame = -1

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSD---------  1241
             D+I  P  +SG      T IS C SE  +GSK       FS+ G++ LL+D         
Sbjct  506   DDIIMPPESSGCS-SLSTIISECISELDVGSKTGARKSFFSEFGIEQLLNDVCNSNSVVK  564

Query  1240  ----NPssscsfvgsSCNDQLS-----------------------STKKRRIEHPLASER  1142
                 NPSS+ +   +      S                       ST +R   H   SE+
Sbjct  565   PSTENPSSTSTVTRTGSTSGYSNQVQLAGLSCLGGSMDVMLPEPESTLERMKIH--GSEK  622

Query  1141  EVTKLETIVSLIGENCSTN----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYER  980
             E      +   I ++ S N    V  TK  E+P+K  +K+A+PG  TRP PKDR +  +R
Sbjct  623   EPVSKPQVGRWIDDSYSINTESAVNQTKRPEEPAKVTRKRARPGETTRPRPKDRQQIQDR  682

Query  979   LAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDS  815
             + ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LKK +E K   ++ G   KD 
Sbjct  683   VKELREIVPNGAKCSIDALLDRTIKHMLFLQSVTKYADKLKKVDEPKMIGEENGVVLKD-  741

Query  814   NSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLN  635
             NS+ +  G TWA E+  QTM+CP++VEDL  PGQML+E+LC+E+G FLEI DIIRGFGL 
Sbjct  742   NSSGSGGGTTWAFEVGGQTMVCPIIVEDLSPPGQMLVEMLCEERGLFLEIADIIRGFGLT  801

Query  634   ILKGTMELRETKIWAHFIVEPEANAFVSRHE-----lfssllqllqlSGPSELHARDQLG  470
             ILKG ME R+ KIWA F+V  EAN  V+R +     +           GPS+        
Sbjct  802   ILKGVMEARDDKIWARFVV--EANRDVTRMDIFLSLVQLLQQTTTGGIGPSK--------  851

Query  469   NVRDNGRPSTSSNCSESAVPFPISL  395
              V D G P   +N  ++ +P PISL
Sbjct  852   -VIDIGVPPF-TNYQQTPMPLPISL  874


 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 110/301 (37%), Positives = 161/301 (53%), Gaps = 16/301 (5%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGV  2168
             + K  LK+LC  NGWSY VFW  N+ NS+ LT+ D+Y+EE +  ++D ML QV++LG G+
Sbjct  5     LIKEELKTLCSSNGWSYGVFWRMNRPNSMLLTVEDSYFEEPISMVVDKMLQQVHMLGQGI  64

Query  2167  VGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEP  1988
             +G+ AFT  H+W+ SDT      + G  DN +     D+SEF+ QFS GIKTIAV+SV P
Sbjct  65    IGETAFTGKHRWLFSDTYFEEWGYPGSVDNENTF--QDNSEFHHQFSSGIKTIAVVSVAP  122

Query  1987  LGVVQFGSNQK-LPERMEFVDETKKLFQ--GTDIETIFAQSSSSSANGDVFGLSGSLASS  1817
             LGV+QFGS +K + E +EFVD  + LF+  G+    I + SS +  N ++   SGS AS 
Sbjct  123   LGVLQFGSMEKQILESLEFVDHAQSLFRQLGSHDGLILSGSSWTPLNSEICDQSGSFASV  182

Query  1816  ICNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAF---SLFDDQFQNGGVETQTNFSSYGF  1646
             +   + F + E + S    +    + Q+  +E     + F  + QNG + T    S   F
Sbjct  183   VLPGNSFPNSENMNSLLVDNSCKRLTQTNSLEILPQSTSFTSEMQNGSMTTLIGNS---F  239

Query  1645  QPSCS-SVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCTNTVQNVLERPVMT  1469
              P     V G E     S   ++    +    ++A  ++P      TNT     E P M 
Sbjct  240   HPKNKFQVAGPEAQVTLSTSTHLTQALLQSTNNSAHNSIPQN----TNTSIWSEENPTMP  295

Query  1468  S  1466
             S
Sbjct  296   S  296



>ref|XP_004310273.1| PREDICTED: transcription factor bHLH157-like [Fragaria vesca 
subsp. vesca]
Length=755

 Score =   197 bits (502),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 142/351 (40%), Positives = 187/351 (53%), Gaps = 51/351 (15%)
 Frame = -1

Query  1324  TSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEHP----  1157
             T E  +GS   P   LFS+LGL+ LL+   S+S S    S  DQLS T+KR++E      
Sbjct  414   TKEAEVGSVAVPRRGLFSELGLEELLNGMNSTSSSVTKCSLEDQLS-TRKRKLESSSVGS  472

Query  1156  -----------------------------LASEREVTKLETIVSLIGENCSTNV------  1082
                                          L  ++EV     +   I ++ S N       
Sbjct  473   NQVQLGRLAGSGGSMHLTGPLYNLDKTNCLVPKKEVLPKSQVGLWIDDSYSVNARSMSQA  532

Query  1081  --MNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTI  908
                  +DH   +   + K    TRP PKDR +  +R+ +LR +IPNGGK SID LL +TI
Sbjct  533   KPQKAEDH-TKTAKKRAKPGESTRPRPKDRQQIQDRMKDLRGMIPNGGKCSIDALLDRTI  591

Query  907   KQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDL  728
             K ++FLQ VT+ A+ LK+  E K         +N      TWA  +E Q ++CP++VEDL
Sbjct  592   KYMIFLQGVTKHADKLKQPHESKVNHSSISGGNN------TWALAVEGQNVVCPILVEDL  645

Query  727   CTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              TPGQMLIEILC+E GFFLE+ D IRGFGLNILKG ME RE KIWA FIV  EA   ++R
Sbjct  646   STPGQMLIEILCEEHGFFLELADEIRGFGLNILKGVMESREEKIWARFIV--EATRHITR  703

Query  547   HElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISL  395
              E+F SL++LLQ +G S +    +  NV D G P    +    + P PISL
Sbjct  704   IEVFWSLVRLLQQNGTSVVDPTSRPSNVADTGFPPVLDSVQPCSFPPPISL  754


 Score =   150 bits (379),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 104/156 (67%), Gaps = 18/156 (12%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + +  +V K  L+ LC GNGWSY VFW F+Q+NS+ LT+ +AYYEE MG +I++ML Q
Sbjct  1     MGEAEKGSVIKEKLRGLCVGNGWSYGVFWRFDQRNSMLLTMGEAYYEEHMGAVIENMLSQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDT-NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             V++LG GV+GQ AFT  H+WM SD  N  W S + + ++C  L Q               
Sbjct  61    VHMLGEGVIGQTAFTGKHQWMHSDAYNGQWNSCNPI-ESCSNLFQ---------------  104

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQ  1907
             TIA +SVE  GV+QFGS +K+ ER+EF+DETK++FQ
Sbjct  105   TIATVSVES-GVIQFGSTEKIMERLEFLDETKRVFQ  139



>ref|XP_002446947.1| hypothetical protein SORBIDRAFT_06g025650 [Sorghum bicolor]
 gb|EES11275.1| hypothetical protein SORBIDRAFT_06g025650 [Sorghum bicolor]
Length=838

 Score =   198 bits (504),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 117/252 (46%), Positives = 162/252 (64%), Gaps = 15/252 (6%)
 Frame = -1

Query  1108  IGENCSTNVMNTK-----DHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGG  944
             + + CS N  N+K     + E      + +A   TRP PKDR    +R+ ELRE++PNG 
Sbjct  591   VDDTCSFNTANSKGSQSSNPEGKVAKRRARAGESTRPRPKDRQLIQDRVKELREIVPNGA  650

Query  943   KMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--DKKG---RKDSNSNSNTNGVTWA  779
             K SID LL +TIK +LFLQSV + AE +K+ +E K  DK+     KD+       G TWA
Sbjct  651   KCSIDALLERTIKHMLFLQSVNKYAEKIKQADEPKIIDKESGVVLKDNPDAGRNGGATWA  710

Query  778   CEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETK  599
              E+  QTM+CP+++EDL  PGQML+E+LC+E+G FLEI D IRGFGL ILKG MELR+ K
Sbjct  711   YEVAGQTMVCPIIIEDLSPPGQMLVEMLCEERGLFLEIADNIRGFGLTILKGQMELRDGK  770

Query  598   IWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSES  419
             IW+ F+V  EAN  V+R ++F SL++LL+ +  S + + DQ+  V +NG PS  +N   S
Sbjct  771   IWSRFLV--EANREVTRMDIFLSLVKLLEQN--SLVRSTDQMAKVMNNGVPSF-ANHQRS  825

Query  418   AVPFPISLPEGL  383
              +P P+ + E L
Sbjct  826   PMPVPVGIAERL  837


 Score = 99.8 bits (247),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 84/145 (58%), Gaps = 5/145 (3%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             +A L +LC   GWSYA  W F+ Q+   LTL D Y E+E   ++  ML  V I+G G++G
Sbjct  2     EAALGALCRAGGWSYAAVWRFHPQDPRLLTLGDCYSEDEAKTMVQKMLNLVEIVGEGILG  61

Query  2161  QVAFTKNHKWMLSDTNSVW-QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             +   +   +W+  DT  V  Q+ H  ADN D  L  D + +  QF  GIKTIAV+ ++  
Sbjct  62    EALVSGECQWIYDDTCHVLNQTSH--ADNRDLYL--DYTWWQHQFLNGIKTIAVLPLQLQ  117

Query  1984  GVVQFGSNQKLPERMEFVDETKKLF  1910
             G+VQFGS +K+P     +++ + +F
Sbjct  118   GLVQFGSTRKVPRSSILLNQVRDIF  142



>ref|XP_009359586.1| PREDICTED: transcription factor EMB1444-like [Pyrus x bretschneideri]
Length=785

 Score =   196 bits (497),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 145/212 (68%), Gaps = 5/212 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  +R+ EL+ +IP GGK SID LL +TIK ++FLQSVT+ A+ LK+T E 
Sbjct  575   TRPRPKDRQQIQDRIKELKGIIPTGGKCSIDSLLDRTIKYMVFLQSVTKYADKLKQTHEP  634

Query  841   K---DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFL  671
             K    + G    ++++   G T A  +E QT++CP+VVEDL  PGQMLIE+LC+EQGFFL
Sbjct  635   KLIGKENGVVLKDNSTKCGGNTRALAVEGQTVVCPIVVEDLDQPGQMLIEMLCEEQGFFL  694

Query  670   EIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSEL  491
             EI DIIRGFGLNILKG ME RE KIWA FIV  EA   V+R ++F SL++ LQ +    +
Sbjct  695   EIADIIRGFGLNILKGVMESREDKIWARFIV--EATRHVTRLDVFWSLVRFLQQTTTGVV  752

Query  490   HARDQLGNVRDNGRPSTSSNCSESAVPFPISL  395
                ++L NV D G P    +C +  +P P+SL
Sbjct  753   DPTNRLSNVVDGGVPPILDSCQQQILPPPVSL  784


 Score =   173 bits (439),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 116/315 (37%), Positives = 170/315 (54%), Gaps = 45/315 (14%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M++    +V +  L+SLC  NGWSY VFW F+ +NS+ LT+ DAYYE+ +G +I++ML Q
Sbjct  1     MAQMGESSVVRERLRSLCVSNGWSYGVFWRFDHRNSMLLTMGDAYYEDHVGAVIENMLPQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDEL----LQDDDSEFYGQFSC  2024
             V++LG G++GQ AFT  H+WM SD      +H G  + C  L    +  D SEF  QFS 
Sbjct  61    VHVLGEGIIGQTAFTGKHRWMHSD------AHGGGWNPCSSLENQDMFQDYSEFSCQFSS  114

Query  2023  GIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET----IFAQSSSSSAN  1856
             GIKTIA+ISVEP GV+Q GS +K+ ER+E +DETK+LF+  ++E     I  +++ SS N
Sbjct  115   GIKTIAIISVEPRGVIQLGSTEKIMERVEVLDETKRLFR--EMENLDGLIPLENAPSSMN  172

Query  1855  GDVFGLSGSLASSICNSSYFMSPEALPSPDFVDPIM-NMVQSFPVEAFSLFDDQFQNGGV  1679
              +   L+   AS I + + +     L   D  D    N++ +   ++ S  D     G  
Sbjct  173   NETSDLNELFASLISSGNSYNGDVNLTPGDKCDEYRGNIISAVGFQSTSSDD----IGSA  228

Query  1678  ETQTNFSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQFEYCTNTV  1499
             +    FS+          W  E S LTS +  +    I          L D FE C +TV
Sbjct  229   DKTPWFST----------WSAESSLLTSFEPLLASEII----------LRDSFESCRDTV  268

Query  1498  QNV----LERPVMTS  1466
             +N+     E+P+  S
Sbjct  269   RNIQLADFEKPIQGS  283



>gb|KDO76670.1| hypothetical protein CISIN_1g038975mg, partial [Citrus sinensis]
Length=398

 Score =   188 bits (478),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 131/354 (37%), Positives = 185/354 (52%), Gaps = 60/354 (17%)
 Frame = -1

Query  1468  STHELGQSAFDEVLDGFG-------CKMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHS  1310
             S  EL  S  +++  G G         + E  ++  KPA  SG      T +S C +E  
Sbjct  49    SKSELFHSVENDLFVGLGLNSGCAQADIGECWEDYIKPA-VSGDHSAISTHMSECITELD  107

Query  1309  IGSKDWPSNRLFSKLGLDHLL--SDNPssscsfvgsSCNDQLSSTKKRRIEHPLASEREV  1136
             +GS   P   LFS+L L+ LL  S NPS+          DQ  S K+R++E   ++  EV
Sbjct  108   VGSASGPCKGLFSELRLEELLRSSTNPSTIAKCSL---EDQFFSPKRRKLESSSSNGNEV  164

Query  1135  TKLETIVS---------------------------------LIGENCSTNVMNT------  1073
              +++   S                                  I ++ S N  N       
Sbjct  165   QRIKLPCSAGSISLVQDVHNKQNTNNLVWKKDVLPKSQVGLWIDDSYSINAENAVAVSPQ  224

Query  1072  -KDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLL  896
               +        + +    TRP PKDR +  +RL ELR++IPNG K SID LL  TIK ++
Sbjct  225   KPEKHMKLSKKRARPGESTRPRPKDRQQIQDRLKELRDIIPNGAKCSIDCLLDLTIKHMI  284

Query  895   FLQSVTRLAEGLKKTEELK--DKKGR---KDSNSNSNTNG--VTWACEIENQTMICPLVV  737
             FL+S+T+ A+ +K+ EE K  DK+     KD+++  ++ G   TWACE+E  T+ CP++V
Sbjct  285   FLKSITQCADKIKEAEEPKLIDKENEVVLKDNSTGGHSGGGCATWACEVEGPTLSCPIIV  344

Query  736   EDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             +DL TP QMLIE++C+++GFFLEI D+IRGFGLNI KG ME RE KIWA FIVE
Sbjct  345   QDLSTPRQMLIEMVCEDRGFFLEITDMIRGFGLNIWKGVMERREDKIWARFIVE  398



>ref|XP_006439262.1| hypothetical protein CICLE_v10018834mg [Citrus clementina]
 gb|ESR52502.1| hypothetical protein CICLE_v10018834mg [Citrus clementina]
Length=847

 Score =   195 bits (495),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 138/362 (38%), Positives = 196/362 (54%), Gaps = 54/362 (15%)
 Frame = -1

Query  1381  KPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLL--SDNPssscsfvgs  1208
             KPA  SG      T +S C +E  +GS   P   LFS+L L+ LL  S NPS+       
Sbjct  477   KPAV-SGDHSAISTHMSECITELDVGSASGPCKGLFSELRLEELLRSSTNPSTIAKCSL-  534

Query  1207  SCNDQLSSTKKRRIEHPLASEREVTKLETIVSL---------------------------  1109
                DQ  S K+R++E   ++  EV +++   S                            
Sbjct  535   --EDQFFSPKRRKLESSSSNGNEVQRIKLPCSAGSISLVQDVHNKQNTNNLVWKKDVLPK  592

Query  1108  ------IGENCSTNVMNT-------KDHEkpskavkkkakPGTRPIPKDRVRTYERLAEL  968
                   I ++ S N  N         +        + +    TRP PKDR +  +RL EL
Sbjct  593   SQVGLWIDDSYSINAENAVAVSPQKPEKHMKLSKKRARPGESTRPRPKDRQQIQDRLKEL  652

Query  967   RELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--DKKGR---KDSNSNS  803
             R++IPNG K SID LL  TIK ++FL+S+T+ A+ +K+ EE K  DK+     KD+++  
Sbjct  653   RDIIPNGAKCSIDCLLDLTIKHMIFLKSITQCADKIKEAEEPKLIDKENEVVLKDNSTGG  712

Query  802   NTNG--VTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNIL  629
             ++ G   TWACE+E  T+ CP++V+DL TP QMLIE+LC+++GFFLEI D+IRGFGLNI 
Sbjct  713   HSGGGCATWACEVEGPTLSCPIIVQDLSTPRQMLIEMLCEDRGFFLEITDMIRGFGLNIW  772

Query  628   KGTMELRETKIWAHFIVEPEANA-FVSRHElfssllqllqlSGPSELHARDQLGNVRDNG  452
             KG ME RE KIWA FIVE   N   ++R ++  SL+QLLQ +  S +++ +Q  N  D+ 
Sbjct  773   KGVMERREDKIWARFIVEKNKNVEHITRLDIIWSLVQLLQQTNMSGMNSMNQANNAMDDR  832

Query  451   RP  446
              P
Sbjct  833   IP  834


 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 116/302 (38%), Positives = 159/302 (53%), Gaps = 48/302 (16%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             K  LKSLCC +GWSY VFW F+++NS+ LTL DAYY+E M  ++  MLLQ + LG G++G
Sbjct  6     KRTLKSLCCCSGWSYGVFWCFDKRNSMLLTLEDAYYDERMATVVSSMLLQAHALGEGIIG  65

Query  2161  QVAFTKNHKWMLSDTN-SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             +VA T  HKWM SD     W S   LA + D  L D D  F+GQFS GI+TIAV+ VE  
Sbjct  66    EVAITGKHKWMFSDARGGGWNS---LARSQDVFLSDSD--FHGQFSFGIQTIAVVPVESR  120

Query  1984  GVVQFGSNQKLPERMEFVDETKKLFQGTD-----IETIFAQSSSSSANGDVFGLSGSLAS  1820
             GV+QFGS QK+ E +EF+D+T++LFQ  +     I+      S +S N D+  +  SL S
Sbjct  121   GVLQFGSTQKMLENLEFLDQTRRLFQEMENFDGVIQLENTPQSLNSGNYDLNAIFASLMS  180

Query  1819  SICNSSYFM---------SPEALPSP----DFVDPIMNMVQSFPVEAFSLFD-DQFQNGG  1682
                 SSY           S E + +P    D      +  +  P+   S ++ ++ Q  G
Sbjct  181   P--GSSYTQNLASAHGGNSREVMGNPCSLADQSSSENDYGRICPLHINSSYNYNKPQTAG  238

Query  1681  VETQTNFSSYG---------FQPSCS-----------SVWGLEGSSLTSLQGNILPGAIS  1562
              E Q   S Y           QP+CS           S W  EGS LTS +   +  ++ 
Sbjct  239   QEAQV-LSPYNPDTQCQQVFLQPTCSVQNSVANTPCISTWSDEGSILTSFEQPFISESVI  297

Query  1561  QD  1556
             Q+
Sbjct  298   QE  299



>ref|XP_004298280.1| PREDICTED: uncharacterized protein LOC101304963 [Fragaria vesca 
subsp. vesca]
Length=638

 Score =   192 bits (488),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 140/375 (37%), Positives = 197/375 (53%), Gaps = 60/375 (16%)
 Frame = -1

Query  1549  NAFCALPDQFEYCTNTVQNVLERPVMTSTHE---LGQSAFDEVLDGFGC-----KMPEKS  1394
             + F  LP   E+   ++Q+ +        HE   + QS+ +++ +G G      ++ E  
Sbjct  271   DTFINLP--IEHPATSMQSSITNAFSADAHEKSVIIQSSGNDLFNGLGTDRGCGQVREWE  328

Query  1393  DNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDNPssscsfv  1214
             D+I   +  SG     GT +   T E  +GS   P   LFS+LGL+ LL+   ++S S  
Sbjct  329   DSIL--SVVSGDCLAAGTDL---TKEAEVGSAAGPRRGLFSELGLEELLNGMNTTSSSMT  383

Query  1213  gsSCNDQLSSTKKRRIEHP---------------------------------LASEREVT  1133
               S  DQLS T+KR++E                                   L  ++EV 
Sbjct  384   KCSLEDQLS-TRKRKLESSSVGTNQVRLARLAGSGGSMHLTRPLYNLDKTNCLVPKKEVL  442

Query  1132  KLETIVSLIGENCSTNV--------MNTKDHEkpskavkkkakPGTRPIPKDRVRTYERL  977
                 +   I ++ S N            +DH   +   + K    TRP PKDR +  +R+
Sbjct  443   PKSQVGLWIDDSYSVNARSMSQAKPQKAEDH-TKTAKKRAKPGESTRPRPKDRQQIQDRI  501

Query  976   AELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKG-RKDSNSNSN  800
              +LR +IPNGGK SID LL +TIK ++FLQ +T+ A+ LK+  E K+     KD +S S 
Sbjct  502   KDLRGMIPNGGKCSIDYLLDRTIKYMIFLQGLTKHADKLKQPHEPKENGVVLKDHSSRSG  561

Query  799   TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGT  620
              N  TWA  +E Q ++CP++VEDL TPGQM+IEILC+E+GFFLE+ D IRGFGLNILKG 
Sbjct  562   GNN-TWALAVEGQNVVCPILVEDLSTPGQMVIEILCEERGFFLELADEIRGFGLNILKGV  620

Query  619   MELRETKIWAHFIVE  575
             ME RE KIWA FIVE
Sbjct  621   MESREDKIWARFIVE  635


 Score = 72.8 bits (177),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 4/76 (5%)
 Frame = -1

Query  2131  MLSDT-NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQK  1955
             M SD+ N  W S + + ++C  L QDD S+F  +FS G+KTIA +SVE  GV+QFGS +K
Sbjct  1     MHSDSYNEQWNSFNSI-ESCSNLFQDD-SKFRCEFSSGVKTIATVSVES-GVIQFGSTEK  57

Query  1954  LPERMEFVDETKKLFQ  1907
             + ER+EF+DETK++FQ
Sbjct  58    IMERLEFLDETKRVFQ  73



>ref|XP_004976520.1| PREDICTED: transcription factor bHLH157-like [Setaria italica]
Length=813

 Score =   193 bits (490),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 161/253 (64%), Gaps = 16/253 (6%)
 Frame = -1

Query  1108  IGENCSTNVMNTKDHE------kpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNG  947
             + + CS N  N+K  +            + +A   TRP PKDR    +R+ ELRE++PNG
Sbjct  565   VDDTCSFNTTNSKGSQSNNTEGTKVAKKRARASESTRPRPKDRQLIQDRVKELREIVPNG  624

Query  946   GKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--DKKG---RKDSNSNSNTNGVTW  782
              K SID LL +TIK +LFLQSVT+ AE +K+ +E K  DK+     KD+       G TW
Sbjct  625   AKCSIDALLERTIKHMLFLQSVTKYAEKIKQADEPKLIDKESGVILKDNQDAGKNGGATW  684

Query  781   ACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRET  602
             A E+  +TM+CP++VEDL  PGQML+E+LC+E+G FLEI D IRGFGL ILKG MELR+ 
Sbjct  685   AYEVAGKTMVCPIIVEDLSPPGQMLVEMLCEERGLFLEIADNIRGFGLTILKGLMELRDG  744

Query  601   KIWAHFIVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSE  422
             KIWA F+V  E N  V+R ++F SL+QLL+ +  S + + +Q+  V ++G PS + +   
Sbjct  745   KIWARFLV--ETNREVTRMDIFLSLVQLLEQN--SLVRSNEQMAKVMNSGVPSFTDH-QR  799

Query  421   SAVPFPISLPEGL  383
             S +P P+ + E L
Sbjct  800   SPLPIPVGVAERL  812


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 89/145 (61%), Gaps = 5/145 (3%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             +A L +LC   GWSYA  W F+  +   LTL + Y E+E   +++ ML QV+I+G G++G
Sbjct  2     EAALGALCRAGGWSYAAVWRFHPHDPRLLTLGERYSEDEAKTVVEKMLGQVHIIGEGIIG  61

Query  2161  QVAFTKNHKWMLSDT-NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             +   +   +W+   T N++ Q+ H  ADN +  L +  + +  QF  GIKTIAV+ ++  
Sbjct  62    EALISGECQWIYDATCNALNQTSH--ADNRE--LFEGYTWWQYQFLNGIKTIAVLPLQLQ  117

Query  1984  GVVQFGSNQKLPERMEFVDETKKLF  1910
             G+VQFGS +K+P   +F+++ + +F
Sbjct  118   GLVQFGSFRKVPRSSDFLNQVRNIF  142



>dbj|BAJ91406.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   185 bits (469),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 148/225 (66%), Gaps = 19/225 (8%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK ++FLQ VT+ AE +K+ +E 
Sbjct  142   TRPRPKDRQQIQDRVKELREIVPNSAKCSIDALLDRTIKHMIFLQGVTKYAEKIKQADEP  201

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       LKD       KD++S ++  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  202   KMISKDSGAVLKDNSSGVVLKDNSSAASNGGATWAYEVAGQTMVCPIIVEDLSPPGQMLV  261

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  262   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  319

Query  523   qllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPE  389
             QLLQ +  S   + DQL  V  NG  S + +  +S +  P+ L E
Sbjct  320   QLLQQN--SHNRSSDQLAKVISNGVRSFAEH-QQSPMLVPVGLAE  361



>ref|XP_006476318.1| PREDICTED: transcription factor LHW-like [Citrus sinensis]
Length=852

 Score =   192 bits (487),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 193/362 (53%), Gaps = 54/362 (15%)
 Frame = -1

Query  1381  KPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLL--SDNPssscsfvgs  1208
             KPA  SG      T +S C +E  +GS   P   LFS+L L+ LL  S NPS+       
Sbjct  482   KPAV-SGDHSAISTHMSECITELDVGSASGPRKGLFSELRLEELLRSSTNPSTITKCS--  538

Query  1207  SCNDQLSSTKKRRIEHPLASEREVTK----------------------------------  1130
                DQ  S K+R++E   ++  +V +                                  
Sbjct  539   -LEDQFFSPKRRKLESSSSNGNQVQRTKLPCSAGSISLVQDVHNKQNTNNLVWKKDVLPK  597

Query  1129  ------LETIVSLIGENCSTNVMNTKDHEkpskavkkkakPGTRPIPKDRVRTYERLAEL  968
                   ++   S+  EN         +        + +    TRP PKDR +  +RL EL
Sbjct  598   SQVGLWIDDSYSINAENAVAVSPQKPEKHMKLSKKRARPGESTRPRPKDRQQIQDRLKEL  657

Query  967   RELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--DKKGR---KDSNSNS  803
             R++IPNG K SID LL  TIK ++FL+S+T+ A+ +K+ EE K  DK+     KD+++  
Sbjct  658   RDIIPNGAKCSIDCLLDLTIKHMIFLKSITQCADKIKEAEEPKLIDKENEVVLKDNSTGG  717

Query  802   NTNG--VTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNIL  629
             ++ G   TWACE+E  T+ CP++V+DL TP QMLIE++C+++GFFLEI D+IRGFGLNI 
Sbjct  718   HSGGGCATWACEVEGPTLSCPIIVQDLSTPRQMLIEMVCEDRGFFLEITDMIRGFGLNIW  777

Query  628   KGTMELRETKIWAHFIVEPEANA-FVSRHElfssllqllqlSGPSELHARDQLGNVRDNG  452
             KG ME RE KIWA FIVE   N   ++R ++  SL+QLLQ +  S +++ +Q  N  D+ 
Sbjct  778   KGVMERREDKIWARFIVEKNKNVEHITRLDIIWSLVQLLQQTNMSGMNSMNQANNAMDDR  837

Query  451   RP  446
              P
Sbjct  838   IP  839


 Score =   167 bits (424),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 120/190 (63%), Gaps = 11/190 (6%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + +  +  K  LKSLCC NGWSY VFW F+++NS+ LTL DAYY+E M  ++  MLLQ
Sbjct  1     MGEAEMGSALKRTLKSLCCCNGWSYGVFWCFDKRNSMLLTLEDAYYDERMATVVSSMLLQ  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTN-SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
              + LG G++G+VA T  HKWM SD     W S   LA + D  L D D  F+GQFS GI+
Sbjct  61    AHALGEGIIGEVAITGKHKWMFSDARGGRWNS---LARSQDVFLSDSD--FHGQFSFGIQ  115

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD-----IETIFAQSSSSSANGD  1850
             TIAV+ VE  GV+QFGS QK+ E +EF+D+T++LFQ  +     I+      S +S N D
Sbjct  116   TIAVVPVESRGVLQFGSTQKMLENLEFLDQTRRLFQEMENFDGVIQLENTPQSLNSGNYD  175

Query  1849  VFGLSGSLAS  1820
             +  +  SL S
Sbjct  176   LNAIFASLMS  185



>ref|XP_004953425.1| PREDICTED: transcription factor bHLH155-like [Setaria italica]
Length=778

 Score =   191 bits (484),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/232 (51%), Positives = 153/232 (66%), Gaps = 27/232 (12%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  558   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADE-  616

Query  841   KDKKGRKDSNS--NSNTNGV--------------TWACEIENQTMICPLVVEDLCTPGQM  710
               K   KDS++  N N++GV              TWA E+  QTM+CP++VEDL  PGQM
Sbjct  617   -PKMISKDSSAVLNDNSSGVVLKDDPSAGINGGATWAYEVAGQTMVCPIIVEDLAPPGQM  675

Query  709   LIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfss  530
             L+E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F S
Sbjct  676   LVEMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLS  733

Query  529   llqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY*R  374
             L+QLLQ +  S   + DQL  V +NG PS + +        PIS+P GL  R
Sbjct  734   LVQLLQQN--SLNRSSDQLTKVINNGVPSFAEHQQS-----PISIPVGLAGR  778


 Score = 92.0 bits (227),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 90/163 (55%), Gaps = 5/163 (3%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L +LC   GWSYA  W  ++++   LT+ + + E+E   +++ M+ QV+++G GV+G+  
Sbjct  5     LGALCRAGGWSYAAIWRSDRRDPRLLTIGECHCEDEARKVMEKMVNQVHVVGEGVIGRAL  64

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQ  1973
              +  ++W+  D   +  S   ++D  +  L    + +  QF  GIKTIAV+ +   GV Q
Sbjct  65    ISGEYQWICDD---IPFSLSQISDADNLGLFQGYTWWQHQFLSGIKTIAVVPIPAFGVAQ  121

Query  1972  FGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVF  1844
             FGS QK+ E +EF+D+ K     T  E+I    S+     DVF
Sbjct  122   FGSMQKVSESLEFLDQVKGAAFLT--ESISWHPSARDVQKDVF  162



>gb|KEH42888.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=767

 Score =   190 bits (483),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 133/318 (42%), Positives = 177/318 (56%), Gaps = 58/318 (18%)
 Frame = -1

Query  1345  GTSISGCTSEHSIGS-KDWPSNRLFSKLGLDHLLS-----DNPssscsfvgsSCNDQLSS  1184
              T  S C SE + G+  D    RLFS+LG++ LL      +NP +S +F     N+ LSS
Sbjct  426   NTGFSECISELNTGTPTDNTRKRLFSELGIEELLRGEAIYNNPFNSSNFE----NELLSS  481

Query  1183  TKKRRIE-HPL---------------------------ASEREVTKLETIVSL-----IG  1103
              KK+ +E  PL                            S   +T+ +T+  L     + 
Sbjct  482   NKKQMVELSPLNQTQVHFANLDGTETRPNLMHSVSDLDKSNSVITRKDTLPKLQVGMLVN  541

Query  1102  ENCSTNVMNTK-------DHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGG  944
             +  S N+           D        K K    TRP PKDR +  + L ELR +IP+GG
Sbjct  542   DRNSINLKRAVPVHPRKLDEPAKPNKKKAKPGESTRPRPKDRQQIQDCLKELRGIIPHGG  601

Query  943   KMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK-----DKKGRKDSNSNSNTN-GVTW  782
             K SID LL +TI+ +LFL+ V + A+ L++  E K     ++   KDSN   N N G TW
Sbjct  602   KCSIDSLLDRTIRYMLFLRGVIKYADILQEPNETKLIEQANEVVPKDSNVAHNKNHGATW  661

Query  781   ACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRET  602
             A E++NQTM+CP++VED+ +PGQMLIEILC++QGFFLEIVDIIRGFGLNILK  ME R+ 
Sbjct  662   AYEVKNQTMVCPIIVEDMKSPGQMLIEILCEDQGFFLEIVDIIRGFGLNILKAKMETRKK  721

Query  601   KIWAHFIVEPEANAFVSR  548
             K+WAHFIV  EAN  V+R
Sbjct  722   KLWAHFIV--EANRHVTR  737


 Score =   116 bits (291),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/178 (39%), Positives = 100/178 (56%), Gaps = 25/178 (14%)
 Frame = -1

Query  2332  LKSLCC-GNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQV  2156
             LK+LC  G+GWSYA+FW F+Q+N + L + + YYEE++G  I  ++ QV++LG G+VG+ 
Sbjct  13    LKTLCAYGDGWSYAIFWRFHQRNPMLLNVEETYYEEQLGEEITKIVPQVHLLGEGIVGEA  72

Query  2155  AFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCG-IKTIAVISVEPLGV  1979
             AFT  H W+           H ++        +DDS  Y Q S G IKTI  I V   GV
Sbjct  73    AFTGKHSWL-----------HSVS-------SEDDSGLYQQLSSGIIKTIVAIPVNACGV  114

Query  1978  VQFGSNQKLPERMEFVDETKKLFQGTD-IETIFAQS----SSSSANGDVFGLSGSLAS  1820
             V FGS  K+ E  +F+D+T+ L +  + I+ I        S    N D+ GL  S++S
Sbjct  115   VLFGSRNKILETTDFLDQTQSLLKEINGIDMIDGSGNEVLSMDFTNDDLNGLLASISS  172



>ref|XP_009400444.1| PREDICTED: transcription factor bHLH157-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=684

 Score =   189 bits (481),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 143/203 (70%), Gaps = 15/203 (7%)
 Frame = -1

Query  1120  IVSLIGENCSTN-----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRE  962
             I S I ++CS N     +  TK  E+ +K VKK+A+PG  TRP PKDR +  +RL ELRE
Sbjct  439   ICSWIDDSCSMNTEGSVLDQTKKPEEAAKVVKKRARPGESTRPRPKDRQQIQDRLKELRE  498

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSNT  797
             ++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ +E K   ++ G   KD NS    
Sbjct  499   IVPNGAKCSIDALLDKTIKHMLFLQSVTKYADKLKQADEPKIIGEESGVVLKD-NSGGVG  557

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
              G TWA E+  QTM+CP++VEDL  PGQML+E+LC+++G FLEI DIIRGFGL ILKG M
Sbjct  558   GGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEDRGLFLEIADIIRGFGLIILKGVM  617

Query  616   ELRETKIWAHFIVEPEANAFVSR  548
             E+RE KIWA F+V  EAN  V+R
Sbjct  618   EIRERKIWARFLV--EANREVTR  638



>ref|XP_004146200.1| PREDICTED: transcription factor bHLH157-like [Cucumis sativus]
 gb|KGN55678.1| hypothetical protein Csa_3G002970 [Cucumis sativus]
Length=772

 Score =   190 bits (483),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 146/450 (32%), Positives = 223/450 (50%), Gaps = 59/450 (13%)
 Frame = -1

Query  1771  PDFVDPIMNMVQSFPVEAFSLFDDQFQ--NGGVETQTNFSSYGFQPSCSSVWGLEGSSLT  1598
             PDF D  ++   +  +   S  DD FQ  +   E  TN ++     +   V G+  SS  
Sbjct  306   PDFCDKHLSEDFTMDLPDISFVDDLFQWFDSSPENGTNGATATLSHNLLHVTGVSTSSSN  365

Query  1597  SLQGNILPGAISQDCDNAFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDEVLD--  1424
              ++ N          D++  ++       TNT ++  +   +     + Q+A D++ D  
Sbjct  366   LVEVNKFVD------DSSKVSVVSAQSLITNTSKSSEQDNTI-----IMQNAKDKLFDSL  414

Query  1423  --GFGCKMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHL  1250
               G GC + +  D++     T G       S+S CTS+ + GS D P  RLF +LG++ L
Sbjct  415   GLGTGCPVGKTWDSM--ITDTHGSYSGGCNSMSTCTSKLATGSTDLPRKRLFWELGIEEL  472

Query  1249  LSDNPssscsfvgsSCNDQLSSTKKRRIEH------------PLAS--------------  1148
             L    ++S +   S  N     +++ ++E             P  S              
Sbjct  473   LDGLSNTSSATKSSVENHHSIGSRRSKMERLSFDSNPIQLLDPCTSMNLTQPSCTVGRFP  532

Query  1147  -EREVTKLETIVSLIGENCSTNV------MNTKDHEkpsk-avkkkakPGTRPIPKDRVR  992
              ++E      + S I ++ STN+      ++ K  E       + K     RP PKDR +
Sbjct  533   CKKEAVPKSQVSSWIDDSYSTNIGGSILELSHKSEEPAKICKKRAKPGESNRPRPKDRQQ  592

Query  991   TYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSN  812
               +R+ ELRE+IP+G K SID LL +TIK +LFLQSVT+ A+ LK+T + K    R    
Sbjct  593   IQDRIKELREIIPSGAKCSIDSLLDRTIKYMLFLQSVTKYADKLKETNKPKLIDQRDGVA  652

Query  811   SNSN------TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIR  650
              N        + GVTWA ++     +CP++VEDL +PGQML+E+LC+E+GFFLEI D+IR
Sbjct  653   VNDKCITERGSGGVTWAFKVGATPTVCPVIVEDLSSPGQMLVEMLCEERGFFLEIADMIR  712

Query  649   GFGLNILKGTMELRETKIWAHFIVEPEANA  560
              +GL ILKG ME+RE KIW  F+VE + NA
Sbjct  713   SYGLTILKGVMEIREDKIWGQFVVEVKVNA  742


 Score =   129 bits (325),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/296 (33%), Positives = 149/296 (50%), Gaps = 45/296 (15%)
 Frame = -1

Query  2356  SETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILG  2177
             ++T   ++L  +CC N WSY VFW F+++NS+ LTL D +YEE++  +  +ML QV++LG
Sbjct  2     AKTELGSVLNRICCSNHWSYGVFWSFDRRNSMLLTLEDIWYEEQVVLVAANMLQQVHMLG  61

Query  2176  SGVVGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVI  2000
              GV+G  AFT  H+W+ SD +N  W S           +  D+ E   QFS G+KT+AVI
Sbjct  62    EGVIGTAAFTGKHQWIFSDASNGEWNSS----------MFQDNLELQQQFSYGVKTVAVI  111

Query  1999  SVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGSLAS  1820
              V P GV+Q GS  K+ E +E +   K+       E I       +  G     +  +AS
Sbjct  112   PVHPHGVIQLGSTHKIWESLEILANAKRSL----CEVI-------NGGGLTLEKTTCMAS  160

Query  1819  S--ICNSSYFMSPEALP--SPDFVDPIM--NMVQSFPVEAFSLFDDQFQNGGVETQTNFS  1658
             S  I + +   +   LP  S D+    M  N    F  ++++ FD Q          + S
Sbjct  161   STDIAHYNDLFTSIVLPANSDDWSLSAMHNNSHTDFTRKSYASFDKQ-------PAFDTS  213

Query  1657  SYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQ--FEYCTNTVQ  1496
             SY  + SC      E S LTS +  +LP +  ++ D  + +  D    ++C NTV+
Sbjct  214   SYFSKSSC------ENSVLTSSE--LLPASDIREQDAQYPSYSDANVLDFCRNTVE  261



>ref|XP_009382310.1| PREDICTED: uncharacterized protein LOC103970308 [Musa acuminata 
subsp. malaccensis]
Length=820

 Score =   191 bits (484),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 132/323 (41%), Positives = 177/323 (55%), Gaps = 57/323 (18%)
 Frame = -1

Query  1351  DFGTSISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSD-----------------------  1241
             +F  S+S C SE  +GS   P N L S+  LD LL+                        
Sbjct  451   NFSVSVSDCLSEMQMGSTAGPRNGLQSEAALDQLLNTINGQTISEGPRHGCLAKSVNPIA  510

Query  1240  ---------------NPssscsfvgsSCNDQLSSTKKRRIEHPLA-----SEREVTKLET  1121
                            +PS   S V S C   +S T    + H ++     S +E      
Sbjct  511   NPDTENQFSMVTNVGSPSVYNSQVPSVCLPSISQTPNVLLPHCISDIIHGSVKEALPKSN  570

Query  1120  IVSLIGENCSTNVMNT-----KDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRE  962
                LI + CS N  ++     K  E+ +K VKK+A+PG   RP PKDR +  +R+ ELRE
Sbjct  571   FSLLIDDCCSMNNESSFPNQPKKPEEAAKVVKKRARPGESARPRPKDRQQIQDRVKELRE  630

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSNT  797
             ++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ E  K   ++ G   KD+ S+ + 
Sbjct  631   IVPNGAKCSIDALLDRTIKHMLFLQSVTKYADKLKQAEAPKMIVEESGVVLKDNTSSGSC  690

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
             +G TWA E+  QTM CP++VEDL  PGQML+E+LC+E+G FLEI DIIRG GL ILKG M
Sbjct  691   DGATWAYEVAGQTMFCPIMVEDLTPPGQMLVEMLCEERGIFLEIADIIRGLGLTILKGVM  750

Query  616   ELRETKIWAHFIVEPEANAFVSR  548
             E+ E K+WA F+V  EAN  V+R
Sbjct  751   EIHERKVWARFLV--EANGDVTR  771


 Score = 55.1 bits (131),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  2035  QFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQ  1907
             QF  GIKTI + S++  GVVQFGS +K+PE  EF+D+ K LFQ
Sbjct  3     QFLAGIKTIVITSLQFSGVVQFGSTKKIPESSEFIDKAKDLFQ  45



>ref|XP_009400443.1| PREDICTED: transcription factor LHW-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=689

 Score =   189 bits (480),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 143/203 (70%), Gaps = 15/203 (7%)
 Frame = -1

Query  1120  IVSLIGENCSTN-----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRE  962
             I S I ++CS N     +  TK  E+ +K VKK+A+PG  TRP PKDR +  +RL ELRE
Sbjct  444   ICSWIDDSCSMNTEGSVLDQTKKPEEAAKVVKKRARPGESTRPRPKDRQQIQDRLKELRE  503

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSNT  797
             ++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ +E K   ++ G   KD NS    
Sbjct  504   IVPNGAKCSIDALLDKTIKHMLFLQSVTKYADKLKQADEPKIIGEESGVVLKD-NSGGVG  562

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
              G TWA E+  QTM+CP++VEDL  PGQML+E+LC+++G FLEI DIIRGFGL ILKG M
Sbjct  563   GGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEDRGLFLEIADIIRGFGLIILKGVM  622

Query  616   ELRETKIWAHFIVEPEANAFVSR  548
             E+RE KIWA F+V  EAN  V+R
Sbjct  623   EIRERKIWARFLV--EANREVTR  643



>ref|XP_010235810.1| PREDICTED: transcription factor EMB1444-like isoform X2 [Brachypodium 
distachyon]
Length=727

 Score =   189 bits (481),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 23/230 (10%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK ++FLQ VT+ AE +K+ +E 
Sbjct  507   TRPRPKDRQQIQDRVKELREIVPNSAKCSIDALLDRTIKHMIFLQGVTKYAEKIKQADEP  566

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L+D       KD++S ++  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  567   KMISKDSGSVLRDNSSGVVLKDNSSAASNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  626

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  627   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  684

Query  523   qllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY*R  374
             QLLQ +  S   + DQL  V  NG PS + +        PIS+P GL  R
Sbjct  685   QLLQQN--SLNRSSDQLAKVISNGVPSFAEHQQS-----PISIPVGLAER  727


 Score = 67.0 bits (162),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 15/108 (14%)
 Frame = -1

Query  2203  MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYG----  2036
             ML QV+++G G++G    +   +W+  D          L   C+    D+ S F G    
Sbjct  1     MLNQVHVVGEGIIGSALASGECRWISDDI------FFNLVQTCN---TDNLSLFQGYTWW  51

Query  2035  --QFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD  1898
               QF  GIKTIAVI +  LGV QFGS QK+ E +EF+D  K  F G +
Sbjct  52    QHQFLSGIKTIAVIPIPTLGVAQFGSTQKVSESLEFLDHVKGTFSGRE  99



>ref|XP_009400440.1| PREDICTED: transcription factor LHW-like isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009400442.1| PREDICTED: transcription factor LHW-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=726

 Score =   189 bits (481),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 143/203 (70%), Gaps = 15/203 (7%)
 Frame = -1

Query  1120  IVSLIGENCSTN-----VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRE  962
             I S I ++CS N     +  TK  E+ +K VKK+A+PG  TRP PKDR +  +RL ELRE
Sbjct  481   ICSWIDDSCSMNTEGSVLDQTKKPEEAAKVVKKRARPGESTRPRPKDRQQIQDRLKELRE  540

Query  961   LIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSNT  797
             ++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ +E K   ++ G   KD NS    
Sbjct  541   IVPNGAKCSIDALLDKTIKHMLFLQSVTKYADKLKQADEPKIIGEESGVVLKD-NSGGVG  599

Query  796   NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTM  617
              G TWA E+  QTM+CP++VEDL  PGQML+E+LC+++G FLEI DIIRGFGL ILKG M
Sbjct  600   GGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMLCEDRGLFLEIADIIRGFGLIILKGVM  659

Query  616   ELRETKIWAHFIVEPEANAFVSR  548
             E+RE KIWA F+V  EAN  V+R
Sbjct  660   EIRERKIWARFLV--EANREVTR  680



>ref|XP_008448575.1| PREDICTED: uncharacterized protein LOC103490712 [Cucumis melo]
Length=772

 Score =   190 bits (482),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 124/334 (37%), Positives = 178/334 (53%), Gaps = 42/334 (13%)
 Frame = -1

Query  1441  FDEVLDGFGCKMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKDWPSNRLFSKLG  1262
             FD +  G GC + +  DN+     T G       S+S CTS+ + GS D P  RLF +LG
Sbjct  411   FDSLGLGTGCSVGKTWDNM--ITDTHGSYSGGCNSMSTCTSKLATGSTDHPRKRLFWELG  468

Query  1261  LDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEH------------PLAS----------  1148
             ++ LL    ++S +   S  N     +++ ++E             P  S          
Sbjct  469   IEELLDGLSNTSSATKSSVENHHSIGSRRSKMERLSLDSNPIQLLDPCTSMNLTQPSCMV  528

Query  1147  -----EREVTKLETIVSLIGENCSTNV------MNTKDHEkpsk-avkkkakPGTRPIPK  1004
                  ++E      + S I ++ STN+      ++ K  E       + K     RP PK
Sbjct  529   GRFPCKKEAVPKSQVSSWIDDSYSTNIGGSILELSHKSEEPAKICKKRVKPGESNRPRPK  588

Query  1003  DRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGR  824
             DR +  +R+ ELRE+IP+G K SID LL +TIK +LFLQSVT+ A+ LK+T + K    R
Sbjct  589   DRQQIQDRIKELREIIPSGAKCSIDSLLDRTIKYMLFLQSVTKYADKLKETNKPKLIDQR  648

Query  823   KDSNSNSN------TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                  N        + GVTWA ++     +CP++VEDL +PGQML+E+LC+E+GFFLEI 
Sbjct  649   DGVAVNDKCMTERGSGGVTWAFKVGATPTVCPVIVEDLSSPGQMLVEMLCEERGFFLEIA  708

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANA  560
             D+IR +GL ILKG ME+RE KIW  F+VE + NA
Sbjct  709   DMIRSYGLTILKGVMEIREDKIWGQFVVEVKVNA  742


 Score =   133 bits (334),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 98/298 (33%), Positives = 150/298 (50%), Gaps = 49/298 (16%)
 Frame = -1

Query  2356  SETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILG  2177
             ++T   ++L  +CC N WSY VFW F+++NS+ LTL D +YEE++  +  +ML QV++LG
Sbjct  2     AKTELGSVLNRICCSNHWSYGVFWSFDRRNSMLLTLEDIWYEEQVVLVAANMLQQVHMLG  61

Query  2176  SGVVGQVAFTKNHKWMLSD-TNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVI  2000
              GV+G  AFT NH+W+ SD +N  W S           +  D+ E   QFS G+KT+AVI
Sbjct  62    EGVIGTAAFTGNHRWIFSDASNGEWNSS----------MFQDNLELQQQFSYGVKTVAVI  111

Query  1999  SVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGS--L  1826
              V P GV+Q GS  K+ E +E + + K+             S     NG    L  +  +
Sbjct  112   PVHPHGVIQLGSTHKIWESLEILADAKR-------------SLCQVINGGGLALEKTTCM  158

Query  1825  ASSICNSSY--FMSPEALP--SPDFVDPIM--NMVQSFPVEAFSLFDDQFQNGGVETQTN  1664
             ASS   + Y    +   LP  S D+    M  N+   F   +++ FD Q          +
Sbjct  159   ASSTNIARYNDLFTSIVLPANSDDWSLSAMHNNIHTDFTRNSYASFDKQ-------PAFD  211

Query  1663  FSSYGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDNAFCALPDQ--FEYCTNTVQ  1496
              SSY  + SC      E S LTS +  +LP +  ++ D  + +  D    ++C NT++
Sbjct  212   TSSYFSKSSC------ENSVLTSSE--LLPASDIREQDAQYPSYSDANVLDFCRNTME  261



>ref|XP_009389438.1| PREDICTED: transcription factor LHW-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   189 bits (480),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 144/204 (71%), Gaps = 14/204 (7%)
 Frame = -1

Query  1123  TIVSLIGENCSTNVMNT-----KDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELR  965
             TI S I ++CS N  N+     K  E+ +K VKK+A+PG  TRP PKDR +  +RL ELR
Sbjct  456   TICSWIDDSCSMNTENSVLNQPKKPEEAAKVVKKRARPGESTRPRPKDRQQIQDRLKELR  515

Query  964   ELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSN  800
             E++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ +E K   ++ G   KD++    
Sbjct  516   EIVPNGAKCSIDALLDKTIKHMLFLQSVTKYADKLKQADEPKIIGEESGVVLKDNSGGVG  575

Query  799   TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGT  620
               G TWA E+  QTM+CP++VEDL  PGQML+E++C+++G FLEI DIIRGFGL ILKG 
Sbjct  576   GGGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMVCEDRGLFLEIADIIRGFGLIILKGI  635

Query  619   MELRETKIWAHFIVEPEANAFVSR  548
             ME+RE KIWA F+V  EAN  V+R
Sbjct  636   MEIRERKIWARFLV--EANREVTR  657



>ref|XP_009389431.1| PREDICTED: transcription factor LHW-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   189 bits (480),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 144/204 (71%), Gaps = 14/204 (7%)
 Frame = -1

Query  1123  TIVSLIGENCSTNVMNT-----KDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELR  965
             TI S I ++CS N  N+     K  E+ +K VKK+A+PG  TRP PKDR +  +RL ELR
Sbjct  485   TICSWIDDSCSMNTENSVLNQPKKPEEAAKVVKKRARPGESTRPRPKDRQQIQDRLKELR  544

Query  964   ELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSN  800
             E++PNG K SID LL +TIK +LFLQSVT+ A+ LK+ +E K   ++ G   KD++    
Sbjct  545   EIVPNGAKCSIDALLDKTIKHMLFLQSVTKYADKLKQADEPKIIGEESGVVLKDNSGGVG  604

Query  799   TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGT  620
               G TWA E+  QTM+CP++VEDL  PGQML+E++C+++G FLEI DIIRGFGL ILKG 
Sbjct  605   GGGATWAYEVAGQTMVCPIIVEDLTPPGQMLVEMVCEDRGLFLEIADIIRGFGLIILKGI  664

Query  619   MELRETKIWAHFIVEPEANAFVSR  548
             ME+RE KIWA F+V  EAN  V+R
Sbjct  665   MEIRERKIWARFLV--EANREVTR  686



>ref|NP_001146644.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACL54454.1| unknown [Zea mays]
 gb|AFW59165.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=629

 Score =   187 bits (476),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 146/218 (67%), Gaps = 10/218 (5%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + AE +K+ +E 
Sbjct  416   TRPRPKDRQLIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVNKYAEKIKQADEP  475

Query  841   K--DKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGF  677
             K  DK      KD+       G TWA E+  QTM+CP+++EDL  PGQML+E+LC+EQG 
Sbjct  476   KIIDKGSGVILKDNPVAGTNGGATWAYEVAGQTMVCPIIIEDLSPPGQMLVEMLCEEQGL  535

Query  676   FLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPS  497
             FLEI D IRG GL +LKG MEL + KIW+ F+V  EAN  V+R ++F SL+QLL+ +  S
Sbjct  536   FLEIADNIRGIGLTVLKGRMELCDGKIWSRFLV--EANREVTRMDIFLSLVQLLEQN--S  591

Query  496   ELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
              + + DQ+  V +NG PS  +N   S +  P+ +PE L
Sbjct  592   LVRSTDQMAKVMNNGVPSF-ANHQRSPLLVPVGIPERL  628


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = -1

Query  2215  LIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDT-NSVWQSHHGLADNCDELLQDDDSEFY  2039
             ++  ML  V ++G G++GQ   +   +W+  DT +++ Q  H  ADN D  L    + + 
Sbjct  1     MVQKMLNLVEVVGEGILGQALVSGECQWIYDDTCHALNQISH--ADNGD--LHQGYTWWQ  56

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              QF  G+KTIAV+ ++  G+VQFGS +K+P    F+++ + +F
Sbjct  57    HQFLSGMKTIAVLPLQLHGLVQFGSTRKVPRSSVFLNQVRDIF  99



>ref|XP_003570083.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Brachypodium 
distachyon]
Length=774

 Score =   189 bits (479),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 150/230 (65%), Gaps = 23/230 (10%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK ++FLQ VT+ AE +K+ +E 
Sbjct  554   TRPRPKDRQQIQDRVKELREIVPNSAKCSIDALLDRTIKHMIFLQGVTKYAEKIKQADEP  613

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L+D       KD++S ++  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  614   KMISKDSGSVLRDNSSGVVLKDNSSAASNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  673

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  674   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  731

Query  523   qllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY*R  374
             QLLQ +  S   + DQL  V  NG PS + +        PIS+P GL  R
Sbjct  732   QLLQQN--SLNRSSDQLAKVISNGVPSFAEHQQS-----PISIPVGLAER  774


 Score =   100 bits (250),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 83/151 (55%), Gaps = 15/151 (10%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L +LC G GWSYA  W  ++++   LT+ + + E+E   ++++ML QV+++G G++G   
Sbjct  5     LGALCRGGGWSYAAIWSTDRRDPRLLTIGECHCEDEARKVVENMLNQVHVVGEGIIGSAL  64

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYG------QFSCGIKTIAVISVE  1991
              +   +W+  D          L   C+    D+ S F G      QF  GIKTIAVI + 
Sbjct  65    ASGECRWISDDI------FFNLVQTCN---TDNLSLFQGYTWWQHQFLSGIKTIAVIPIP  115

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLFQGTD  1898
              LGV QFGS QK+ E +EF+D  K  F G +
Sbjct  116   TLGVAQFGSTQKVSESLEFLDHVKGTFSGRE  146



>ref|XP_010106138.1| hypothetical protein L484_003641 [Morus notabilis]
 gb|EXC07932.1| hypothetical protein L484_003641 [Morus notabilis]
Length=816

 Score =   189 bits (480),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 120/279 (43%), Positives = 161/279 (58%), Gaps = 33/279 (12%)
 Frame = -1

Query  1291  PSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEHP---------------  1157
             P   LFS+LGL+ LL    SSSC    S  +   +  K+RRIE                 
Sbjct  473   PKKGLFSELGLEELLVGASSSSCLTKSSFEDQSSTPAKRRRIESSSVKCSQSQMSLLQYN  532

Query  1156  ------LASEREVTK------LETIVSLIGENCSTNVMNTKDHEkpskavkkkakPGTRP  1013
                   L +++E+ K      ++   SL   +   +     + +K     + +    TRP
Sbjct  533   LDKADNLMTKKELPKSQVGLWIDDSYSLTAASAVLSQTQKPEEQKKITRKRARPGESTRP  592

Query  1012  IPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK--  839
              PKDR    +R+ ELR +IPNGGK SID LL +TIK ++FLQ VT+  + L+++ E K  
Sbjct  593   RPKDRQLIQDRIKELRGIIPNGGKCSIDSLLDRTIKYMVFLQGVTKHGDKLRQSNEPKLI  652

Query  838   -DKKGRK-DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
              ++ G     N +S   G TWA E+  Q+M+CP++VEDL  PGQMLIE+LC+EQGFFLEI
Sbjct  653   GNENGVPLRDNKSSGGGGATWAFEVGGQSMVCPIIVEDLNPPGQMLIEMLCEEQGFFLEI  712

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              DIIRGFGL+ILKG MELRE KIWAHFIV  EA + V+R
Sbjct  713   ADIIRGFGLSILKGMMELRENKIWAHFIV--EAKSHVTR  749


 Score =   167 bits (423),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 123/187 (66%), Gaps = 10/187 (5%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V K  LKSLC  N WSYAVFW F+ +N + LT+ DAYYE+++G ++D+MLL V++LG G
Sbjct  9     SVIKRTLKSLCVSNAWSYAVFWRFDHRNPMLLTVEDAYYEDQVGAVLDNMLLMVHLLGEG  68

Query  2170  VVGQVAFTKNHKWMLSDTNS-VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
              +GQ A +  H+W+L D  S  W S    +    E  Q DDS+   QFS GIKTIA I +
Sbjct  69    TIGQAALSGKHRWILEDDQSGEWDSVR--SSEIRETFQ-DDSDVSFQFSSGIKTIAAIPI  125

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFA----QSSSSSANGDVFGLSGSL  1826
             EP GVVQFGS +K+ E  EFVD+T +LF+  DIE + A    +++ SS  G+++ ++G  
Sbjct  126   EPRGVVQFGSTEKICENFEFVDQTTRLFR--DIENLSALNHLENAHSSEEGEMYDINGLF  183

Query  1825  ASSICNS  1805
             AS I N+
Sbjct  184   ASLISNN  190



>ref|XP_006647675.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=788

 Score =   189 bits (479),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 112/226 (50%), Positives = 151/226 (67%), Gaps = 20/226 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ EE 
Sbjct  567   TRPRPKDRQQIQDRVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQAEEP  626

Query  844   ----------LKDKKG----RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQML  707
                       LK+       + +S++ SN  G TWA E+  QTM+CP++VEDL  PGQML
Sbjct  627   KMISKDSGAVLKENSSGVVLKDNSSAASNNGGATWAYEVAGQTMVCPIIVEDLSPPGQML  686

Query  706   IEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssl  527
             +E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL
Sbjct  687   VEMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSL  744

Query  526   lqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPE  389
             +QLLQ +  S   + DQ+  V  NG PS + +  +S +  P++L +
Sbjct  745   VQLLQQN--SLNRSPDQIAKVIRNGVPSFAEH-QQSPISVPVALAD  787


 Score = 99.0 bits (245),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 89/146 (61%), Gaps = 4/146 (3%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGV  2168
             +A++ L +LC G GW YA  W  ++++   LT+ + + E++   +++ ML QV+++G G+
Sbjct  1     MAESPLGALCRGGGWCYAAIWRSDRRDPRLLTIGEFHTEDDARNVVEKMLNQVHVVGEGI  60

Query  2167  VGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEP  1988
             +G+   ++  +W+   + S  Q+    ADN D  L    + +  QF CGIKTIAV+ +  
Sbjct  61    IGRALVSRECEWISDTSFSSVQTSD--ADNQD--LFQGYTWWQHQFLCGIKTIAVVPISD  116

Query  1987  LGVVQFGSNQKLPERMEFVDETKKLF  1910
             LGV QFGS +K+ + +EF+D+ K  F
Sbjct  117   LGVAQFGSMEKVSQSLEFLDQVKGTF  142



>gb|KCW77335.1| hypothetical protein EUGRSUZ_D01696 [Eucalyptus grandis]
Length=495

 Score =   184 bits (467),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 156/422 (37%), Positives = 222/422 (53%), Gaps = 62/422 (15%)
 Frame = -1

Query  1507  NTVQNVLERPVMTSTHELGQ---SAFDEVLDGFGCKMPEKSDNIRKPAATSGQQWDFGTS  1337
             ++V +V++R   TS   + Q   S ++ + D F   M EK+ NI+         +D    
Sbjct  84    SSVSSVIDRGDYTSELPINQATGSTWNSISDAF--MMEEKTINIQN---AERDVFDESGV  138

Query  1336  ISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDN-------------PssscsfvgsSCND  1196
              +GC  E        P   LFS+LGL+     N             P +    V  SC D
Sbjct  139   NAGCKLEPGYYEDGGPWKGLFSELGLEEFFEGNQNSVTKSGFQESPPFAQREMVEQSCYD  198

Query  1195  ------------QLSSTKKRRIEHPLASEREVTKLETIVS------LIGENCSTN-----  1085
                             T    I + L  E+++ + E +         I ++ S N     
Sbjct  199   YKEFQSSSLSCSGSMKTSMNPIPY-LYKEKDLVQREVVFPKSQVGLWIDDSYSVNTRGAT  257

Query  1084  VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQT  911
             VM+ K  E+P KA +K+A+PG  TRP PKDR +  +RL ELR +IPNG K SID LL +T
Sbjct  258   VMSPKRTEEPMKAPRKRARPGESTRPRPKDRQQIQDRLKELRGIIPNGAKCSIDALLDRT  317

Query  910   IKQLLFLQSVTRLAEGLKKTEE-----------LKDKKGRKDSNSNSNTNGVTWACEIEN  764
             +K +LFLQS+ + A+ LK+  E           LK+++  +D    S   G TWA E+  
Sbjct  318   VKHMLFLQSMMKYADKLKRAAETKLIGQGNSLVLKNERDERDVGDGSR-GGTTWAYEVGG  376

Query  763   QTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHF  584
             Q M+CP+VVEDL  PGQMLIE+LC +QG FLEI DIIRGFGLNILKG M +RE KIW+ F
Sbjct  377   QAMVCPIVVEDLGLPGQMLIEMLCDDQGLFLEIADIIRGFGLNILKGDMGVREGKIWSRF  436

Query  583   IVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFP  404
             IV  EA   V+R ++F SL+QL+Q +    +++  Q G+  D+ +  + ++  E  +P P
Sbjct  437   IV--EATRHVTRMDVFWSLIQLVQETNSHGINSTTQPGDAMDS-QFYSCNDYKEPLLPLP  493

Query  403   IS  398
             IS
Sbjct  494   IS  495



>ref|XP_002454491.1| hypothetical protein SORBIDRAFT_04g032060 [Sorghum bicolor]
 gb|EES07467.1| hypothetical protein SORBIDRAFT_04g032060 [Sorghum bicolor]
Length=777

 Score =   187 bits (476),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 120/232 (52%), Positives = 152/232 (66%), Gaps = 27/232 (12%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  557   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADE-  615

Query  841   KDKKGRKDSNS--NSNTNGV--------------TWACEIENQTMICPLVVEDLCTPGQM  710
               K   KDS +  N N+NGV              TWA E+  QTM+CP++VEDL  PGQM
Sbjct  616   -PKMISKDSGAVLNDNSNGVVLKDDPSGGCNGGATWAYEVAGQTMVCPIIVEDLAPPGQM  674

Query  709   LIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfss  530
             L+E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F S
Sbjct  675   LVEMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLS  732

Query  529   llqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY*R  374
             L+QLLQ +  S   + DQL  V +NG  S     +E   P P+S+P GL  R
Sbjct  733   LVQLLQQN--SLNRSSDQLTKVMNNGILS----FAEHQQP-PVSIPVGLAGR  777


 Score = 87.0 bits (214),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L++LC   GWSY   W  ++++   LT+ + + E+E   +++ M+ QV+++G G++G+  
Sbjct  5     LEALCRAGGWSYGAIWRPDRRDPRLLTVGECHCEDEATKVVEKMVNQVHVVGEGLIGRAL  64

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQ  1973
              +   +W +SD      S    ADN    L    + +  QF  GIKTIAV+ +   GV Q
Sbjct  65    ISGEFQW-ISDDIPFSFSQISDADNLG--LCQGYTWWQHQFLSGIKTIAVVPMPAFGVAQ  121

Query  1972  FGSNQKLPERMEFVDETK  1919
             FGS QK+ E +EF+D+ K
Sbjct  122   FGSMQKVSESLEFLDQVK  139



>ref|XP_008644112.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X3 [Zea mays]
Length=711

 Score =   187 bits (474),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 139/207 (67%), Gaps = 18/207 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  493   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADEP  552

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L D       KD+ S  +  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  553   NMISKDNGSVLNDNSHGVVLKDNPSGGSNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  612

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  613   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  670

Query  523   qllqlSGPSELHARDQLGNVRDNGRPS  443
             QLLQ +  S   + DQL  V +NG PS
Sbjct  671   QLLQQN--SRNRSSDQLVKVMNNGIPS  695


 Score = 60.8 bits (146),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 56/95 (59%), Gaps = 3/95 (3%)
 Frame = -1

Query  2203  MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSC  2024
             M+ QV+++G G++G+   +  H+W+  D   +  S   ++D  +  L    + +  QF  
Sbjct  1     MVNQVHVVGEGLIGRTLISGEHQWISDD---IPFSFSQISDEDNLGLCQGYTWWQHQFLS  57

Query  2023  GIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
             GIKTIAV+ +   GV QFGS QK+ E ++F+D+ K
Sbjct  58    GIKTIAVVPMPAFGVAQFGSMQKVSESLQFLDQVK  92



>ref|XP_008644113.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X4 [Zea mays]
Length=645

 Score =   186 bits (472),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 139/207 (67%), Gaps = 18/207 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  427   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADEP  486

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L D       KD+ S  +  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  487   NMISKDNGSVLNDNSHGVVLKDNPSGGSNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  546

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  547   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  604

Query  523   qllqlSGPSELHARDQLGNVRDNGRPS  443
             QLLQ +  S   + DQL  V +NG PS
Sbjct  605   QLLQQN--SRNRSSDQLVKVMNNGIPS  629



>gb|AFW59164.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=844

 Score =   188 bits (477),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 146/218 (67%), Gaps = 10/218 (5%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + AE +K+ +E 
Sbjct  631   TRPRPKDRQLIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVNKYAEKIKQADEP  690

Query  841   K--DKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGF  677
             K  DK      KD+       G TWA E+  QTM+CP+++EDL  PGQML+E+LC+EQG 
Sbjct  691   KIIDKGSGVILKDNPVAGTNGGATWAYEVAGQTMVCPIIIEDLSPPGQMLVEMLCEEQGL  750

Query  676   FLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPS  497
             FLEI D IRG GL +LKG MEL + KIW+ F+V  EAN  V+R ++F SL+QLL+ +  S
Sbjct  751   FLEIADNIRGIGLTVLKGRMELCDGKIWSRFLV--EANREVTRMDIFLSLVQLLEQN--S  806

Query  496   ELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
              + + DQ+  V +NG PS  +N   S +  P+ +PE L
Sbjct  807   LVRSTDQMAKVMNNGVPSF-ANHQRSPLLVPVGIPERL  843


 Score =   100 bits (248),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 85/145 (59%), Gaps = 5/145 (3%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             +A L +LC   GWSYA  W F+ Q+   LTL D Y E+E   ++  ML  V ++G G++G
Sbjct  2     EAALGALCRAGGWSYAAVWRFHPQDPRLLTLGDCYCEDEAKAMVQKMLNLVEVVGEGILG  61

Query  2161  QVAFTKNHKWMLSDT-NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             Q   +   +W+  DT +++ Q  H  ADN D  L    + +  QF  G+KTIAV+ ++  
Sbjct  62    QALVSGECQWIYDDTCHALNQISH--ADNGD--LHQGYTWWQHQFLSGMKTIAVLPLQLH  117

Query  1984  GVVQFGSNQKLPERMEFVDETKKLF  1910
             G+VQFGS +K+P    F+++ + +F
Sbjct  118   GLVQFGSTRKVPRSSVFLNQVRDIF  142



>ref|NP_001169943.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
 gb|ACN35319.1| unknown [Zea mays]
 gb|AFW72761.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=731

 Score =   186 bits (473),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 139/207 (67%), Gaps = 18/207 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  513   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADEP  572

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L D       KD+ S  +  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  573   NMISKDNGSVLNDNSHGVVLKDNPSGGSNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  632

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  633   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  690

Query  523   qllqlSGPSELHARDQLGNVRDNGRPS  443
             QLLQ +  S   + DQL  V +NG PS
Sbjct  691   QLLQQN--SRNRSSDQLVKVMNNGIPS  715


 Score = 71.6 bits (174),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 68/115 (59%), Gaps = 3/115 (3%)
 Frame = -1

Query  2263  LFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLA  2084
             + LT+ + + E+E   ++D M+ QV+++G G++G+   +  H+W+  D   +  S   ++
Sbjct  1     MLLTVGECHCEDEARKVVDKMVNQVHVVGEGLIGRTLISGEHQWISDD---IPFSFSQIS  57

Query  2083  DNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
             D  +  L    + +  QF  GIKTIAV+ +   GV QFGS QK+ E ++F+D+ K
Sbjct  58    DEDNLGLCQGYTWWQHQFLSGIKTIAVVPMPAFGVAQFGSMQKVSESLQFLDQVK  112



>ref|NP_001047714.1| Os02g0673500 [Oryza sativa Japonica Group]
 dbj|BAD29456.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF09628.1| Os02g0673500 [Oryza sativa Japonica Group]
 gb|EEE57559.1| hypothetical protein OsJ_07902 [Oryza sativa Japonica Group]
Length=792

 Score =   187 bits (475),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 151/232 (65%), Gaps = 25/232 (11%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  570   TRPRPKDRQQIQDRVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADEP  629

Query  844   -----------LKDKKG----RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQM  710
                        LK+       + +S++ SN  G TWA E+  +TM+CP+++EDL  PGQM
Sbjct  630   KMISNKDSGAVLKENSSGVVLKDNSSAGSNNGGATWAYEVAGRTMVCPIIIEDLSPPGQM  689

Query  709   LIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfss  530
             L+E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F S
Sbjct  690   LVEMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLS  747

Query  529   llqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGLY*R  374
             L+QLLQ +  S   + DQ+  V  NG PS + +        PIS+P GL  R
Sbjct  748   LVQLLQQN--SLNRSSDQISKVIRNGVPSFAEHQQS-----PISVPVGLADR  792


 Score = 98.2 bits (243),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 84/141 (60%), Gaps = 4/141 (3%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L +LC G GW YA  W  ++++   LT+ + + E+    +++ ML QV+++G G++G+  
Sbjct  7     LGALCRGGGWCYAAIWRSDRRDPRLLTIGEFHSEDGTRNVVEKMLNQVHVVGEGIIGRAL  66

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQ  1973
              +   +W+   + S  Q+    ADN D  L    + +  QF CGIKTIAVI +  LGV Q
Sbjct  67    VSGECQWISDTSFSFAQTSD--ADNQD--LFQGYTWWQHQFLCGIKTIAVIPIADLGVAQ  122

Query  1972  FGSNQKLPERMEFVDETKKLF  1910
             FGS QK+ E +EF+D+ K +F
Sbjct  123   FGSMQKISECLEFLDQVKGIF  143



>ref|XP_009398085.1| PREDICTED: transcription factor LHW-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398087.1| PREDICTED: transcription factor LHW-like [Musa acuminata subsp. 
malaccensis]
Length=731

 Score =   186 bits (472),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 132/198 (67%), Gaps = 13/198 (7%)
 Frame = -1

Query  1108  IGENCSTNVMNT------KDHEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNG  947
             I ++CS N  ++      K  E      + +    TRP PKDR +  +RL ELRE++PNG
Sbjct  491   IDDSCSINTESSVLSQSKKPEEAAKVKKRARPGESTRPRPKDRQQIQDRLNELREIVPNG  550

Query  946   GKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK---DKKG--RKDSNSNSNTNGVTW  782
              K SID LL +TIK +LFLQSVT+ A+ LK+ +E K   ++ G   KD+   ++  G TW
Sbjct  551   AKCSIDALLDKTIKHMLFLQSVTKYADKLKQADEPKIISEQSGVVLKDNPGGASGGGATW  610

Query  781   ACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRET  602
             A E+  QTM+CP++VEDL   GQML+E++C+++G FLEI DIIRGFGL ILKG ME+RE 
Sbjct  611   AYEVAGQTMVCPIIVEDLTPSGQMLVEMVCEDRGLFLEIADIIRGFGLIILKGVMEIREC  670

Query  601   KIWAHFIVEPEANAFVSR  548
             KIWA F+V  EAN  V+R
Sbjct  671   KIWARFLV--EANREVTR  686



>ref|XP_008644109.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 ref|XP_008644110.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X1 [Zea mays]
 gb|AFW72762.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=758

 Score =   186 bits (473),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 139/207 (67%), Gaps = 18/207 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  540   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADEP  599

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L D       KD+ S  +  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  600   NMISKDNGSVLNDNSHGVVLKDNPSGGSNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  659

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  660   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  717

Query  523   qllqlSGPSELHARDQLGNVRDNGRPS  443
             QLLQ +  S   + DQL  V +NG PS
Sbjct  718   QLLQQN--SRNRSSDQLVKVMNNGIPS  742


 Score = 90.5 bits (223),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L +LC   GWSY   W  ++++   LT+ + + E+E   ++D M+ QV+++G G++G+  
Sbjct  5     LGALCRAGGWSYGAIWRPDRRDPRLLTVGECHCEDEARKVVDKMVNQVHVVGEGLIGRTL  64

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQ  1973
              +  H+W+  D   +  S   ++D  +  L    + +  QF  GIKTIAV+ +   GV Q
Sbjct  65    ISGEHQWISDD---IPFSFSQISDEDNLGLCQGYTWWQHQFLSGIKTIAVVPMPAFGVAQ  121

Query  1972  FGSNQKLPERMEFVDETK  1919
             FGS QK+ E ++F+D+ K
Sbjct  122   FGSMQKVSESLQFLDQVK  139



>ref|XP_008644111.1| PREDICTED: putative HLH DNA-binding domain superfamily protein 
isoform X2 [Zea mays]
Length=752

 Score =   186 bits (472),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 139/207 (67%), Gaps = 18/207 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  ER+ ELRE++PN  K SID LL +TIK +LFLQSVT+ AE +K+ +E 
Sbjct  534   TRPRPKDRQQIQERVKELREIVPNSAKCSIDALLDRTIKHMLFLQSVTKYAEKIKQADEP  593

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       L D       KD+ S  +  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  594   NMISKDNGSVLNDNSHGVVLKDNPSGGSNGGATWAYEVAGQTMVCPIIVEDLAPPGQMLV  653

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssll  524
             E+LC+E+GFFLEI D IRGFGL ILKG MELR+ KI A F+V  EAN  V+R ++F SL+
Sbjct  654   EMLCEERGFFLEIADTIRGFGLTILKGLMELRDGKIMARFLV--EANKNVTRMDIFLSLV  711

Query  523   qllqlSGPSELHARDQLGNVRDNGRPS  443
             QLLQ +  S   + DQL  V +NG PS
Sbjct  712   QLLQQN--SRNRSSDQLVKVMNNGIPS  736


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 76/138 (55%), Gaps = 9/138 (7%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L +LC   GWSY   W  ++++   LT+ + + E+E   ++D M+ QV+++G G++G+  
Sbjct  5     LGALCRAGGWSYGAIWRPDRRDPRLLTVGECHCEDEARKVVDKMVNQVHVVGEGLIGRTL  64

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQ  1973
              +  H+W+  D   +  S   ++D  +  L    + +  QF  GIKTIAV+ +   GV Q
Sbjct  65    ISGEHQWISDD---IPFSFSQISDEDNLGLCQGYTWWQHQFLSGIKTIAVVPMPAFGVAQ  121

Query  1972  FGSNQKLPERMEFVDETK  1919
             FGS QK      F+D+ K
Sbjct  122   FGSMQK------FLDQVK  133



>ref|XP_007145951.1| hypothetical protein PHAVU_006G000400g [Phaseolus vulgaris]
 gb|ESW17945.1| hypothetical protein PHAVU_006G000400g [Phaseolus vulgaris]
Length=831

 Score =   185 bits (470),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/299 (42%), Positives = 168/299 (56%), Gaps = 44/299 (15%)
 Frame = -1

Query  1342  TSISGCTSEHSIGSKDWPSNRLFSKLGLDHLL-----SDNPssscsfvgsSCNDQLSSTK  1178
             T+ S C SE ++G+      RLFS+LG++  L      D PS++            SS +
Sbjct  493   TAFSDCISESNVGTFG-SGKRLFSELGIEEFLHGSNFGDQPSTNRKQRTE------SSPE  545

Query  1177  KRRIEHPLASEREVTKLETIVSLIGE-------------------NCSTNVMNTKD----  1067
             KR  +H L S   V KL+   +L  +                   N +T      D    
Sbjct  546   KRNPKH-LTSHALVPKLDITNNLADQKEIFSKSQVGVGGLWINDRNGNTGRAGRADAKPQ  604

Query  1066  ---HEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLL  896
                        + +    TRP PKDR +  +R+ ELR +IPNGGK SID LL +TI+ ++
Sbjct  605   KVVEHNKVTRKRARPGETTRPRPKDRQQIQDRIGELRGIIPNGGKCSIDSLLDRTIRYMI  664

Query  895   FLQSVTRLAEGLKKTEELKDKKGRKDS---NSNSNTNGVTWACEIENQTMICPLVVEDLC  725
             FLQS+T+ A+ L++  E K  +  KDS   +S  +  GVT A E+E QTM+CP++VED+ 
Sbjct  665   FLQSITKYADKLQEPSEPKLIEKAKDSSVGDSKKSGGGVTCAFEVEGQTMVCPIIVEDMD  724

Query  724   TPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              PGQMLIE+L +EQG FLEIVDII GFGLNILKG ME+R+TKIWA FIV  EAN  V+R
Sbjct  725   PPGQMLIEMLFEEQGSFLEIVDIIGGFGLNILKGKMEIRDTKIWARFIV--EANRHVTR  781


 Score =   120 bits (302),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 99/321 (31%), Positives = 149/321 (46%), Gaps = 55/321 (17%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             T  +  LK+LC  +G SY + W  + QN+L L + D Y E+++G  I + +  V+ +G G
Sbjct  10    TSLRNKLKTLCAVDGCSYVILWRIHPQNTLVLRVEDVYCEDQLGEEIVNTVPHVHSMGEG  69

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             +VGQ A T  H+W+ SD              C+E     D   + QF  GIKT+ VISV+
Sbjct  70    IVGQAALTGKHRWVDSD-----------GQMCEE-----DYGLHPQFLSGIKTVVVISVK  113

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSS------ANGDVFGLSGS  1829
             P GVVQFGS +K+ +R++FV++T++L +G + E +    +SS        N D+ GL  S
Sbjct  114   PWGVVQFGSKKKILDRVKFVEQTERLLRGIEDEGLLDVFNSSRDLYLDCENYDLNGLLAS  173

Query  1828  LASS------------------ICNS-SYFMSPEALPSPDFVDPIMNMVQSFPVEAFSLF  1706
             ++S                   + NS SY    ++ PS   +D I+    + P+  FS  
Sbjct  174   ISSENLYDWNLKSVHSDNSEMLLGNSCSYASLDDSFPS---MDMILVEEGTTPMHGFSYL  230

Query  1705  DDQFQNGGVETQTNFS-----SYGFQPSCS-----SVWGLEGSSLTSLQGNILPGAISQD  1556
              DQ     VE Q  FS      Y      S       W  E SSL SL    +     +D
Sbjct  231   CDQLA-PAVEAQAVFSDRDSNDYSMNTIISRNPSFGTWSGEISSLNSLGQQPVSEIRDED  289

Query  1555  CDNAFCALPDQFEYCTNTVQN  1493
              +   C   ++F      VQ+
Sbjct  290   VEYMHCKEANEFSSNKLAVQD  310



>ref|XP_007039440.1| Serine/threonine-protein kinase WNK-related, putative isoform 
3 [Theobroma cacao]
 gb|EOY23941.1| Serine/threonine-protein kinase WNK-related, putative isoform 
3 [Theobroma cacao]
Length=800

 Score =   183 bits (464),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/364 (35%), Positives = 178/364 (49%), Gaps = 41/364 (11%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + +  +V K  LK+LCC NGWSY VFW F+Q+NS+ LT+ DAYYEE+MG L+D MLL+
Sbjct  1     MGEAEMGSVLKQTLKNLCCSNGWSYGVFWRFDQRNSMLLTMEDAYYEEQMGPLVDSMLLK  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTN-SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
              +ILG G++GQ AFT  H+W+  D++   W S        ++ +  D+SEF  QFS GIK
Sbjct  61    FHILGQGIIGQAAFTGKHQWIFPDSHGKAWDS------TGNQNIFQDESEFQNQFSSGIK  114

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLS  1835
             TIA+ISVE  GVVQFGS QK+ E +EF+DETKKLF   +         + + N D F  S
Sbjct  115   TIAIISVETRGVVQFGSTQKILEGLEFLDETKKLFYAMESCHGLIPLENETCNLDGFFAS  174

Query  1834  GSLASSICNSSYFM-------SPEALPSP------------DFVDPIMNMVQSFPVEAFS  1712
              + + +  N +           P+  P              +  D  +N VQ    +  S
Sbjct  175   LAASGNFYNENLITEQGGCSKEPKGRPCSLTNLSKSSSSMREIQDQRINSVQ----QNLS  230

Query  1711  LFDDQFQNGGVETQTNFSS-----YGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDN  1547
                 Q Q    E Q   S            C+S W  EGS LTS + ++       D  N
Sbjct  231   HLRTQLQTISAEAQIISSGKTGNCLAADTPCASTWSSEGSILTSFETSLPSERGIWDSPN  290

Query  1546  AFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDE--VLDGFGCKMPEKSDNIRKPA  1373
             A     +    C  T Q+       TS +  G+    E  ++D FG    + ++N+    
Sbjct  291   ALPRKANGHLLCGKTEQHFQGASTFTSFYSTGELVDAELPIVDSFG----KTAENLHSLG  346

Query  1372  ATSG  1361
              T G
Sbjct  347   CTGG  350


 Score =   172 bits (437),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 131/344 (38%), Positives = 175/344 (51%), Gaps = 57/344 (17%)
 Frame = -1

Query  1471  TSTHELGQSAFDEVLDGFGC-KMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKD  1295
             T  H+ G   FD+V   FG  K  E  ++I  P    G      + +S   SE  + S +
Sbjct  449   TIVHDDGYDLFDDVGLNFGFGKTGECLEDIIMPL-LHGDNAAVSSGMSESISELDVHSMN  507

Query  1294  WPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEHPLASEREVTKLETIV  1115
                  LFS+LGL+ LL D  S S     SS  DQ S+TK+R+ E   ++  +        
Sbjct  508   GKRKGLFSELGLEELL-DGVSHSSYATKSSVEDQFSTTKRRKSESSSSNFHQG-------  559

Query  1114  SLIGENCSTNVMNTKDHE-----------------------------------------k  1058
               +G +CS   MN   H                                          K
Sbjct  560   QFVGLSCSGGSMNLVQHSHNWDKSNNTIFNKEVHQKSQVGVWIDDSYSVNSGHAVVATSK  619

Query  1057  pskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVT  878
                  + K    TRP PKDR    +R+ ELR +IP+ GK+SID LL +TIK LLFLQ VT
Sbjct  620   KPTRKRAKPGESTRPRPKDRQLIQDRIKELRGIIPHSGKLSIDLLLERTIKHLLFLQGVT  679

Query  877   RLAEGLKKTEELKDKKGRKDS---NSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQML  707
             + A+ +K+T+E K   G+++      N  + G TWA E+  QT+  P+VV+DL  PGQML
Sbjct  680   KYADKIKQTDEPK-LIGQENGLLPKHNKMSGGATWAYEVGAQTI--PIVVKDLNPPGQML  736

Query  706   IEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             IE LC+++G FLEI D+IRGFGLNILKG MEL+E KIWA F+VE
Sbjct  737   IETLCEDRGLFLEIADVIRGFGLNILKGVMELQEDKIWARFMVE  780



>ref|XP_007039441.1| Serine/threonine-protein kinase WNK-related, putative isoform 
4 [Theobroma cacao]
 gb|EOY23942.1| Serine/threonine-protein kinase WNK-related, putative isoform 
4 [Theobroma cacao]
Length=801

 Score =   183 bits (464),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 127/364 (35%), Positives = 178/364 (49%), Gaps = 41/364 (11%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + +  +V K  LK+LCC NGWSY VFW F+Q+NS+ LT+ DAYYEE+MG L+D MLL+
Sbjct  1     MGEAEMGSVLKQTLKNLCCSNGWSYGVFWRFDQRNSMLLTMEDAYYEEQMGPLVDSMLLK  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTN-SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
              +ILG G++GQ AFT  H+W+  D++   W S        ++ +  D+SEF  QFS GIK
Sbjct  61    FHILGQGIIGQAAFTGKHQWIFPDSHGKAWDS------TGNQNIFQDESEFQNQFSSGIK  114

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLS  1835
             TIA+ISVE  GVVQFGS QK+ E +EF+DETKKLF   +         + + N D F  S
Sbjct  115   TIAIISVETRGVVQFGSTQKILEGLEFLDETKKLFYAMESCHGLIPLENETCNLDGFFAS  174

Query  1834  GSLASSICNSSYFM-------SPEALPSP------------DFVDPIMNMVQSFPVEAFS  1712
              + + +  N +           P+  P              +  D  +N VQ    +  S
Sbjct  175   LAASGNFYNENLITEQGGCSKEPKGRPCSLTNLSKSSSSMREIQDQRINSVQ----QNLS  230

Query  1711  LFDDQFQNGGVETQTNFSS-----YGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDN  1547
                 Q Q    E Q   S            C+S W  EGS LTS + ++       D  N
Sbjct  231   HLRTQLQTISAEAQIISSGKTGNCLAADTPCASTWSSEGSILTSFETSLPSERGIWDSPN  290

Query  1546  AFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDE--VLDGFGCKMPEKSDNIRKPA  1373
             A     +    C  T Q+       TS +  G+    E  ++D FG    + ++N+    
Sbjct  291   ALPRKANGHLLCGKTEQHFQGASTFTSFYSTGELVDAELPIVDSFG----KTAENLHSLG  346

Query  1372  ATSG  1361
              T G
Sbjct  347   CTGG  350


 Score =   168 bits (426),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 131/345 (38%), Positives = 175/345 (51%), Gaps = 58/345 (17%)
 Frame = -1

Query  1471  TSTHELGQSAFDEVLDGFGC-KMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKD  1295
             T  H+ G   FD+V   FG  K  E  ++I  P    G      + +S   SE  + S +
Sbjct  449   TIVHDDGYDLFDDVGLNFGFGKTGECLEDIIMPLL-HGDNAAVSSGMSESISELDVHSMN  507

Query  1294  WPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEHPLASEREVTKLETIV  1115
                  LFS+LGL+ LL D  S S     SS  DQ S+TK+R+ E   ++  +        
Sbjct  508   GKRKGLFSELGLEELL-DGVSHSSYATKSSVEDQFSTTKRRKSESSSSNFHQG-------  559

Query  1114  SLIGENCSTNVMNTKDHE-----------------------------------------k  1058
               +G +CS   MN   H                                          K
Sbjct  560   QFVGLSCSGGSMNLVQHSHNWDKSNNTIFNKEVHQKSQVGVWIDDSYSVNSGHAVVATSK  619

Query  1057  pskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGK-MSIDRLLHQTIKQLLFLQSV  881
                  + K    TRP PKDR    +R+ ELR +IP+ GK +SID LL +TIK LLFLQ V
Sbjct  620   KPTRKRAKPGESTRPRPKDRQLIQDRIKELRGIIPHSGKQLSIDLLLERTIKHLLFLQGV  679

Query  880   TRLAEGLKKTEELKDKKGRKDS---NSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQM  710
             T+ A+ +K+T+E K   G+++      N  + G TWA E+  QT+  P+VV+DL  PGQM
Sbjct  680   TKYADKIKQTDEPK-LIGQENGLLPKHNKMSGGATWAYEVGAQTI--PIVVKDLNPPGQM  736

Query  709   LIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             LIE LC+++G FLEI D+IRGFGLNILKG MEL+E KIWA F+VE
Sbjct  737   LIETLCEDRGLFLEIADVIRGFGLNILKGVMELQEDKIWARFMVE  781



>ref|XP_007039438.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
 ref|XP_007039439.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
 gb|EOY23939.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
 gb|EOY23940.1| Serine/threonine-protein kinase WNK-related, putative isoform 
1 [Theobroma cacao]
Length=843

 Score =   183 bits (464),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/364 (35%), Positives = 178/364 (49%), Gaps = 41/364 (11%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M + +  +V K  LK+LCC NGWSY VFW F+Q+NS+ LT+ DAYYEE+MG L+D MLL+
Sbjct  1     MGEAEMGSVLKQTLKNLCCSNGWSYGVFWRFDQRNSMLLTMEDAYYEEQMGPLVDSMLLK  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTN-SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
              +ILG G++GQ AFT  H+W+  D++   W S        ++ +  D+SEF  QFS GIK
Sbjct  61    FHILGQGIIGQAAFTGKHQWIFPDSHGKAWDS------TGNQNIFQDESEFQNQFSSGIK  114

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLS  1835
             TIA+ISVE  GVVQFGS QK+ E +EF+DETKKLF   +         + + N D F  S
Sbjct  115   TIAIISVETRGVVQFGSTQKILEGLEFLDETKKLFYAMESCHGLIPLENETCNLDGFFAS  174

Query  1834  GSLASSICNSSYFM-------SPEALPSP------------DFVDPIMNMVQSFPVEAFS  1712
              + + +  N +           P+  P              +  D  +N VQ    +  S
Sbjct  175   LAASGNFYNENLITEQGGCSKEPKGRPCSLTNLSKSSSSMREIQDQRINSVQ----QNLS  230

Query  1711  LFDDQFQNGGVETQTNFSS-----YGFQPSCSSVWGLEGSSLTSLQGNILPGAISQDCDN  1547
                 Q Q    E Q   S            C+S W  EGS LTS + ++       D  N
Sbjct  231   HLRTQLQTISAEAQIISSGKTGNCLAADTPCASTWSSEGSILTSFETSLPSERGIWDSPN  290

Query  1546  AFCALPDQFEYCTNTVQNVLERPVMTSTHELGQSAFDE--VLDGFGCKMPEKSDNIRKPA  1373
             A     +    C  T Q+       TS +  G+    E  ++D FG    + ++N+    
Sbjct  291   ALPRKANGHLLCGKTEQHFQGASTFTSFYSTGELVDAELPIVDSFG----KTAENLHSLG  346

Query  1372  ATSG  1361
              T G
Sbjct  347   CTGG  350


 Score =   174 bits (441),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 152/409 (37%), Positives = 207/409 (51%), Gaps = 61/409 (15%)
 Frame = -1

Query  1471  TSTHELGQSAFDEVLDGFGC-KMPEKSDNIRKPAATSGQQWDFGTSISGCTSEHSIGSKD  1295
             T  H+ G   FD+V   FG  K  E  ++I  P    G      + +S   SE  + S +
Sbjct  449   TIVHDDGYDLFDDVGLNFGFGKTGECLEDIIMPLL-HGDNAAVSSGMSESISELDVHSMN  507

Query  1294  WPSNRLFSKLGLDHLLSDNPssscsfvgsSCNDQLSSTKKRRIEHPLASEREVTKLETIV  1115
                  LFS+LGL+ LL D  S S     SS  DQ S+TK+R+ E   ++  +        
Sbjct  508   GKRKGLFSELGLEELL-DGVSHSSYATKSSVEDQFSTTKRRKSESSSSNFHQG-------  559

Query  1114  SLIGENCSTNVMNTKDHE-----------------------------------------k  1058
               +G +CS   MN   H                                          K
Sbjct  560   QFVGLSCSGGSMNLVQHSHNWDKSNNTIFNKEVHQKSQVGVWIDDSYSVNSGHAVVATSK  619

Query  1057  pskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGK-MSIDRLLHQTIKQLLFLQSV  881
                  + K    TRP PKDR    +R+ ELR +IP+ GK +SID LL +TIK LLFLQ V
Sbjct  620   KPTRKRAKPGESTRPRPKDRQLIQDRIKELRGIIPHSGKQLSIDLLLERTIKHLLFLQGV  679

Query  880   TRLAEGLKKTEELKDKKGRKDS---NSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQM  710
             T+ A+ +K+T+E K   G+++      N  + G TWA E+  QT+  P+VV+DL  PGQM
Sbjct  680   TKYADKIKQTDEPK-LIGQENGLLPKHNKMSGGATWAYEVGAQTI--PIVVKDLNPPGQM  736

Query  709   LIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfss  530
             LIE LC+++G FLEI D+IRGFGLNILKG MEL+E KIWA F+V  EA   V R ++  S
Sbjct  737   LIETLCEDRGLFLEIADVIRGFGLNILKGVMELQEDKIWARFMV--EATEQVERTDIIWS  794

Query  529   llqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             LL LLQ +G S + + +Q     D G  S S+N  +  +  P+S+ E L
Sbjct  795   LLLLLQQTGTSGIDSANQESRAMDGG-ISLSNNFQQPLLLPPVSMAETL  842



>ref|XP_010053090.1| PREDICTED: transcription factor bHLH157 [Eucalyptus grandis]
Length=829

 Score =   182 bits (463),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 158/422 (37%), Positives = 224/422 (53%), Gaps = 62/422 (15%)
 Frame = -1

Query  1507  NTVQNVLERPVMTSTHELGQ---SAFDEVLDGFGCKMPEKSDNIRKPAATSGQQWDFGTS  1337
             ++V +V++R   TS   + Q   S ++ + D F   M EK+ NI+         +D    
Sbjct  418   SSVSSVIDRGDYTSELPINQATGSTWNSISDAF--MMEEKTINIQN---AERDVFDESGV  472

Query  1336  ISGCTSEHSIGSKDWPSNRLFSKLGLDHLLSDN-------------PssscsfvgsSCND  1196
              +GC  E        P   LFS+LGL+     N             P +    V  SC D
Sbjct  473   NAGCKLEPGYYEDGGPWKGLFSELGLEEFFEGNQNSVTKSGFQESPPFAQREMVEQSCYD  532

Query  1195  ------------QLSSTKKRRIEHPLASEREVTKLETI-----VSL-IGENCSTN-----  1085
                             T    I + L  E+++ + E +     V L I ++ S N     
Sbjct  533   YKEFQSSSLSCSGSMKTSMNPIPY-LYKEKDLVQREVVFPKSQVGLWIDDSYSVNTRGAT  591

Query  1084  VMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQT  911
             VM+ K  E+P KA +K+A+PG  TRP PKDR +  +RL ELR +IPNG K SID LL +T
Sbjct  592   VMSPKRTEEPMKAPRKRARPGESTRPRPKDRQQIQDRLKELRGIIPNGAKCSIDALLDRT  651

Query  910   IKQLLFLQSVTRLAEGLKKTEE-----------LKDKKGRKDSNSNSNTNGVTWACEIEN  764
             +K +LFLQS+ + A+ LK+  E           LK+++  +D    S   G TWA E+  
Sbjct  652   VKHMLFLQSMMKYADKLKRAAETKLIGQGNSLVLKNERDERDVGDGSR-GGTTWAYEVGG  710

Query  763   QTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHF  584
             Q M+CP+VVEDL  PGQMLIE+LC +QG FLEI DIIRGFGLNILKG M +RE KIW+ F
Sbjct  711   QAMVCPIVVEDLGLPGQMLIEMLCDDQGLFLEIADIIRGFGLNILKGDMGVREGKIWSRF  770

Query  583   IVEPEANAFVSRHElfssllqllqlSGPSELHARDQLGNVRDNGRPSTSSNCSESAVPFP  404
             IV  EA   V+R ++F SL+QL+Q +    +++  Q G+  D+ +  + ++  E  +P P
Sbjct  771   IV--EATRHVTRMDVFWSLIQLVQETNSHGINSTTQPGDAMDS-QFYSCNDYKEPLLPLP  827

Query  403   IS  398
             IS
Sbjct  828   IS  829


 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 113/182 (62%), Gaps = 14/182 (8%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             +V K  LK+LCC +GWSY VFW F+ +N + LT+ DAY+EE++  ++ ++L QV++LG G
Sbjct  3     SVVKTKLKTLCCDDGWSYGVFWRFDHRNPMLLTVEDAYFEEQLETVVSNVLQQVHLLGDG  62

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNC---DELLQDDDSEFYGQFSCGIKTIAVI  2000
             ++GQ AFT   +W++ D            + C   D+    D+SE   +FS GIKTI VI
Sbjct  63    IIGQAAFTGKQRWIMEDVR---------GEQCCSVDDTGLQDESEIDREFSAGIKTIGVI  113

Query  1999  SVEPLGVVQFGSNQKLPERMEFVDETKKLFQ--GTDIETIFAQSSSSSANGDVFGLSGSL  1826
              VE LGVVQ G+ +K+PE  EF+D+ KKLFQ  G     +  +++ SS N D   L+G  
Sbjct  114   PVEQLGVVQVGAMKKIPESSEFLDKVKKLFQEMGNIDGRLHLENNPSSLNNDRDILNGFF  173

Query  1825  AS  1820
             AS
Sbjct  174   AS  175



>ref|XP_004495499.1| PREDICTED: transcription factor LHW-like [Cicer arietinum]
Length=281

 Score =   171 bits (433),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 116/159 (73%), Gaps = 3/159 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  + + ELR +IP+GGK SID LL +TI+ +LFL+SV + A+ + +  E 
Sbjct  91    TRPRPKDRQQIQDCIKELRGIIPHGGKCSIDSLLDRTIRYMLFLRSVIKYADMIHEPNEP  150

Query  841   K-DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K  ++       +S   G TWA E+ NQTM+CP++VED+  PGQMLIE+LC++QGFFLEI
Sbjct  151   KLIEQANGVVPKDSENRGATWAFEVGNQTMVCPIIVEDMNPPGQMLIEMLCEDQGFFLEI  210

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             VDII+GFGLNILK  ME++++K+W  FIV  EAN  V+R
Sbjct  211   VDIIKGFGLNILKAKMEIKKSKLWGRFIV--EANRHVTR  247



>gb|EMT18281.1| Putative basic helix-loop-helix protein [Aegilops tauschii]
Length=761

 Score =   179 bits (454),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 118/172 (69%), Gaps = 16/172 (9%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE-  845
             TRP PKDR +  +R+ ELRE++PN  K SID LL +TIK ++FLQ VT+ AE +K+ +E 
Sbjct  560   TRPRPKDRQQIQDRVKELREIVPNSAKCSIDALLDRTIKHMIFLQGVTKYAEKIKQADEP  619

Query  844   ----------LKDKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLI  704
                       LKD       KD++S ++  G TWA E+  QTM+CP++VEDL  PGQML+
Sbjct  620   KMISKDSGAVLKDNSSGVVLKDNSSAASNGGATWAYEVAGQTMVCPIIVEDLSPPGQMLV  679

Query  703   EILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             E+LC+E+GFFLEI D IR FGL ILKG MELR+ KI A F+V  EAN  V+R
Sbjct  680   EMLCEERGFFLEIADTIRRFGLTILKGLMELRDGKIMARFLV--EANKNVTR  729


 Score = 87.0 bits (214),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/163 (32%), Positives = 87/163 (53%), Gaps = 19/163 (12%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQVA  2153
             L +LC G GWSYA  W  ++++   LT+ + + E+E   ++++ML QV+++G G++G   
Sbjct  5     LGALCRGGGWSYAAIWRSDRRDPRLLTIGECHCEDEARKVVENMLNQVHVVGEGIIGSAL  64

Query  2152  FTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQ  1973
              +   +W +SD            D+   L+Q  ++E  G F    +TIAV+ +  LGV Q
Sbjct  65    VSGKCQW-ISD------------DDSFSLVQTCNAENLGLF----QTIAVVPIPALGVAQ  107

Query  1972  FGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVF  1844
             FGS QK+ E +EF++  K        E+I    S+   +GD  
Sbjct  108   FGSVQKVSENLEFLEHVKGTL--CRRESILWDPSTKHIHGDAL  148



>ref|XP_006857834.1| hypothetical protein AMTR_s00069p00042170 [Amborella trichopoda]
 gb|ERN19301.1| hypothetical protein AMTR_s00069p00042170 [Amborella trichopoda]
Length=963

 Score =   180 bits (456),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 115/163 (71%), Gaps = 5/163 (3%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ L++  E 
Sbjct  751   TRPRPKDRQQIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLRQASEP  810

Query  841   K---DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFL  671
             K   ++ G    +      G TWA E+  Q+M+CP++VEDL  P QML+E+LC+E+GFFL
Sbjct  811   KMIGNESGLVLKDYLDGGGGATWAFEVGCQSMVCPIIVEDLNPPRQMLVEMLCEERGFFL  870

Query  670   EIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             EI DIIRGFGL ILKG ME R  KIWAHF V  EAN  ++R E
Sbjct  871   EIADIIRGFGLTILKGVMESRNDKIWAHFAV--EANRDMTRME  911


 Score =   103 bits (256),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 98/216 (45%), Gaps = 42/216 (19%)
 Frame = -1

Query  2344  AKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY-----------------------  2234
              K  LKSLC   GWSYA+ W F   + + +   DAYY                       
Sbjct  5     VKETLKSLCNNYGWSYALLWKFKYLDPMLVMCEDAYYASPEDQLEVSNCSSLTTIKPRPS  64

Query  2233  ----------------EEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQ  2102
                             + E+G ++D ML QV+++   ++G VA T  H+W+  D+++   
Sbjct  65    HSFSKDIIEAHVKCETDNEIGSMVDKMLHQVHVVEECLIGHVAHTGKHQWVFQDSSTEKG  124

Query  2101  SHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDET  1922
             S  G AD        + +    QFS GIKTI VI V  LGVVQ GS +K+ E  EF+   
Sbjct  125   SLAGYADQQAHF--QNVTALGHQFSVGIKTIVVIDVASLGVVQLGSIKKIMENKEFIAHV  182

Query  1921  KKLF-QGTDIETIFAQSSSSSANGDVFGLSGSLASS  1817
             + LF Q   ++ + + S+  ++N  +  ++    S+
Sbjct  183   RSLFLQVNSVQEVLSASAQKASNPTIHAIATQRTSA  218



>ref|XP_010267512.1| PREDICTED: transcription factor EMB1444-like isoform X2 [Nelumbo 
nucifera]
Length=768

 Score =   177 bits (450),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 141/217 (65%), Gaps = 8/217 (4%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A  LK+  + 
Sbjct  555   TRPRPKDRQQIQDRVKELREIVPNGEKCSIDALLDRTIKHMLFLQSVTKYANKLKQVNDP  614

Query  841   K---DKKGRK-DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
             K   ++ G     NS  +  G TWA E+  QTM+CP+ VEDL  P QML+E+LC+EQGFF
Sbjct  615   KMIGEENGVVLRDNSCGSDGGATWAFEVGGQTMVCPITVEDLNPPDQMLVEMLCEEQGFF  674

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSE  494
             LEI DII+GFGL ILKG ME++E KIWA F+V  EAN  ++R ++F  L++ LQ    S 
Sbjct  675   LEIADIIQGFGLTILKGLMEVQEDKIWARFVV--EANRDLTRMDIFLFLVEFLQQM-TSG  731

Query  493   LHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             +   ++     D G P    NC ++ +P  I L + +
Sbjct  732   IGPNNESNKAVDTGAP-LFINCQQAPMPLRIGLADRM  767


 Score = 99.0 bits (245),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 86/179 (48%), Gaps = 34/179 (19%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             ++ K  LKSLCC N WSY VFW  N  NS+                              
Sbjct  3     SLLKEELKSLCCSNRWSYGVFWRINHPNSI------------------------------  32

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             ++G+ AFT  ++W+ SDT           DN +     D ++F+ QFS G+KTI VI+V 
Sbjct  33    IIGEAAFTGKNRWLFSDTYYREYCPQESVDNQNAF--QDSTDFHHQFSSGVKTIVVIAVT  90

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET--IFAQSSSSSANGDVFGLSGSLAS  1820
             P GV+QFGS +K+ E  EFVD  + LF   +     + +    +S N ++   SGS AS
Sbjct  91    PQGVLQFGSTEKVQESSEFVDHAQNLFGQIENRNGIVLSGDVLTSLNSEICHQSGSFAS  149



>ref|XP_010267508.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267509.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267510.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Nelumbo 
nucifera]
Length=798

 Score =   177 bits (450),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 141/217 (65%), Gaps = 8/217 (4%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A  LK+  + 
Sbjct  585   TRPRPKDRQQIQDRVKELREIVPNGEKCSIDALLDRTIKHMLFLQSVTKYANKLKQVNDP  644

Query  841   K---DKKGRK-DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
             K   ++ G     NS  +  G TWA E+  QTM+CP+ VEDL  P QML+E+LC+EQGFF
Sbjct  645   KMIGEENGVVLRDNSCGSDGGATWAFEVGGQTMVCPITVEDLNPPDQMLVEMLCEEQGFF  704

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHElfssllqllqlSGPSE  494
             LEI DII+GFGL ILKG ME++E KIWA F+V  EAN  ++R ++F  L++ LQ    S 
Sbjct  705   LEIADIIQGFGLTILKGLMEVQEDKIWARFVV--EANRDLTRMDIFLFLVEFLQQM-TSG  761

Query  493   LHARDQLGNVRDNGRPSTSSNCSESAVPFPISLPEGL  383
             +   ++     D G P    NC ++ +P  I L + +
Sbjct  762   IGPNNESNKAVDTGAP-LFINCQQAPMPLRIGLADRM  797


 Score =   144 bits (364),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 112/196 (57%), Gaps = 15/196 (8%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSG  2171
             ++ K  LKSLCC N WSY VFW  N  NS+ LT  D Y++E +G ++D ML QV++LG G
Sbjct  3     SLLKEELKSLCCSNRWSYGVFWRINHPNSMLLTAEDVYFKEYIGVVVDRMLQQVHMLGQG  62

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             ++G+ AFT  ++W+ SDT           DN +     D ++F+ QFS G+KTI VI+V 
Sbjct  63    IIGEAAFTGKNRWLFSDTYYREYCPQESVDNQNAF--QDSTDFHHQFSSGVKTIVVIAVT  120

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET--IFAQSSSSSANGDVFGLSGSLAS-  1820
             P GV+QFGS +K+ E  EFVD  + LF   +     + +    +S N ++   SGS AS 
Sbjct  121   PQGVLQFGSTEKVQESSEFVDHAQNLFGQIENRNGIVLSGDVLTSLNSEICHQSGSFASM  180

Query  1819  ----------SICNSS  1802
                       S CNS+
Sbjct  181   AGLEAQALLQSTCNST  196



>ref|XP_008230230.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor LHW [Prunus 
mume]
Length=963

 Score =   179 bits (453),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  757   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  816

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G    N N +  G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+EQGFFLEI
Sbjct  817   IIGKEGGLVLNDNFD-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEEQGFFLEI  875

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  876   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  914


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/180 (33%), Positives = 87/180 (48%), Gaps = 48/180 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK+LC  N W+YAVFW    QN   L + + +YE                       
Sbjct  6     KQALKTLCGSNQWAYAVFWKIGCQNPKLL-IWECHYEPSICSLPKRIAGTERAELPFGEW  64

Query  2230  -----------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHG  2090
                          +  LI+ M++    NI+G G+VG+ AFT NH+W+LS +N    +H  
Sbjct  65    EGCWVSSEVCSSXLSSLINRMMMDKPFNIVGEGIVGRAAFTGNHQWILS-SNYTKDAHP-  122

Query  2089  LADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
                   E+L    +E + QFS G++TIAVI V P GVVQ GS+  + E + F+++ K L 
Sbjct  123   -----PEVL----NEMHHQFSAGMQTIAVIPVLPHGVVQLGSSLAMMENIGFINDVKSLI  173



>gb|AFW59166.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=593

 Score =   175 bits (443),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 108/154 (70%), Gaps = 5/154 (3%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + AE +K+ +E 
Sbjct  416   TRPRPKDRQLIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVNKYAEKIKQADEP  475

Query  841   K--DKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGF  677
             K  DK      KD+       G TWA E+  QTM+CP+++EDL  PGQML+E+LC+EQG 
Sbjct  476   KIIDKGSGVILKDNPVAGTNGGATWAYEVAGQTMVCPIIIEDLSPPGQMLVEMLCEEQGL  535

Query  676   FLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             FLEI D IRG GL +LKG MEL + KIW+ F+VE
Sbjct  536   FLEIADNIRGIGLTVLKGRMELCDGKIWSRFLVE  569


 Score = 60.5 bits (145),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 5/103 (5%)
 Frame = -1

Query  2215  LIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDT-NSVWQSHHGLADNCDELLQDDDSEFY  2039
             ++  ML  V ++G G++GQ   +   +W+  DT +++ Q  H  ADN D  L    + + 
Sbjct  1     MVQKMLNLVEVVGEGILGQALVSGECQWIYDDTCHALNQISH--ADNGD--LHQGYTWWQ  56

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              QF  G+KTIAV+ ++  G+VQFGS +K+P    F+++ + +F
Sbjct  57    HQFLSGMKTIAVLPLQLHGLVQFGSTRKVPRSSVFLNQVRDIF  99



>ref|XP_007208256.1| hypothetical protein PRUPE_ppa016557mg [Prunus persica]
 gb|EMJ09455.1| hypothetical protein PRUPE_ppa016557mg [Prunus persica]
Length=971

 Score =   178 bits (451),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  765   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  824

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G    N + +  G TWA E+ +Q+M+CP++VEDL  P QML+EILC+EQGFFLEI
Sbjct  825   IIGKEGGLVLNDDFD-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEILCEEQGFFLEI  883

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  884   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  922


 Score = 86.7 bits (213),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 54/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY------------------------  2234
             K  LK+LC  N W+YAVFW    QN   L     Y                         
Sbjct  6     KQALKTLCGSNQWAYAVFWKIGCQNPKLLIWECHYEPSICSLPKRIAGTERAELPFGEWE  65

Query  2233  -----------------EEEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                              EE +  LI+ M++    NI+G G+VG+ AFT NH+W+LS +N 
Sbjct  66    GCWVSSEVCSSSNGIQPEERVSSLINRMMMDKPFNIVGEGIVGRAAFTGNHQWILS-SNY  124

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
                +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E + F+
Sbjct  125   TKDAHP------PEVL----NEMHHQFSAGMQTVAVIPVLPHGVVQLGSSLAMMENIGFI  174

Query  1930  DETKKLF  1910
             ++ K L 
Sbjct  175   NDVKSLI  181



>gb|ABN06178.1| Helix-loop-helix DNA-binding [Medicago truncatula]
Length=589

 Score =   174 bits (441),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+  E K
Sbjct  396   RPRPKDRQMIQDRVKELREIVPNGSKCSIDALLERTIKHMLFLQSVTKHADKLKQNGESK  455

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL TP QMLIE+LC+E+GFFLEI
Sbjct  456   IISKEGGLVLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNTPRQMLIEMLCEERGFFLEI  514

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA FIV  EAN  V+R E
Sbjct  515   ADLIRGLGLTILKGVMEAHNDKIWARFIV--EANRDVTRME  553



>ref|XP_007015675.1| Transcription factor-related, putative isoform 1 [Theobroma cacao]
 gb|EOY33294.1| Transcription factor-related, putative isoform 1 [Theobroma cacao]
Length=921

 Score =   177 bits (449),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  723   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  782

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              K+  +         G TWA E+ +Q+MICP+VVEDL  P QML+E+LC+E+GFFLEI D
Sbjct  783   IKENFE--------GGATWAFEVGSQSMICPIVVEDLNPPRQMLVEMLCEERGFFLEIAD  834

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             +IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  835   LIRGLGLTILKGVMETRNDKIWARFAV--EANRDVTRVE  871


 Score = 89.7 bits (221),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 88/185 (48%), Gaps = 52/185 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGG------------------  2216
             K  LKSLC  + W YAVFW    QN+  L   + YYE  +                    
Sbjct  6     KEALKSLCGVSQWCYAVFWKIGCQNTKLLIWEECYYEPTLSAVPPCIAGVENRELPFGEW  65

Query  2215  ----------------------LIDDMLL-QVNILGSGVVGQVAFTKNHKWMLSDTNSVW  2105
                                   LI+ M+  ++NI+G G+VG+ AFT NH+W+L++ N + 
Sbjct  66    EGDWGSETSSQLGSQPWDKVHLLINKMMNNRINIVGQGLVGRAAFTGNHQWILAN-NYIT  124

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
              +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E M F+++
Sbjct  125   DTHP------PEVL----NEVHLQFSAGMQTVAVIPVLPHGVVQLGSSTSILENMGFMND  174

Query  1924  TKKLF  1910
              K L 
Sbjct  175   VKSLI  179



>gb|KHN05001.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=812

 Score =   176 bits (447),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 7/164 (4%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  + + ELR LIPN GK SID LL +TI+ +LFLQSV + ++ L++  E 
Sbjct  617   TRPRPKDRQQIQDCIKELRRLIPNDGKCSIDSLLDRTIRYMLFLQSVVKYSDKLQEPNEP  676

Query  841   K-----DKKGRKDSNSNSNTN-GVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQG  680
             K     +K   KDS +    N G+TWA E+ +Q M+CP++VED+  PGQMLIE+LC+EQG
Sbjct  677   KLIEQANKVVLKDSGAADGKNCGITWAYEVAHQPMLCPIIVEDMSLPGQMLIEMLCEEQG  736

Query  679   FFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             FFLEI+DIIR FGLNILK  ME R  K+WA FIVE   N  V+R
Sbjct  737   FFLEIIDIIRHFGLNILKAKMERRRNKLWARFIVEAN-NRHVTR  779


 Score =   136 bits (342),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 114/188 (61%), Gaps = 19/188 (10%)
 Frame = -1

Query  2332  LKSLC-CGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQV  2156
             LK+LC CG+GWSYA+FW F+ +NSL LT  +AYYEE +G  I +M  QV++LG G+VG+ 
Sbjct  11    LKTLCTCGDGWSYAIFWRFHPRNSLLLTAEEAYYEEHLGEEIANMHPQVHLLGEGIVGEA  70

Query  2155  AFTKNHKWMLSDTNSVWQSHHGLADNCDELLQ---DDDSEFYGQFSCGIKTIAVISVEPL  1985
             AFT  H W+ SD         GL  + +   Q   +DDSE   QFS GIKTI V+ V+  
Sbjct  71    AFTGKHSWVHSD---------GLTHDWNLTGQNTCEDDSELQQQFSSGIKTIVVVPVKAW  121

Query  1984  GVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSA------NGDVFGLSGSLA  1823
             GVVQFGS +K+ E++EF+++T+ +    D +        ++       N D+ G   S++
Sbjct  122   GVVQFGSRKKILEKVEFLEQTQSVLTEMDDDMGMFDMPGNAVLPLDCENNDLNGFLDSIS  181

Query  1822  SSICNSSY  1799
             S+  N+S+
Sbjct  182   SASPNNSF  189



>ref|XP_006606416.1| PREDICTED: transcription factor bHLH157-like [Glycine max]
Length=813

 Score =   176 bits (446),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 115/164 (70%), Gaps = 7/164 (4%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  + + ELR LIPN GK SID LL +TI+ +LFLQSV + ++ L++  E 
Sbjct  618   TRPRPKDRQQIQDCIKELRRLIPNDGKCSIDSLLDRTIRYMLFLQSVVKYSDKLQEPNEP  677

Query  841   K-----DKKGRKDSNSNSNTN-GVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQG  680
             K     +K   KDS +    N G+TWA E+ +Q M+CP++VED+  PGQMLIE+LC+EQG
Sbjct  678   KLIEQANKVVLKDSGAADGKNCGITWAYEVAHQPMLCPIIVEDMSLPGQMLIEMLCEEQG  737

Query  679   FFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             FFLEI+DIIR FGLNILK  ME R  K+WA FIVE   N  V+R
Sbjct  738   FFLEIIDIIRHFGLNILKAKMERRRNKLWARFIVEAN-NRHVTR  780


 Score =   137 bits (344),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 115/188 (61%), Gaps = 19/188 (10%)
 Frame = -1

Query  2332  LKSLC-CGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQV  2156
             LK+LC CG+GWSYA+FW F+ +NSL LT+ +AYYEE +G  I +M  QV++LG G+VG+ 
Sbjct  11    LKTLCTCGDGWSYAIFWRFHPRNSLLLTVEEAYYEEHLGEEIANMHPQVHLLGEGIVGEA  70

Query  2155  AFTKNHKWMLSDTNSVWQSHHGLADNCDELLQ---DDDSEFYGQFSCGIKTIAVISVEPL  1985
             AFT  H W+ SD         GL  + +   Q   +DDSE   QFS GIKTI V+ V+  
Sbjct  71    AFTGKHSWVHSD---------GLTHDWNLTGQNTCEDDSELQQQFSSGIKTIVVVPVKAW  121

Query  1984  GVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSA------NGDVFGLSGSLA  1823
             GVVQFGS +K+ E++EF+++T+ +    D +        ++       N D+ G   S++
Sbjct  122   GVVQFGSRKKILEKVEFLEQTQSVLTEMDDDMGMFDMPGNAVLPLDCENNDLNGFLDSIS  181

Query  1822  SSICNSSY  1799
             S+  N+S+
Sbjct  182   SASPNNSF  189



>ref|XP_009629479.1| PREDICTED: transcription factor LHW-like [Nicotiana tomentosiformis]
Length=876

 Score =   176 bits (447),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  669   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  728

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      NS   G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  729   IISKEGGLLLKDNSE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  787

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R
Sbjct  788   ADIIRGLGLTILKGVMETRNDKIWARFAV--EANRDVTR  824


 Score = 90.5 bits (223),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 85/181 (47%), Gaps = 48/181 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++YY+                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKLLIWEESYYQPLTFSGILGISEIENTELSFQDW  65

Query  2230  ------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHH  2093
                         E +  L++ M+   Q N++G G+VG+ A T NH+W  SD  S      
Sbjct  66    GVCNSQLMNQAGERVHLLVNKMMTESQFNLVGEGLVGRAAVTGNHQWFHSDGFS------  119

Query  2092  GLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
                 +  E+L+    E   QF+ GIKTIAV+ + P GVVQFGS   + E M FV++ + L
Sbjct  120   -RVAHPPEVLK----ELTQQFNAGIKTIAVVPILPHGVVQFGSCSHIMENMGFVEDARML  174

Query  1912  F  1910
              
Sbjct  175   I  175



>ref|XP_009760053.1| PREDICTED: transcription factor LHW-like [Nicotiana sylvestris]
Length=867

 Score =   176 bits (446),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 112/159 (70%), Gaps = 5/159 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  660   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  719

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      NS   G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  720   IISKEGGLLLKDNSE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  778

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R
Sbjct  779   ADIIRGLGLTILKGVMETRNDKIWARFAV--EANRDVTR  815


 Score = 90.1 bits (222),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 85/181 (47%), Gaps = 48/181 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++YY+                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKLLIWEESYYQPLTFSEVHGISGLENPELSFQDW  65

Query  2230  ------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHH  2093
                         E +  L++ M+   Q N++G G+VG+ A T NH+W  SD  S      
Sbjct  66    GVCNSQLMNQAGERVHLLVNKMMTESQFNLVGEGLVGRAAVTGNHQWFHSDGFS------  119

Query  2092  GLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
                 +  E+L+    E   QF+ GIKTIAV+ + P GVVQFGS   + E M FV++ + L
Sbjct  120   -RVAHPPEVLK----ELTQQFNAGIKTIAVVPILPHGVVQFGSCSHIMENMGFVEDARML  174

Query  1912  F  1910
              
Sbjct  175   I  175



>emb|CBI24427.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   176 bits (445),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + A+ LK+T E K
Sbjct  635   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVMKHADKLKQTGESK  694

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  695   IINKEGGLHLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  753

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  754   ADIIRGMGLTILKGVMETRNDKIWARFTV--EANRDVTRME  792


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 87/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LKSLC  N WSYAVFW    QN   L   + + E                       
Sbjct  6     KEALKSLCGVNQWSYAVFWKIGCQNPKLLIWEECHCEFIPSSGLPHGSGMENSEVPFEDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  QVNI+G G+VG+ AFT  H+W+LS+ N
Sbjct  66    EGCWVFPETRISQLDGQAVESIYFLVNKMMMNNQVNIVGEGIVGRAAFTGKHQWILSE-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GV+QFGS+  + E   F
Sbjct  125   YTRDAHP------PEVL----NEVHHQFSAGMQTVAVIPVLPHGVIQFGSSLAIMENAGF  174

Query  1933  VDETKKLF  1910
             V++ K L 
Sbjct  175   VNDVKSLI  182



>ref|XP_004139141.1| PREDICTED: transcription factor LHW-like [Cucumis sativus]
 ref|XP_004154707.1| PREDICTED: transcription factor LHW-like [Cucumis sativus]
 gb|KGN66585.1| hypothetical protein Csa_1G632370 [Cucumis sativus]
Length=959

 Score =   176 bits (446),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  752   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALFEKTIKHMLFLQSVTKHADKLKQTGESK  811

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +QTM+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  812   IISKEGGLFLKDNFE-GGATWAFEVGSQTMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  870

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R+ KIWA F V  EAN  V+R E
Sbjct  871   ADLIRGMGLTILKGVMEARDDKIWARFAV--EANRDVTRME  909


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 85/185 (46%), Gaps = 52/185 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY------------------------  2234
             K +LK+LC  N WSYAVFW    QN+  L   + +Y                        
Sbjct  6     KEMLKALCGSNQWSYAVFWKIGCQNTKLLIWEECHYQPLPSFDSSGSGSSKFPLGELEGC  65

Query  2233  ---------------EEEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVW  2105
                            E+++  LI  M L   ++++G G+VG+ AFT NH W+LS      
Sbjct  66    WGYSQSSSSFQANHGEDKLYSLIHKMTLNKHISLVGEGIVGRAAFTGNHLWILS------  119

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
              S++       E+L    SE + QF  G++T+AVI V P GVVQ GS+  + E M FV+ 
Sbjct  120   -SNYTRDAYPPEVL----SELHQQFLAGMQTVAVIPVLPHGVVQLGSSFSIMENMMFVNH  174

Query  1924  TKKLF  1910
              K L 
Sbjct  175   VKSLI  179



>ref|XP_002298267.2| transcription factor-related family protein [Populus trichocarpa]
 gb|EEE83072.2| transcription factor-related family protein [Populus trichocarpa]
Length=680

 Score =   173 bits (439),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 128/190 (67%), Gaps = 7/190 (4%)
 Frame = -1

Query  1105  GENCSTNVMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSI  932
             G +CS +   +K +++ SK  +K+ K G   RP PKDR    +R+ ELRE++PNG K SI
Sbjct  446   GHDCSVSTAFSKKNDETSKPNRKRLKAGENPRPRPKDRQMIQDRVKELREIVPNGAKCSI  505

Query  931   DRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEIENQTMI  752
             D LL +TIK +LFLQSVT+ A+ LK+T + K+       N      G TWA E+ +Q+M+
Sbjct  506   DALLERTIKHMLFLQSVTKHADKLKQTGDSKESGLLLKENFEG---GATWAFEVGSQSMV  562

Query  751   CPLVVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEP  572
             CP++VEDL  P QM++E+LC+E+GFFLEI D+IRG GL ILKG ME R  KIWA F V  
Sbjct  563   CPIIVEDLNPPRQMIVEMLCEERGFFLEIADLIRGLGLTILKGVMETRNDKIWARFAV--  620

Query  571   EANAFVSRHE  542
             EAN  V+R E
Sbjct  621   EANRDVTRME  630


 Score =   101 bits (252),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 72/207 (35%), Positives = 107/207 (52%), Gaps = 28/207 (14%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEE-------EMGG----LIDDMLL  2195
             + +LK LC  N W YAVFW    QN   L   + +YE        + GG    LI+ M++
Sbjct  6     REVLKILCGVNQWCYAVFWKIGCQNPKLLIWEECHYEPTSCSLGIQAGGRLCSLINKMMV  65

Query  2194  --QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCG  2021
               QVNI+G G+VG+VAFT NH+W+L++  S  +  H       E+L    +E + QFS G
Sbjct  66    NNQVNIVGEGIVGRVAFTGNHEWILANNYS--KDAHP-----PEVL----NEVHHQFSAG  114

Query  2020  IKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF--QGTDIETIFAQSSSSSANGDV  1847
             ++TIAVI V P GV+Q GS+  + E + FV+  K L    G     + + +       + 
Sbjct  115   MQTIAVIPVCPHGVLQLGSSLAILENIGFVNNVKSLILQLGCVPGALLSDNHMEKEPTER  174

Query  1846  FGL--SGSLASSICNSSYFMSPEALPS  1772
              G+  S  +A  +C S  +  P + PS
Sbjct  175   IGMPISCGMALPVCFSGTYKVPSSTPS  201



>ref|XP_008450292.1| PREDICTED: transcription factor LHW isoform X1 [Cucumis melo]
Length=961

 Score =   176 bits (446),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  754   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALFEKTIKHMLFLQSVTKHADKLKQTGESK  813

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +QTM+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  814   IISKEGGLFLKDNFE-GGATWAFEVGSQTMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  872

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R+ KIWA F V  EAN  V+R E
Sbjct  873   ADLIRGMGLTILKGVMEARDNKIWARFAV--EANRDVTRME  911


 Score = 83.6 bits (205),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 84/185 (45%), Gaps = 52/185 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY------------------------  2234
             K +LK+LC  + WSYAVFW    QN+  L   + +Y                        
Sbjct  6     KEMLKALCGSSQWSYAVFWKIGCQNTKLLIWEECHYQPLPSFDSSGSESSKFPLGELEGC  65

Query  2233  ---------------EEEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVW  2105
                            E+++  LI  M L   V+++G G+VG+ AF  NH W+LS      
Sbjct  66    WGYSQSSSSLQSNHGEDKLYSLIHKMNLNKHVSLVGEGIVGRAAFIGNHLWILS------  119

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
              S++       E+L    SE + QF  G++T+AVI V P GVVQ GS+  + E M FV+ 
Sbjct  120   -SNYTRDAYPPEVL----SELHQQFLAGMQTVAVIPVLPHGVVQLGSSFSIMENMMFVNH  174

Query  1924  TKKLF  1910
              K L 
Sbjct  175   VKSLI  179



>gb|KHG26450.1| hypothetical protein F383_09948 [Gossypium arboreum]
Length=906

 Score =   176 bits (445),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 112/159 (70%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  707   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKQTGESK  766

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              K+  +         G TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+E+GFFLEI D
Sbjct  767   IKENFE--------GGATWAFEVGSQSMLCPIVVEDLNRPRQMLVEMLCEERGFFLEIAD  818

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             +IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  819   LIRGLGLTILKGVMETRNDKIWARFTV--EANRDVTRVE  855


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 89/186 (48%), Gaps = 54/186 (29%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------------  2231
             LKSLC  + WSYAVFW    QN+  L   + +Y+                          
Sbjct  9     LKSLCGVSQWSYAVFWKIGCQNTRLLIWEECFYQPAPSSVSPSLVGVQNPELSFGEREGC  68

Query  2230  ------EEMGG---------LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQ  2102
                    ++G          LI+ M +  ++NI+G G+VG+ AFT NH+W+L++ N V  
Sbjct  69    WGLETSSQLGSQKWDDKVHLLINKMNINNRINIVGQGLVGRAAFTGNHQWILAN-NYVTD  127

Query  2101  SHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDET  1922
             +H        E+L    +E   Q S G++T+AVI V P GV+Q GS+  + E M F+++ 
Sbjct  128   AHP------PEVL----NEVQLQVSAGMQTVAVIPVLPHGVLQLGSSMTIMENMGFLNDV  177

Query  1921  KKLFQG  1904
             K L  G
Sbjct  178   KSLILG  183



>ref|XP_010089791.1| hypothetical protein L484_022306 [Morus notabilis]
 gb|EXB38407.1| hypothetical protein L484_022306 [Morus notabilis]
Length=953

 Score =   176 bits (446),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  746   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  805

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP++VEDL +P QML+E+LC+E+GFFLEI
Sbjct  806   IINKEGGLLLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNSPRQMLVEMLCEERGFFLEI  864

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F +  EAN  V+R E
Sbjct  865   ADLIRGMGLTILKGVMEARNDKIWARFAI--EANRDVTRME  903


 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 87/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK+LC  N WSYAVFW    QN   L   + +YE                       
Sbjct  6     KEALKTLCGSNQWSYAVFWKIGCQNPKLLIWEECHYEPSKSSLPTHMSGAGSAELPFEEW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                + +  LI  M++  Q NI+G G+VG+ AFT NH+W+LS+  
Sbjct  66    ERLWMSSETCSSQLGSQVGDRVSSLISKMMINNQFNIVGEGMVGRAAFTGNHQWILSNNY  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
             + +        +  E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E + F
Sbjct  126   TKFA-------HPPEVL----NEMHHQFSAGMQTVAVIPVRPHGVVQLGSSLAIMEDIGF  174

Query  1933  VDETKKLF  1910
             V++ K L 
Sbjct  175   VNDVKSLI  182



>gb|EYU28511.1| hypothetical protein MIMGU_mgv1a003404mg [Erythranthe guttata]
Length=587

 Score =   172 bits (436),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK ++FLQSVT+ A+ LK+T E K
Sbjct  392   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMIFLQSVTKHADKLKQTGESK  451

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  452   IISKDGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  510

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  511   ADIIRGLGLTILKGVMETRNDKIWARFAV--EANRDVTRME  549


 Score = 73.9 bits (180),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 60/95 (63%), Gaps = 11/95 (12%)
 Frame = -1

Query  2194  QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             QVNI+G G+VG+VAFT NH+W++SD N   ++H        E+L+    E   QFS G++
Sbjct  6     QVNIVGEGLVGRVAFTGNHQWIVSD-NCFGEAH------PPEVLK----EVCQQFSAGMQ  54

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             T+AVI V P GVVQFGS   + E M F+++   L 
Sbjct  55    TVAVIPVLPHGVVQFGSFLTIRENMGFINDVISLL  89



>ref|XP_002513717.1| expressed protein, putative [Ricinus communis]
 gb|EEF48664.1| expressed protein, putative [Ricinus communis]
Length=933

 Score =   176 bits (445),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 114/164 (70%), Gaps = 11/164 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  727   RPRPKDRQMIQDRMKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKETGESK  786

Query  838   --DKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
               DKKG    KD        G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFF
Sbjct  787   IMDKKGGLVLKDGFEG----GATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFF  842

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI D+IR  GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  843   LEIADLIRTLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  884


 Score = 97.8 bits (242),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 89/174 (51%), Gaps = 41/174 (24%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N W YAVFW    QNS  L   + YYE                       
Sbjct  6     KQVLKTLCGVNQWCYAVFWKIGFQNSKLLIWEECYYEPNPELPFGDWEGCWASDAHSSQL  65

Query  2230  -----EEMGGLIDDML--LQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCD  2072
                  + +  LI+ M+   QVN++G G+VG+ AFT NH+W+L++ N +  +H        
Sbjct  66    KVQTGDRVYMLINKMMGNNQVNLVGQGLVGRAAFTGNHEWILAN-NYIGGAHP------P  118

Query  2071  ELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E+L    SE + QFS G++TIAVI V P GVVQ GS+  + E + FV+  K L 
Sbjct  119   EVL----SEIHHQFSAGMQTIAVIPVCPHGVVQLGSSSTIMENLGFVNNVKSLI  168



>gb|KEH38995.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=881

 Score =   175 bits (444),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+  E K
Sbjct  688   RPRPKDRQMIQDRVKELREIVPNGSKCSIDALLERTIKHMLFLQSVTKHADKLKQNGESK  747

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL TP QMLIE+LC+E+GFFLEI
Sbjct  748   IISKEGGLVLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNTPRQMLIEMLCEERGFFLEI  806

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA FIV  EAN  V+R E
Sbjct  807   ADLIRGLGLTILKGVMEAHNDKIWARFIV--EANRDVTRME  845


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 80/187 (43%), Gaps = 54/187 (29%)
 Frame = -1

Query  2341  KALLKSLCC-GNGWSYAVFWGFNQQNSLFLTLRDAYYE----------------------  2231
             K  LK+LC   N WSYAVFW     NS  L   + YYE                      
Sbjct  6     KEALKTLCGRNNQWSYAVFWKIGCNNSKLLIWEECYYEPVSCPSPHGIDGMSNFPNPNGE  65

Query  2230  ------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                               +++  L++ M +   V + G G++G+ AFT +H+W+L +   
Sbjct  66    GSWFSSEFQSPHLGIQEEDKVSSLVNKMTVNNLVIVAGEGIIGRSAFTNSHEWILLND--  123

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
                     A N      +  +E + QFS G++T+AVI V P GVVQ GS   + E M FV
Sbjct  124   -------FAKNA--YPPEVYAEMHDQFSAGMQTVAVIPVLPHGVVQIGSFLPIMENMGFV  174

Query  1930  DETKKLF  1910
              E K L 
Sbjct  175   HEVKSLI  181



>gb|KEH29771.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=833

 Score =   175 bits (443),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  639   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  698

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  699   IVSKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNHPRQMLVEMLCEERGFFLEI  757

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  758   ADLIRGLGLTILKGVMEARNDKIWARFSV--EANRDVTRME  796


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 54/96 (56%), Gaps = 15/96 (16%)
 Frame = -1

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDT--NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGI  2018
             VN+ G G++G+ AFT NH+W+L +     V+           E+L    +E + QFS G+
Sbjct  7     VNVAGQGILGRAAFTGNHQWILLNNFIKDVYPP---------EVL----NEVHCQFSAGM  53

Query  2017  KTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             +T+ VI V P GVVQ GS   + E + FV++ K L 
Sbjct  54    QTVVVIPVLPHGVVQLGSFLPIMENIGFVNDVKNLI  89



>ref|XP_010651650.1| PREDICTED: transcription factor LHW-like isoform X2 [Vitis vinifera]
Length=828

 Score =   174 bits (442),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + A+ LK+T E K
Sbjct  621   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVMKHADKLKQTGESK  680

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  681   IINKEGGLHLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  739

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  740   ADIIRGMGLTILKGVMETRNDKIWARFTV--EANRDVTRME  778



>ref|XP_009376366.1| PREDICTED: transcription factor LHW-like [Pyrus x bretschneideri]
Length=819

 Score =   174 bits (441),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID LL +TIK +LFLQ VT+ A+ LK+T E K
Sbjct  617   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALLERTIKHMLFLQGVTKHADKLKQTGESK  676

Query  838   DKK-GRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              +  G+KD     ++   G TWA E+  Q+M+CP++VEDL  P QML+E+LC+EQGFFLE
Sbjct  677   MQIIGKKDGLVLKDNFDGGATWAFEVGTQSMVCPIIVEDLNPPHQMLVEMLCEEQGFFLE  736

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  737   IADLIRGMGLTILKGVMEARNDKIWACFAV--EANRDVTRME  776



>ref|XP_010031564.1| PREDICTED: transcription factor LHW-like isoform X2 [Eucalyptus 
grandis]
 gb|KCW50921.1| hypothetical protein EUGRSUZ_J00573 [Eucalyptus grandis]
Length=863

 Score =   174 bits (442),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 115/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQ VT+ A+ L++T E K
Sbjct  664   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQGVTKHADKLEQTAESK  723

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               D++G      N +  G TWA E+ +Q+M+CP++VEDL  PGQML+E+LCQE+G+FLEI
Sbjct  724   IIDREGGLLLKDNFD-GGATWAFEVGSQSMVCPIIVEDLNPPGQMLVEMLCQERGYFLEI  782

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL IL+G +E R  KIWA F V  EAN  V+R E
Sbjct  783   ADIIRGLGLTILRGKVEARNDKIWAQFSV--EANRDVTRME  821


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK++C  N WSYAVFW F  QN   L   + YYE                       
Sbjct  6     KEALKTICGVNQWSYAVFWKFGCQNPKLLIWEECYYEPLRCCVPPSTAVSVIGKVPMGEF  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                +++  LID M++Q  +NI+G G++G+ AFT NH W+LS + 
Sbjct  66    DGCLVTPENQFAMPENHAADKIQSLIDKMMIQNQINIVGEGIIGRAAFTGNHLWILSSSY  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                        N D    +  +E   QFS G++TIAVI + P GV+Q GS+  + E + F
Sbjct  126   -----------NGDAYPPEVQNETLHQFSAGMQTIAVIPITPHGVIQVGSSLHIMENVRF  174

Query  1933  VDETKKLF  1910
             VDE + L 
Sbjct  175   VDEVRSLI  182



>ref|XP_002274971.1| PREDICTED: transcription factor LHW-like isoform X1 [Vitis vinifera]
 ref|XP_010651649.1| PREDICTED: transcription factor LHW-like isoform X1 [Vitis vinifera]
Length=973

 Score =   175 bits (444),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + A+ LK+T E K
Sbjct  766   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVMKHADKLKQTGESK  825

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  826   IINKEGGLHLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  884

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  885   ADIIRGMGLTILKGVMETRNDKIWARFTV--EANRDVTRME  923


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 87/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LKSLC  N WSYAVFW    QN   L   + + E                       
Sbjct  6     KEALKSLCGVNQWSYAVFWKIGCQNPKLLIWEECHCEFIPSSGLPHGSGMENSEVPFEDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  QVNI+G G+VG+ AFT  H+W+LS+ N
Sbjct  66    EGCWVFPETRISQLDGQAVESIYFLVNKMMMNNQVNIVGEGIVGRAAFTGKHQWILSE-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GV+QFGS+  + E   F
Sbjct  125   YTRDAH------PPEVL----NEVHHQFSAGMQTVAVIPVLPHGVIQFGSSLAIMENAGF  174

Query  1933  VDETKKLF  1910
             V++ K L 
Sbjct  175   VNDVKSLI  182



>ref|XP_007161572.1| hypothetical protein PHAVU_001G080900g [Phaseolus vulgaris]
 ref|XP_007161573.1| hypothetical protein PHAVU_001G080900g [Phaseolus vulgaris]
 gb|ESW33566.1| hypothetical protein PHAVU_001G080900g [Phaseolus vulgaris]
 gb|ESW33567.1| hypothetical protein PHAVU_001G080900g [Phaseolus vulgaris]
Length=754

 Score =   173 bits (439),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 8/164 (5%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  + + ELR +IPNGGK SID LL +TI+ +LFLQSV +  + L++  E 
Sbjct  557   TRPRPKDRQQIQDCIKELRGIIPNGGKCSIDSLLDRTIRYMLFLQSVLKYTDKLQEPSEP  616

Query  841   K-----DKKGRKDSN-SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQG  680
             K     ++   KDS  ++S   G+TWA E+ ++TM+CP++VED+  PGQMLIE+LC+ QG
Sbjct  617   KLIEQENEVVLKDSGVADSKNCGITWAYEVGHETMLCPIIVEDMSPPGQMLIEMLCEVQG  676

Query  679   FFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              FLEI+DIIRGFGLNILK  ME ++ K+WA FIV  EAN  V+R
Sbjct  677   IFLEIIDIIRGFGLNILKAKMERKKNKLWARFIV--EANRHVTR  718


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 80/271 (30%), Positives = 124/271 (46%), Gaps = 44/271 (16%)
 Frame = -1

Query  2203  MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSC  2024
             M  QV++LG G+VG+ AFT  H W+ SD  + + +  G  D C+     DDS    QF  
Sbjct  1     MHPQVHLLGQGIVGEAAFTGKHSWVHSDGQTHYWNLSG-QDICE-----DDSCLLQQFCS  54

Query  2023  GIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANG---  1853
             GIKTI VI V+ LGV+QFGS  K+ ER+EF+++T+ +   T+I+         S N    
Sbjct  55    GIKTIVVIPVKALGVIQFGSRNKILERVEFLEQTQSML--TEIDDDDMGMFDMSENAVLP  112

Query  1852  ------DVFGLSGSLASSICNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAFSLFDDQFQ  1691
                   D+ G+  S++S+  N          P P       + V SF  ++ S   DQ +
Sbjct  113   LLYQSNDLNGMLASVSSASPND---------PFPTHYKNYEDAVASFQGDS-SYLGDQLK  162

Query  1690  NGGVETQT-----NFSSYGFQPSCSS-----------VWGLEGSSLTSLQGNILPGAISQ  1559
              G +E Q      N +    +P+ S+           V   E SS   L+  ++    +Q
Sbjct  163   -GTMEAQVVLSERNSTDVLLKPNTSTDNLIAKTPYLGVCDGELSSFDLLEQQLVSSVRAQ  221

Query  1558  DCDNAFCALPDQFEYCTNTVQNVLERPVMTS  1466
             D  +A     + F  C   VQ+    P+ ++
Sbjct  222   DVADACFTNENVFATCKLPVQDSTLVPLCST  252



>ref|XP_007150023.1| hypothetical protein PHAVU_005G119400g [Phaseolus vulgaris]
 gb|ESW22017.1| hypothetical protein PHAVU_005G119400g [Phaseolus vulgaris]
Length=956

 Score =   175 bits (443),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  752   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  811

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+EQGFFLEI
Sbjct  812   IINKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIVVEDLNPPRQMLVEMLCEEQGFFLEI  870

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA F V  EAN  V+R E
Sbjct  871   ADLIRGLGLTILKGVMEAHNDKIWARFAV--EANRDVTRME  909


 Score = 85.1 bits (209),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 80/186 (43%), Gaps = 55/186 (30%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L++LC  N WSYAVFW     NS  L   + YYE                       
Sbjct  6     KEALRTLCGRNQWSYAVFWKIGCHNSKLLIWEECYYEPLPCPPPMFGIGDLPYHNGGGHW  65

Query  2230  ---------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWML--SDTNSV  2108
                            + +  LI  M +   V I G G++G+ AFT NH+W+L  S T  V
Sbjct  66    FSSGSQSSQLGIQEEDRVNSLIKKMTVNNSVIIAGEGMIGRAAFTGNHQWILLNSFTKDV  125

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
                      N  EL      E + QFS GI+T+AVI V P GVVQ GS   + E M FV+
Sbjct  126   ---------NPPELY----PEVHHQFSAGIQTVAVIPVLPHGVVQLGSFLPINENMGFVN  172

Query  1927  ETKKLF  1910
             + K L 
Sbjct  173   DVKSLI  178



>gb|KHN19923.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=939

 Score =   175 bits (443),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  732   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKQTGESK  791

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  792   IVSKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  850

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  851   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  889


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 82/172 (48%), Gaps = 39/172 (23%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L++LC  N WSYA+FW     NS  L   D YYE                       
Sbjct  6     KEALRTLCSRNRWSYAIFWKIGCNNSKLLIWEDYYYEPLPSPFPPRDGEGCWFSSESQLI  65

Query  2230  ---EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDEL  2066
                + +  LI+ M++   V+I G G+VG+ AFT N++W+L +  +            D  
Sbjct  66    QEEDRVCVLINKMMVNNSVSIAGEGIVGRAAFTGNYQWILLNNFTR-----------DAY  114

Query  2065  LQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
               +   E + QFS G++T+AVI V P GVVQ GS   + E + FV++ K LF
Sbjct  115   PPEVYPELHYQFSAGMQTVAVIPVLPHGVVQLGSFLPIMEDIGFVNDVKNLF  166



>ref|XP_003539152.1| PREDICTED: transcription factor LHW-like [Glycine max]
Length=939

 Score =   175 bits (443),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  732   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKQTGESK  791

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  792   IVSKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  850

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  851   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  889


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 82/172 (48%), Gaps = 39/172 (23%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L++LC  N WSYA+FW     NS  L   D YYE                       
Sbjct  6     KEALRTLCSRNRWSYAIFWKIGCNNSKLLIWEDYYYEPLPSPFPPRDGEGCWFSSESQLI  65

Query  2230  ---EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDEL  2066
                + +  LI+ M++   V+I G G+VG+ AFT N++W+L +  +            D  
Sbjct  66    QEEDRVCVLINKMMVNNSVSIAGEGIVGRAAFTGNYQWILLNNFTR-----------DAY  114

Query  2065  LQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
               +   E + QFS G++T+AVI V P GVVQ GS   + E + FV++ K LF
Sbjct  115   PPEVYPELHYQFSAGMQTVAVIPVLPHGVVQLGSFLPIMEDIGFVNDVKNLF  166



>ref|XP_006589237.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Glycine 
max]
Length=811

 Score =   174 bits (440),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 4/162 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR +  + + ELR +IPN GK SID LL +TI+ +LFLQSV + ++ L++  E 
Sbjct  621   TRPRPKDRQQIQDCIKELRRIIPNDGKCSIDSLLDRTIRYMLFLQSVLKYSDKLQEPNEP  680

Query  841   KDKKG-RKDSNS-NSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             K K+   KDS + +S   G+TWA E+ +QTM+ P++VED+  PGQMLIE+LC+EQGFFLE
Sbjct  681   KAKEVVLKDSGAADSKNGGITWAYEVAHQTMLYPVIVEDMSLPGQMLIEMLCEEQGFFLE  740

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I+D I+ FGLNILK  ME R+TK+WA FIV  EAN  V+R E
Sbjct  741   IIDKIQRFGLNILKAKMERRKTKLWARFIV--EANRPVTRIE  780


 Score =   138 bits (348),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 117/185 (63%), Gaps = 13/185 (7%)
 Frame = -1

Query  2332  LKSLC-CGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQV  2156
             LK+LC CG+GWSYA+FW F+ +NSL LT+ +AYYEE +G  I +M  QV++LG G+VG+ 
Sbjct  15    LKTLCTCGDGWSYAIFWRFHPRNSLLLTVEEAYYEEHLGEEIANMHPQVHLLGEGIVGEA  74

Query  2155  AFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVV  1976
             A T  H W+ SD     Q+H    +   + + +DDSEF  QFS GIKTI V+ V+  GVV
Sbjct  75    ASTGKHSWVHSDG----QTHDW--NLTGQNICEDDSEFQQQFSSGIKTIVVVPVKAWGVV  128

Query  1975  QFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSA------NGDVFGLSGSLASSI  1814
             QFGS +K+ E++EF+++T+ +    D +        +S       N D+ GL  S++S+ 
Sbjct  129   QFGSRKKILEKVEFLEQTQSVLTDMDDDMGMFDMPGNSVLPLDCENNDLNGLWDSISSAN  188

Query  1813  CNSSY  1799
              N+S+
Sbjct  189   PNNSF  193



>ref|XP_010533556.1| PREDICTED: transcription factor bHLH157-like isoform X2 [Tarenaya 
hassleriana]
Length=637

 Score =   172 bits (435),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR +IPNG K SID LL  TIK +LF+QS+ + A+ LK+  E K
Sbjct  439   RPRPKDRQMIQDRIKELRGMIPNGAKCSIDALLDLTIKHMLFMQSIAKYADKLKQPYEPK  498

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              K    +     + NG TWA E+ +++++CP++VEDL  PGQMLIE+LC+E+G FLEI D
Sbjct  499   -KGSSVEEQLAGDRNGATWAFEVGDESVVCPIIVEDLNRPGQMLIEMLCEEEGRFLEIAD  557

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVE  575
              ++GFGLN+LKG ME R+ +IWAHFIVE
Sbjct  558   AVKGFGLNVLKGVMERRDGRIWAHFIVE  585


 Score =   122 bits (307),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 23/195 (12%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             K +LKSLCC +GWSYAVFW ++  NS+ LT+ DAY++E+    +DDMLLQV+I G G++G
Sbjct  6     KHMLKSLCCSHGWSYAVFWRYDHINSMLLTMGDAYHDEQFRTAVDDMLLQVHIFGEGIIG  65

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
             + A T NH+WM  DT              D++ Q ++          ++T+ V+ V   G
Sbjct  66    EAALTGNHRWMSRDT-------------ADDIFQVENE---------LQTVLVVPVGSRG  103

Query  1981  VVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSS  1802
             V QFGS +K+ E  E ++ET    +   ++ + A S   S++ +   L    AS +   S
Sbjct  104   VAQFGSTRKIQESPEILEETTTALE-LAMDHVSAASPPRSSDLETLDLDSLFASLVPLRS  162

Query  1801  YFMSPEALPSPDFVD  1757
               M  ++L    F D
Sbjct  163   PDMHDQSLHGLSFDD  177



>ref|XP_011088969.1| PREDICTED: transcription factor LHW [Sesamum indicum]
Length=956

 Score =   174 bits (442),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  750   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  809

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  810   IISKDGGLLLKENFE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  868

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  869   ADIIRGLGLTILKGVMETRNDKIWARFAV--EANRDVTRME  907


 Score = 94.4 bits (233),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 89/184 (48%), Gaps = 52/184 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK+LC  N WSYAVFW    QN   L   + YYE                       
Sbjct  6     KEALKTLCGVNQWSYAVFWKIGCQNPKLLIWEECYYEPASCSGLSVNQNQETAFHDYGAS  65

Query  2230  ----------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVW  2105
                             + +  L++ M++   VNI+G G+VG+VAFT NH+W+LS+ N   
Sbjct  66    WISAETHSLQSYAQAGDRVHSLVNKMMMDNHVNIVGEGLVGRVAFTGNHQWILSE-NYCK  124

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
             ++H        E+L+    E   QFS G++T+AV+ V P GVVQFGS  K+ E M F+++
Sbjct  125   EAH------PPEVLK----EVNLQFSAGMQTVAVVPVLPHGVVQFGSYLKIMENMAFLND  174

Query  1924  TKKL  1913
                L
Sbjct  175   VTSL  178



>gb|KDP23204.1| hypothetical protein JCGZ_00320 [Jatropha curcas]
Length=962

 Score =   174 bits (442),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  755   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  814

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  815   ILNKEGGLLLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  873

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  874   ADLIRGLGLTILKGVMEARNDKIWALFAV--EANRDVTRME  912


 Score = 91.3 bits (225),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 84/184 (46%), Gaps = 54/184 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGL-----------------  2213
             + +L++LC  N W YAVFW    QN   L   + ++E ++  L                 
Sbjct  6     REVLRTLCGANQWCYAVFWKIGYQNPKLLIWEECHFESKLSSLPPRTSGIENPELPFGEC  65

Query  2212  ------------------------IDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                                     I+ M++  QVN++G G+VG+ AFT NH+W+L++   
Sbjct  66    EGHQASDIHFSQPNVQTGEAVHLLINKMMMNNQVNVVGQGIVGRAAFTGNHEWILANNY-  124

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
                       N D    +  +E + QFS G++TIAVI V P GVVQ GS+  + E M FV
Sbjct  125   ----------NGDVHPPEVFTEIHQQFSAGMQTIAVIPVSPHGVVQLGSSLTMVENMGFV  174

Query  1930  DETK  1919
             +  K
Sbjct  175   NNVK  178



>ref|XP_004251101.1| PREDICTED: transcription factor LHW-like [Solanum lycopersicum]
Length=930

 Score =   174 bits (442),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  725   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  784

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  785   IISKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  843

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  844   ADIIRGLGLTILKGVMETRNDKIWAKFAV--EANRDVTRME  882


 Score = 90.1 bits (222),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 61/190 (32%), Positives = 90/190 (47%), Gaps = 59/190 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAV+W    QN+  L   ++YYE                       
Sbjct  6     KEVLKTLCGVNQWSYAVYWKIGCQNTKLLIWEESYYEPSTYSGIHGVPMVENPELPFHDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  Q+NI+G G+VG+ A T +H+W  S+  
Sbjct  66    GVCWGPGEVRNPQLMNQAGERVQLLVNKMMMESQINIVGEGLVGRAAVTGSHQWFHSE--  123

Query  2113  SVWQSHHGLAD--NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERM  1940
                    GL+   +  E+L+    E  GQFS GI+TIAV+ V P GV+QFGS   + E M
Sbjct  124   -------GLSRVVHPQEVLK----ELTGQFSAGIQTIAVVPVLPHGVLQFGSCLHIMENM  172

Query  1939  EFVDETKKLF  1910
              FV++ + L 
Sbjct  173   SFVEDVRILI  182



>ref|XP_006362846.1| PREDICTED: transcription factor LHW-like [Solanum tuberosum]
Length=929

 Score =   174 bits (441),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  725   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  784

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  785   IISKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  843

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  844   ADIIRGLGLTILKGVMETRNDKIWARFAV--EANRDVTRME  882


 Score = 86.3 bits (212),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 87/189 (46%), Gaps = 57/189 (30%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAV+W    QN+  L   ++YYE                       
Sbjct  6     KEVLKTLCGVNQWSYAVYWKIGCQNTKLLIWEESYYEPSTFSGIHGISGVENSELSFHDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDT-  2117
                                E +  L++ M++  Q+NI+G G+VG+ A T +H+W  S+  
Sbjct  66    GVCWGSGEVRNPQLMNQAGERVHMLVNKMMMESQINIVGEGLVGRAAVTGSHQWFHSEGF  125

Query  2116  NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERME  1937
             N V            E+L+    E  GQ+S GI+TIAV+ + P GVVQFGS   + E   
Sbjct  126   NRVVHP--------PEVLK----ELTGQYSAGIQTIAVVPILPHGVVQFGSCLHIMESTS  173

Query  1936  FVDETKKLF  1910
             FV++ + L 
Sbjct  174   FVEDVRILI  182



>ref|XP_009373889.1| PREDICTED: transcription factor LHW-like isoform X1 [Pyrus x 
bretschneideri]
Length=965

 Score =   174 bits (442),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID LL +TIK +LFLQ VT+ A+ LK+T E K
Sbjct  763   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALLERTIKHMLFLQGVTKHADKLKQTGESK  822

Query  838   DKK-GRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              +  G+KD     ++   G TWA E+  Q+M+CP++VEDL  P QML+E+LC+EQGFFLE
Sbjct  823   MQIIGKKDGLVLKDNFDGGATWAFEVGTQSMVCPIIVEDLNPPHQMLVEMLCEEQGFFLE  882

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  883   IADLIRGMGLTILKGVMEARNDKIWACFAV--EANRDVTRME  922


 Score = 87.0 bits (214),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 55/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK LC  N W+YAVFW    QN   L   + +YE                       
Sbjct  6     KEVLKRLCGANQWAYAVFWKIGCQNPKLLIWEECHYESSVSSLPKRNAGTERAELPFGEW  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++    NI+G G+VG+ AFT NH+W+LS  N
Sbjct  66    EGCWVSSKVCSSSSGIQQEERVSSLINTMMMDKPFNIVGEGMVGRAAFTGNHQWILSG-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E   F
Sbjct  125   YRKDAH------PPEVL----NEMHHQFSSGMQTVAVIPVLPHGVVQLGSSTAMMEDTGF  174

Query  1933  VDETKKL  1913
             +++ K L
Sbjct  175   INDVKSL  181



>ref|XP_007132495.1| hypothetical protein PHAVU_011G098900g [Phaseolus vulgaris]
 gb|ESW04489.1| hypothetical protein PHAVU_011G098900g [Phaseolus vulgaris]
Length=949

 Score =   174 bits (442),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK T E K
Sbjct  742   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKHTGESK  801

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  802   IVSKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  860

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  861   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  899


 Score = 91.3 bits (225),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 60/183 (33%), Positives = 83/183 (45%), Gaps = 50/183 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +L++LC  N WSYAVFW     NS  L   D YYE                       
Sbjct  6     KEVLRTLCSRNRWSYAVFWKIGCNNSKLLIWEDHYYEPLPSPFPPRTVGMSNFPYRDGEG  65

Query  2230  --------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQS  2099
                           + +GGLI+ M++   V+I G G+VG+  FT N++W+L +  S    
Sbjct  66    CWFSSESQLGIQEEDRVGGLINKMIVNNSVSIAGEGIVGRATFTGNYQWILMNNFSR---  122

Query  2098  HHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
                     D    +   E   QFS G++T+AVI V P GVVQFGS   + E + FV++ K
Sbjct  123   --------DAYPPEVYPELLYQFSAGMQTVAVIPVLPHGVVQFGSLLPIMEDIGFVNDVK  174

Query  1918  KLF  1910
              L 
Sbjct  175   NLI  177



>ref|XP_010031563.1| PREDICTED: transcription factor LHW-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW50922.1| hypothetical protein EUGRSUZ_J00573 [Eucalyptus grandis]
Length=865

 Score =   174 bits (440),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 115/163 (71%), Gaps = 7/163 (4%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQ VT+ A+ L++T E K
Sbjct  664   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQGVTKHADKLEQTAESK  723

Query  838   ----DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFL  671
                 D++G      N +  G TWA E+ +Q+M+CP++VEDL  PGQML+E+LCQE+G+FL
Sbjct  724   MQIIDREGGLLLKDNFD-GGATWAFEVGSQSMVCPIIVEDLNPPGQMLVEMLCQERGYFL  782

Query  670   EIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             EI DIIRG GL IL+G +E R  KIWA F V  EAN  V+R E
Sbjct  783   EIADIIRGLGLTILRGKVEARNDKIWAQFSV--EANRDVTRME  823


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK++C  N WSYAVFW F  QN   L   + YYE                       
Sbjct  6     KEALKTICGVNQWSYAVFWKFGCQNPKLLIWEECYYEPLRCCVPPSTAVSVIGKVPMGEF  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                +++  LID M++Q  +NI+G G++G+ AFT NH W+LS + 
Sbjct  66    DGCLVTPENQFAMPENHAADKIQSLIDKMMIQNQINIVGEGIIGRAAFTGNHLWILSSSY  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                        N D    +  +E   QFS G++TIAVI + P GV+Q GS+  + E + F
Sbjct  126   -----------NGDAYPPEVQNETLHQFSAGMQTIAVIPITPHGVIQVGSSLHIMENVRF  174

Query  1933  VDETKKLF  1910
             VDE + L 
Sbjct  175   VDEVRSLI  182



>gb|KHG29075.1| hypothetical protein F383_03858 [Gossypium arboreum]
Length=859

 Score =   174 bits (440),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 110/159 (69%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LF+QSVT+ A+ +K   E K
Sbjct  661   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFMQSVTKHADKIKHMGESK  720

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              K+  K         G TWA E+ +++MICP++VEDL  P QML+E+LC+EQGFFLEI D
Sbjct  721   IKENFK--------GGTTWAFEVGSRSMICPIIVEDLNPPRQMLVEMLCEEQGFFLEIAD  772

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             +IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  773   LIRGMGLTILKGVMETRNDKIWARFAV--EANRDVTRVE  809


 Score = 88.6 bits (218),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 84/178 (47%), Gaps = 45/178 (25%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLL-----------  2195
             K  LKSLC    WSYAVFW    +N+  L   + YYE  + GL    LL           
Sbjct  6     KEALKSLCGVTQWSYAVFWKIGCRNTKLLIWEEYYYESTLPGLRYPELLFQEWGECCGSD  65

Query  2194  -----------------------QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLA  2084
                                    ++ I+G G+VG+ AFT NH+W+L+++       +   
Sbjct  66    TSSQLGCQPWDKVGLLISKMMNNRIVIVGQGLVGRAAFTGNHQWILANS-------YMTD  118

Query  2083  DNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
                 E+L    +E + QFS G++T+AVI V P GV+Q GS+  + E M FV++ K L 
Sbjct  119   SEPPEVL----NELHLQFSAGMQTVAVIPVFPHGVLQLGSSTTIMENMGFVNDVKSLI  172



>ref|XP_009373890.1| PREDICTED: transcription factor LHW-like isoform X2 [Pyrus x 
bretschneideri]
Length=963

 Score =   174 bits (441),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID LL +TIK +LFLQ VT+ A+ LK+T E K
Sbjct  763   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALLERTIKHMLFLQGVTKHADKLKQTGESK  822

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G+KD     ++   G TWA E+  Q+M+CP++VEDL  P QML+E+LC+EQGFFLEI
Sbjct  823   -IIGKKDGLVLKDNFDGGATWAFEVGTQSMVCPIIVEDLNPPHQMLVEMLCEEQGFFLEI  881

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  882   ADLIRGMGLTILKGVMEARNDKIWACFAV--EANRDVTRME  920


 Score = 87.0 bits (214),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 55/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK LC  N W+YAVFW    QN   L   + +YE                       
Sbjct  6     KEVLKRLCGANQWAYAVFWKIGCQNPKLLIWEECHYESSVSSLPKRNAGTERAELPFGEW  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++    NI+G G+VG+ AFT NH+W+LS  N
Sbjct  66    EGCWVSSKVCSSSSGIQQEERVSSLINTMMMDKPFNIVGEGMVGRAAFTGNHQWILSG-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E   F
Sbjct  125   YRKDAH------PPEVL----NEMHHQFSSGMQTVAVIPVLPHGVVQLGSSTAMMEDTGF  174

Query  1933  VDETKKL  1913
             +++ K L
Sbjct  175   INDVKSL  181



>gb|KEH29770.1| bHLH transcription factor-like protein [Medicago truncatula]
Length=921

 Score =   174 bits (441),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  727   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  786

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  787   IVSKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNHPRQMLVEMLCEERGFFLEI  845

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  846   ADLIRGLGLTILKGVMEARNDKIWARFSV--EANRDVTRME  884


 Score = 85.9 bits (211),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 83/185 (45%), Gaps = 54/185 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK+LC  N WSYAVFW     NS  L   D YYE                       
Sbjct  6     KEALKTLCARNQWSYAVFWKIGCNNSKLLIWEDCYYEPLPSTFLPQNVGTSNLPYQDREG  65

Query  2230  --------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDT--NSVW  2105
                           + +  LI+ M++   VN+ G G++G+ AFT NH+W+L +     V+
Sbjct  66    CWFSSDSQLRIQEDDRVCSLINKMMVNNSVNVAGQGILGRAAFTGNHQWILLNNFIKDVY  125

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
                        E+L    +E + QFS G++T+ VI V P GVVQ GS   + E + FV++
Sbjct  126   PP---------EVL----NEVHCQFSAGMQTVVVIPVLPHGVVQLGSFLPIMENIGFVND  172

Query  1924  TKKLF  1910
              K L 
Sbjct  173   VKNLI  177



>ref|XP_010533555.1| PREDICTED: transcription factor bHLH157-like isoform X1 [Tarenaya 
hassleriana]
Length=641

 Score =   171 bits (434),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 110/151 (73%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR +IPNG K SID LL  TIK +LF+QS+ + A+ LK+  E K
Sbjct  439   RPRPKDRQMIQDRIKELRGMIPNGAKCSIDALLDLTIKHMLFMQSIAKYADKLKQPYEPK  498

Query  838   --DKKGRK-DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
               ++KG   +     + NG TWA E+ +++++CP++VEDL  PGQMLIE+LC+E+G FLE
Sbjct  499   LINQKGSSVEEQLAGDRNGATWAFEVGDESVVCPIIVEDLNRPGQMLIEMLCEEEGRFLE  558

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D ++GFGLN+LKG ME R+ +IWAHFIVE
Sbjct  559   IADAVKGFGLNVLKGVMERRDGRIWAHFIVE  589


 Score =   122 bits (307),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 23/195 (12%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             K +LKSLCC +GWSYAVFW ++  NS+ LT+ DAY++E+    +DDMLLQV+I G G++G
Sbjct  6     KHMLKSLCCSHGWSYAVFWRYDHINSMLLTMGDAYHDEQFRTAVDDMLLQVHIFGEGIIG  65

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
             + A T NH+WM  DT              D++ Q ++          ++T+ V+ V   G
Sbjct  66    EAALTGNHRWMSRDT-------------ADDIFQVENE---------LQTVLVVPVGSRG  103

Query  1981  VVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSS  1802
             V QFGS +K+ E  E ++ET    +   ++ + A S   S++ +   L    AS +   S
Sbjct  104   VAQFGSTRKIQESPEILEETTTALE-LAMDHVSAASPPRSSDLETLDLDSLFASLVPLRS  162

Query  1801  YFMSPEALPSPDFVD  1757
               M  ++L    F D
Sbjct  163   PDMHDQSLHGLSFDD  177



>ref|XP_006424092.1| hypothetical protein CICLE_v10029797mg [Citrus clementina]
 gb|ESR37332.1| hypothetical protein CICLE_v10029797mg [Citrus clementina]
Length=944

 Score =   174 bits (440),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  738   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  797

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P Q+L+E+LC+E+GFFLEI
Sbjct  798   IISKEGGLLLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQLLVEMLCEERGFFLEI  856

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  857   ADLIRGLGLTILKGLMEARNDKIWARFAV--EANRDVTRME  895


 Score = 92.4 bits (228),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 85/176 (48%), Gaps = 43/176 (24%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             + +LK+ C GN W YAVFW    QN+  L   + +YE                       
Sbjct  6     RQVLKAFCAGNQWCYAVFWKIGCQNTKLLIWEECHYESTPHPDIPFGEWDGCWGSYEILS  65

Query  2230  -------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADN  2078
                    + +  LI+ M+   QVN++G G++G+ AFT NH+W L++ N +  +H     N
Sbjct  66    RLRIQAEDRVQLLINKMMNNNQVNVVGEGILGRAAFTGNHQWFLAN-NHIRDAHPPEVQN  124

Query  2077  CDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
                       E + QFS G++T+AVI + P GVVQ GS+  + E + FV+  K L 
Sbjct  125   ----------EVHLQFSAGMQTVAVIPILPHGVVQLGSSLAISENIGFVNYVKSLI  170



>gb|KDO46593.1| hypothetical protein CISIN_1g036631mg [Citrus sinensis]
Length=944

 Score =   174 bits (440),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  738   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  797

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P Q+L+E+LC+E+GFFLEI
Sbjct  798   IISKEGGLLLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQLLVEMLCEERGFFLEI  856

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  857   ADLIRGLGLTILKGLMEARNDKIWARFAV--EANRDVTRME  895


 Score = 92.4 bits (228),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/176 (32%), Positives = 85/176 (48%), Gaps = 43/176 (24%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             + +LK+ C GN W YAVFW    QN+  L   + +YE                       
Sbjct  6     RQVLKAFCAGNQWCYAVFWKIGCQNTKLLIWEECHYESTPHPDIPFGEWDGCWGSYEILS  65

Query  2230  -------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADN  2078
                    + +  LI+ M+   QVN++G G++G+ AFT NH+W L++ N +  +H     N
Sbjct  66    RLRIQAEDRVQLLINKMMNNNQVNVVGEGILGRAAFTGNHQWFLAN-NHIRDAHPPEVQN  124

Query  2077  CDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
                       E + QFS G++T+AVI + P GVVQ GS+  + E + FV+  K L 
Sbjct  125   ----------EVHLQFSAGMQTVAVIPILPHGVVQLGSSLAISENIGFVNYVKSLI  170



>ref|XP_004242114.1| PREDICTED: transcription factor LHW-like isoform X1 [Solanum 
lycopersicum]
Length=911

 Score =   173 bits (439),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  705   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALFERTIKHMLFLQSVTKHADKLKQTGESK  764

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  765   IISKEGGLLLKDNLE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  823

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  824   ADIIRGLGLTILKGVMETRNDKIWAQFAV--EANRDVTRME  862


 Score = 92.8 bits (229),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 89/190 (47%), Gaps = 59/190 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++YYE                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKILIWEESYYETSTLSNIHGTSGVENPELAFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++  Q N++G G++G+ A T  H+W+LS+  
Sbjct  66    STGWAFGGVQNSQLQNQAGENLHLLINKMMMDNQFNLVGEGLIGRAAVTGKHQWVLSE--  123

Query  2113  SVWQSHHGLADNCD--ELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERM  1940
                    GL+ N    E+L+    E   QFS GI+TI+VI V P GVVQFGS   + E M
Sbjct  124   -------GLSRNVHPPEVLR----ELRQQFSAGIQTISVIPVLPHGVVQFGSYLHIMENM  172

Query  1939  EFVDETKKLF  1910
              FV++ K L 
Sbjct  173   GFVEDVKTLM  182



>ref|XP_004293110.1| PREDICTED: transcription factor LHW-like [Fragaria vesca subsp. 
vesca]
Length=963

 Score =   173 bits (439),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 112/160 (70%), Gaps = 3/160 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T + K
Sbjct  757   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGKGK  816

Query  838   DKKGRKDSNSNSNTNG-VTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                     +   N +G  TWA ++ +Q+M+CP++VEDL  P QML+E+LC+EQGFFLEI 
Sbjct  817   IIGKEAGLHLKENFDGRATWAFDVGSQSMVCPIIVEDLDAPRQMLVEMLCEEQGFFLEIA  876

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  877   DLIRGLGLTILKGMMETRNDKIWARFAV--EANRDVTRME  914


 Score = 85.9 bits (211),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 86/189 (46%), Gaps = 55/189 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY-------------------------  2237
             K  LK LC  N W+YAVFW    QNS  L   +++                         
Sbjct  6     KEALKRLCTANHWAYAVFWKIGCQNSNLLIWEESHCEPSLSSRRTHIDGTESGESPFGEW  65

Query  2236  -----------------YEEEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                               EE +  L++ ML+     I+G G+VG+ AFT NH+W+LS   
Sbjct  66    EGCWASSDMCSSSHGIQPEEFVSALLNKMLMNKPFTIMGEGIVGRAAFTGNHQWILSSNY  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
             S +        +  E++    +E + QFS G++T+AVI V P GVVQ GS+  + E + F
Sbjct  126   SKYA-------HPPEVV----NEMHHQFSAGMQTVAVIPVLPHGVVQLGSSLTIMENIGF  174

Query  1933  VDETKKLFQ  1907
             +++ + L +
Sbjct  175   INDVRSLIR  183



>ref|XP_006494896.1| PREDICTED: transcription factor LHW-like [Citrus sinensis]
Length=953

 Score =   173 bits (439),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  747   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  806

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P Q+L+E+LC+E+GFFLEI
Sbjct  807   IISKEGGLLLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQLLVEMLCEERGFFLEI  865

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  866   ADLIRGLGLTILKGLMEARNDKIWARFAV--EANRDVTRME  904


 Score = 96.3 bits (238),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 90/188 (48%), Gaps = 43/188 (23%)
 Frame = -1

Query  2377  KKMSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------  2231
             KK  K K   + + +LK+ C GN W YAVFW    QN+  L   + +YE           
Sbjct  3     KKERKSKMGAMLRQVLKAFCAGNQWCYAVFWKIGCQNTKLLIWEECHYESTPHPDIPFGE  62

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                + +  LI+ M+   QVN++G G++G+ AFT NH+W L++ N
Sbjct  63    WDGCWGSYEILSRLRIHAEDRVQLLINKMMNNNQVNVVGEGILGRAAFTGNHQWFLAN-N  121

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
              +  +H     N          E + QFS G++T+AVI + P GVVQ GS+  + E + F
Sbjct  122   HIRDAHPPEVQN----------EVHLQFSAGMQTVAVIPILPHGVVQLGSSLAISENIGF  171

Query  1933  VDETKKLF  1910
             V+  K L 
Sbjct  172   VNYVKSLI  179



>ref|XP_009804416.1| PREDICTED: transcription factor LHW-like isoform X2 [Nicotiana 
sylvestris]
Length=948

 Score =   173 bits (439),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 107/155 (69%), Gaps = 3/155 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  745   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  804

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+E+G FLEI
Sbjct  805   IISKEGGLLLKDNLE-GGATWAYEVSSQSMVCPIVVEDLNQPRQMLVEMLCEERGLFLEI  863

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANA  560
              DIIRG GL ILKG ME R  KIWA F VE   N 
Sbjct  864   ADIIRGLGLTILKGVMETRNDKIWARFAVEAYRNV  898


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 85/188 (45%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++Y E                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKLLIWEESYCETSTFSGLHGTCEVENPKLAFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L+  M++  Q N++G G++G+ A   NH+W+LS   
Sbjct  66    SACWDSGEVQNSQLLNQAGESLCLLVKRMMMDKQFNLVGEGLIGRAAAIGNHQWILSKGQ  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
             S  +  H       E+L+    E   QFS GI+TI+VI V P GVVQFGS   + E M F
Sbjct  126   S--KDAHP-----PEVLK----ELSQQFSSGIQTISVIPVLPHGVVQFGSYLHILENMGF  174

Query  1933  VDETKKLF  1910
             V++ + L 
Sbjct  175   VEDVRTLI  182



>ref|XP_008450293.1| PREDICTED: transcription factor LHW isoform X2 [Cucumis melo]
Length=913

 Score =   173 bits (438),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  754   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALFEKTIKHMLFLQSVTKHADKLKQTGESK  813

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +QTM+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  814   IISKEGGLFLKDNFE-GGATWAFEVGSQTMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  872

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              D+IRG GL ILKG ME R+ KIWA F VE
Sbjct  873   ADLIRGMGLTILKGVMEARDNKIWARFAVE  902


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 84/185 (45%), Gaps = 52/185 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY------------------------  2234
             K +LK+LC  + WSYAVFW    QN+  L   + +Y                        
Sbjct  6     KEMLKALCGSSQWSYAVFWKIGCQNTKLLIWEECHYQPLPSFDSSGSESSKFPLGELEGC  65

Query  2233  ---------------EEEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVW  2105
                            E+++  LI  M L   V+++G G+VG+ AF  NH W+LS      
Sbjct  66    WGYSQSSSSLQSNHGEDKLYSLIHKMNLNKHVSLVGEGIVGRAAFIGNHLWILS------  119

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
              S++       E+L    SE + QF  G++T+AVI V P GVVQ GS+  + E M FV+ 
Sbjct  120   -SNYTRDAYPPEVL----SELHQQFLAGMQTVAVIPVLPHGVVQLGSSFSIMENMMFVNH  174

Query  1924  TKKLF  1910
              K L 
Sbjct  175   VKSLI  179



>ref|XP_006361093.1| PREDICTED: transcription factor LHW-like [Solanum tuberosum]
Length=912

 Score =   173 bits (438),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  706   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALFERTIKHMLFLQSVTKHADKLKQTGESK  765

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  766   IISKEGGLLLKDNLE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  824

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  825   ADIIRGLGLTILKGVMETRNDKIWAQFAV--EANRDVTRME  863


 Score = 94.4 bits (233),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 90/190 (47%), Gaps = 59/190 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++YYE                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKILIWEESYYETSTLSNIHGTSGVENPELAFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  Q N++G G++G+ A T NH+W+LS+  
Sbjct  66    STGWVSGGVQNSQLQNQAGENLHLLVNKMMMDNQFNLVGEGLIGRAAVTGNHQWILSE--  123

Query  2113  SVWQSHHGLADNCD--ELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERM  1940
                    GL+ N    E+L+    E   QFS GI+TI+VI V P GVVQFGS   + E M
Sbjct  124   -------GLSRNAHPPEVLK----ELCQQFSAGIQTISVIPVLPHGVVQFGSYLHIMENM  172

Query  1939  EFVDETKKLF  1910
              FV++ K L 
Sbjct  173   GFVEDVKTLI  182



>gb|KCW50923.1| hypothetical protein EUGRSUZ_J00573 [Eucalyptus grandis]
Length=815

 Score =   172 bits (436),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 109/150 (73%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQ VT+ A+ L++T E K
Sbjct  664   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQGVTKHADKLEQTAESK  723

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               D++G      N +  G TWA E+ +Q+M+CP++VEDL  PGQML+E+LCQE+G+FLEI
Sbjct  724   IIDREGGLLLKDNFD-GGATWAFEVGSQSMVCPIIVEDLNPPGQMLVEMLCQERGYFLEI  782

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              DIIRG GL IL+G +E R  KIWA F VE
Sbjct  783   ADIIRGLGLTILRGKVEARNDKIWAQFSVE  812


 Score = 98.6 bits (244),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK++C  N WSYAVFW F  QN   L   + YYE                       
Sbjct  6     KEALKTICGVNQWSYAVFWKFGCQNPKLLIWEECYYEPLRCCVPPSTAVSVIGKVPMGEF  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                +++  LID M++Q  +NI+G G++G+ AFT NH W+LS + 
Sbjct  66    DGCLVTPENQFAMPENHAADKIQSLIDKMMIQNQINIVGEGIIGRAAFTGNHLWILSSSY  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                        N D    +  +E   QFS G++TIAVI + P GV+Q GS+  + E + F
Sbjct  126   -----------NGDAYPPEVQNETLHQFSAGMQTIAVIPITPHGVIQVGSSLHIMENVRF  174

Query  1933  VDETKKLF  1910
             VDE + L 
Sbjct  175   VDEVRSLI  182



>ref|XP_006378984.1| hypothetical protein POPTR_0009s02270g [Populus trichocarpa]
 gb|ERP56781.1| hypothetical protein POPTR_0009s02270g [Populus trichocarpa]
Length=874

 Score =   172 bits (437),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T   +
Sbjct  667   RPRPKDRQMIQDRVKELREIVPNGAKCSIDSLLERTIKHMLFLQSVTKHADKLKQTGDSK  726

Query  844   LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             L +K+G      N    G TWA E+ +++M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  727   LINKEGGLHLKDNFE-GGATWAFEVGSRSMVCPIIVEDLNPPRQMLVEMLCEEKGFFLEI  785

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  ++R E
Sbjct  786   ADLIRGLGLTILKGVMEARNDKIWACFAV--EANRDITRME  824


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 58/92 (63%), Gaps = 11/92 (12%)
 Frame = -1

Query  2194  QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             QV I+G G+VG+ AFT NH+W+L++ N    +H        E+L    +E + QFS G++
Sbjct  6     QVIIVGEGIVGRAAFTGNHEWILAN-NYCKDAHP------PEVL----NEAHHQFSAGMQ  54

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
             TIAV+ V P GV+Q GS+  +PE + FV+  K
Sbjct  55    TIAVVPVCPYGVLQLGSSLAIPENIGFVNIVK  86



>gb|KHN21191.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=957

 Score =   172 bits (437),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  751   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKQTGESK  810

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+  Q+M+CP++VEDL  P QML+E+LC+E GFFLEI
Sbjct  811   IVSKEGGLLLKDNFE-GGATWAYEVGAQSMVCPIIVEDLNPPRQMLVEMLCEECGFFLEI  869

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  870   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  908


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 50/183 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L++LC  N WSYAVFW     NS  L   D YYE                       
Sbjct  6     KEALRTLCSRNRWSYAVFWKIGCNNSKLLIWEDYYYEPLPSPFPPRTVGRSNFPYQDEEG  65

Query  2230  --------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQS  2099
                           + +  LI+ M++   V+I G G+VG+ AFT N++W+L +  +    
Sbjct  66    CWFSSESQLGIQEEDRVRVLINKMMVNNSVSIAGEGIVGRAAFTGNYQWILLNNFTR---  122

Query  2098  HHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
                     D    +   E + QFS G++T+AVI V P GVVQ GS   + E + FV++ K
Sbjct  123   --------DAYPPEVYPELHYQFSAGMQTVAVIPVLPHGVVQLGSFSPIMEDIGFVNDVK  174

Query  1918  KLF  1910
                
Sbjct  175   NFI  177



>ref|XP_003540817.1| PREDICTED: transcription factor LHW-like [Glycine max]
Length=957

 Score =   172 bits (437),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  751   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKQTGESK  810

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+  Q+M+CP++VEDL  P QML+E+LC+E GFFLEI
Sbjct  811   IVSKEGGLLLKDNFE-GGATWAYEVGAQSMVCPIIVEDLNPPRQMLVEMLCEECGFFLEI  869

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  870   ADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRME  908


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 80/183 (44%), Gaps = 50/183 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L++LC  N WSYAVFW     NS  L   D YYE                       
Sbjct  6     KEALRTLCSRNRWSYAVFWKIGCNNSKLLIWEDYYYEPLPSPFPPRTVGRSNFPYQDGEG  65

Query  2230  --------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQS  2099
                           + +  LI+ M++   V+I G G+VG+ AFT N++W+L +  +    
Sbjct  66    CWFSSESQLGIQEEDRVRVLINKMMVNNSVSIAGEGIVGRAAFTGNYQWILLNNFTR---  122

Query  2098  HHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
                     D    +   E + QFS G++T+AVI V P GVVQ GS   + E + FV++ K
Sbjct  123   --------DAYPPEVYPELHYQFSAGMQTVAVIPVLPHGVVQLGSFSPIMEDIGFVNDVK  174

Query  1918  KLF  1910
                
Sbjct  175   NFI  177



>ref|XP_006592778.1| PREDICTED: transcription factor LHW-like isoform X1 [Glycine 
max]
 gb|KHN17978.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=952

 Score =   172 bits (437),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  748   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  807

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+E+GFFLEI
Sbjct  808   IINKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIVVEDLNPPRQMLVEMLCEERGFFLEI  866

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA F V  EAN  ++R E
Sbjct  867   ADLIRGLGLTILKGVMEAHNDKIWARFAV--EANRDLTRME  905


 Score = 82.8 bits (203),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 79/184 (43%), Gaps = 51/184 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L++LC  N WSYAVFW     NS  L   + YYE                       
Sbjct  6     KEALRTLCGRNQWSYAVFWKIGCHNSKLLIWEECYYEPLPCPPHMFGMPDLPYQNGEGCW  65

Query  2230  ---------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQ  2102
                            +++  LI+ M +   V I G G+VG+ AFT +H+W+L +  +   
Sbjct  66    FSLEYRSSQLGIQEDDQVSSLINKMTVNNSVIIAGEGIVGRAAFTGSHQWILLNNFTK--  123

Query  2101  SHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDET  1922
                      D       +E + QFS GI+T+AVI V P GVVQ GS   + E M FV + 
Sbjct  124   ---------DAYPPQVYAEVHHQFSAGIQTVAVIPVLPHGVVQLGSFFPIIENMGFVKDV  174

Query  1921  KKLF  1910
             K L 
Sbjct  175   KSLI  178



>ref|XP_008361584.1| PREDICTED: transcription factor LHW-like isoform X1 [Malus domestica]
Length=965

 Score =   172 bits (437),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 114/162 (70%), Gaps = 5/162 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID LL +TIK +LFLQ VT+ A+ LK+T E K
Sbjct  763   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALLERTIKHMLFLQGVTKHADELKQTGESK  822

Query  838   DKK-GRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              +  G+KD     ++   G TWA ++  Q+M+CP++VEDL  P QML+E+LC+EQGFFLE
Sbjct  823   MQIIGKKDGLVLKDNFDGGATWAFDVGTQSMVCPIIVEDLNPPRQMLVEMLCEEQGFFLE  882

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  883   IADLIRGMGLTILKGVMEARNDKIWACFAV--EANRDVTRME  922


 Score = 83.6 bits (205),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 55/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  L  LC  N W+YAVFW    QN   L   + +YE                       
Sbjct  6     KEALNRLCGANQWAYAVFWKIGCQNPKLLIWEECHYEPSVSSLPKRNAETERAELPFGEW  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++    NI+G G+VG+ AFT NH+W++S  N
Sbjct  66    EGCWVSSKVCSSSSGIQQEERVSTLINTMMMDKPFNIVGEGIVGRAAFTGNHQWIVSG-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E   F
Sbjct  125   YRKDAH------PPEVL----NEMHHQFSAGMQTVAVIPVIPHGVVQLGSSTAMMEDTGF  174

Query  1933  VDETKKL  1913
             +++ K L
Sbjct  175   INDVKSL  181



>ref|XP_004487450.1| PREDICTED: transcription factor LHW-like isoform X1 [Cicer arietinum]
 ref|XP_004487451.1| PREDICTED: transcription factor LHW-like isoform X2 [Cicer arietinum]
Length=848

 Score =   171 bits (434),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK++ E K
Sbjct  642   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQSGESK  701

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  702   IISKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLDPPRQMLVEMLCEERGFFLEI  760

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA F+V  EAN  V+R E
Sbjct  761   ADLIRGLGLTILKGVMEAHNGKIWARFVV--EANRDVTRME  799


 Score = 80.9 bits (198),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 81/186 (44%), Gaps = 53/186 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW     NS  L   + Y+E                       
Sbjct  6     KEVLKTLCNRNQWSYAVFWKIGCNNSKLLIWEECYHEPLLCPSPRGIVGMSNFPNQNGEG  65

Query  2230  -----------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
                              +++  LI+ M +   V + G G++G+ AFT +H+W+L +  + 
Sbjct  66    CWFSSESQSFHLGIQEEDKVSSLINKMTVNNLVIVAGEGMIGRAAFTNSHQWILLNNFAK  125

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
                        D    +  +E + QFS G++T+AVI V P GVVQ GS   + E M FV 
Sbjct  126   -----------DAYPPEVYAEVHHQFSAGMQTVAVIPVLPHGVVQLGSFLPIMENMGFVH  174

Query  1927  ETKKLF  1910
             E K L 
Sbjct  175   EVKSLI  180



>ref|XP_010685440.1| PREDICTED: transcription factor LHW-like [Beta vulgaris subsp. 
vulgaris]
Length=911

 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/164 (56%), Positives = 115/164 (70%), Gaps = 11/164 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  701   RPRPKDRQMIQDRVKELREIVPNGSKCSIDALLERTIKHMLFLQSVTKHADKLKQTVESK  760

Query  838   --DKKG---RKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
               +K+G    KD    S     TWA E+ +Q+M+CP+VVEDL  P Q+LIE+LC+ +GFF
Sbjct  761   IANKEGGMLSKDGFQGS----ATWAFELGSQSMVCPIVVEDLNPPRQLLIEMLCEHRGFF  816

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI DIIRG GL ILKG ME++  KIWA F V  EAN  V+R E
Sbjct  817   LEIADIIRGLGLTILKGVMEVQNDKIWARFAV--EANRDVTRME  858


 Score = 88.6 bits (218),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 84/170 (49%), Gaps = 37/170 (22%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY------------------------  2234
             K +LK++C  N WSYAVFW    QN   L   + YY                        
Sbjct  6     KEVLKAICGVNQWSYAVFWKIGCQNPKLLIWEECYYGSSSSAAQNRCLQKQEGYNNGAQV  65

Query  2233  EEEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQ  2060
              E++  L+D M++   VN++G G+VG+ AFT NH+W++S        ++ +A   + L  
Sbjct  66    GEKVHMLMDRMMISNHVNVVGEGLVGRAAFTGNHQWIVSGL------YNEIAHPAEVL--  117

Query  2059  DDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
                +E   QFS G++TIAVI V P GV+Q GS   + E + FV + +   
Sbjct  118   ---NEVRHQFSAGMQTIAVIPVIPHGVLQLGSPLTIMENVGFVHDVRSFI  164



>ref|XP_009804415.1| PREDICTED: transcription factor LHW-like isoform X1 [Nicotiana 
sylvestris]
Length=974

 Score =   172 bits (436),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  745   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  804

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+E+G FLEI
Sbjct  805   IISKEGGLLLKDNLE-GGATWAYEVSSQSMVCPIVVEDLNQPRQMLVEMLCEERGLFLEI  863

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              DIIRG GL ILKG ME R  KIWA F VE
Sbjct  864   ADIIRGLGLTILKGVMETRNDKIWARFAVE  893


 Score = 82.0 bits (201),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 85/188 (45%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++Y E                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKLLIWEESYCETSTFSGLHGTCEVENPKLAFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L+  M++  Q N++G G++G+ A   NH+W+LS   
Sbjct  66    SACWDSGEVQNSQLLNQAGESLCLLVKRMMMDKQFNLVGEGLIGRAAAIGNHQWILSKGQ  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
             S  +  H       E+L+    E   QFS GI+TI+VI V P GVVQFGS   + E M F
Sbjct  126   S--KDAHP-----PEVLK----ELSQQFSSGIQTISVIPVLPHGVVQFGSYLHILENMGF  174

Query  1933  VDETKKLF  1910
             V++ + L 
Sbjct  175   VEDVRTLI  182



>ref|XP_010247165.1| PREDICTED: transcription factor LHW-like isoform X3 [Nelumbo 
nucifera]
Length=900

 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  694   RPRPKDRQMIQDRVKELREIVPNGTKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  753

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+MICP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  754   IINKEGGLLLKDNFE-GGATWAFEVGSQSMICPIIVEDLNPPRQMLVEMLCEERGLFLEI  812

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  K+WA F V  EA+  V+R E
Sbjct  813   ADIIRGLGLTILKGVMEARNDKVWARFAV--EADRDVTRME  851


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 64/144 (44%), Gaps = 41/144 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             K  LK LC  N WSYAVFW    +N                                +VG
Sbjct  6     KEALKCLCGVNRWSYAVFWKIGCRNPT------------------------------IVG  35

Query  2161  QVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLG  1982
             + AFT  H W+L   N +  +H        E++    +E + QF  G++TIAVI V P G
Sbjct  36    RAAFTGAHLWILPG-NCLGVAHP------SEVM----AEVHHQFLSGMQTIAVIPVLPHG  84

Query  1981  VVQFGSNQKLPERMEFVDETKKLF  1910
             VVQ GS   + E MEFVD  K LF
Sbjct  85    VVQLGSTLTIMEDMEFVDSVKSLF  108



>ref|XP_010931062.1| PREDICTED: transcription factor LHW-like [Elaeis guineensis]
Length=947

 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+  + LK+T E K
Sbjct  744   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHVDKLKETGEPK  803

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N +  G TWA E+  Q+MICP+VVEDL  P Q+L+E+LC+E GFFLEI
Sbjct  804   IISKEGGLLLKDNFD-GGATWAFEVGTQSMICPIVVEDLKPPRQLLVEMLCEEHGFFLEI  862

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME R+ K+WA F V  EAN  V+R E
Sbjct  863   ADFIRGLGLTILKGVMEARKNKVWARFAV--EANRDVTRIE  901


 Score = 86.7 bits (213),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 81/184 (44%), Gaps = 58/184 (32%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE------------------------  2228
             LK LC   GWSYAVFW     +N   L   D Y E+                        
Sbjct  9     LKRLCIEIGWSYAVFWRAIGARNPTHLVWGDGYCEQTLGVAGFEATYLLRMEQGMISNSS  68

Query  2227  -----EMGGLIDD---------MLLQVNILGSGVVGQVAFTKNHKWM----LSDTNSVWQ  2102
                  EM GL D          M  QV+++G G++GQ A T NH+W+    L D+ S+ +
Sbjct  69    NDRTAEMRGLADYRVGVLVNKIMASQVHVVGDGIIGQAALTGNHQWIVRDNLKDSGSITE  128

Query  2101  SHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDET  1922
                GLA            E   QF   I+TIA+I V PLGVVQ GS Q + E + F++  
Sbjct  129   ---GLA------------EIKCQFLADIQTIAIIPVFPLGVVQLGSTQMVIENVGFINHV  173

Query  1921  KKLF  1910
             K LF
Sbjct  174   KSLF  177



>emb|CAN76581.1| hypothetical protein VITISV_034321 [Vitis vinifera]
Length=1023

 Score =   172 bits (436),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV + A+ LK+T E K
Sbjct  737   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVMKHADKLKQTGESK  796

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  797   IINKEGGLHLKDNFE-GGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  855

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              DIIRG GL ILKG ME R  KIWA F VE
Sbjct  856   ADIIRGMGLTILKGVMETRNDKIWARFTVE  885


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/240 (30%), Positives = 106/240 (44%), Gaps = 67/240 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LKSLC  N WSYAVFW    QN   L   + + E                       
Sbjct  6     KEALKSLCGVNQWSYAVFWKIGCQNPKLLIWEECHCEFIPSSGLPHGSGMENSEVPFEDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  QVNI+G G+VG+ AFT  H+W+LS+ N
Sbjct  66    EGCWVXPETRISQLDGQAVESIYFLVNKMMMNNQVNIVGEGIVGRAAFTGKHQWILSE-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GV+QFGS+  + E   F
Sbjct  125   YTRDAH------PPEVL----NEVHHQFSAGMQTVAVIPVLPHGVIQFGSSLAIMENAGF  174

Query  1933  VDETKKLF------QGTDIETIFAQSSSSSANGDVFGLSGSLAS------SICNSSYFMS  1790
             V++ K L        G  +   +A   +S   G+   ++ S+         + NSS F++
Sbjct  175   VNDVKSLILQLGCVPGALLSESYAIKETSQNIGEPISVAASIYGDPSRNYEVTNSSPFIA  234



>ref|XP_004506222.1| PREDICTED: transcription factor LHW-like [Cicer arietinum]
Length=934

 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  727   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  786

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  787   IVSKEGGLLLKDNFE-GGATWAYEVGSQSMVCPIIVEDLNHPRQMLVEMLCEERGLFLEI  845

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+++G GLNILKG ME R  KIWA F V  EAN  V+R E
Sbjct  846   ADLVKGLGLNILKGVMEARNDKIWARFSV--EANRDVTRME  884


 Score = 83.6 bits (205),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 86/183 (47%), Gaps = 50/183 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-------EEMGG-----------  2216
             K  LK+LC  N W YAVFW     NS  L   D YYE       +++G            
Sbjct  6     KEALKTLCSQNQWCYAVFWKIGCNNSKLLIWEDCYYEPLPSPFLQQIGATSNFPYRDAEG  65

Query  2215  -------------------LIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTNSVWQS  2099
                                LI+ M++   VN+ G G++G+ AFT +H+W+L + N +  +
Sbjct  66    CWFSTDSQLRIQEDDRVCSLINKMMVNNSVNVAGQGILGRAAFTGSHQWILLN-NFIKDA  124

Query  2098  HHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
             +        E+L    +E   QFS G++T+AVI V P GVVQ GS   + E + FV++ K
Sbjct  125   YP------PEVL----TELQCQFSAGMQTVAVIPVLPHGVVQLGSFLPIMENIGFVNDVK  174

Query  1918  KLF  1910
              L 
Sbjct  175   SLI  177



>ref|XP_008799711.1| PREDICTED: transcription factor LHW-like [Phoenix dactylifera]
Length=947

 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+  + LK+T E K
Sbjct  744   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHVDKLKETGEPK  803

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N +  G TWA E+  Q+MICP+VVEDL  P Q+L+E+LC+E+GFFLEI
Sbjct  804   IISKEGGLLLKDNFD-GGATWAFEVGTQSMICPIVVEDLKPPRQLLVEMLCEERGFFLEI  862

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME R+ K+WA F V  EAN  V+R E
Sbjct  863   ADFIRGLGLTILKGVMEARKNKVWARFAV--EANRDVTRIE  901


 Score = 89.4 bits (220),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 82/187 (44%), Gaps = 54/187 (29%)
 Frame = -1

Query  2347  VAKALLKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEEEMG----------------  2219
             V +  LK LC   GWSYAVFW     +N   L   D Y E+ +G                
Sbjct  4     VLREALKRLCIEIGWSYAVFWRAIGARNPTHLVWEDGYCEQTLGVSGFEATDLLLKEQGL  63

Query  2218  -------------GLIDD---------MLLQVNILGSGVVGQVAFTKNHKWMLSDT-NSV  2108
                          GL DD         M  QV+++G G++GQ A T NH+W++ D     
Sbjct  64    ISNPSNDHTAELRGLADDRVSVLVNKIMASQVHLVGDGIIGQAALTGNHQWIVRDNLKDC  123

Query  2107  WQSHHGLAD-NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
               +  GLA+ NC             QF   I+TIA+I V P GVVQ GS Q + E + F+
Sbjct  124   GSTTEGLAEINC-------------QFLADIQTIAIIPVFPHGVVQLGSTQMVIENIGFI  170

Query  1930  DETKKLF  1910
             +  K LF
Sbjct  171   NHVKSLF  177



>ref|XP_008338609.1| PREDICTED: transcription factor LHW-like [Malus domestica]
Length=888

 Score =   171 bits (434),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/164 (55%), Positives = 111/164 (68%), Gaps = 11/164 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID L  +TIK +LFLQSVTR A+ LK+T E K
Sbjct  682   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALFERTIKHMLFLQSVTRHADKLKQTGESK  741

Query  838   -----DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
                  D    KD+       G TWA ++  Q+M+CP++VEDL  P QML+E+LC+EQGFF
Sbjct  742   IIGTEDGLVLKDNFDG----GATWAFKVGTQSMVCPIIVEDLNPPRQMLVEMLCEEQGFF  797

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  798   LEIADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRVE  839



>ref|XP_010263009.1| PREDICTED: transcription factor LHW-like [Nelumbo nucifera]
Length=943

 Score =   172 bits (435),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  737   RPRPKDRQMIQDRVKELREIVPNGSKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  796

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ + +MICP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  797   IINKEGGLLLKDNFE-GGATWAFEVGSHSMICPIIVEDLNPPRQMLVEMLCEERGLFLEI  855

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  K+WA F V  EAN  V+R E
Sbjct  856   ADIIRGLGLTILKGVMEARNDKVWARFAV--EANRDVTRVE  894


 Score = 92.8 bits (229),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 58/167 (35%), Positives = 84/167 (50%), Gaps = 30/167 (18%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------EEMGGL  2213
             +  L+ LC  N WSYAVFW    +N   L   + YYE                 +E+  L
Sbjct  6     REALRFLCGVNRWSYAVFWKIGCRNPTLLVWEECYYEPARYSPESRLSQLGCQVDEVCSL  65

Query  2212  IDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFY  2039
             ++ M +  Q++++G G+VG+ AFT  H W+L   N + + H        E+L    +E +
Sbjct  66    VNKMTINNQIHVVGEGIVGRAAFTGTHLWILQG-NCIGEGH------PSEVL----AEVH  114

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTD  1898
              QF  G++TIAVI V P GVVQ GS   + E + FV+  K LF   D
Sbjct  115   HQFLAGMQTIAVIPVLPHGVVQLGSTNVIMEDVGFVNSVKSLFLQID  161



>ref|XP_011003843.1| PREDICTED: transcription factor LHW-like [Populus euphratica]
Length=966

 Score =   172 bits (435),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T   +
Sbjct  759   RPRPKDRQMIQDRVKELREIVPNGAKCSIDSLLERTIKHMLFLQSVTKHADKLKQTGDSK  818

Query  844   LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             L +K+G      N    G TWA E+ +++M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  819   LINKEGGLHLKDNFE-GGATWAFEVGSRSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  877

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  ++R E
Sbjct  878   ADLIRGLGLTILKGVMEARNDKIWACFAV--EANRDITRME  916


 Score = 86.3 bits (212),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 85/186 (46%), Gaps = 58/186 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFL---------TL-------------------R  2246
             + +LK LCC N W YAVFW    QN   L         TL                   R
Sbjct  6     REVLKKLCCVNQWCYAVFWKIGYQNPKLLIWEECNSESTLCSVSPSTSGTENLVLPFRER  65

Query  2245  DAYYEEEMGG-------------LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
             + Y   E+               LI+ M+   QV I+G G+VG+ AFT NH+W+L     
Sbjct  66    EGYLGSEVHSSQFGVHEGDRLRLLINKMMANNQVIIVGEGIVGRAAFTGNHEWIL-----  120

Query  2110  VWQSHHGLADNC--DELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERME  1937
                     A+NC  D    +  +E + QFS G++TIAV+ V P GV+Q GS+  +PE + 
Sbjct  121   --------ANNCCRDAHPPEGLNEAHLQFSAGMQTIAVVPVCPYGVLQLGSSLAIPENIG  172

Query  1936  FVDETK  1919
             FV+  K
Sbjct  173   FVNIVK  178



>ref|XP_011010233.1| PREDICTED: transcription factor LHW-like [Populus euphratica]
Length=966

 Score =   171 bits (434),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 114/161 (71%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T   +
Sbjct  759   RPRPKDRQMIQDRVKELREIVPNGAKCSIDSLLERTIKHMLFLQSVTKHADKLKQTGDSK  818

Query  844   LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             L +K+G      N    G TWA E+ +++M+CP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  819   LINKEGGLHLKDNFE-GGATWAFEVGSRSMVCPIIVEDLNPPRQMLVEMLCEERGFFLEI  877

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  KIWA F V  EAN  ++R E
Sbjct  878   ADLIRGLGLTILKGVMEARNDKIWACFAV--EANRDITRME  916


 Score = 86.3 bits (212),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 62/186 (33%), Positives = 85/186 (46%), Gaps = 58/186 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFL---------TL-------------------R  2246
             + +LK LCC N W YAVFW    QN   L         TL                   R
Sbjct  6     REVLKKLCCVNQWCYAVFWKIGYQNPKLLIWEECNSESTLCSVSPSTSGTENLVLPFRER  65

Query  2245  DAYYEEEMGG-------------LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
             + Y   E+               LI+ M+   QV I+G G+VG+ AFT NH+W+L     
Sbjct  66    EGYLGSEVHSSQFGVHEGDRLRLLINKMMANNQVIIVGEGIVGRAAFTGNHEWIL-----  120

Query  2110  VWQSHHGLADNC--DELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERME  1937
                     A+NC  D    +  +E + QFS G++TIAV+ V P GV+Q GS+  +PE + 
Sbjct  121   --------ANNCCRDAHPPEGLNEAHLQFSAGMQTIAVVPVCPYGVLQLGSSLAIPENIG  172

Query  1936  FVDETK  1919
             FV+  K
Sbjct  173   FVNIVK  178



>ref|XP_011021433.1| PREDICTED: transcription factor LHW-like isoform X1 [Populus 
euphratica]
Length=976

 Score =   171 bits (434),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 7/162 (4%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T +  
Sbjct  769   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGD--  826

Query  838   DKKGRKDSNSNSNTN---GVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              K   K+S      N   G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLE
Sbjct  827   SKLLNKESGLLLKENFEGGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLE  886

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  887   IADLIRGLGLTILKGLMETRNDKIWARFAV--EANRDVTRME  926


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 71/237 (30%), Positives = 107/237 (45%), Gaps = 58/237 (24%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEE----------------------  2228
             + +LK LC  N W YAVFW    QN   L   + ++E                       
Sbjct  6     REVLKILCGVNQWCYAVFWKIGCQNPKLLIWEECHFEPTSCSVPPSTSGTENLALPFGEW  65

Query  2227  ---------------EMGG----LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                            + GG    LI+ M++  QVNI+G G+VG+VAFT NH+W+L++ N 
Sbjct  66    EGHFGSDVHSSHLGIQAGGRLCSLINKMMVNNQVNIVGEGIVGRVAFTGNHEWILAN-NY  124

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
                +H        E+L    +E + QFS G++TIAVI V P GV+Q GS+  + E + FV
Sbjct  125   SKDAHP------PEVL----NEVHHQFSAGMQTIAVIPVCPHGVLQLGSSLAIMENIGFV  174

Query  1930  DETKKLF--QGTDIETIFAQSSSSSANGDVFGL--SGSLASSICNSSYFMSPEALPS  1772
             +  K L    G     + + +       +  G+  S  +A  +C S  +  P + PS
Sbjct  175   NNVKSLILQLGCVPGALLSDNHMEKEPTERIGMPISCGMALPVCFSGTYKVPNSTPS  231



>ref|XP_010247149.1| PREDICTED: transcription factor LHW-like isoform X1 [Nelumbo 
nucifera]
Length=972

 Score =   171 bits (434),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 113/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  766   RPRPKDRQMIQDRVKELREIVPNGTKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  825

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+MICP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  826   IINKEGGLLLKDNFE-GGATWAFEVGSQSMICPIIVEDLNPPRQMLVEMLCEERGLFLEI  884

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              DIIRG GL ILKG ME R  K+WA F V  EA+  V+R E
Sbjct  885   ADIIRGLGLTILKGVMEARNDKVWARFAV--EADRDVTRME  923


 Score = 89.0 bits (219),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 85/186 (46%), Gaps = 53/186 (28%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK LC  N WSYAVFW    +N   L   + YYE                       
Sbjct  6     KEALKCLCGVNRWSYAVFWKIGCRNPTLLVWEECYYEPARLSAFPGISGNEGTELLSKEW  65

Query  2230  EEMGG-----------------LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
             E +G                  L++ M++  QV+++G G+VG+ AFT  H W+L   N +
Sbjct  66    EGLGSASEGQPSRPQVDDRVCSLVNKMIINGQVHVVGEGIVGRAAFTGAHLWILPG-NCL  124

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
               +H        E++    +E + QF  G++TIAVI V P GVVQ GS   + E MEFVD
Sbjct  125   GVAHP------SEVM----AEVHHQFLSGMQTIAVIPVLPHGVVQLGSTLTIMEDMEFVD  174

Query  1927  ETKKLF  1910
               K LF
Sbjct  175   SVKSLF  180



>ref|XP_006589236.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Glycine 
max]
 gb|KHN14753.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=815

 Score =   171 bits (432),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 116/166 (70%), Gaps = 8/166 (5%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGL------  860
             TRP PKDR +  + + ELR +IPN GK SID LL +TI+ +LFLQSV + ++ L      
Sbjct  621   TRPRPKDRQQIQDCIKELRRIIPNDGKCSIDSLLDRTIRYMLFLQSVLKYSDKLQEPNEP  680

Query  859   KKTEELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQG  680
             K  E+ K+   +    ++S   G+TWA E+ +QTM+ P++VED+  PGQMLIE+LC+EQG
Sbjct  681   KLIEQAKEVVLKDSGAADSKNGGITWAYEVAHQTMLYPVIVEDMSLPGQMLIEMLCEEQG  740

Query  679   FFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             FFLEI+D I+ FGLNILK  ME R+TK+WA FIV  EAN  V+R E
Sbjct  741   FFLEIIDKIQRFGLNILKAKMERRKTKLWARFIV--EANRPVTRIE  784


 Score =   138 bits (348),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 117/185 (63%), Gaps = 13/185 (7%)
 Frame = -1

Query  2332  LKSLC-CGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQV  2156
             LK+LC CG+GWSYA+FW F+ +NSL LT+ +AYYEE +G  I +M  QV++LG G+VG+ 
Sbjct  15    LKTLCTCGDGWSYAIFWRFHPRNSLLLTVEEAYYEEHLGEEIANMHPQVHLLGEGIVGEA  74

Query  2155  AFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVV  1976
             A T  H W+ SD     Q+H    +   + + +DDSEF  QFS GIKTI V+ V+  GVV
Sbjct  75    ASTGKHSWVHSDG----QTHDW--NLTGQNICEDDSEFQQQFSSGIKTIVVVPVKAWGVV  128

Query  1975  QFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSSSSA------NGDVFGLSGSLASSI  1814
             QFGS +K+ E++EF+++T+ +    D +        +S       N D+ GL  S++S+ 
Sbjct  129   QFGSRKKILEKVEFLEQTQSVLTDMDDDMGMFDMPGNSVLPLDCENNDLNGLWDSISSAN  188

Query  1813  CNSSY  1799
              N+S+
Sbjct  189   PNNSF  193



>gb|EYU36027.1| hypothetical protein MIMGU_mgv1a020569mg, partial [Erythranthe 
guttata]
Length=386

 Score =   164 bits (416),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 101/152 (66%), Gaps = 17/152 (11%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQS+ + A+ L K     
Sbjct  218   RPRPKDRQMIQDRVKELREIVPNGEKYSIDALLERTIKHMLFLQSIVKHADELTK-----  272

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                         +  G TWA E+ +Q+ +CP+VVEDL  P QMLIE+LC+E+G FLEI D
Sbjct  273   ------------DNVGATWAYEVRSQSTVCPIVVEDLNQPRQMLIEMLCEERGIFLEIAD  320

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEAN  563
             IIRG GL ILKG +E R+ KIWAHFIVE   N
Sbjct  321   IIRGLGLTILKGLIETRDDKIWAHFIVEANRN  352



>ref|XP_011021434.1| PREDICTED: transcription factor LHW-like isoform X2 [Populus 
euphratica]
Length=948

 Score =   171 bits (433),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 113/162 (70%), Gaps = 7/162 (4%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T +  
Sbjct  741   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGD--  798

Query  838   DKKGRKDSNSNSNTN---GVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              K   K+S      N   G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+GFFLE
Sbjct  799   SKLLNKESGLLLKENFEGGATWAFEVGSQSMVCPIIVEDLNPPRQMLVEMLCEERGFFLE  858

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  859   IADLIRGLGLTILKGLMETRNDKIWARFAV--EANRDVTRME  898


 Score = 86.7 bits (213),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 89/187 (48%), Gaps = 54/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEE----------------------  2228
             + +LK LC  N W YAVFW    QN   L   + ++E                       
Sbjct  6     REVLKILCGVNQWCYAVFWKIGCQNPKLLIWEECHFEPTSCSVPPSTSGTENLALPFGEW  65

Query  2227  ---------------EMGG----LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                            + GG    LI+ M++  QVNI+G G+VG+VAFT NH+W+L++ N 
Sbjct  66    EGHFGSDVHSSHLGIQAGGRLCSLINKMMVNNQVNIVGEGIVGRVAFTGNHEWILAN-NY  124

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
                +H        E+L    +E + QFS G++TIAVI V P GV+Q GS+  + E + FV
Sbjct  125   SKDAHP------PEVL----NEVHHQFSAGMQTIAVIPVCPHGVLQLGSSLAIMENIGFV  174

Query  1930  DETKKLF  1910
             +  K L 
Sbjct  175   NNVKSLI  181



>ref|XP_009625579.1| PREDICTED: transcription factor LHW isoform X1 [Nicotiana tomentosiformis]
Length=944

 Score =   171 bits (432),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  738   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  797

Query  838   DKKGRKDSNSNSNTNG-VTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                         N  G  TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+E+G FLEI 
Sbjct  798   IISKEAGLLLKDNLEGGATWAYEVGSQSMVCPIVVEDLNQPRQMLVEMLCEERGLFLEIA  857

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             DIIR  GL ILKG ME+R  KIWA F V  EAN  V+R
Sbjct  858   DIIRELGLTILKGVMEMRNDKIWARFAV--EANRDVTR  893


 Score = 86.7 bits (213),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 87/188 (46%), Gaps = 55/188 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  + WSYAVFW    QN+  L   ++Y E                       
Sbjct  6     KEVLKTLCGVSQWSYAVFWKIGCQNTKLLIWEESYCETSIFSGLHGTREVENPKLVFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  Q N++G G++G+ A T NH W+LS   
Sbjct  66    SACWDSGEVQNSQLLNQAGESLRLLVNKMMMDNQFNLVGEGLIGRAAVTGNHHWILSKGQ  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
             S  +  H       E+L+    E   QFS GI+TI+VI + P GVVQFGS   +PE M F
Sbjct  126   S--KDAHP-----PEVLK----ELSQQFSSGIQTISVIPLLPHGVVQFGSYLHIPENMGF  174

Query  1933  VDETKKLF  1910
             V++ + L 
Sbjct  175   VEDVRTLI  182



>ref|XP_009625580.1| PREDICTED: transcription factor LHW isoform X2 [Nicotiana tomentosiformis]
Length=908

 Score =   171 bits (432),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/158 (56%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  702   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  761

Query  838   DKKGRKDSNSNSNTNG-VTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                         N  G  TWA E+ +Q+M+CP+VVEDL  P QML+E+LC+E+G FLEI 
Sbjct  762   IISKEAGLLLKDNLEGGATWAYEVGSQSMVCPIVVEDLNQPRQMLVEMLCEERGLFLEIA  821

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             DIIR  GL ILKG ME+R  KIWA F V  EAN  V+R
Sbjct  822   DIIRELGLTILKGVMEMRNDKIWARFAV--EANRDVTR  857


 Score = 86.7 bits (213),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 73/263 (28%), Positives = 112/263 (43%), Gaps = 61/263 (23%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  + WSYAVFW    QN+  L   ++Y E                       
Sbjct  6     KEVLKTLCGVSQWSYAVFWKIGCQNTKLLIWEESYCETSIFSGLHGTREVENPKLVFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  L++ M++  Q N++G G++G+ A T NH W+LS   
Sbjct  66    SACWDSGEVQNSQLLNQAGESLRLLVNKMMMDNQFNLVGEGLIGRAAVTGNHHWILSKGQ  125

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
             S  +  H       E+L+    E   QFS GI+TI+VI + P GVVQFGS   +PE M F
Sbjct  126   S--KDAHP-----PEVLK----ELSQQFSSGIQTISVIPLLPHGVVQFGSYLHIPENMGF  174

Query  1933  VDETKKLFQ--GTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDFV  1760
             V++ + L    G     + +  +++     +      L SS+   S   + E++ S D  
Sbjct  175   VEDVRTLISQLGCVPGVLLSDENATKEPAPITARPVYLGSSVSMESCRRAKESVQSNDST  234

Query  1759  DPIMNMVQSFPVEAFSLFDDQFQ  1691
                 N+ + F        DD F 
Sbjct  235   FQASNIARRFA----EYHDDYFH  253



>emb|CDP15550.1| unnamed protein product [Coffea canephora]
Length=927

 Score =   170 bits (431),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 111/159 (70%), Gaps = 5/159 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK T + K
Sbjct  721   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKHTGDFK  780

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N +  GVTWA E+ +Q+M+CP++VEDL    QML+E+LC+E+G FLEI
Sbjct  781   ILGKEGGLLIKDNYD-GGVTWAYELGSQSMVCPIIVEDLNQHRQMLVEMLCEERGLFLEI  839

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              DIIRG GL ILKG ME R  KIWA F V  EAN  V+R
Sbjct  840   ADIIRGLGLTILKGIMETRNEKIWARFAV--EANRDVTR  876


 Score = 95.1 bits (235),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 90/184 (49%), Gaps = 48/184 (26%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------  2231
             ++ K  LK+LC  N WSYAVFW    QN   L   + YYE                    
Sbjct  3     SLLKEALKTLCGVNQWSYAVFWKIGCQNPKLLIWEECYYEPVIYATGLPRNSGIEGFENW  62

Query  2230  ---------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQ  2102
                             E+  L++ M++  QVN+LG G+VG+ AFT +H+W+LS+  +  +
Sbjct  63    NSAEACNSQLGVGAGNELHLLVNKMMMENQVNVLGEGLVGRAAFTGSHQWILSE--NYRR  120

Query  2101  SHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDET  1922
               H L     E+L+    E   QFS G++TIAVI V P GVVQ GS   + E + FV++ 
Sbjct  121   DAHPL-----EVLK----EVVQQFSAGMQTIAVIPVLPHGVVQLGSCMPIMENVAFVNDV  171

Query  1921  KKLF  1910
             K L 
Sbjct  172   KTLV  175



>ref|XP_008784115.1| PREDICTED: transcription factor LHW-like [Phoenix dactylifera]
Length=948

 Score =   170 bits (430),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV++  + LK+  E K
Sbjct  744   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLERTIKHMLFLQSVSKHVDKLKEIGEPK  803

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N +  G TWA E+ +Q+MICP++VEDL  P QML+E+LC+E+GFFLEI
Sbjct  804   IISKEGGPLLEDNFD-GGATWAFEVGSQSMICPIMVEDLNPPRQMLVEMLCEERGFFLEI  862

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME R+ K+WA F V  EAN  V+R E
Sbjct  863   ADFIRGLGLTILKGVMEARKNKVWARFAV--EANRDVTRME  901


 Score = 87.4 bits (215),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 81/180 (45%), Gaps = 50/180 (28%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE------------------------  2228
             LKSLC   GWSYAVFW     +N   L   D Y E                         
Sbjct  9     LKSLCVEIGWSYAVFWRAVGARNPTHLVWEDGYCERVPPISGVEAMDLLLKEQGLMRNHN  68

Query  2227  -----EMGGLIDD---------MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHG  2090
                  E+ G  +D         M  QV+++G+G+VGQ A T NH+W++ D   +   +  
Sbjct  69    NDHASELRGQAEDRVGMLVNKIMAAQVHVVGAGMVGQAALTGNHQWIIQD---ILHEYGS  125

Query  2089  LADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             +A+          +E   QF  GI+TIAVI V P GVVQ G+ Q + E + FV+  + LF
Sbjct  126   IAEGF--------AEINHQFLAGIQTIAVIPVIPHGVVQLGAIQMIIENIVFVNHVRSLF  177



>ref|XP_010322443.1| PREDICTED: transcription factor LHW-like isoform X2 [Solanum 
lycopersicum]
Length=890

 Score =   170 bits (430),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  705   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALFERTIKHMLFLQSVTKHADKLKQTGESK  764

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N    G TWA E+ +Q+M+CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  765   IISKEGGLLLKDNLE-GGATWAYEVGSQSMVCPIIVEDLNQPRQMLVEMLCEERGLFLEI  823

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              DIIRG GL ILKG ME R  KIWA F VE
Sbjct  824   ADIIRGLGLTILKGVMETRNDKIWAQFAVE  853


 Score = 92.0 bits (227),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 89/190 (47%), Gaps = 59/190 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K +LK+LC  N WSYAVFW    QN+  L   ++YYE                       
Sbjct  6     KEVLKTLCGVNQWSYAVFWKIGCQNTKILIWEESYYETSTLSNIHGTSGVENPELAFQDW  65

Query  2230  -------------------EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++  Q N++G G++G+ A T  H+W+LS+  
Sbjct  66    STGWAFGGVQNSQLQNQAGENLHLLINKMMMDNQFNLVGEGLIGRAAVTGKHQWVLSE--  123

Query  2113  SVWQSHHGLADNCD--ELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERM  1940
                    GL+ N    E+L+    E   QFS GI+TI+VI V P GVVQFGS   + E M
Sbjct  124   -------GLSRNVHPPEVLR----ELRQQFSAGIQTISVIPVLPHGVVQFGSYLHIMENM  172

Query  1939  EFVDETKKLF  1910
              FV++ K L 
Sbjct  173   GFVEDVKTLM  182



>ref|XP_010247158.1| PREDICTED: transcription factor LHW-like isoform X2 [Nelumbo 
nucifera]
Length=930

 Score =   170 bits (430),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  766   RPRPKDRQMIQDRVKELREIVPNGTKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  825

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ +Q+MICP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  826   IINKEGGLLLKDNFE-GGATWAFEVGSQSMICPIIVEDLNPPRQMLVEMLCEERGLFLEI  884

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              DIIRG GL ILKG ME R  K+WA F VE
Sbjct  885   ADIIRGLGLTILKGVMEARNDKVWARFAVE  914


 Score = 88.6 bits (218),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 82/188 (44%), Gaps = 57/188 (30%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK LC  N WSYAVFW    +N   L   + YYE                       
Sbjct  6     KEALKCLCGVNRWSYAVFWKIGCRNPTLLVWEECYYEPARLSAFPGISGNEGTELLSKEW  65

Query  2230  EEMGG-----------------LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
             E +G                  L++ M++  QV+++G G+VG+ AFT  H W+L      
Sbjct  66    EGLGSASEGQPSRPQVDDRVCSLVNKMIINGQVHVVGEGIVGRAAFTGAHLWIL------  119

Query  2107  WQSHHGLADNCDELLQDDD--SEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                      NC  +    +  +E + QF  G++TIAVI V P GVVQ GS   + E MEF
Sbjct  120   -------PGNCLGVAHPSEVMAEVHHQFLSGMQTIAVIPVLPHGVVQLGSTLTIMEDMEF  172

Query  1933  VDETKKLF  1910
             VD  K LF
Sbjct  173   VDSVKSLF  180



>ref|XP_002441863.1| hypothetical protein SORBIDRAFT_08g003770 [Sorghum bicolor]
 gb|EES15701.1| hypothetical protein SORBIDRAFT_08g003770 [Sorghum bicolor]
Length=891

 Score =   169 bits (429),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK +LFLQSVT+ A+ LK T E K
Sbjct  690   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMLFLQSVTKHADNLKDTNESK  749

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G      +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI D
Sbjct  750   ILGGENGPLKDYFEGGATWAFDVGSQSMTCPIIVEDLERPRQMLVEMLCEDRGIFLEIAD  809

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  810   FIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  846


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 52/161 (32%), Positives = 76/161 (47%), Gaps = 31/161 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRD-----------AYYEEEMG--------GL  2213
             L+ LC   GWSYAVFW      + + L   D           +   EE G         L
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGCCGHASCSAGSEAPEEAGCEPGTSVCTL  66

Query  2212  IDDMLL-QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYG  2036
             +  ++  Q++++G G +G+ AFT NH+W++          H  A N   L  +  +E   
Sbjct  67    VKKVMASQIHVVGEGAIGRAAFTGNHQWIV----------HDPAANDHNLRPEVAAEMNH  116

Query  2035  QFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             QF+ GI+TIA+I V P GV+Q GS   + E    V + KKL
Sbjct  117   QFAAGIQTIAIIPVLPRGVLQLGSTSVVVENTNLVLQYKKL  157



>ref|XP_004977333.1| PREDICTED: transcription factor LHW-like [Setaria italica]
Length=889

 Score =   168 bits (425),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK +LFLQSVT+ A+ LK + E K
Sbjct  689   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMLFLQSVTKHADNLKDSNESK  748

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G      +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI D
Sbjct  749   ILGGENGPLKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEIAD  808

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  809   FIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  845


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 72/160 (45%), Gaps = 31/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAY---------YEEEMGG----------L  2213
             L+ LC   GWSYAVFW      + + L   D +          E    G          +
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGFCGHASCSAGSEAAEAGCEPGSGVCTLV  66

Query  2212  IDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M LQ++++G G +G+ AFT NH+W++ D             N   L  +  +E   Q
Sbjct  67    RKVMALQIHVVGEGTIGRAAFTGNHQWIIHD-----------PANEHSLRSEVSAEMNYQ  115

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F  GI+TIA+I V P GV+Q GS   + E    V + KKL
Sbjct  116   FVAGIQTIAIIPVLPRGVLQLGSTNVVVEDTNLVLQYKKL  155



>ref|XP_009401173.1| PREDICTED: transcription factor LHW-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=930

 Score =   168 bits (425),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK   E K
Sbjct  731   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKVAGEPK  790

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                ++G      N +  G TWA E+  Q MICP++VEDL  P Q+L+E+LC+E+GFFLEI
Sbjct  791   ISGEEGGLLLKDNFD-GGATWAFEVGTQPMICPIIVEDLNPPRQLLVEMLCEERGFFLEI  849

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME R+ K+WA F V  EAN  V+R E
Sbjct  850   ADFIRGLGLTILKGVMEARKRKVWARFAV--EANRDVTRME  888


 Score = 60.5 bits (145),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 80/186 (43%), Gaps = 58/186 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFW---GFNQQNSLFLTLRDAYYEEEMGG---LIDDMLL-----  2195
             +  L+ LC   GWSYAVFW   GF   + + LT  D Y + ++G     + D+LL     
Sbjct  6     REALRQLCLEFGWSYAVFWSATGFG--SGMHLTWEDGYCDRKLGVSKLQVSDLLLKEHAV  63

Query  2194  ------------------------------QVNILGSGVVGQVAFTKNHKWMLSDT-NSV  2108
                                           QV+I+G G+ GQ A    H W+  DT +  
Sbjct  64    VESTEDNCFSERGCQADDRIVDLVDKIMASQVHIVGDGLTGQAASVGKHLWIHKDTLDGF  123

Query  2107  WQSHHGLAD-NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
               +  G AD NC             Q   GI+TI V+ V P+GV+Q GS Q + E ++F+
Sbjct  124   GSTSKGFADINC-------------QIVAGIQTIVVVPVLPVGVIQLGSTQMVLENIDFI  170

Query  1930  DETKKL  1913
             +  K L
Sbjct  171   NHVKNL  176



>ref|XP_009401172.1| PREDICTED: transcription factor LHW-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=931

 Score =   168 bits (425),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 110/161 (68%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK   E K
Sbjct  732   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHADKLKVAGEPK  791

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                ++G      N +  G TWA E+  Q MICP++VEDL  P Q+L+E+LC+E+GFFLEI
Sbjct  792   ISGEEGGLLLKDNFD-GGATWAFEVGTQPMICPIIVEDLNPPRQLLVEMLCEERGFFLEI  850

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME R+ K+WA F V  EAN  V+R E
Sbjct  851   ADFIRGLGLTILKGVMEARKRKVWARFAV--EANRDVTRME  889


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 78/186 (42%), Gaps = 57/186 (31%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFW---GFNQQNSLFLTLRDAYYEEEMGG---LIDDMLL-----  2195
             +  L+ LC   GWSYAVFW   GF       LT  D Y + ++G     + D+LL     
Sbjct  6     REALRQLCLEFGWSYAVFWSATGFGS-GIRHLTWEDGYCDRKLGVSKLQVSDLLLKEHAV  64

Query  2194  ------------------------------QVNILGSGVVGQVAFTKNHKWMLSDT-NSV  2108
                                           QV+I+G G+ GQ A    H W+  DT +  
Sbjct  65    VESTEDNCFSERGCQADDRIVDLVDKIMASQVHIVGDGLTGQAASVGKHLWIHKDTLDGF  124

Query  2107  WQSHHGLAD-NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
               +  G AD NC             Q   GI+TI V+ V P+GV+Q GS Q + E ++F+
Sbjct  125   GSTSKGFADINC-------------QIVAGIQTIVVVPVLPVGVIQLGSTQMVLENIDFI  171

Query  1930  DETKKL  1913
             +  K L
Sbjct  172   NHVKNL  177



>ref|XP_006594923.1| PREDICTED: transcription factor LHW-like isoform X2 [Glycine 
max]
Length=880

 Score =   167 bits (424),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  678   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  737

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ + +M+CP+VVEDL  P QML+E+LC+E+G FLEI
Sbjct  738   IINKEGGLLLKDNFE-GGATWAYEVGSLSMVCPIVVEDLIPPRQMLVEMLCEERGCFLEI  796

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA F V  EAN  ++R E
Sbjct  797   ADLIRGLGLTILKGVMEAHNDKIWARFAV--EANRDITRME  835


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 11/87 (13%)
 Frame = -1

Query  2170  VVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVE  1991
             ++G+ AFT +H+W+L   N+  +         D       +E + QFS GI+T+AVI V 
Sbjct  41    IIGRAAFTGSHQWIL--LNNFTE---------DAYPPQVYAEVHHQFSAGIQTVAVIPVL  89

Query  1990  PLGVVQFGSNQKLPERMEFVDETKKLF  1910
             P GVVQ GS   + E M FV++ K L 
Sbjct  90    PHGVVQLGSFLPIIENMGFVNDVKSLI  116



>ref|XP_009368308.1| PREDICTED: transcription factor LHW-like [Pyrus x bretschneideri]
Length=964

 Score =   168 bits (425),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (67%), Gaps = 11/164 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  758   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALFERTIKHMLFLQSVTKHADKLKQTGESK  817

Query  838   -----DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
                  D    KD+       G TWA ++  Q+ +CP++VEDL  P QML+E+LC+EQGFF
Sbjct  818   IIGTDDGLVLKDNFDG----GATWAFKVGTQSTVCPIIVEDLDPPRQMLVEMLCEEQGFF  873

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  874   LEIADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRVE  915


 Score = 87.8 bits (216),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 55/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK LC  N W+YAVFW    QN   L   + +YE                       
Sbjct  6     KEALKRLCGTNQWAYAVFWKIGCQNPKLLIWEECHYEPSLSSLPKRIAGTERAELPFGEW  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++    NI+G G+VG+ AFT NH+W+LS  N
Sbjct  66    EGCWVSSEVCSSSNGFQQEESVSSLINTMMIDKPFNIVGEGMVGRAAFTGNHQWILSG-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E + F
Sbjct  125   YTKDAH------PPEVL----NEMHHQFSAGMQTVAVIPVLPHGVVQLGSSSAMMENLGF  174

Query  1933  VDETKKL  1913
             +++ K L
Sbjct  175   INDVKSL  181



>ref|XP_009337709.1| PREDICTED: transcription factor LHW-like [Pyrus x bretschneideri]
Length=964

 Score =   168 bits (425),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 110/164 (67%), Gaps = 11/164 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR+++PNG K SID L  +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  758   RPRPKDRQMIQDRVKELRDIVPNGAKCSIDALFERTIKHMLFLQSVTKHADKLKQTGESK  817

Query  838   -----DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
                  D    KD+       G TWA ++  Q+ +CP++VEDL  P QML+E+LC+EQGFF
Sbjct  818   IIGTDDGLVLKDNFDG----GATWAFKVGTQSTVCPIIVEDLDPPRQMLVEMLCEEQGFF  873

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI D+IRG GL ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  874   LEIADLIRGLGLTILKGVMEARNDKIWARFAV--EANRDVTRVE  915


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 85/187 (45%), Gaps = 55/187 (29%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK LC  N W+YAVFW    QN   L   + +YE                       
Sbjct  6     KEALKRLCGTNQWAYAVFWKIGCQNPKLLIWEECHYEPSLSSLPKRIAGTERAELPFGEW  65

Query  2230  -------------------EEMGGLIDDMLLQ--VNILGSGVVGQVAFTKNHKWMLSDTN  2114
                                E +  LI+ M++    NI+G G+VG+ AFT NH+W+LS  N
Sbjct  66    EGCWVSSEVCSSSNGFQQEERVSSLINTMMIDKPFNIVGEGMVGRAAFTGNHQWILSG-N  124

Query  2113  SVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEF  1934
                 +H        E+L    +E + QFS G++T+AVI V P GVVQ GS+  + E + F
Sbjct  125   YTKDAH------PPEVL----NEMHHQFSAGMQTVAVIPVLPHGVVQLGSSSAMMENLGF  174

Query  1933  VDETKKL  1913
             +++ K L
Sbjct  175   INDVKSL  181



>ref|XP_008662493.1| PREDICTED: transcription factor LHW-like [Zea mays]
 gb|AFW56112.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=890

 Score =   167 bits (423),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK ++FLQSVT+ A+ LK + E K
Sbjct  689   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMVFLQSVTKHADNLKDSNESK  748

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G      +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI D
Sbjct  749   ILGGENGPLKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEIAD  808

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  809   FIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  845


 Score = 71.6 bits (174),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 71/160 (44%), Gaps = 31/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRD---------AYYEEEMGG----------L  2213
             L+ LC   GWSYAVFW      + + L   D         A  E    G          +
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGCCGHVSCSAGSEAPEAGCELGTSVCTLV  66

Query  2212  IDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M  Q++++G G +G+ AFT NH+W++ D             N   L  +  +E   Q
Sbjct  67    RKVMTSQIHVVGEGTIGRAAFTGNHQWIVHD-----------PANDHNLRPEVSAEMNHQ  115

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F+ GI+TIA+I V P GV+Q G+   + E    V + K L
Sbjct  116   FAAGIQTIAIIPVLPRGVLQLGATSVVMENTNLVLQYKNL  155



>gb|KHN36498.1| Putative basic helix-loop-helix protein [Glycine soja]
Length=965

 Score =   167 bits (423),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  763   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  822

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ + +M+CP+VVEDL  P QML+E+LC+E+G FLEI
Sbjct  823   IINKEGGLLLKDNFE-GGATWAYEVGSLSMVCPIVVEDLIPPRQMLVEMLCEERGCFLEI  881

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA F V  EAN  ++R E
Sbjct  882   ADLIRGLGLTILKGVMEAHNDKIWARFAV--EANRDITRME  920


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 84/197 (43%), Gaps = 52/197 (26%)
 Frame = -1

Query  2377  KKMSKG-KSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEE---------  2228
             +K S+G +   + K  L++LC  N WSYAVFW     NS  L   + YYE          
Sbjct  16    RKFSRGFEMGFLLKEALRTLCGRNQWSYAVFWKIGCHNSKLLIWEECYYEPLPWPPHMFG  75

Query  2227  -----------------------------EMGGLIDDMLLQ--VNILGSGVVGQVAFTKN  2141
                                           +  LI  M +   V I G G++G+ AFT +
Sbjct  76    MPDLPYQNGEGCWFSSESLSSQLGIQEEVRVSSLIKKMTVNNSVIIAGEGIIGRAAFTGS  135

Query  2140  HKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSN  1961
             H+W+L +  +            D       +E + QFS GI+T+AVI V P GVVQ GS 
Sbjct  136   HQWILLNNFTE-----------DAYPPQVYAEVHHQFSAGIQTVAVIPVLPHGVVQLGSF  184

Query  1960  QKLPERMEFVDETKKLF  1910
               + E M FV++ K L 
Sbjct  185   LPIIENMGFVNDVKSLI  201



>ref|XP_003541959.2| PREDICTED: transcription factor LHW-like isoform X1 [Glycine 
max]
Length=965

 Score =   167 bits (422),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+ A+ LK+T E K
Sbjct  763   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLKQTGESK  822

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+ + +M+CP+VVEDL  P QML+E+LC+E+G FLEI
Sbjct  823   IINKEGGLLLKDNFE-GGATWAYEVGSLSMVCPIVVEDLIPPRQMLVEMLCEERGCFLEI  881

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME    KIWA F V  EAN  ++R E
Sbjct  882   ADLIRGLGLTILKGVMEAHNDKIWARFAV--EANRDITRME  920


 Score = 81.6 bits (200),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 84/197 (43%), Gaps = 52/197 (26%)
 Frame = -1

Query  2377  KKMSKG-KSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEE---------  2228
             +K S+G +   + K  L++LC  N WSYAVFW     NS  L   + YYE          
Sbjct  16    RKFSRGFEMGFLLKEALRTLCGRNQWSYAVFWKIGCHNSKLLIWEECYYEPLPWPPHMFG  75

Query  2227  -----------------------------EMGGLIDDMLLQ--VNILGSGVVGQVAFTKN  2141
                                           +  LI  M +   V I G G++G+ AFT +
Sbjct  76    MPDLPYQNGEGCWFSSESLSSQLGIQEEVRISSLIKKMTVNNSVIIAGEGIIGRAAFTGS  135

Query  2140  HKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSN  1961
             H+W+L +  +            D       +E + QFS GI+T+AVI V P GVVQ GS 
Sbjct  136   HQWILLNNFTE-----------DAYPPQVYAEVHHQFSAGIQTVAVIPVLPHGVVQLGSF  184

Query  1960  QKLPERMEFVDETKKLF  1910
               + E M FV++ K L 
Sbjct  185   LPIIENMGFVNDVKSLI  201



>ref|XP_003578882.1| PREDICTED: transcription factor LHW isoform X1 [Brachypodium 
distachyon]
Length=896

 Score =   166 bits (421),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 127/187 (68%), Gaps = 5/187 (3%)
 Frame = -1

Query  1093  STNVMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLL  920
             S +  N+K H+ P+KA +K+++PG  ++P PKDR    +R+ ELREL+PNGGK SID LL
Sbjct  668   SASASNSKGHDTPNKANRKRSRPGESSKPRPKDRQLIQDRIKELRELVPNGGKCSIDALL  727

Query  919   HQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSN-SNSNTNGVTWACEIENQTMICPL  743
              +TIK ++FLQSVT+ A+ LK + E K   G       +    G TWA  + +Q+M CP+
Sbjct  728   EKTIKHMVFLQSVTKHADNLKDSNETKILGGENGPLWKDYFEGGATWAFNVGSQSMTCPI  787

Query  742   VVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEAN  563
             +VEDL  P QML+E++C+++G FLEI D I+G GL IL+G ME R+ KIWA F V  EAN
Sbjct  788   IVEDLDRPRQMLVEMICEDRGIFLEIADFIKGLGLTILRGVMEARKNKIWARFTV--EAN  845

Query  562   AFVSRHE  542
               V+R E
Sbjct  846   RDVTRME  852


 Score = 81.3 bits (199),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 75/160 (47%), Gaps = 31/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI----  2210
             L+ LC   GWSYAVFW      + + L   D +                 E GG +    
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGHCGHASCPAGSEASEVGCESGGTVCTLV  66

Query  2209  -DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M  QV+++G G +G+ AFT NH+W++ DT     + HGL            +E   Q
Sbjct  67    RKVMASQVHVVGDGTIGRAAFTGNHQWIVHDT----ANDHGLRSEVA-------AEMNYQ  115

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F  GI+TIA+I V P GV+Q GS   + E   +V + KKL
Sbjct  116   FRAGIQTIAIIPVLPRGVLQLGSTSVVMENTTYVLQYKKL  155



>ref|XP_010912383.1| PREDICTED: uncharacterized protein LOC105038317 isoform X1 [Elaeis 
guineensis]
Length=1084

 Score =   167 bits (422),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+  + LK+  E K
Sbjct  880   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHVDKLKEIGEPK  939

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N +  G TWA E+  Q+M+CP++VEDL  P QML+++LC+E+GFFLEI
Sbjct  940   IISKEGGPLLKDNFD-GGATWAFEVGAQSMVCPIIVEDLNPPRQMLVKMLCEERGFFLEI  998

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL I+KG ME R  K+WA FIV  EA+  V+R E
Sbjct  999   ADFIRGLGLTIVKGVMEGRNNKVWARFIV--EADRDVTRME  1037


 Score = 93.2 bits (230),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 88/192 (46%), Gaps = 52/192 (27%)
 Frame = -1

Query  2365  KGKSETVAKALLKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEEEMG----------  2219
             +G    + +  LKSLC   GWSYAVFW     +N + L   D Y E  +G          
Sbjct  134   RGTMGLMLREALKSLCAEIGWSYAVFWRAIGARNPMHLVWEDGYCERVLGISGFEAVDLL  193

Query  2218  ----GLIDD------------------------MLLQVNILGSGVVGQVAFTKNHKWMLS  2123
                 GLI +                        M  QV+++G+G+VGQ A T NH+W++ 
Sbjct  194   LKEQGLIRNHNNDHASELRGQSEDRVGMLVNKIMAAQVHVVGAGIVGQAALTGNHQWIIQ  253

Query  2122  DTNSVWQSHHGLAD-NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPE  1946
             DT         L D  C   + +  +E   QF  GI+TIA+I V P GVVQ G+ Q + E
Sbjct  254   DT---------LHDYGC---IAEGLAEINHQFLAGIQTIAIIPVIPHGVVQLGATQMIIE  301

Query  1945  RMEFVDETKKLF  1910
              + FV+  + LF
Sbjct  302   NIVFVNHVRSLF  313



>ref|XP_009420898.1| PREDICTED: transcription factor LHW-like [Musa acuminata subsp. 
malaccensis]
Length=936

 Score =   166 bits (421),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/161 (55%), Positives = 109/161 (68%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+  + LK T E K
Sbjct  736   RPRPKDRQMIQDRIKELREIVPNGSKCSIDALLEKTIKHMLFLQSVTKHGDKLKVTGEPK  795

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
               +K+G      N    G TWA E+  Q  ICP+VVEDL  P QML+E+LC+++GFFLEI
Sbjct  796   ISNKEGGLLLKDNFE-GGATWAFEVGTQPTICPIVVEDLNPPRQMLVEMLCEDRGFFLEI  854

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME R+ K+WA F V  EAN  ++R E
Sbjct  855   ADFIRGLGLTILKGVMEARKNKVWARFAV--EANRDMTRME  893


 Score = 70.5 bits (171),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 76/182 (42%), Gaps = 56/182 (31%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW---GFNQQNSLFLTLRDAYYEE----------------------  2228
             L+ LC   GWSYAVFW   GF   + + L   D Y ++                      
Sbjct  9     LRRLCLEFGWSYAVFWRVTGFG--SPMHLIWEDGYCDQNPGMPRSKVSELLLKEQGVIKS  66

Query  2227  -----EMGGLIDD---------MLLQVNILGSGVVGQVAFTKNHKWM-LSDTNSVWQSHH  2093
                  E+G   DD         M  QV+++G G+VG  A    H+W+  ++ +       
Sbjct  67    TDSFLELGCQADDGLGVLVHKIMASQVHVVGDGLVGHAASMGKHQWINQNNLDKFGFVSK  126

Query  2092  GLAD-NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKK  1916
             G AD NC             Q   GI+T+ V+ V P GV+Q GS Q + E +EFVD  K 
Sbjct  127   GFADMNC-------------QVLAGIQTVVVVPVLPFGVIQLGSTQMVLENIEFVDHVKS  173

Query  1915  LF  1910
             L 
Sbjct  174   LL  175



>ref|XP_010912384.1| PREDICTED: uncharacterized protein LOC105038317 isoform X2 [Elaeis 
guineensis]
Length=1035

 Score =   166 bits (419),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSVT+  + LK+  E K
Sbjct  880   RPRPKDRQMIQDRIKELREIVPNGAKCSIDALLEKTIKHMLFLQSVTKHVDKLKEIGEPK  939

Query  838   --DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                K+G      N +  G TWA E+  Q+M+CP++VEDL  P QML+++LC+E+GFFLEI
Sbjct  940   IISKEGGPLLKDNFD-GGATWAFEVGAQSMVCPIIVEDLNPPRQMLVKMLCEERGFFLEI  998

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              D IRG GL I+KG ME R  K+WA FIVE
Sbjct  999   ADFIRGLGLTIVKGVMEGRNNKVWARFIVE  1028


 Score = 92.8 bits (229),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 88/192 (46%), Gaps = 52/192 (27%)
 Frame = -1

Query  2365  KGKSETVAKALLKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEEEMG----------  2219
             +G    + +  LKSLC   GWSYAVFW     +N + L   D Y E  +G          
Sbjct  134   RGTMGLMLREALKSLCAEIGWSYAVFWRAIGARNPMHLVWEDGYCERVLGISGFEAVDLL  193

Query  2218  ----GLIDD------------------------MLLQVNILGSGVVGQVAFTKNHKWMLS  2123
                 GLI +                        M  QV+++G+G+VGQ A T NH+W++ 
Sbjct  194   LKEQGLIRNHNNDHASELRGQSEDRVGMLVNKIMAAQVHVVGAGIVGQAALTGNHQWIIQ  253

Query  2122  DTNSVWQSHHGLAD-NCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPE  1946
             DT         L D  C   + +  +E   QF  GI+TIA+I V P GVVQ G+ Q + E
Sbjct  254   DT---------LHDYGC---IAEGLAEINHQFLAGIQTIAIIPVIPHGVVQLGATQMIIE  301

Query  1945  RMEFVDETKKLF  1910
              + FV+  + LF
Sbjct  302   NIVFVNHVRSLF  313



>ref|XP_006846364.1| hypothetical protein AMTR_s00012p00261730 [Amborella trichopoda]
 gb|ERN08039.1| hypothetical protein AMTR_s00012p00261730 [Amborella trichopoda]
Length=717

 Score =   164 bits (414),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 104/150 (69%), Gaps = 2/150 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP P+DR +  +R+ ELRE++PNG K SID LL +TIK ++FL++VT  A+ LK   ++ 
Sbjct  533   RPRPRDRQQIQDRVKELREIVPNGAKCSIDALLERTIKHMIFLRNVTSHADKLKLCSKVA  592

Query  838   DKKGRK--DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             D K R      SNS+  G +WA ++ +QT +CP+VVE+L  PG ML+E+LC+E G FLEI
Sbjct  593   DNKQRPLLVGRSNSDQRGASWALDLGSQTGVCPVVVENLDHPGHMLVEMLCEEDGLFLEI  652

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
               +IR  GL I+KG ME R  K WAHF+VE
Sbjct  653   AQVIRNLGLTIIKGLMEARADKFWAHFVVE  682


 Score = 85.9 bits (211),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 82/187 (44%), Gaps = 46/187 (25%)
 Frame = -1

Query  2353  ETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY--------------------  2234
             ET  + LLK  C  + W YAVFW    ++ + LT  D YY                    
Sbjct  2     ETPLRQLLKGFCHDSEWQYAVFWKLKHRSRMLLTWEDGYYNFPKPPCNIQDTTTNAFFNS  61

Query  2233  -------------------EEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                                 + +G  + +M   V  LG G++GQVAF+  H W  ++   
Sbjct  62    IGGADYSSDAIDGRVRHSVRDPIGAAVANMSYLVYALGEGIIGQVAFSGRHYWAFAE---  118

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
               +  +G  ++  + + +  SE+  QF+ GIKTI +I V P GVVQ GS + L E ++ V
Sbjct  119   --KVFNGEGNS--QFVPEYPSEWQFQFAAGIKTIVLIPVVPHGVVQLGSLKLLMEDLKLV  174

Query  1930  DETKKLF  1910
             D  K  F
Sbjct  175   DHVKSSF  181



>ref|XP_010544940.1| PREDICTED: transcription factor bHLH157-like [Tarenaya hassleriana]
 ref|XP_010535519.1| PREDICTED: transcription factor bHLH157-like [Tarenaya hassleriana]
Length=566

 Score =   162 bits (409),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    ER+ ELR +IPN  K SID LL  T K +LF+QSV + A+ LK+T E K
Sbjct  393   KPRPKDRQMIQERIKELRGMIPNAAKCSIDALLDLTTKHVLFMQSVAKHADKLKQTYEPK  452

Query  838   --DKKGRK-DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
               ++KG   +       NG TWA E+ +++++CP++VEDL  PG + IE++C+E G FLE
Sbjct  453   LVNQKGSSIEEQVAGERNGATWAFEVGDESVVCPIIVEDLNPPGHLQIEMICEESGQFLE  512

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D+IRGFGLNILKG ME R  +IWAHFI E
Sbjct  513   IADLIRGFGLNILKGAMETRHGRIWAHFITE  543


 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 109/210 (52%), Gaps = 38/210 (18%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVG  2162
             K  LKSLCC +GWS+AVFW ++ +NS+ LT+ +AY++E    ++D ML Q +I G G++G
Sbjct  6     KHTLKSLCCSHGWSFAVFWRYDLRNSMLLTVEEAYHDELTRTVVDGMLRQDHIFGQGIIG  65

Query  2161  QVAFTKNHKWMLSDT-NSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             + A T NH+WM  DT   V+Q+ H L                       +T+ V+ +   
Sbjct  66    EAALTGNHRWMFRDTAKDVFQAEHDL-----------------------QTVLVVPIGSR  102

Query  1984  GVVQFGSNQKLPERMEFVDETKKLFQGT-------DIETIFAQSSSSSANGDVFGLS--G  1832
             GVVQ GS  K+ +  E +++T +  Q T       D++ +F+  +   ++  + GL+  G
Sbjct  103   GVVQLGSTNKIQKSTEILEQTARALQQTGHISETLDLDELFSTLAPLGSSESLQGLAFDG  162

Query  1831  SLASSICNSSYFMSPEALPSPDFVDPIMNM  1742
               A+  C+   F SPE  P   F   I  M
Sbjct  163   IFAAGSCS---FPSPE--PPSCFTSDICEM  187



>gb|ABA96530.2| expressed protein [Oryza sativa Japonica Group]
Length=881

 Score =   165 bits (417),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK ++FLQSVT+ A+ LK + E K
Sbjct  677   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMVFLQSVTKHADNLKDSNESK  736

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI
Sbjct  737   IHGGGENGPLLKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEI  796

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  797   ADFIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  835


 Score = 79.7 bits (195),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 54/160 (34%), Positives = 77/160 (48%), Gaps = 30/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI----  2210
             L+ LC    WSYAVFW      + + L   D +                 E GG +    
Sbjct  7     LRRLCEEARWSYAVFWKAIGAADPVHLVWEDGFCGHASCSAGSEASEAGCESGGAVCTLV  66

Query  2209  -DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M  QV+++G G +G+ AFT NH+W++ +T     + HGL     E++    +E   Q
Sbjct  67    RKIMASQVHVVGEGTIGRAAFTGNHQWIVHET----ANDHGLRS---EVVA---AEMNNQ  116

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F  GIKTIA+I V P GV+Q GS   + E +  V + KKL
Sbjct  117   FRAGIKTIAIIPVLPRGVLQLGSTSVILENISSVQQYKKL  156



>ref|NP_001066215.1| Os12g0160400 [Oryza sativa Japonica Group]
 gb|ABG21893.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF29234.1| Os12g0160400 [Oryza sativa Japonica Group]
 gb|EAZ19726.1| hypothetical protein OsJ_35303 [Oryza sativa Japonica Group]
Length=880

 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK ++FLQSVT+ A+ LK + E K
Sbjct  676   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMVFLQSVTKHADNLKDSNESK  735

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI
Sbjct  736   IHGGGENGPLLKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEI  795

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  796   ADFIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  834


 Score = 79.7 bits (195),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 74/160 (46%), Gaps = 31/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI----  2210
             L+ LC    WSYAVFW      + + L   D +                 E GG +    
Sbjct  7     LRRLCEEARWSYAVFWKAIGAADPVHLVWEDGFCGHASCSAGSEASEAGCESGGAVCTLV  66

Query  2209  -DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M  QV+++G G +G+ AFT NH+W++ +T     + HGL            +E   Q
Sbjct  67    RKIMASQVHVVGEGTIGRAAFTGNHQWIVHET----ANDHGLRSEVA-------AEMNNQ  115

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F  GIKTIA+I V P GV+Q GS   + E +  V + KKL
Sbjct  116   FRAGIKTIAIIPVLPRGVLQLGSTSVILENISSVQQYKKL  155



>gb|EAY82345.1| hypothetical protein OsI_37555 [Oryza sativa Indica Group]
Length=880

 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 110/161 (68%), Gaps = 4/161 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK ++FLQSVT+ A+ LK + E K
Sbjct  676   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMVFLQSVTKHADNLKDSNESK  735

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI
Sbjct  736   IHGGGENGPLLKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEI  795

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  796   ADFIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  834


 Score = 79.7 bits (195),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 74/160 (46%), Gaps = 31/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI----  2210
             L+ LC    WSYAVFW      + + L   D +                 E GG +    
Sbjct  7     LRRLCEEARWSYAVFWKAIGAADPVHLVWEDGFCGHASCSAGSEASEAGCESGGAVCTLV  66

Query  2209  -DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M  QV+++G G +G+ AFT NH+W++ +T     + HGL            +E   Q
Sbjct  67    RKIMASQVHVVGEGTIGRAAFTGNHQWIVHET----ANDHGLRSEVA-------AEMNNQ  115

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F  GIKTIA+I V P GV+Q GS   + E +  V + KKL
Sbjct  116   FRAGIKTIAIIPVLPRGVLQLGSTSVILENISSVQQYKKL  155



>ref|XP_009403680.1| PREDICTED: transcription factor LHW-like [Musa acuminata subsp. 
malaccensis]
Length=930

 Score =   164 bits (416),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELREL+P+G K SID LL +TIK +LFLQS+++ A+ LK   E K
Sbjct  730   RPRPKDRQMIQDRIKELRELVPSGAKCSIDALLEKTIKHMLFLQSISKHADKLKVAGEPK  789

Query  838   DKKGRKDSNSNSN-TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                         N   G TWA E+  Q M+CP++VEDL  P Q+L+E+LC+E+GFFLEI 
Sbjct  790   ISSEEGGLLLKDNFEGGATWAFEVGTQPMVCPIIVEDLNPPRQLLVEMLCEERGFFLEIA  849

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             D IRG GL ILKG ME R+ K+WA F V  EAN  V+R E
Sbjct  850   DFIRGLGLTILKGVMEARKNKVWARFAV--EANRNVTRME  887



>ref|XP_004978745.1| PREDICTED: transcription factor LHW-like [Setaria italica]
Length=897

 Score =   164 bits (415),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 110/160 (69%), Gaps = 3/160 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +T+K +LFLQSVT+ A+ LK + E K
Sbjct  697   KPRPKDRQLIQDRIKELRELVPNGAKCSIDGLLEKTVKHMLFLQSVTKNADKLKDSTESK  756

Query  838   DKKGRKDSN-SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                G       +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI 
Sbjct  757   ILGGENGPLWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEIA  816

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             D I+G GL IL+G ME+R++KIWA F V  EAN  V+R E
Sbjct  817   DFIKGLGLTILRGVMEMRKSKIWARFTV--EANRDVTRME  854


 Score = 77.8 bits (190),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 80/182 (44%), Gaps = 38/182 (21%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYY--------EEEMGGLIDD--------  2204
             L+ LC   GWSYAVFW      + + L   D Y          E    L  D        
Sbjct  7     LRRLCEEIGWSYAVFWKAIGAADPVRLVWEDGYCGHTSCPVGSESSEALPSDTGCSVPAA  66

Query  2203  ----------MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDD  2054
                       M  +++++G G VG+ AF+ NH+W++          HG A N  EL  + 
Sbjct  67    DTICSLVNKVMASEIHVVGQGTVGRAAFSGNHQWIV----------HGTA-NGHELSSEV  115

Query  2053  DSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQS  1874
              +E   QF  GI+TIA+I V P GV+Q GS   + E   FV   KKL    +  +  A S
Sbjct  116   AAEMNNQFRVGIQTIAIIPVLPRGVLQLGSTGLVMENTNFVMFAKKLCSQLNNRSSMAAS  175

Query  1873  SS  1868
             +S
Sbjct  176   AS  177



>ref|XP_008674450.1| PREDICTED: transcription factor LHW-like isoform X1 [Zea mays]
 ref|XP_008674453.1| PREDICTED: transcription factor LHW-like isoform X1 [Zea mays]
 tpg|DAA55617.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=888

 Score =   163 bits (413),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 107/159 (67%), Gaps = 2/159 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK +LFLQSVT+ A+ LK + +  
Sbjct  690   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMLFLQSVTKHADNLKDSNKSD  749

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G      +    G TWA ++ +++M CP++VEDL  P QML+E+LC+++G FLEI D
Sbjct  750   ILGGENGPLKDYFEGGATWALDVGSRSMTCPIIVEDLERPRQMLVEMLCEDRGIFLEIAD  809

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  810   FIKGLGLTILRGVMEARKNKIWARFTV--EANRNVTRME  846


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 75/160 (47%), Gaps = 29/160 (18%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI----  2210
             L+ LC   GWSYAVFW      + + L   D                   E G  +    
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGSCGHASCYTGSDAPEAGCEPGTSVCTLV  66

Query  2209  -DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M  Q++++G G +G+ AFT NH+W++ D  +   S H L     E++    +E   Q
Sbjct  67    GKVMASQIHVIGEGTIGRAAFTGNHQWIVHDPATA--SDHNLRP---EVV----AEMNHQ  117

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F+ GI+TIA+I V P GV+Q G+   + E    V + KKL
Sbjct  118   FAAGIQTIAIIPVLPRGVLQLGATSVVVENTNLVLQYKKL  157



>ref|NP_001065807.1| Os11g0158500 [Oryza sativa Japonica Group]
 dbj|BAF27652.1| Os11g0158500 [Oryza sativa Japonica Group]
Length=425

 Score =   158 bits (399),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELRE++PNG K SID LL +T+K +LFLQSVT+ A+ LK + E K
Sbjct  224   KPRPKDRQLIQDRIKELREMVPNGAKCSIDALLEKTVKHMLFLQSVTKHADKLKDSTESK  283

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E++C+++G FLEI
Sbjct  284   -ILGNENGPVWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMICEDRGIFLEI  342

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D I+G GL IL+G ME R++KIWA F V  EAN  V+R E
Sbjct  343   ADFIKGLGLTILRGAMEARKSKIWARFTV--EANRDVTRME  381



>ref|XP_006664356.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=893

 Score =   163 bits (412),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 82/160 (51%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +TIK ++FLQ+VT+ A+ LK + E K
Sbjct  691   KPRPKDRQLIQDRIKELRELVPNGAKCSIDALLEKTIKHMVFLQNVTKHADNLKDSNESK  750

Query  838   DKKGRKDSN-SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                G       +    G TWA ++ +Q+M CP+VVEDL  P QML+E+LC+++G FLEI 
Sbjct  751   IHGGENGPLLKDYFEGGATWAFDVGSQSMTCPIVVEDLDRPRQMLVEMLCEDRGIFLEIA  810

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             D I+G GL IL+G ME R+ KIWA F V  EAN  V+R E
Sbjct  811   DFIKGLGLTILRGVMEARKNKIWARFTV--EANRDVTRME  848


 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 75/162 (46%), Gaps = 33/162 (20%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRD---------AYYEEEMGG-----------  2216
             L+ LC   GWSYAVFW      + + L   D         A  E    G           
Sbjct  7     LRRLCEEAGWSYAVFWKAIGAADPVHLVWEDGCCGHPSCSAGSEASEAGCESGSSSAVCT  66

Query  2215  LIDDMLL-QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFY  2039
             L+  +++ QV+++G G +G+ AFT NH+W++ DT     + HGL            +E  
Sbjct  67    LVRKIMVSQVHVVGEGTIGRAAFTGNHQWIVHDT----ANDHGLRSEVA-------AEMN  115

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
              QF  GIKTIA+I V P GV+Q GS   + E    V   KKL
Sbjct  116   NQFRAGIKTIAIIPVLPRGVLQLGSTSVILENTSSVQLYKKL  157



>ref|XP_010045177.1| PREDICTED: transcription factor LHW-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW87330.1| hypothetical protein EUGRSUZ_B03816 [Eucalyptus grandis]
Length=940

 Score =   162 bits (411),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV++ A+ LK+    +
Sbjct  733   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVSKHADKLKQIGGSK  792

Query  844   LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             + +++GR     N    G TWA EI +Q+M+ P++VEDL  P QM +E+LC+E+GFFLEI
Sbjct  793   IINEEGRILLKDNFE-RGATWAYEIGSQSMVHPIIVEDLNPPRQMTVEMLCEERGFFLEI  851

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  +IWA F V  EA+  V+R E
Sbjct  852   ADMIRGLGLTILKGVMETRSDRIWARFAV--EADRDVTRVE  890


 Score = 99.8 bits (247),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 104/216 (48%), Gaps = 39/216 (18%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             K  LK+LC  N WSYAVFW    QN   L   + YYE                       
Sbjct  6     KEALKTLCGVNQWSYAVFWKIGHQNPKLLIWEECYYEPMTFSLPPQVSGSGPSEAPPGGW  65

Query  2230  ---EEMGGLIDDML--LQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDEL  2066
                + +  LI+ M+   Q++++G G++G+ AFT +H+W++S +       +G   +  E+
Sbjct  66    EAKDRVQMLIERMMTKAQISVVGEGIIGRAAFTGDHEWIVSTS-------YGGHAHPPEV  118

Query  2065  LQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETI  1886
             +    +E + QFS GI+T+AVI V   GVVQ GS+  + E M FV++ K L         
Sbjct  119   V----NEVHHQFSAGIQTVAVIPVPLHGVVQLGSSIAIMEHMGFVNDVKSLILQVAFIPG  174

Query  1885  FAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEAL  1778
                SSSS+    + G  GSL ++   +   +  E+L
Sbjct  175   ALFSSSSAGKAGMLGYPGSLTAAAPGNCQVIGSESL  210



>ref|XP_010045178.1| PREDICTED: uncharacterized protein LOC104433951 isoform X2 [Eucalyptus 
grandis]
Length=788

 Score =   162 bits (409),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             RP PKDR    +R+ ELRE++PNG K SID LL +TIK +LFLQSV++ A+ LK+    +
Sbjct  581   RPRPKDRQMIQDRVKELREIVPNGAKCSIDALLERTIKHMLFLQSVSKHADKLKQIGGSK  640

Query  844   LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             + +++GR     N    G TWA EI +Q+M+ P++VEDL  P QM +E+LC+E+GFFLEI
Sbjct  641   IINEEGRILLKDNFE-RGATWAYEIGSQSMVHPIIVEDLNPPRQMTVEMLCEERGFFLEI  699

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D+IRG GL ILKG ME R  +IWA F V  EA+  V+R E
Sbjct  700   ADMIRGLGLTILKGVMETRSDRIWARFAV--EADRDVTRVE  738



>ref|XP_006854628.1| hypothetical protein AMTR_s00030p00176130 [Amborella trichopoda]
 gb|ERN16095.1| hypothetical protein AMTR_s00030p00176130 [Amborella trichopoda]
Length=926

 Score =   162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             TRP PKDR    +R+ ELRE++PNG K SID LL +TI  +LFLQSVT+  + LK T E 
Sbjct  721   TRPRPKDRQMIQDRVKELREIVPNGAKCSIDALLEKTINHMLFLQSVTKHVDKLKHTGEP  780

Query  841   K--DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             K   K+G      N    G TWA ++ +Q MICP++VE+L  P  ML+E+LC E+GFFLE
Sbjct  781   KMISKEGGLILKDNYE-GGATWAFDVGSQPMICPIIVENLNAPRHMLVEMLCDERGFFLE  839

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             I DIIRG GL I+KG ME    KIWA F V  EAN  ++R
Sbjct  840   IADIIRGLGLTIVKGVMEACNNKIWARFAV--EANRDITR  877


 Score = 87.8 bits (216),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 85/187 (45%), Gaps = 50/187 (27%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             +  LKS C   GWSYAVFW  + +N + L L + YYE                       
Sbjct  6     REALKSFCSEGGWSYAVFWKHDCRNQMILMLGEGYYEFGNHPAVSECATNADPDMLLQEW  65

Query  2230  -------------------EEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWML-SDTNS  2111
                                +++  ++  M+ Q++++G G VG VA    H+W+  +  NS
Sbjct  66    ESFLNPLELHSSLVKQQGEDQLRAVVGKMVDQIHVIGEGFVGHVALAGKHQWIFRTGGNS  125

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
             +     G AD   + + +  S +  QF  GI+TIAVISV P GVVQ GS Q + E +E V
Sbjct  126   M-----GPADF--KSVSEVASGWKEQFLVGIQTIAVISVSPHGVVQLGSTQMIAENLELV  178

Query  1930  DETKKLF  1910
                + +F
Sbjct  179   SHVRSVF  185



>ref|XP_006662753.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=836

 Score =   162 bits (409),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 3/160 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PNG K SID LL +T+K +LFLQSVT+ A+ LK + E K
Sbjct  635   RPRPKDRQLIQDRIKELREMVPNGAKCSIDALLEKTVKHMLFLQSVTKHADKLKDSTESK  694

Query  838   DKKGRKDSN-SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                        +    G TWA ++ +Q+M CP++VEDL  P QML+E++C+++G FLEI 
Sbjct  695   ILGSENGPVWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPHQMLVEMICEDRGIFLEIA  754

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             D I+G GL IL+G ME R++KIWA F V  EAN  V+R E
Sbjct  755   DFIKGLGLTILRGAMEARKSKIWARFTV--EANRNVTRME  792


 Score = 67.8 bits (164),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 57/112 (51%), Gaps = 11/112 (10%)
 Frame = -1

Query  2203  MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSC  2024
             M  QV+++G G VG+ AFT NH+W++  T       HGL            +E   QF  
Sbjct  11    MASQVHVVGEGTVGRAAFTGNHEWIIHGT----AKDHGLPSEVA-------AEMSNQFRV  59

Query  2023  GIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSS  1868
             GI+TIA+I V P GV+Q GS + + E    +   KKL    +  +  A SSS
Sbjct  60    GIQTIAIIPVLPRGVLQLGSTRVVMENKSLMTHAKKLCSQLNNRSSMAVSSS  111



>ref|XP_002449032.1| hypothetical protein SORBIDRAFT_05g003740 [Sorghum bicolor]
 gb|EES08020.1| hypothetical protein SORBIDRAFT_05g003740 [Sorghum bicolor]
Length=870

 Score =   162 bits (409),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/161 (51%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +T+K +LFLQSVT+ A+ LK + E K
Sbjct  669   KPRPKDRQLIQDRIKELRELVPNGAKCSIDGLLEKTVKHMLFLQSVTKNADKLKDSTESK  728

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI
Sbjct  729   -ILGSENGPLWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEI  787

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D I+G GL IL+G ME+R++KIWA F V  EAN  V+R E
Sbjct  788   ADFIKGLGLTILRGVMEMRKSKIWARFTV--EANRDVTRME  826


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 93/213 (44%), Gaps = 42/213 (20%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAY--------------------------Y  2234
             L+ LC   GWSYAVFW      + + L   D Y                           
Sbjct  7     LRRLCEEIGWSYAVFWKAIGAADPVHLVREDGYCGHTSCPVGSEPSESLPSDAAGCSAPA  66

Query  2233  EEEMGGLIDDMLL-QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQD  2057
              + +  L+++++  QV+++G G VG+ AF+ NH+W++  T     + HGL+         
Sbjct  67    ADTICSLVNNVMASQVHVVGQGTVGRAAFSGNHQWIVHGT----ANGHGLSSEVA-----  117

Query  2056  DDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQ  1877
               +E   Q   GI+TIA+I V P GV+Q GS   + E   FV   KKL    +  +  A 
Sbjct  118   --AEMNNQLRVGIQTIAIIPVLPRGVLQLGSTGLVMENTNFVMFAKKLCSQLNNRSSMAV  175

Query  1876  SSSSSANGDVFGLSGSLASSICNSSYFMSPEAL  1778
             S+S+       G S    +++  S+    P AL
Sbjct  176   SASAKNGSSQHGQSRPDTATVSTST---PPHAL  205



>ref|XP_008679687.1| PREDICTED: transcription factor LHW [Zea mays]
 gb|AFW65579.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=866

 Score =   161 bits (408),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 112/162 (69%), Gaps = 5/162 (3%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
              +P PKDR    +R+ ELREL+PNG K SID LL +T+K +LFLQSVT+ A+ LK + E 
Sbjct  664   AKPRPKDRQLIQDRIKELRELVPNGAKCSIDGLLEKTVKHMLFLQSVTKNADKLKDSTES  723

Query  841   KDKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             K   G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLE
Sbjct  724   K-ILGSENGPLWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLE  782

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D I+G GL IL+G ME+R++KIWA F V  EAN  V+R E
Sbjct  783   IADFIKGLGLTILRGVMEMRKSKIWARFTV--EANRDVTRME  822


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 74/167 (44%), Gaps = 38/167 (23%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYY--------EEEMGGLIDD--------  2204
             L+ LC   GWSYAVFW      + + L   D Y          E    L  D        
Sbjct  7     LRRLCEEIGWSYAVFWKAIGAADPVHLVQEDGYCGHTSCPVGSEPSESLPSDAGCSVPAA  66

Query  2203  ----------MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDD  2054
                       M  QV+++G G VG+ AF+ NH+W++  T     + HGL+          
Sbjct  67    NTICSLVHSVMASQVHVVGQGTVGRAAFSGNHQWIVRGT----ANGHGLSSEVA------  116

Query  2053  DSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
              +E   QF  GI+TIA+I V P GV+Q GS   + E + FV   KKL
Sbjct  117   -AEMNNQFRVGIQTIAIIPVLPRGVLQLGSAGLVMENINFVMFAKKL  162



>gb|EPS62249.1| hypothetical protein M569_12542, partial [Genlisea aurea]
Length=203

 Score =   150 bits (379),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 107/163 (66%), Gaps = 7/163 (4%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELREL+PNG K SID LL +TIK +LFLQSVT+ A+ L +    +
Sbjct  28    RPRPKDRQMIQDRVKELRELVPNGAKCSIDALLERTIKHMLFLQSVTKHADKLNQAGG-E  86

Query  838   DKKGRKDSN---SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              K   KD N    N    G TWA E+ +++ +CP+VVEDL  PGQML+E++ +E+G FLE
Sbjct  87    SKIVSKDGNFLVRNEFEGGATWAYEVGSRSTVCPIVVEDLNQPGQMLVEMVYEERGLFLE  146

Query  667   IVDIIRGFGLNILKGTMELRETKI-WAHFIVEPEANAFVSRHE  542
             I D+IRG GL ILKG ME R   I  A F V  EAN  +SR E
Sbjct  147   IADVIRGLGLTILKGVMETRNDNICCARFAV--EANREISRME  187



>dbj|BAK06575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score =   161 bits (408),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 123/187 (66%), Gaps = 5/187 (3%)
 Frame = -1

Query  1093  STNVMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLL  920
             S +  N+K H+  +KA +K+++PG  ++P PKDR    +R+ ELREL+PNG K SID LL
Sbjct  657   SVSASNSKGHDTANKANRKRSRPGESSKPRPKDRQLIQDRIKELRELVPNGAKCSIDALL  716

Query  919   HQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSN-SNSNTNGVTWACEIENQTMICPL  743
              +TIK ++FLQSVT+ A+ LK + E K           +    G TWA  + +Q+M CP+
Sbjct  717   EKTIKHMVFLQSVTKHADNLKDSNESKILSSENGPLWKDYFEGGATWAFNVGSQSMTCPI  776

Query  742   VVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEAN  563
             +VEDL  P QML+E++C ++G FLEI D I+G GL IL+G ME R+ KIWA F V  EAN
Sbjct  777   IVEDLDRPHQMLVEMICDDRGIFLEIADFIKGLGLTILRGVMEARKNKIWARFTV--EAN  834

Query  562   AFVSRHE  542
               V+R E
Sbjct  835   RDVTRME  841


 Score = 80.1 bits (196),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 77/160 (48%), Gaps = 31/160 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI----  2210
             L+ LC   GWSYAVFW      + + L   D +                 E GG +    
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGFCGHASCPTGSEASEVGCESGGTVCTLV  66

Query  2209  -DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQ  2033
                M+ QV+++G G +G+ AFT +H+W++ DT          AD+   L  +  +E   Q
Sbjct  67    RKVMISQVHVVGEGTIGRAAFTGSHQWIIHDT----------ADD-HRLRSEVAAEMNYQ  115

Query  2032  FSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             F  GI+TIA+I V P GV+Q GS   + E   +V + KKL
Sbjct  116   FRAGIQTIAIIPVLPRGVLQLGSTSVVMENTTYVLQYKKL  155



>gb|KHG17321.1| hypothetical protein F383_21887 [Gossypium arboreum]
Length=818

 Score =   161 bits (407),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/154 (52%), Positives = 104/154 (68%), Gaps = 5/154 (3%)
 Frame = -1

Query  2371  MSKGKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQ  2192
             M +    +  K  LK+LCC NGW Y VFW F+ +NS+ LTL DAYYE++MG L+D MLL+
Sbjct  1     MGEAAMGSALKQPLKNLCCSNGWCYGVFWRFDPRNSMLLTLGDAYYEQKMGPLVDKMLLK  60

Query  2191  VNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKT  2012
              +ILG G++GQ AFT  H+W+ SD+N       G     +E +  D+SE   QFS GIKT
Sbjct  61    FHILGEGIIGQAAFTGKHQWIFSDSNGKGSDSAG-----NENIFQDESELQDQFSSGIKT  115

Query  2011  IAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             IAVISV   GVVQFGS +K+ ER+E + ET+KLF
Sbjct  116   IAVISVGRRGVVQFGSTKKILERLELLAETEKLF  149


 Score =   157 bits (397),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 111/154 (72%), Gaps = 5/154 (3%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGK-MSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE  845
             +RP PKDR    +R+ ELR +IP+ GK +SID LL +TIK LLFLQ VT+ A+ +K+ +E
Sbjct  606   SRPRPKDRQLIQDRIKELRGIIPHSGKQLSIDHLLERTIKYLLFLQGVTKYADKIKQADE  665

Query  844   LK--DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFL  671
              K   ++  K    N+ + G TWA E+  Q++  P+VV+DL  PGQML+E+LC+++ FFL
Sbjct  666   PKLIGQENGKLLKHNTMSGGATWAFEVGAQSI--PIVVKDLNPPGQMLVEMLCEDREFFL  723

Query  670   EIVDIIRGFGLNILKGTMELRETKIWAHFIVEPE  569
             EI ++IRGF LNILKG MEL+E KIWA FIVE +
Sbjct  724   EIAEVIRGFPLNILKGVMELQEDKIWARFIVEAD  757



>ref|NP_001044899.2| Os01g0865600 [Oryza sativa Japonica Group]
 dbj|BAD81907.1| bHLH transcription factor-like protein [Oryza sativa Japonica 
Group]
 dbj|BAG90720.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06813.2| Os01g0865600 [Oryza sativa Japonica Group]
Length=904

 Score =   161 bits (407),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 3/161 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
              RP PKDR    +R+ ELRE++PN  K SID LL +TIK +LFLQ+V + A+ LK + E 
Sbjct  700   ARPRPKDRQMIQDRIKELREIVPNSAKCSIDTLLEKTIKHMLFLQNVAKHADKLKGSGEP  759

Query  841   KDKKGRKDSNSNSN-TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K     +      N   G TWA E+  ++M CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  760   KIVSHEEGLLLKDNFEGGATWAFEVGTRSMTCPIIVEDLNPPRQMLVEMLCKERGIFLEI  819

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME+R+ KIWA F V  EAN  V+R E
Sbjct  820   ADQIRGLGLTILKGVMEVRKDKIWARFAV--EANKDVTRME  858


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 75/195 (38%), Gaps = 64/195 (33%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQ---QNSLFLTLRDAYYEEEMGGL------IDDMLL-----  2195
             L+ LC   GWSYAVFW   +      L L   D +YE   G          D+LL     
Sbjct  11    LRRLCTDVGWSYAVFWRATRAADSQRLKLVWGDGHYERAAGAPSISGFEAMDLLLKEKAA  70

Query  2194  ---------------------------------------QVNILGSGVVGQVAFTKNHKW  2132
                                                    QV+++G GV+GQ A T  H+W
Sbjct  71    ALRSGTGRGGGGGEGHAADGAAGHSHDRVDALVHKAMAQQVHVVGEGVIGQAALTGLHRW  130

Query  2131  MLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKL  1952
             ++ D     +              +   E  GQF  GI+TIAVI V P GV+Q GS + +
Sbjct  131   IVHDIVDECEE-----------EDEVLLEMKGQFCAGIQTIAVIPVLPRGVIQLGSTKMV  179

Query  1951  PERMEFVDETKKLFQ  1907
              E   F+D  + LFQ
Sbjct  180   MEEAAFIDHVRSLFQ  194



>gb|EAY76601.1| hypothetical protein OsI_04550 [Oryza sativa Indica Group]
Length=895

 Score =   161 bits (407),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 3/161 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
              RP PKDR    +R+ ELRE++PN  K SID LL +TIK +LFLQ+V + A+ LK + E 
Sbjct  691   ARPRPKDRQMIQDRIKELREIVPNSAKCSIDTLLEKTIKHMLFLQNVAKHADKLKGSGEP  750

Query  841   KDKKGRKDSNSNSN-TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K     +      N   G TWA E+  ++M CP++VEDL  P QML+E+LC+E+G FLEI
Sbjct  751   KIVSHEEGLLLKDNFEGGATWAFEVGTRSMTCPIIVEDLNPPRQMLVEMLCKERGIFLEI  810

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D IRG GL ILKG ME+R+ KIWA F V  EAN  V+R E
Sbjct  811   ADQIRGLGLTILKGVMEVRKDKIWARFAV--EANKDVTRME  849


 Score = 75.5 bits (184),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 56/195 (29%), Positives = 75/195 (38%), Gaps = 64/195 (33%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQ---QNSLFLTLRDAYYEEEMGGL------IDDMLL-----  2195
             L+ LC   GWSYAVFW   +      L L   D +YE   G          D+LL     
Sbjct  11    LRRLCTDVGWSYAVFWRATRAADSQRLKLVWGDGHYERAAGAPSISGFEAMDLLLKEKAA  70

Query  2194  ---------------------------------------QVNILGSGVVGQVAFTKNHKW  2132
                                                    QV+++G GV+GQ A T  H+W
Sbjct  71    ALRSGTGRGGGGGEGHAADGAAGHSHDRVDALVHKAMAQQVHVVGEGVIGQAALTGLHRW  130

Query  2131  MLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKL  1952
             ++ D     +              +   E  GQF  GI+TIAVI V P GV+Q GS + +
Sbjct  131   IVHDIVDECEE-----------EDEVLLEMKGQFCAGIQTIAVIPVLPRGVIQLGSTKMV  179

Query  1951  PERMEFVDETKKLFQ  1907
              E   F+D  + LFQ
Sbjct  180   MEEAAFIDHVRSLFQ  194



>gb|EEE55720.1| hypothetical protein OsJ_04192 [Oryza sativa Japonica Group]
Length=904

 Score =   160 bits (406),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/160 (52%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE++PN  K SID LL +TIK +LFLQ+V + A+ LK + E K
Sbjct  701   RPRPKDRQMIQDRIKELREIVPNSAKCSIDTLLEKTIKHMLFLQNVAKHADKLKGSGEPK  760

Query  838   DKKGRKDSNSNSN-TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
                  +      N   G TWA E+  ++M CP++VEDL  P QML+E+LC+E+G FLEI 
Sbjct  761   IVSHEEGLLLKDNFEGGATWAFEVGTRSMTCPIIVEDLNPPRQMLVEMLCKERGIFLEIA  820

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             D IRG GL ILKG ME+R+ KIWA F V  EAN  V+R E
Sbjct  821   DQIRGLGLTILKGVMEVRKDKIWARFAV--EANKDVTRME  858


 Score = 72.4 bits (176),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 74/195 (38%), Gaps = 64/195 (33%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQ---QNSLFLTLRDAYYEEE---------------------  2225
             L+ LC   GWSYAVFW   +      L L   + +YE                       
Sbjct  11    LRRLCTDVGWSYAVFWRATRAADSQRLKLVWGNGHYERAPETPRSPASRPWTCCSRRRPR  70

Query  2224  -------------------------MGGL----IDDMLLQVNILGSGVVGQVAFTKNHKW  2132
                                      M GL       M  QV+++G GV+GQ A T  H+W
Sbjct  71    RCGAAPGAVVAAARGTRLMAPRDTAMTGLNALVHKAMAQQVHVVGEGVIGQAALTGLHRW  130

Query  2131  MLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKL  1952
             ++ D     +              +   E  GQF  GI+TIAVI V P GV+Q GS + +
Sbjct  131   IVHDIVDECEE-----------EDEVLLEMKGQFCAGIQTIAVIPVLPRGVIQLGSTKMV  179

Query  1951  PERMEFVDETKKLFQ  1907
              E   F+D  + LFQ
Sbjct  180   MEEAAFIDHVRSLFQ  194



>ref|XP_010523120.1| PREDICTED: transcription factor LHW [Tarenaya hassleriana]
Length=719

 Score =   159 bits (402),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 108/159 (68%), Gaps = 9/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+VT+ A+ LK++ E K
Sbjct  521   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVTKHADKLKQSGESK  580

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               +G           G TWA E+ +Q+++CP+VVEDL +P    +E+LC+++GFFLEI D
Sbjct  581   MMEG-------GFGGGATWAFEVGSQSLVCPIVVEDLNSPRCFQVEMLCEQRGFFLEIAD  633

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              I+  GL ILKG ME R  KIWA F+V  EAN  V+R E
Sbjct  634   WIKSLGLTILKGVMETRNDKIWARFVV--EANRDVTRME  670


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 84/171 (49%), Gaps = 38/171 (22%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             +  L+++C  N WSYAVFW    QN+  L   + Y+E                       
Sbjct  6     REALRTICVNNQWSYAVFWKIGCQNASLLIWEECYHETSPSPSSLPPRISGFSSSEIDTS  65

Query  2230  --EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELL  2063
               E++  L + M+L  ++ ++G G+VG+ AFT +H+W+L +             N D   
Sbjct  66    GNEKVPFLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILVN-----------GFNRDLHP  114

Query  2062  QDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              +  +E   QFS GI+T+AV+ V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   PEVINEMLLQFSAGIQTVAVVPVVPHGVVQLGSSFPIMENLGFVNDVKGLI  165



>gb|ABA91568.2| expressed protein [Oryza sativa Japonica Group]
 gb|EEE51685.1| hypothetical protein OsJ_33044 [Oryza sativa Japonica Group]
Length=902

 Score =   159 bits (403),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 112/164 (68%), Gaps = 11/164 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE--  845
             +P PKDR    +R+ ELRE++PNG K SID LL +T+K +LFLQSVT+ A+ LK + E  
Sbjct  701   KPRPKDRQLIQDRIKELREMVPNGAKCSIDALLEKTVKHMLFLQSVTKHADKLKDSTESK  760

Query  844   -LKDKKGR--KDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
              L ++ G   KD        G TWA ++ +Q+M CP++VEDL  P QML+E++C+++G F
Sbjct  761   ILGNENGPVWKDYFEG----GATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMICEDRGIF  816

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI D I+G GL IL+G ME R++KIWA F V  EAN  V+R E
Sbjct  817   LEIADFIKGLGLTILRGAMEARKSKIWARFTV--EANRDVTRME  858


 Score = 76.3 bits (186),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 74/168 (44%), Gaps = 39/168 (23%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYYEEE-----------------------  2225
             L+ LC   GWSYAVFW      + + L   D Y                           
Sbjct  7     LRRLCEEVGWSYAVFWKAIGAADPVHLVWEDGYCGHASCPAGSDPSEALPTDVGCAAAAD  66

Query  2224  ---MGGLIDDMLL-QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQD  2057
                M  L++ ++  QV+++G G VG+ AFT NH+W++  T     + HG+          
Sbjct  67    TMTMCSLVNKVMASQVHVVGEGTVGRAAFTGNHQWIIHGT----ANDHGIPSEVA-----  117

Query  2056  DDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
               +E   QF  GI+TIA+I V P GV+Q GS   + E   F+   KKL
Sbjct  118   --AEMSYQFRVGIQTIAIIPVLPRGVLQLGSTGVVLENKSFMTHAKKL  163



>ref|XP_002271475.2| PREDICTED: transcription factor LHW [Vitis vinifera]
 emb|CBI30504.3| unnamed protein product [Vitis vinifera]
Length=720

 Score =   158 bits (400),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 98/151 (65%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT---E  848
             RP P+DR    +R+ ELREL+PNG K SID LL +TIK +LFL++ T  A  LK+    E
Sbjct  541   RPRPRDRQMIQDRVKELRELVPNGAKCSIDGLLDRTIKHMLFLRNSTDQAAKLKQRVHQE  600

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
                 K  R   N  S+ NG +WA E+ ++  +CP+VVEDL  PG MLIE+LC E G FLE
Sbjct  601   VASQKSWRSSENKCSHQNGTSWAFELGSELKVCPIVVEDLECPGHMLIEMLCNEHGLFLE  660

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IRG  L ILKG ME R   +WAHFIVE
Sbjct  661   IAQVIRGLELTILKGVMESRSDNMWAHFIVE  691


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 80/192 (42%), Gaps = 45/192 (23%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----EEMGGLIDDMLLQ-----  2192
             + LLKS C  + W YAVFW    QN + LT  D Y +     E +  + DD+ L      
Sbjct  7     RQLLKSFCNNSHWKYAVFWRLKHQNPMLLTWEDGYCDYPNPREPVESISDDIYLNNANDI  66

Query  2191  ----------------------VNI------LGSGVVGQVAFTKNHKWMLSDTNSVWQSH  2096
                                    N+       G GVVG+VA T NH W+ +D     + +
Sbjct  67    SSLNCEIDGFNGSYGYPVELAVANMSCLQYAFGEGVVGEVAKTGNHCWVFTDDIFASRFN  126

Query  2095  HGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKK  1916
               L   C +       E+  QF  GIKT+ ++ V P GV+Q GS +K+ E +  V   K 
Sbjct  127   SKLVPECPD-------EWLLQFVAGIKTVLLVPVIPHGVLQLGSLEKVAENVAVVACIKD  179

Query  1915  LFQGTDIETIFA  1880
              F     E  F+
Sbjct  180   SFDTLQNEVGFS  191



>gb|EMT30779.1| Putative basic helix-loop-helix protein [Aegilops tauschii]
Length=886

 Score =   159 bits (403),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/195 (47%), Positives = 125/195 (64%), Gaps = 11/195 (6%)
 Frame = -1

Query  1093  STNVMNTKDHEkpskavkkkakPG--TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLL  920
             S +  N+K H+ P+KA +K+++PG  ++P PKDR    +R+ ELREL+PNG K SID LL
Sbjct  648   SVSASNSKGHDTPNKANRKRSRPGESSKPRPKDRQLIQDRIKELRELVPNGAKCSIDALL  707

Query  919   HQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSN-SNSNTNGVTWACEIENQTMICPL  743
              +TIK ++FLQSVT+ A+ LK   E K   G       +    G TWA  + +Q+M CP+
Sbjct  708   EKTIKHMVFLQSVTKHADNLKDCNESKILSGDNGPLWKDYFEGGATWAFNVGSQSMTCPI  767

Query  742   VVEDLCTPGQMLIEILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE----  575
             +VEDL  P QML+E++C ++G FLEI D I+G GL IL+G ME R+ KIWA F VE    
Sbjct  768   IVEDLDRPRQMLVEMICDDRGIFLEIADFIKGLGLTILRGVMEARKNKIWARFTVEVFLY  827

Query  574   ----PEANAFVSRHE  542
                  +AN  V+R E
Sbjct  828   LVPFVQANRDVTRME  842


 Score = 76.3 bits (186),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 70/152 (46%), Gaps = 31/152 (20%)
 Frame = -1

Query  2308  GWSYAVFW-GFNQQNSLFLTLRDAYYEE--------------EMGGLI-----DDMLLQV  2189
             GWSYAVFW      + + L   D Y                 E GG +       M  QV
Sbjct  6     GWSYAVFWKAIGAADPVHLVWEDGYCGHASCPTGSEASEVGCESGGTVCTLVRKVMASQV  65

Query  2188  NILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTI  2009
             +++G G +G+ AFT +H+W++ DT            N   L  +  +E   QF  GI+TI
Sbjct  66    HVVGEGTIGRAAFTGSHQWIIHDTA-----------NDHRLRSEVAAEMNYQFRAGIQTI  114

Query  2008  AVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
             A+I V P GV+Q GS   + E   +V + KKL
Sbjct  115   AIIPVLPRGVLQLGSTSVVMENTTYVLQYKKL  146



>gb|KFK32958.1| hypothetical protein AALP_AA6G311800 [Arabis alpina]
Length=551

 Score =   156 bits (394),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 129/222 (58%), Gaps = 26/222 (12%)
 Frame = -1

Query  1192  LSSTKKRRIE-------------HPLASEREVTKLETIVSLIGENCSTNVMN-TKDHEkp  1055
             L+ +KKR++E             +P   E E          I E  S+   N  K HE+ 
Sbjct  315   LNQSKKRKLETSSAQSSSFFPQMNPQEKEEETVTTHQRSLWIDEERSSVAGNWKKPHEEG  374

Query  1054  skavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTR  875
              K  + KA    RP PKDR    +R+ ELR +IPNG K SID LL  TI+ ++F+QSV +
Sbjct  375   VKKKRAKAGESRRPRPKDRQMIQDRIKELRGMIPNGSKCSIDTLLDLTIRHMVFMQSVAK  434

Query  874   LAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEI--ENQTMICPLVVEDLCTPGQMLIE  701
              A+ LK+  E K  K ++           TWA E+  E+ +++CP++VEDL + GQM IE
Sbjct  435   YADKLKQPYEPKLVKEKER----------TWALEVNDESSSVVCPIIVEDLKSQGQMEIE  484

Query  700   ILCQEQGFFLEIVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             +LC+E G FLEI D+I+G GLNILKG ME R+ KIW+HFIVE
Sbjct  485   MLCEENGQFLEITDVIKGLGLNILKGVMERRQGKIWSHFIVE  526


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 88/159 (55%), Gaps = 24/159 (15%)
 Frame = -1

Query  2335  LLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVVGQV  2156
             +LKSLC  +GWSY VFW ++  N + L     Y +E+   +++DM+LQ +ILG G+VG+ 
Sbjct  5     ILKSLCSSHGWSYGVFWCYDPINPMLLRFEQVYNDEQSVAVVNDMILQPHILGQGIVGEA  64

Query  2155  AFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVV  1976
             A T NH+W+ SDT   +Q  H               EF  QF  G KTIA+I V   GVV
Sbjct  65    ALTGNHQWLFSDT-LFFQCGH---------------EFQHQFLSGFKTIAIIPVGSSGVV  108

Query  1975  QFGSNQKLPERMEFVDETKKLF--------QGTDIETIF  1883
             Q GS QK+ E  E +++T +          Q  +++T+F
Sbjct  109   QLGSTQKILESPEVLEQTTRAVHEMCLKPDQSVELDTLF  147



>ref|XP_006646502.1| PREDICTED: transcription factor LHW-like [Oryza brachyantha]
Length=904

 Score =   159 bits (402),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 107/164 (65%), Gaps = 6/164 (4%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
              RP PKDR    +R+ ELRE++P+  K SID LL +TIK +LFLQ+V + A+ LK++ E 
Sbjct  697   ARPRPKDRQMIQDRIKELREIVPSSAKCSIDALLEKTIKHMLFLQNVAKHADKLKESGES  756

Query  841   KDKKGRKDSN----SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFF  674
             K              ++   G TWA E+  ++M CP++VEDL  P QML+E+LC+E+G F
Sbjct  757   KIVSQETQEEGLLLKDNFEGGATWAFEVGTRSMTCPIIVEDLSPPRQMLVEMLCKERGIF  816

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI D IRG GL ILKG ME+R+ KIWA F V  EAN  V+R E
Sbjct  817   LEIADQIRGLGLTILKGVMEVRKDKIWARFAV--EANKDVTRME  858


 Score = 73.2 bits (178),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 61/110 (55%), Gaps = 17/110 (15%)
 Frame = -1

Query  2203  MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDS--EFYGQF  2030
             M  Q++++G GV+GQ A T  H+W+L D+           D C+E   +D+   E   QF
Sbjct  109   MAQQLHVVGKGVIGQAAVTGLHRWILHDS----------LDECEE---EDEVLLEMKDQF  155

Query  2029  SCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQ--GTDIETI  1886
               GI+T+AVI V P GV+Q GS + + E   FVD  + LFQ  G+ I  +
Sbjct  156   CAGIQTVAVIPVLPQGVIQLGSTKMVMEEASFVDHVRSLFQQLGSSIAVV  205



>gb|AFW65580.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=830

 Score =   158 bits (400),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 106/151 (70%), Gaps = 3/151 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
              +P PKDR    +R+ ELREL+PNG K SID LL +T+K +LFLQSVT+ A+ LK + E 
Sbjct  664   AKPRPKDRQLIQDRIKELRELVPNGAKCSIDGLLEKTVKHMLFLQSVTKNADKLKDSTES  723

Query  841   KDKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             K   G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLE
Sbjct  724   K-ILGSENGPLWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLE  782

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D I+G GL IL+G ME+R++KIWA F VE
Sbjct  783   IADFIKGLGLTILRGVMEMRKSKIWARFTVE  813


 Score = 75.5 bits (184),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 74/167 (44%), Gaps = 38/167 (23%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAYY--------EEEMGGLIDD--------  2204
             L+ LC   GWSYAVFW      + + L   D Y          E    L  D        
Sbjct  7     LRRLCEEIGWSYAVFWKAIGAADPVHLVQEDGYCGHTSCPVGSEPSESLPSDAGCSVPAA  66

Query  2203  ----------MLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDD  2054
                       M  QV+++G G VG+ AF+ NH+W++  T     + HGL+          
Sbjct  67    NTICSLVHSVMASQVHVVGQGTVGRAAFSGNHQWIVRGT----ANGHGLSSEVA------  116

Query  2053  DSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
              +E   QF  GI+TIA+I V P GV+Q GS   + E + FV   KKL
Sbjct  117   -AEMNNQFRVGIQTIAIIPVLPRGVLQLGSAGLVMENINFVMFAKKL  162



>dbj|BAF01612.1| hypothetical protein [Arabidopsis thaliana]
Length=319

 Score =   151 bits (381),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 106/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ ++ LK+T E K
Sbjct  131   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHSDKLKQTGESK  190

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K         +  G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  191   IMK--------EDGGGATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLEIAD  242

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  243   WIRSLGLTILKGVIETRVDKIWARFTV--EASRDVTRME  279



>ref|XP_010557442.1| PREDICTED: transcription factor LHW-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557443.1| PREDICTED: transcription factor LHW-like isoform X1 [Tarenaya 
hassleriana]
Length=676

 Score =   156 bits (394),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+VT      K T++LK
Sbjct  481   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVT------KHTDKLK  534

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              + G  +S   +   G TWA E+  Q++ICP+VVEDL  P    +E+LC+++GFFLEI D
Sbjct  535   QQTG--ESTKMTKEGGATWAFEVGTQSLICPIVVEDLNPPRCFQVEMLCEQRGFFLEIAD  592

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  G+ ILKG ME R  KIWA F V  EAN  V+R E
Sbjct  593   WIRSLGVTILKGAMETRNDKIWARFAV--EANRDVTRME  629


 Score = 84.7 bits (208),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 85/169 (50%), Gaps = 36/169 (21%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             +  L+++C  N WSYAVFW    QN+  L   + Y+E                       
Sbjct  6     REALRTVCVNNQWSYAVFWKIGCQNASLLIWEECYHETTVSSLPPRISGFSPSHVSTRGS  65

Query  2230  EEMGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQD  2057
             E++  L + M+L  ++ ++G G+VG+ AF  +H+W+L++             N D    +
Sbjct  66    EKIPLLTNRMMLNSRIVLVGEGLVGRAAFAGHHQWILANRF-----------NRDVHPPE  114

Query  2056  DDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
               +E   QFS GI+T+AV+ V P G+VQ GS+  + E + FV++ K+L 
Sbjct  115   VINEMLLQFSAGIQTVAVVPVLPHGIVQLGSSLPIMESLGFVNDVKRLI  163



>tpg|DAA39099.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=834

 Score =   157 bits (398),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 77/150 (51%), Positives = 105/150 (70%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P PKDR    +R+ ELREL+PNG K SID LL +T+K +LFLQSVT+ A+ LK + E K
Sbjct  668   KPRPKDRQLIQDRIKELRELVPNGAKCSIDGLLEKTVKHMLFLQSVTKNADKLKDSTESK  727

Query  838   DKKGRKDSN--SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
                G ++     +    G TWA ++ +Q+M CP++VEDL  P QML+E+LC+++G FLEI
Sbjct  728   -ILGSENGPLWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMLCEDRGIFLEI  786

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVE  575
              D I+G GL IL+G ME R++KIWA F VE
Sbjct  787   ADFIKGLGLTILRGVMETRKSKIWARFTVE  816


 Score = 80.9 bits (198),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 68/241 (28%), Positives = 102/241 (42%), Gaps = 45/241 (19%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAY-----------------YEEEMGGLI-  2210
             L+ LC   GWSYAVFW      + + L   D Y                    + G  + 
Sbjct  7     LRRLCEEIGWSYAVFWKAIGAADPVHLVREDGYCGHTSCPVGSEPSESLPLPSDAGCSVP  66

Query  2209  ----------DDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQ  2060
                       +DM  QV+++G G+VG+ AF+ NH+W++  T     + HGL+        
Sbjct  67    AADTICWLVNNDMASQVHVVGQGIVGRAAFSGNHQWIVHGT----ANGHGLSSEVA----  118

Query  2059  DDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFA  1880
                +E   QF  GIKTIA+I V P GV+Q GS   + E   FV   KKL    +  +  A
Sbjct  119   ---AEVNNQFRVGIKTIAIIPVLPRGVLQLGSTGLVMENTNFVMFAKKLCSQLNNRSSMA  175

Query  1879  QSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDFVDPIMNMVQSFPVEAFSLFDD  1700
              S+S        G S    +++  S+    P AL S   +   +      PV   S++ +
Sbjct  176   ASASVKNTSSQHGQSRPDTATVSTST---PPNALLSASLLK--VAQQNGHPVREHSVYAE  230

Query  1699  Q  1697
             +
Sbjct  231   R  231



>gb|KFK33154.1| hypothetical protein AALP_AA6G337700 [Arabis alpina]
Length=637

 Score =   155 bits (392),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 11/159 (7%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL  TIK +LFLQSV++ A+ +K+T + K
Sbjct  451   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLESTIKHMLFLQSVSKHADKMKQTNKSK  510

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              KK         +  G TWA E+ +++M+CP+VVEDL  P    +E+LC+++GFFLEI D
Sbjct  511   IKK---------DEGGATWAFEVGSKSMVCPIVVEDLNPPRIFQVEMLCEQRGFFLEIAD  561

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              +R  GL ILKG +E R  KIWA F V  EAN  V+R E
Sbjct  562   WVRTLGLTILKGVIETRIDKIWACFTV--EANRDVTRME  598


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/148 (36%), Positives = 85/148 (57%), Gaps = 15/148 (10%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--EEMGGLIDDMLL--QVNILGS  2174
             +  L+S+C  N WSYAVFW    QNS  L   + Y E   ++  L + M+L  ++ ++G 
Sbjct  6     REALRSMCVNNQWSYAVFWKIGCQNSSLLIWEECYIEATSKLDLLTNRMMLNNRIILVGE  65

Query  2173  GVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             G+VG+ AFT +H+W+LS++   +  H    +  +E+L         QFS G++T+AV  V
Sbjct  66    GLVGRAAFTGHHQWILSNS---FNRHLHPPEVINEMLL--------QFSAGVQTVAVFPV  114

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              P GVVQ GS+  + E + FV++ K L 
Sbjct  115   VPHGVVQLGSSLPIMENLGFVNDVKGLI  142



>dbj|BAK00701.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=887

 Score =   157 bits (397),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/161 (48%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEEL  842
             ++  PKDR    +R+ ELRE++PNG K SID LL +T+K +LFLQSVT+ A+ LK + E 
Sbjct  684   SKARPKDRQLIQDRIKELREMVPNGAKCSIDALLEKTVKHMLFLQSVTKHADKLKDSTES  743

Query  841   KDKKGRKDSN-SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEI  665
             K           +    G TWA ++ +Q+M CP++VEDL  P QML+E++C+++G FLEI
Sbjct  744   KILGSENGPVWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMICEDRGIFLEI  803

Query  664   VDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              D I+G GL IL+G ME R++KIWA F V  EAN  V+R E
Sbjct  804   ADFIKGLGLTILRGVMEARKSKIWARFTV--EANRDVTRME  842


 Score = 87.0 bits (214),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 84/181 (46%), Gaps = 37/181 (20%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFW-GFNQQNSLFLTLRDAY---------------YEEEMG--GLID  2207
             L+ LC   GWSYAVFW      + + L   D Y                  E+G    +D
Sbjct  7     LRRLCEEIGWSYAVFWKAIGAADPVHLVWEDGYCGHTPCPAGSEASQARATELGCSAAVD  66

Query  2206  --------DMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDD  2051
                     DM  QV+++G G +G+VAFT  H+W++          HG AD+   L  +  
Sbjct  67    SICSLVRKDMAEQVHVVGEGTIGRVAFTGTHQWII----------HGTADD-HGLSSEVA  115

Query  2050  SEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSS  1871
             SE + QF  GIKTIA+I V P GV+Q GS   + E   FV   KKL    +  +  A S+
Sbjct  116   SEMHYQFRAGIKTIAIIPVLPRGVLQLGSTGVVMENTSFVMHAKKLCSQLNQRSSMAVSA  175

Query  1870  S  1868
             S
Sbjct  176   S  176



>ref|XP_011006385.1| PREDICTED: transcription factor EMB1444-like isoform X2 [Populus 
euphratica]
Length=667

 Score =   155 bits (391),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL QTIK + +L+SVT  AE L++   +E
Sbjct  488   KPRPRDRQLIQDRVKELRELVPNGSKCSIDGLLDQTIKHMQYLRSVTDQAEKLRQWVHQE  547

Query  844   LKDKKGRKDSNSNSNT-NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             + D+K  + S +N N  +G +WA E  N   ICP+VVEDL  PG +LIE+LC ++G FLE
Sbjct  548   VADRKNCRSSETNVNIQSGKSWAFEFGNDLQICPIVVEDLAYPGHLLIEMLCNDRGVFLE  607

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R +  WAHFIVE
Sbjct  608   IAQVIRSLDLTILKGVMESRLSNTWAHFIVE  638


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 81/186 (44%), Gaps = 46/186 (25%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------  2231
             T  + LL+SLC  + W YAV W     + + LT  + Y++                    
Sbjct  4     TDLRQLLESLCNNSDWKYAVLWKMGHGSPMILTWEEGYFDCPKPREPLQTISSDVYCNGG  63

Query  2230  --------------EEMGG-----LIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
                              GG     ++ DML     LG GVVG+VA+T +H W+    NS+
Sbjct  64    NDLVSSLRDASASNANFGGHQLELVVADMLHLQYPLGEGVVGEVAYTGDHFWL--SFNSI  121

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
             + S     +    L+ +   E+  QF+ GIKTI ++ V P GVVQ GS  ++ E ++ V 
Sbjct  122   FSS-----EMSKNLVPEFPEEWLLQFASGIKTILLVPVLPHGVVQLGSFDEVAEDIQIVA  176

Query  1927  ETKKLF  1910
               K  F
Sbjct  177   YIKGRF  182



>ref|XP_011006384.1| PREDICTED: transcription factor EMB1444-like isoform X1 [Populus 
euphratica]
Length=708

 Score =   155 bits (392),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL QTIK + +L+SVT  AE L++   +E
Sbjct  529   KPRPRDRQLIQDRVKELRELVPNGSKCSIDGLLDQTIKHMQYLRSVTDQAEKLRQWVHQE  588

Query  844   LKDKKGRKDSNSNSNT-NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             + D+K  + S +N N  +G +WA E  N   ICP+VVEDL  PG +LIE+LC ++G FLE
Sbjct  589   VADRKNCRSSETNVNIQSGKSWAFEFGNDLQICPIVVEDLAYPGHLLIEMLCNDRGVFLE  648

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R +  WAHFIVE
Sbjct  649   IAQVIRSLDLTILKGVMESRLSNTWAHFIVE  679


 Score = 72.0 bits (175),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 81/186 (44%), Gaps = 46/186 (25%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------  2231
             T  + LL+SLC  + W YAV W     + + LT  + Y++                    
Sbjct  4     TDLRQLLESLCNNSDWKYAVLWKMGHGSPMILTWEEGYFDCPKPREPLQTISSDVYCNGG  63

Query  2230  --------------EEMGG-----LIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
                              GG     ++ DML     LG GVVG+VA+T +H W+    NS+
Sbjct  64    NDLVSSLRDASASNANFGGHQLELVVADMLHLQYPLGEGVVGEVAYTGDHFWL--SFNSI  121

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
             + S     +    L+ +   E+  QF+ GIKTI ++ V P GVVQ GS  ++ E ++ V 
Sbjct  122   FSS-----EMSKNLVPEFPEEWLLQFASGIKTILLVPVLPHGVVQLGSFDEVAEDIQIVA  176

Query  1927  ETKKLF  1910
               K  F
Sbjct  177   YIKGRF  182



>ref|XP_010544333.1| PREDICTED: transcription factor LHW-like [Tarenaya hassleriana]
Length=604

 Score =   154 bits (389),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 105/159 (66%), Gaps = 12/159 (8%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V + A+ LK++ E K
Sbjct  409   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVAKHADKLKQSGESK  468

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               +            G TWA E+ +Q ++CP+ VEDL TP    +E+LC+++GFFLEI D
Sbjct  469   IME----------EGGATWAFEVGSQPLVCPITVEDLSTPRCFKVEMLCEQRGFFLEIAD  518

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG ME R+ KIWA F+V  +AN  V+R E
Sbjct  519   WIRSLGLTILKGFMETRKDKIWARFVV--DANRDVTRME  555


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 59/95 (62%), Gaps = 11/95 (12%)
 Frame = -1

Query  2194  QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             ++ ++G G+VG+ AFT +H+W+L+  NS  ++ H       E++    +E   QFS GI+
Sbjct  6     RIILVGEGLVGRAAFTGHHQWILA--NSFNRNIHP-----PEVI----NEMLLQFSAGIQ  54

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             T+AV+ V P GVVQFGS+  + E   FV+E K L 
Sbjct  55    TVAVVPVIPHGVVQFGSSLPIMENSGFVNEVKGLI  89



>ref|XP_006293814.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
 ref|XP_006293815.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
 gb|EOA26712.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
 gb|EOA26713.1| hypothetical protein CARUB_v10022796mg [Capsella rubella]
Length=662

 Score =   154 bits (390),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ LK+T E K
Sbjct  474   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKLKQTGESK  533

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K            G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  534   VMK--------EEGGGATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLEIAD  585

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EAN  V+R E
Sbjct  586   WIRSLGLTILKGVIETRIDKIWARFTV--EANRDVTRME  622


 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 84/166 (51%), Gaps = 33/166 (20%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------EEM  2222
             +  L+S+C  N WSYAVFW    QNS  L   + Y E                    +++
Sbjct  6     REALRSMCVNNQWSYAVFWKIGCQNSSLLIWEECYNETASSSHPRRVCGLGVDTQGNDKV  65

Query  2221  GGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDS  2048
               L + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +
Sbjct  66    QLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVIN  114

Query  2047  EFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E   QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   EMLLQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  160



>ref|XP_006408683.1| hypothetical protein EUTSA_v10001928mg [Eutrema salsugineum]
 dbj|BAJ33802.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50136.1| hypothetical protein EUTSA_v10001928mg [Eutrema salsugineum]
Length=655

 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 106/159 (67%), Gaps = 7/159 (4%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ ++ LK+T E K
Sbjct  460   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHSDKLKQTGESK  519

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K        +   G TWA E+ +++++CP+VVEDL  P    +E+LC+++GFFLEI D
Sbjct  520   IMK-----EEGAFGGGATWAFEVGSKSLVCPIVVEDLNPPRIFQVEMLCEQRGFFLEIAD  574

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EAN  V+R E
Sbjct  575   WIRSLGLTILKGVIETRTDKIWARFTV--EANRDVTRME  611


 Score = 86.7 bits (213),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/167 (33%), Positives = 84/167 (50%), Gaps = 34/167 (20%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE---------------------EE  2225
             +  L+S+C  N WSYAVFW    QNS  L   + Y E                     E+
Sbjct  6     REALRSMCVNNQWSYAVFWKIGCQNSSLLIWEECYNETASTSSVPRRGSGLGIDTQGNEK  65

Query  2224  MGGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDD  2051
             +  L + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  
Sbjct  66    VQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVI  114

Query  2050  SEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             +E   QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   NEMLLQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  161



>ref|XP_002309084.1| hypothetical protein POPTR_0006s09100g [Populus trichocarpa]
 gb|EEE92607.1| hypothetical protein POPTR_0006s09100g [Populus trichocarpa]
Length=708

 Score =   154 bits (388),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 102/151 (68%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL QTIK + +L+SVT  AE L++   +E
Sbjct  529   KPRPRDRQLIQDRVKELRELVPNGSKCSIDGLLDQTIKHMQYLRSVTDQAEKLRQWVHQE  588

Query  844   LKDKKGRKDSNSNSNT-NGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             + D+K  + S +N N  +G +WA E  N   ICP+VVEDL  PG +LIE+LC ++G FLE
Sbjct  589   VADRKNCRLSETNVNIQSGKSWAFEFGNDLQICPIVVEDLAYPGHLLIEMLCNDRGVFLE  648

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R +  WAHFIVE
Sbjct  649   IAQVIRSLDLTILKGVMESRLSNTWAHFIVE  679


 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/186 (28%), Positives = 80/186 (43%), Gaps = 46/186 (25%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------  2231
             T  + LL+SLC  + W YAV W     + + LT  D Y++                    
Sbjct  4     TDLRQLLESLCNNSDWKYAVLWKMRYGSPMILTWEDGYFDCPKPREPLQTISSDVYCNGG  63

Query  2230  --------------EEMGG-----LIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
                              GG     ++ DML     LG GVVG+VA+T +H W+    N++
Sbjct  64    NDLASSLRDASASNANFGGHQIELVVADMLHLQYPLGEGVVGEVAYTGDHFWL--SFNNI  121

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
             +       +    L+ +   E+  QF+ GIKTI ++ V P GV+Q GS  ++ E ++ V 
Sbjct  122   FS-----CEMSKNLVPEFPEEWLLQFASGIKTILLVPVLPHGVLQLGSFDEVAEDIQIVA  176

Query  1927  ETKKLF  1910
               K  F
Sbjct  177   YIKGRF  182



>gb|KDO48150.1| hypothetical protein CISIN_1g005301mg [Citrus sinensis]
Length=691

 Score =   152 bits (385),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL +TI+ +L+L+SVT  AE L +    E
Sbjct  524   KPRPRDRQLIQDRIKELRELVPNGVKCSIDCLLGRTIEHMLYLRSVTDQAEKLNQWVHRE  583

Query  844   LKDKKGRKDSNSNS-NTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S +N    NG TWA E+ N+ + CP+VVEDL  PG MLIE+LC EQ  FLE
Sbjct  584   VAARKDLRSSETNDGKQNGTTWAFEVGNELLACPIVVEDLSYPGHMLIEMLCNEQSLFLE  643

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R    WAHFIVE
Sbjct  644   IAQVIRSLELTILKGVMENRCNNTWAHFIVE  674


 Score = 68.6 bits (166),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 84/338 (25%), Positives = 129/338 (38%), Gaps = 65/338 (19%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----EEMGGLIDDM-----  2201
             T  + LLKS C    W+YAV W    +  + L+  D Y +     E +G + +D+     
Sbjct  4     TALRQLLKSFCYNLPWNYAVLWKLKLEGQMILSWEDGYCDHLKPREPLGIMSEDIYHNGA  63

Query  2200  -----------------------LLQVNI------LGSGVVGQVAFTKNHKWMLSDTNSV  2108
                                    L+  N+      LG GVVG+VA +  H W+  D  S 
Sbjct  64    NELFSTHSETSAGDGGFEGYSIGLVLANMSHLQYALGEGVVGEVANSGTHFWVSYDDVST  123

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
              + +  L   C +       E+  Q + GIKTI ++ V P GVVQ GS Q + E +  V 
Sbjct  124   TKVNSKLVPKCPD-------EWLLQLASGIKTILLVPVLPHGVVQLGSLQVIAEDVAVVA  176

Query  1927  ETKKLF-----QGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDF  1763
               K  F     + T +  +     + S++    GL  SL     ++   +  E   + D 
Sbjct  177   GIKDRFIHNAWRNTVLSILNRDIRTKSSSTLTSGLMDSLDEPSASTISQLKSEDSDAVDS  236

Query  1762  VDPIMNMVQSF-PVEAFSLFDDQFQNGGVETQTNFSSYGFQPSCSSVWGL------EGSS  1604
             V P   ++ +F P+       D  +    +    F S           GL      +G S
Sbjct  237   VKPNKVLLSTFDPILPVETLQDALRGSVKDLSGTFRSESENKIAVPSLGLSEASKSQGHS  296

Query  1603  LTSLQGNILP-----GAISQDCDNAFCALPDQFEYCTN  1505
             L + Q  ++      GA+S  C  A    P Q E C N
Sbjct  297   LFAGQWEMMEREFSGGAMS--CYPASMEQPFQHEICNN  332



>ref|XP_010510794.1| PREDICTED: transcription factor LHW-like isoform X2 [Camelina 
sativa]
Length=588

 Score =   151 bits (382),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 107/162 (66%), Gaps = 16/162 (10%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE--  845
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ LK T E  
Sbjct  400   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKLKHTGESK  459

Query  844   -LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              LK++ G           G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLE
Sbjct  460   ILKEEGG-----------GATWAFEVGSKSMVCPIVVEDVNPPRIFQVEMLCEQRGFFLE  508

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  509   IADWIRSLGLTILKGVIETRIDKIWARFTV--EASRDVTRME  548


 Score = 60.8 bits (146),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 55/95 (58%), Gaps = 11/95 (12%)
 Frame = -1

Query  2194  QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIK  2015
             ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +E   QFS GI+
Sbjct  6     RIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVINEMLLQFSAGIQ  54

Query  2014  TIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  55    TVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKALI  89



>ref|XP_006493563.1| PREDICTED: transcription factor EMB1444-like [Citrus sinensis]
Length=730

 Score =   152 bits (385),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL +TI+ +L+L+SVT  AE L +    E
Sbjct  551   KPRPRDRQLIQDRIKELRELVPNGVKCSIDCLLGRTIEHMLYLRSVTDQAEKLNQWVHRE  610

Query  844   LKDKKGRKDSNSNS-NTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S +N    NG TWA E+ N+ + CP+VVEDL  PG MLIE+LC EQ  FLE
Sbjct  611   VAARKDLRSSETNDGKQNGTTWAFEVGNELLACPIVVEDLSYPGHMLIEMLCNEQSLFLE  670

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R    WAHFIVE
Sbjct  671   IAQVIRSLELTILKGVMENRCNNTWAHFIVE  701


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 67/260 (26%), Positives = 104/260 (40%), Gaps = 55/260 (21%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----EEMGGLIDDM-----  2201
             T  + LLKS C    W+YAV W    +  + L+  D Y +     + +G + +D+     
Sbjct  4     TALRQLLKSFCYNLPWNYAVLWKLKLEGQMILSWEDGYCDHLKPRQPLGIMSEDIYHNGA  63

Query  2200  -----------------------LLQVNI------LGSGVVGQVAFTKNHKWMLSDTNSV  2108
                                    L+  N+      LG GVVG+VA +  H W+  D  S 
Sbjct  64    NELFSTRSETSAGDGGFEGYSIGLVLANMSHLQYALGEGVVGEVANSGTHFWVSYDDVST  123

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
              + +  L   C +       E+  Q + GIKTI ++ V P GVVQ GS Q + E +  V 
Sbjct  124   TKVNSKLVPKCPD-------EWLLQLASGIKTILLVPVLPHGVVQLGSLQVIAEDVAVVA  176

Query  1927  ETKKLF-----QGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDF  1763
               K  F     + T +  +     + S++    GL  SL     ++   +  E   + D 
Sbjct  177   GIKDRFIHNAWRNTVLSILNRDIRTKSSSTLTSGLMDSLDEPSASTISQLKSEDSDAVDS  236

Query  1762  VDPIMNMVQSF----PVEAF  1715
             V P   +V +F    PVE  
Sbjct  237   VKPNKVLVSTFDPILPVETL  256



>gb|KDO48148.1| hypothetical protein CISIN_1g005301mg [Citrus sinensis]
 gb|KDO48149.1| hypothetical protein CISIN_1g005301mg [Citrus sinensis]
Length=703

 Score =   152 bits (385),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL +TI+ +L+L+SVT  AE L +    E
Sbjct  524   KPRPRDRQLIQDRIKELRELVPNGVKCSIDCLLGRTIEHMLYLRSVTDQAEKLNQWVHRE  583

Query  844   LKDKKGRKDSNSNS-NTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S +N    NG TWA E+ N+ + CP+VVEDL  PG MLIE+LC EQ  FLE
Sbjct  584   VAARKDLRSSETNDGKQNGTTWAFEVGNELLACPIVVEDLSYPGHMLIEMLCNEQSLFLE  643

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R    WAHFIVE
Sbjct  644   IAQVIRSLELTILKGVMENRCNNTWAHFIVE  674


 Score = 68.9 bits (167),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 84/338 (25%), Positives = 129/338 (38%), Gaps = 65/338 (19%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----EEMGGLIDDM-----  2201
             T  + LLKS C    W+YAV W    +  + L+  D Y +     E +G + +D+     
Sbjct  4     TALRQLLKSFCYNLPWNYAVLWKLKLEGQMILSWEDGYCDHLKPREPLGIMSEDIYHNGA  63

Query  2200  -----------------------LLQVNI------LGSGVVGQVAFTKNHKWMLSDTNSV  2108
                                    L+  N+      LG GVVG+VA +  H W+  D  S 
Sbjct  64    NELFSTHSETSAGDGGFEGYSIGLVLANMSHLQYALGEGVVGEVANSGTHFWVSYDDVST  123

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
              + +  L   C +       E+  Q + GIKTI ++ V P GVVQ GS Q + E +  V 
Sbjct  124   TKVNSKLVPKCPD-------EWLLQLASGIKTILLVPVLPHGVVQLGSLQVIAEDVAVVA  176

Query  1927  ETKKLF-----QGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDF  1763
               K  F     + T +  +     + S++    GL  SL     ++   +  E   + D 
Sbjct  177   GIKDRFIHNAWRNTVLSILNRDIRTKSSSTLTSGLMDSLDEPSASTISQLKSEDSDAVDS  236

Query  1762  VDPIMNMVQSF-PVEAFSLFDDQFQNGGVETQTNFSSYGFQPSCSSVWGL------EGSS  1604
             V P   ++ +F P+       D  +    +    F S           GL      +G S
Sbjct  237   VKPNKVLLSTFDPILPVETLQDALRGSVKDLSGTFRSESENKIAVPSLGLSEASKSQGHS  296

Query  1603  LTSLQGNILP-----GAISQDCDNAFCALPDQFEYCTN  1505
             L + Q  ++      GA+S  C  A    P Q E C N
Sbjct  297   LFAGQWEMMEREFSGGAMS--CYPASMEQPFQHEICNN  332



>gb|KDO48153.1| hypothetical protein CISIN_1g005301mg [Citrus sinensis]
Length=570

 Score =   151 bits (381),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL +TI+ +L+L+SVT  AE L +    E
Sbjct  391   KPRPRDRQLIQDRIKELRELVPNGVKCSIDCLLGRTIEHMLYLRSVTDQAEKLNQWVHRE  450

Query  844   LKDKKGRKDSNSN-SNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S +N    NG TWA E+ N+ + CP+VVEDL  PG MLIE+LC EQ  FLE
Sbjct  451   VAARKDLRSSETNDGKQNGTTWAFEVGNELLACPIVVEDLSYPGHMLIEMLCNEQSLFLE  510

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R    WAHFIVE
Sbjct  511   IAQVIRSLELTILKGVMENRCNNTWAHFIVE  541



>ref|NP_565640.1| transcription factor LHW [Arabidopsis thaliana]
 ref|NP_001031430.1| transcription factor LHW [Arabidopsis thaliana]
 sp|Q9XIN0.1|LHW_ARATH RecName: Full=Transcription factor LHW; AltName: Full=BHLH transcription 
factor delta; Short=bHLH delta; AltName: Full=Basic 
helix-loop-helix protein 156; Short=AtbHLH156; Short=bHLH 
156; AltName: Full=Protein LONESOME HIGHWAY; AltName: Full=bHLH 
transcription factor bHLH156 [Arabidopsis thaliana]
 gb|AAD42006.1| expressed protein [Arabidopsis thaliana]
 emb|CAE09170.1| bHLH transcription factor [Arabidopsis thaliana]
 dbj|BAH30404.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07959.1| transcription factor LHW [Arabidopsis thaliana]
 gb|AEC07960.1| transcription factor LHW [Arabidopsis thaliana]
Length=650

 Score =   152 bits (383),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 106/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ ++ LK+T E K
Sbjct  462   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHSDKLKQTGESK  521

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K         +  G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  522   IMK--------EDGGGATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLEIAD  573

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  574   WIRSLGLTILKGVIETRVDKIWARFTV--EASRDVTRME  610


 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 84/166 (51%), Gaps = 33/166 (20%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------EEM  2222
             +  L+S+C  N WSYAVFW    QNS  L   + Y E                    E++
Sbjct  6     REALRSMCVNNQWSYAVFWKIGCQNSSLLIWEECYNETESSSNPRRLCGLGVDTQGNEKV  65

Query  2221  GGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDS  2048
               L + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +
Sbjct  66    QLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVIN  114

Query  2047  EFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E   QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   EMLLQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  160



>ref|XP_002533696.1| basic helix-loop-helix-containing protein, putative [Ricinus 
communis]
 gb|EEF28691.1| basic helix-loop-helix-containing protein, putative [Ricinus 
communis]
Length=740

 Score =   152 bits (385),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             R  P+DR    ER+ ELREL+PNG K SID LL +TIK +++L+SVT  AE L+    +E
Sbjct  561   RQRPRDRQLIQERVKELRELVPNGAKCSIDGLLDRTIKHMMYLRSVTDQAEKLRHCLHQE  620

Query  844   LKDKKGRKDSNSNSN-TNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             L   K  + S +  N  NG +WA E+ N+  +CP+ VEDL  PG MLIE+LC E G FLE
Sbjct  621   LAGCKNWRPSETEENYQNGTSWAFELGNEFQVCPIAVEDLAYPGHMLIEMLCDEHGLFLE  680

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IRG GL ILKG ++ R +  WA F+VE
Sbjct  681   IAQVIRGLGLTILKGVLKSRSSNTWARFVVE  711


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 78/186 (42%), Gaps = 48/186 (26%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY---------------------  2234
             T  + LLKSLC  + W+YAV W     + + LT  D Y+                     
Sbjct  4     TALRQLLKSLCSNSTWNYAVLWKLRHGSPMILTWEDGYFNYSKSRELVGTISDDVYGKGA  63

Query  2233  ------------------EEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSV  2108
                               E  +G ++ DM     I G GVVG+VA  ++H W+       
Sbjct  64    SDLISPQVETNTSRGISEEYPVGLVVADMSHLQYIFGEGVVGKVAALRDHCWV-------  116

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
               S H +     EL+ +   E+  QF+ GIKTI ++ V P GV+Q GS +++ E +  V 
Sbjct  117   --SFHHIFTGKSELIPECPEEWLLQFASGIKTILLVPVLPYGVLQLGSLEEVAEDVSIVA  174

Query  1927  ETKKLF  1910
               K  F
Sbjct  175   YIKYRF  180



>gb|EMT30797.1| Putative basic helix-loop-helix protein [Aegilops tauschii]
Length=887

 Score =   153 bits (387),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 108/162 (67%), Gaps = 4/162 (2%)
 Frame = -1

Query  1021  TRPIPKDRVRTYERLAELRELIPNGGKM-SIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE  845
             ++  PKDR    +R+ ELRE++PNG K  SID LL +T+K +LFLQSVT+ A+ LK + E
Sbjct  684   SKARPKDRQLIQDRIKELREMVPNGAKQCSIDALLEKTVKHMLFLQSVTKHADKLKDSTE  743

Query  844   LKDKKGRKDSN-SNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              K           +    G TWA ++ +Q+M CP++VEDL  P QML+E++C+++G FLE
Sbjct  744   SKILGSENGPVWKDYFEGGATWAFDVGSQSMTCPIIVEDLDRPRQMLVEMICEDRGIFLE  803

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D I+G GL IL+G ME R++KIWA F V  EAN  V+R E
Sbjct  804   IADFIKGLGLTILRGVMEARKSKIWARFTV--EANRDVTRME  843


 Score = 76.6 bits (187),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 81/173 (47%), Gaps = 37/173 (21%)
 Frame = -1

Query  2308  GWSYAVFWGFNQQNS-LFLTLRDAY---------------YEEEMG--GLID--------  2207
             G SYAVFW  +   + + L   D Y                  E+G    +D        
Sbjct  15    GCSYAVFWKASGAAAPVHLVWEDGYCGHTPCPAGSEASQARATELGCSAAVDSICSLVRK  74

Query  2206  DMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFS  2027
             DM  QV+++G G +G+VAFT +H+W++          HG AD+   L  +  SE + QF 
Sbjct  75    DMAQQVHVVGEGTIGRVAFTGSHQWII----------HGTADD-HGLSSEVASEMHYQFI  123

Query  2026  CGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIETIFAQSSS  1868
              GIKTIA+I V P GV+Q GS   + E   FV   KKL    +  +  A S+S
Sbjct  124   AGIKTIAIIPVLPRGVLQLGSTGVVMENTSFVMHAKKLCSQLNQRSSMAASAS  176



>ref|XP_002986361.1| hypothetical protein SELMODRAFT_157919 [Selaginella moellendorffii]
 gb|EFJ12570.1| hypothetical protein SELMODRAFT_157919 [Selaginella moellendorffii]
Length=226

 Score =   144 bits (362),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR +  +R+ ELR+++PN  K SID LL +TI+ + FLQSVT+  +  K   ++K
Sbjct  14    RPRPKDRQQIQDRVRELRDIVPNATKCSIDALLEKTIRHMKFLQSVTQHGDKWKAGGDVK  73

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
              +  R   NS+   NG +WA E++ +    P++VE+L  P QML+E+LC+E+G F EI D
Sbjct  74    GE--RSAENSSGLENGASWAMELDAKGSGVPILVENLKQPRQMLVEMLCEERGLFWEIAD  131

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
              IRG GL ILKG ME R  KIWA F VE  A   V+R
Sbjct  132   NIRGLGLTILKGVMESRNDKIWARFNVEVHAAKEVNR  168



>dbj|BAH19848.1| AT2G27230 [Arabidopsis thaliana]
Length=650

 Score =   151 bits (382),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 106/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ ++ LK+T E K
Sbjct  462   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHSDELKQTGESK  521

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K         +  G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  522   IMK--------EDGGGATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLEIAD  573

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  574   WIRSLGLTILKGVIETRVDKIWARFTV--EASRDVTRME  610


 Score = 86.7 bits (213),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 84/166 (51%), Gaps = 33/166 (20%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------EEM  2222
             +  L+S+C  N WSYAVFW    QNS  L   + Y E                    E++
Sbjct  6     REALRSMCVNNQWSYAVFWKIGCQNSSLLIWEECYNETESSSNPRRLCGLGVDTQGNEKV  65

Query  2221  GGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDS  2048
               L + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +
Sbjct  66    QLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVIN  114

Query  2047  EFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E   QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   EMLLQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  160



>ref|XP_010417875.1| PREDICTED: transcription factor LHW-like [Camelina sativa]
Length=659

 Score =   151 bits (382),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 103/159 (65%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ LK T E K
Sbjct  471   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKLKHTGESK  530

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K            G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  531   IMK--------EEGGGATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLEIAD  582

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA   V+R E
Sbjct  583   WIRSLGLTILKGVIETRIDKIWARFTV--EATRDVTRME  619


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 81/163 (50%), Gaps = 33/163 (20%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY-------YEEEMGGL-------------  2213
             L+S+C  N W YAVFW    QNS  L   + Y       +   + GL             
Sbjct  9     LRSMCVNNQWCYAVFWKIGCQNSSLLIWEECYNDTASSSHPRRVSGLGIDAQGNDKVQLL  68

Query  2212  IDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFY  2039
              + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +E  
Sbjct  69    TNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVINEML  117

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  118   LQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  160



>ref|XP_010510793.1| PREDICTED: transcription factor LHW-like isoform X1 [Camelina 
sativa]
Length=659

 Score =   151 bits (382),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/162 (50%), Positives = 107/162 (66%), Gaps = 16/162 (10%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE--  845
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ LK T E  
Sbjct  471   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKLKHTGESK  530

Query  844   -LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              LK++ G           G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLE
Sbjct  531   ILKEEGG-----------GATWAFEVGSKSMVCPIVVEDVNPPRIFQVEMLCEQRGFFLE  579

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  580   IADWIRSLGLTILKGVIETRIDKIWARFTV--EASRDVTRME  619


 Score = 82.8 bits (203),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 81/163 (50%), Gaps = 33/163 (20%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY-------YEEEMGGL-------------  2213
             L+S+C  N W YAVFW    QNS  L   + Y       +   + GL             
Sbjct  9     LRSMCVNNQWCYAVFWKIGCQNSSLLIWEECYNDTASSSHPRRVSGLGIDAQGNDKVQLL  68

Query  2212  IDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFY  2039
              + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +E  
Sbjct  69    TNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVINEML  117

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  118   LQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKALI  160



>ref|XP_002879076.1| hypothetical protein ARALYDRAFT_481620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55335.1| hypothetical protein ARALYDRAFT_481620 [Arabidopsis lyrata subsp. 
lyrata]
Length=656

 Score =   151 bits (381),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 106/159 (67%), Gaps = 10/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ ++ LK+T E K
Sbjct  468   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHSDKLKQTGESK  527

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K         +  G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLEI +
Sbjct  528   IMK--------EDGGGATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLEIAE  579

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  G+ ILKG +E R  KIWA F V  EAN  V+R E
Sbjct  580   WIRSLGMTILKGVIETRLDKIWARFTV--EANRDVTRME  616


 Score = 86.7 bits (213),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 84/166 (51%), Gaps = 33/166 (20%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE--------------------EEM  2222
             +  L+S+C  N WSYAVFW    QNS  L   + Y E                    E++
Sbjct  6     REALRSMCVNNQWSYAVFWKIGCQNSSLLIWEECYNETASSSNPRRLCGLGVDTQGNEKV  65

Query  2221  GGLIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDS  2048
               L + M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +
Sbjct  66    QLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVIN  114

Query  2047  EFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             E   QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   EMLLQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  160



>ref|XP_006429166.1| hypothetical protein CICLE_v10011164mg [Citrus clementina]
 gb|ESR42406.1| hypothetical protein CICLE_v10011164mg [Citrus clementina]
Length=730

 Score =   151 bits (382),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 99/151 (66%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             +P P+DR    +R+ ELREL+PNG K SID LL +TI+ +L+L+SVT  AE L +    E
Sbjct  551   KPRPRDRQLIQDRIKELRELVPNGVKCSIDCLLGRTIEHMLYLRSVTDQAEKLNQWVHRE  610

Query  844   LKDKKGRKDSNSNS-NTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S +N    NG TWA E+ N+ + CP+VVEDL  PG MLIE+LC EQ  FLE
Sbjct  611   VAARKDLRSSETNDGKQNGTTWAFEVGNELLACPIVVEDLSYPGHMLIEMLCNEQCLFLE  670

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR   L ILKG ME R    WAHFIVE
Sbjct  671   IAQVIRSLELTILKGVMENRCNNTWAHFIVE  701


 Score = 66.6 bits (161),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 67/260 (26%), Positives = 104/260 (40%), Gaps = 55/260 (21%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----EEMGGLIDDM-----  2201
             T  + LLKS C    W+YAV W    +  + L+  D Y +     + +G + +D+     
Sbjct  4     TALRQLLKSFCYNLPWNYAVLWKLKLEGQMILSWEDGYCDHLKPRQPLGIMSEDIYHNGA  63

Query  2200  -----------------------LLQVNI------LGSGVVGQVAFTKNHKWMLSDTNSV  2108
                                    L+  N+      LG GVVG+VA +  H W+  D  S 
Sbjct  64    NELFSTRSETSAGDGGFEGYSIGLVLANMSHLQYALGEGVVGEVANSGTHFWVSYDDVST  123

Query  2107  WQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVD  1928
              + +  L   C +       E+  Q + GIKTI ++ V P GVVQ GS Q + E +  V 
Sbjct  124   TKVNSKLVPKCPD-------EWLLQLASGIKTILLVPVLPHGVVQLGSLQVIAEDVAVVA  176

Query  1927  ETKKLF-----QGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDF  1763
               K  F     + T +  +     + S++    GL  SL     ++   +  E   + D 
Sbjct  177   GIKDRFIHNAWRNTVLSILNRDIRTKSSSTLTSGLMDSLDEPSASTISQLKSEDSDAVDS  236

Query  1762  VDPIMNMVQSF----PVEAF  1715
             V P   +V +F    PVE  
Sbjct  237   VKPNKVLVSTFDPILPVETL  256



>emb|CDX71466.1| BnaC04g17010D [Brassica napus]
Length=574

 Score =   150 bits (378),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 107/159 (67%), Gaps = 9/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ +K+TE   
Sbjct  378   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKVKQTE--G  435

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
             + K  K+        G TWA E+ +++++CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  436   ESKIMKEEG-----GGATWAFEVGSKSLMCPIVVEDITPPRIFQVEMLCEQRGFFLEIAD  490

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA+  VSR E
Sbjct  491   WIRSLGLTILKGVIETRVDKIWARFTV--EASRDVSRME  527


 Score = 63.9 bits (154),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 68/125 (54%), Gaps = 17/125 (14%)
 Frame = -1

Query  2260  FLTLRDAYYEEEMGG------LIDDMLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVW  2105
              L   + Y E  + G      L + M+L  ++ ++G G+VG+ AFT +H+W+L+      
Sbjct  5     LLIWEECYNETSVSGNENVQLLTNRMMLNNRIILVGEGLVGRAAFTGHHQWILAA-----  59

Query  2104  QSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDE  1925
              S +    +  E++    +E   QFS GI+T+AVI V P GVVQ GS+  + E + FV+E
Sbjct  60    DSFNRGGVHPPEVI----NEMLLQFSAGIQTVAVIPVVPHGVVQLGSSLPIMENLGFVNE  115

Query  1924  TKKLF  1910
              K L 
Sbjct  116   VKGLI  120



>ref|XP_010473116.1| PREDICTED: transcription factor LHW [Camelina sativa]
Length=660

 Score =   150 bits (380),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 106/162 (65%), Gaps = 16/162 (10%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEE--  845
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ LK T E  
Sbjct  472   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKLKHTGESN  531

Query  844   -LKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
              +K++ G           G TWA E+ +++M+CP+VVED+  P    +E+LC+++GFFLE
Sbjct  532   IMKEEGG-----------GATWAFEVGSKSMVCPIVVEDINPPRIFQVEMLCEQRGFFLE  580

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             I D IR  GL ILKG +E R  KIWA F V  EA   V+R E
Sbjct  581   IADWIRSLGLTILKGVIETRIDKIWARFTV--EATRDVTRME  620


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/163 (33%), Positives = 81/163 (50%), Gaps = 33/163 (20%)
 Frame = -1

Query  2332  LKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY-------YEEEMGGLIDD----------  2204
             L+S+C  N W YAVFW    QNS  L   + Y       +   + GL  D          
Sbjct  9     LRSMCVNNQWCYAVFWKIGCQNSSLLIWEECYNDTASSSHPRRVSGLGIDAQGNDKVQLL  68

Query  2203  ---MLL--QVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFY  2039
                M+L  ++ ++G G+VG+ AFT +H+W+L+++            N D    +  +E  
Sbjct  69    TNRMMLNNRIILVGEGLVGRAAFTGHHQWILANSF-----------NRDVHPPEVINEML  117

Query  2038  GQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              QFS GI+T+AV  V P GVVQ GS+  + E + FV++ K L 
Sbjct  118   LQFSAGIQTVAVFPVVPHGVVQLGSSLPIMENLGFVNDVKGLI  160



>ref|XP_006391596.1| hypothetical protein EUTSA_v10023398mg [Eutrema salsugineum]
 gb|ESQ28882.1| hypothetical protein EUTSA_v10023398mg [Eutrema salsugineum]
Length=546

 Score =   149 bits (376),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 119/191 (62%), Gaps = 16/191 (8%)
 Frame = -1

Query  1108  IGENCSTNVMNTKD--HEkpskavkkkakPGTRPIPKDRVRTYERLAELRELIPNGGKMS  935
             I E+ S+   N K   HE+  K  + KA    RP PKDR    +R+ ELR +IPNG K S
Sbjct  346   IDEDRSSVAGNWKKQPHEEGVKKKRAKAGESRRPRPKDRQMIQDRIKELRGMIPNGAKCS  405

Query  934   IDRLLHQTIKQLLFLQSVTRLAEGLKKTEELKDKKGRKDSNSNSNTNGVTWACEI-ENQT  758
             ID LL  TI+ +LF+QS+ + A+ LK+  E K  K           N  TWA E+ E+++
Sbjct  406   IDTLLDLTIRHMLFMQSIAKYADKLKQPYEPKLVK----------ENERTWALEVGEDES  455

Query  757   MICPLVVEDLCTPGQMLIEILCQEQG-FFLEIVDIIRGFGLNILKGTMELRETKIWAHFI  581
             ++CP++VEDL   GQM IE++C+E G  FLEI D++R  GLNILKG ME R+ +IWAHFI
Sbjct  456   VVCPIIVEDLKPQGQMQIEMVCEETGERFLEIADVVRNLGLNILKGVMETRQGQIWAHFI  515

Query  580   VEPEANAFVSR  548
             V  EA   V+R
Sbjct  516   V--EAKPHVTR  524


 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 79/146 (54%), Gaps = 34/146 (23%)
 Frame = -1

Query  2344  AKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY-YEEEMGGLIDDMLLQV--NILGS  2174
              K +LKSLC  +GWSYAVFWG++  N + L  ++A+ Y+E    L DDM+LQ   +ILG 
Sbjct  5     VKQILKSLCFSHGWSYAVFWGYDPINPMLLRFKEAHKYDEASAALADDMILQAHDHILGQ  64

Query  2173  GVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISV  1994
             G+VG+ A T N++W+ SDT                L Q               TIA+I V
Sbjct  65    GIVGEAALTGNYRWLFSDT----------------LFQ---------------TIAIIPV  93

Query  1993  EPLGVVQFGSNQKLPERMEFVDETKK  1916
                GVVQ GS QK+ E  E +++T +
Sbjct  94    GSSGVVQLGSTQKIVESPEMLEQTTR  119



>ref|XP_007026935.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 7, partial [Theobroma cacao]
 gb|EOY07437.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 7, partial [Theobroma cacao]
Length=713

 Score =   150 bits (378),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 96/157 (61%), Gaps = 3/157 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             RP P+DR    +RL ELREL+PNG K SID LL  T+K + +L SVT  AE LK+    E
Sbjct  503   RPRPRDRQMIQDRLKELRELVPNGDKHSIDALLDHTVKHMRYLSSVTNQAEKLKQWVHRE  562

Query  844   LKDKKGRKDSNS-NSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S S +    G +WA EI ++   CP+VVEDL  PG  LIE+LC E   FLE
Sbjct  563   VTVRKNMRSSESKDCYQMGASWAFEIGDELKACPIVVEDLAYPGHFLIEMLCNEHCLFLE  622

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAF  557
             I  +IR F L ILKG ME      WAHFIVEP  + +
Sbjct  623   IAQVIRSFNLTILKGVMESCSNNTWAHFIVEPAQHQY  659


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 76/188 (40%), Gaps = 44/188 (23%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY-------------------------  2237
             + LLKS C  + W YAV W    ++ + LT  D Y                         
Sbjct  7     RQLLKSFCSNSPWKYAVLWKLRHRSPMSLTWEDGYCVYPRPRESVESISSDVHSNSEIIP  66

Query  2236  --YEEEM----------GGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHH  2093
               +E  +          G ++ +M       G GVVG+VA+T  H W+  D     +++ 
Sbjct  67    SHFETSIHDGCFGGYPIGLVVANMSHLKYAWGEGVVGKVAYTGKHCWVSYDDIFTGKANS  126

Query  2092  GLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKL  1913
              L   C E       E+  QF+ GIKTI ++ V P GV Q GS + +PE +      K  
Sbjct  127   KLVPECPE-------EWLLQFASGIKTIVLVPVLPHGVFQLGSLEMVPEDLSTPAYIKDR  179

Query  1912  FQGTDIET  1889
             F   DI T
Sbjct  180   FSCKDIHT  187



>gb|KDP24564.1| hypothetical protein JCGZ_25128 [Jatropha curcas]
Length=711

 Score =   150 bits (378),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 98/150 (65%), Gaps = 3/150 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKT--EE  845
             RP P+DR    +R+ ELREL+PN GK SID LL +TIK +L+L++VT  AE LK+   +E
Sbjct  531   RPRPRDRQLIQDRVKELRELVPNSGKCSIDSLLDRTIKHMLYLRNVTDQAEKLKQCVHQE  590

Query  844   LKDKKGRKDSNSN-SNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             L   K    S +  +N  G +WA E+ N+  +CP++VEDL  PG MLIE+LC E G FLE
Sbjct  591   LAGCKNWSSSKTKQTNEKGTSWAFELGNEIQMCPILVEDLAFPGHMLIEMLCNENGLFLE  650

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIV  578
             I  +IRG  L ILKG +E R    WA FIV
Sbjct  651   IAQVIRGLDLTILKGVLENRSNDTWARFIV  680


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 88/211 (42%), Gaps = 58/211 (27%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRD-------------------AYY--  2234
             T  + LLKSLC  + W+YAV W  +  +   LT  D                   AYY  
Sbjct  4     TALRQLLKSLCNNSVWNYAVLWNLSHGSQRILTWEDGHFNPPNSREVAECITDDAAYYKD  63

Query  2233  -------------------EEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNS  2111
                                E  +G ++ +M+     +G GVVG+VAF+ +  W+    N+
Sbjct  64    AKDIFSRQFERNTSSGSSEEYRVGHVVANMMHLQYAMGEGVVGKVAFSGDPCWVC--LNN  121

Query  2110  VWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
             ++ +   L   C E       E+  QF+ GI+TI ++ V P  V+Q GS +++ E +  +
Sbjct  122   LFTNRARLIPECPE-------EWLLQFASGIQTILLVPVLPHRVLQLGSLEEVAEDINII  174

Query  1930  DETKKLFQGTDIETIFAQSSSSSANGDVFGL  1838
             +  K  F G           S S NG  F +
Sbjct  175   EYVKDRFNGLH---------SVSGNGGAFSI  196



>ref|XP_009785130.1| PREDICTED: transcription factor bHLH157-like [Nicotiana sylvestris]
Length=731

 Score =   149 bits (376),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 98/151 (65%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLK---KTE  848
             RP P+DR    +RL ELR+L+PNG K SID LLH+TIK +LFL+SVT  A+ L+   + +
Sbjct  552   RPRPRDRQLIQDRLKELRQLVPNGAKCSIDGLLHKTIKHMLFLRSVTDQADKLRCQAQKD  611

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
                DK  +      S+  G +WA E+ ++  ICP++V+DL  PG MLIE++C + G FLE
Sbjct  612   VDPDKSLQSPELKTSDQRGTSWALELGSEDQICPIIVKDLEYPGHMLIEMVCDDHGRFLE  671

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D+I    L ILKG ME R    WAHFIVE
Sbjct  672   IADVIHRLELTILKGVMEKRPESTWAHFIVE  702


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 69/175 (39%), Gaps = 45/175 (26%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYY------------------------  2234
             +  L+SLC    W+YAVFW    + +  LT  D Y                         
Sbjct  7     RHFLQSLCSKPPWNYAVFWKLQHEYAPILTWEDGYLDIPCAREPYRSLIGNYYNKTLNEL  66

Query  2233  --------------EEEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSH  2096
                           E  +G  + +M    ++ G GVVG+VA     +W+ SD+ +  +  
Sbjct  67    FPNCGSRSHNGKLGEHPIGLALVEMSSTYHVAGKGVVGEVASLCIPRWISSDSIAPAELS  126

Query  2095  HGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
              G    C +       E+  QF  GIKTI ++   P GV+Q GS + + E  E V
Sbjct  127   FGSVSECPD-------EWLLQFVAGIKTILLVPCIPHGVLQLGSMETVAENAEMV  174



>ref|XP_010256798.1| PREDICTED: transcription factor bHLH155-like isoform X1 [Nelumbo 
nucifera]
Length=733

 Score =   148 bits (374),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP P+DR    +R+ ELREL+P G K SID LL QT+K +LFL+SVT  +  L+     K
Sbjct  558   RPRPRDRQMIQDRVKELRELVPKGEKCSIDSLLDQTVKHILFLRSVTSQSNKLRHCMRPK  617

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G K+S  +   NG  W  ++ +Q  ICP+VVEDL  PG +LIE+LC E G FLEI  
Sbjct  618   -VSGWKNSKPSGTQNGTNWTFQMGSQLGICPIVVEDLDYPGHLLIEMLCDEHGLFLEIAQ  676

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVE  575
             +IR   L ILKG +E R  K WAHFIVE
Sbjct  677   VIRHLELTILKGVLENRSNKTWAHFIVE  704


 Score = 77.0 bits (188),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 99/236 (42%), Gaps = 57/236 (24%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------EEMGGL  2213
             + LL++LC  + W+YAVFW    QN + LT  D YY+                 +E  G+
Sbjct  7     RQLLRNLCLNSQWNYAVFWKLKHQNRMVLTWEDGYYDHPKLIEPIESISDNVCFKETDGI  66

Query  2212  ----------------------IDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQS  2099
                                   + DM  Q+ +LG G+VG+VA T  H W+ +   S    
Sbjct  67    KSFGCETNTSNGNSVGSPIELVVADMSCQLYLLGEGIVGKVASTAKHCWVYAGIESY---  123

Query  2098  HHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
                       L+ +   E+  QF+ GIKTI ++ V   GVVQ GS + + E +  V   K
Sbjct  124   ----------LVPEYPDEWSIQFAAGIKTILLVPVLH-GVVQLGSLEMVDEDLILVAHIK  172

Query  1918  KLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDFVDPI  1751
              +F    ++ +   S    +N D+     S  +S+        P A PS + + PI
Sbjct  173   DMF--NTLQYVGGTSLPLISNKDLLAFQSSPLTSLFLDK-LADPLAFPS-NMLKPI  224



>ref|XP_010256799.1| PREDICTED: transcription factor LHW-like isoform X2 [Nelumbo 
nucifera]
Length=698

 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP P+DR    +R+ ELREL+P G K SID LL QT+K +LFL+SVT  +  L+     K
Sbjct  523   RPRPRDRQMIQDRVKELRELVPKGEKCSIDSLLDQTVKHILFLRSVTSQSNKLRHCMRPK  582

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G K+S  +   NG  W  ++ +Q  ICP+VVEDL  PG +LIE+LC E G FLEI  
Sbjct  583   -VSGWKNSKPSGTQNGTNWTFQMGSQLGICPIVVEDLDYPGHLLIEMLCDEHGLFLEIAQ  641

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVE  575
             +IR   L ILKG +E R  K WAHFIVE
Sbjct  642   VIRHLELTILKGVLENRSNKTWAHFIVE  669


 Score = 77.4 bits (189),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/236 (27%), Positives = 99/236 (42%), Gaps = 57/236 (24%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------EEMGGL  2213
             + LL++LC  + W+YAVFW    QN + LT  D YY+                 +E  G+
Sbjct  7     RQLLRNLCLNSQWNYAVFWKLKHQNRMVLTWEDGYYDHPKLIEPIESISDNVCFKETDGI  66

Query  2212  ----------------------IDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQS  2099
                                   + DM  Q+ +LG G+VG+VA T  H W+ +   S    
Sbjct  67    KSFGCETNTSNGNSVGSPIELVVADMSCQLYLLGEGIVGKVASTAKHCWVYAGIESY---  123

Query  2098  HHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETK  1919
                       L+ +   E+  QF+ GIKTI ++ V   GVVQ GS + + E +  V   K
Sbjct  124   ----------LVPEYPDEWSIQFAAGIKTILLVPVLH-GVVQLGSLEMVDEDLILVAHIK  172

Query  1918  KLFQGTDIETIFAQSSSSSANGDVFGLSGSLASSICNSSYFMSPEALPSPDFVDPI  1751
              +F    ++ +   S    +N D+     S  +S+        P A PS + + PI
Sbjct  173   DMF--NTLQYVGGTSLPLISNKDLLAFQSSPLTSLFLDK-LADPLAFPS-NMLKPI  224



>ref|XP_010325716.1| PREDICTED: prf interactor 30137 isoform X2 [Solanum lycopersicum]
Length=705

 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 98/151 (65%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLK---KTE  848
             +P P+DR    +RL ELR+L+P+G K SID LL +TIK +LFL+SVT  A+ L+   +TE
Sbjct  526   KPRPRDRQLIQDRLKELRQLVPSGAKCSIDGLLDKTIKHMLFLRSVTDQADKLRFQAQTE  585

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
                DK  +     +SN  G +WA E+ +   ICP++V+DL  PG MLIE++C + G FLE
Sbjct  586   VAPDKNLQSPPIKSSNQQGTSWALELGSVDQICPIIVKDLEYPGHMLIEMMCDDHGRFLE  645

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D+I    L ILKG ME R    WAHFIVE
Sbjct  646   ISDVIHRLELTILKGVMEKRSESTWAHFIVE  676


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 71/175 (41%), Gaps = 45/175 (26%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             +  L+SLC  + W+YAVFW    Q  + LT  D Y +                       
Sbjct  7     RHFLESLCFKSPWNYAVFWKLQHQCPIILTWEDGYLDVPGAREPYRSQNGNYYSKNLSDL  66

Query  2230  ---------------EEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSH  2096
                              +G  + +M    +I G GVVG+VA     +W+ SD+ +  +  
Sbjct  67    SPNCGSRSHNGYLSAHSIGLAVAEMSSTYHIAGKGVVGEVASLGIPRWISSDSVAPAELG  126

Query  2095  HGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
              G    C +       ++  QF  GIKTI ++   P GV+Q GS + + E ME V
Sbjct  127   FGSVAECPD-------KWMLQFVAGIKTILLVPCIPYGVLQLGSVETVAENMEMV  174



>ref|XP_010325715.1| PREDICTED: prf interactor 30137 isoform X1 [Solanum lycopersicum]
Length=740

 Score =   148 bits (373),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 98/151 (65%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLK---KTE  848
             +P P+DR    +RL ELR+L+P+G K SID LL +TIK +LFL+SVT  A+ L+   +TE
Sbjct  561   KPRPRDRQLIQDRLKELRQLVPSGAKCSIDGLLDKTIKHMLFLRSVTDQADKLRFQAQTE  620

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
                DK  +     +SN  G +WA E+ +   ICP++V+DL  PG MLIE++C + G FLE
Sbjct  621   VAPDKNLQSPPIKSSNQQGTSWALELGSVDQICPIIVKDLEYPGHMLIEMMCDDHGRFLE  680

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D+I    L ILKG ME R    WAHFIVE
Sbjct  681   ISDVIHRLELTILKGVMEKRSESTWAHFIVE  711


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/175 (27%), Positives = 71/175 (41%), Gaps = 45/175 (26%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE-----------------------  2231
             +  L+SLC  + W+YAVFW    Q  + LT  D Y +                       
Sbjct  7     RHFLESLCFKSPWNYAVFWKLQHQCPIILTWEDGYLDVPGAREPYRSQNGNYYSKNLSDL  66

Query  2230  ---------------EEMGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSH  2096
                              +G  + +M    +I G GVVG+VA     +W+ SD+ +  +  
Sbjct  67    SPNCGSRSHNGYLSAHSIGLAVAEMSSTYHIAGKGVVGEVASLGIPRWISSDSVAPAELG  126

Query  2095  HGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFV  1931
              G    C +       ++  QF  GIKTI ++   P GV+Q GS + + E ME V
Sbjct  127   FGSVAECPD-------KWMLQFVAGIKTILLVPCIPYGVLQLGSVETVAENMEMV  174



>ref|XP_009112852.1| PREDICTED: transcription factor bHLH157-like [Brassica rapa]
Length=524

 Score =   145 bits (367),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 86/224 (38%), Positives = 135/224 (60%), Gaps = 19/224 (8%)
 Frame = -1

Query  1192  LSSTKKRRIEHPLASEREVTKLETIVSL-----IGENCSTNVMNTKDHEkpskavkkkak  1028
             L+ +K+R++++  +S   +T+ ET+  L     I E+ + N    ++     K  + KA 
Sbjct  291   LNQSKRRKLDNSTSSSFFMTQAETLTPLNPPMWIDEDMAGNWKKPQEEGVKKKKKRAKAG  350

Query  1027  PGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTE  848
                +P PKDR    +R+ ELR +IPNG K SID LL  TI+ ++F+QS+ + A+ LK+  
Sbjct  351   ESRKPRPKDRQMIQDRIKELRGMIPNGAKCSIDTLLDLTIRHMVFMQSIAKYADKLKQPY  410

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEI-ENQTMICPLVVEDLCTPGQMLIEILCQEQG-FF  674
             + K  K ++           TWA E+ ++++++CP++VEDL   GQM IE++CQE G  F
Sbjct  411   QPKLVKEKER----------TWALEVGDDESVVCPIIVEDLKPQGQMQIEMVCQENGDEF  460

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             LEI  ++RG GLNILKG M  R+ +IWAH IV  EA   ++R +
Sbjct  461   LEIAHVVRGLGLNILKGVMVTRQGRIWAHLIV--EAKPHITRRQ  502


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/164 (36%), Positives = 90/164 (55%), Gaps = 27/164 (16%)
 Frame = -1

Query  2344  AKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVV  2165
              K +LKSLC   GWSYAV+W  +  N + L + + + +E+   L+DDM+L+ ++LG G+V
Sbjct  6     VKQILKSLCFSYGWSYAVYWRSDPINPMLLRVEETHNDEQSATLVDDMILKTHVLGQGIV  65

Query  2164  GQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             G+ A T N++W+ SDT  + Q  H               EF  QF  G  +IA+I +   
Sbjct  66    GEAALTGNYQWLFSDT--LVQCEH---------------EFQNQFISGFTSIAIIPIGSS  108

Query  1984  GVVQFGSNQKLPERMEFVDETKKLF----------QGTDIETIF  1883
             GVVQ GS QK+ E  E ++ET++            Q  D++T+F
Sbjct  109   GVVQLGSTQKIVESREMLEETERALQEKHSLKVKDQSVDLDTLF  152



>ref|XP_009103583.1| PREDICTED: transcription factor LHW-like [Brassica rapa]
Length=599

 Score =   146 bits (369),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 106/159 (67%), Gaps = 9/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++  + +K+TE   
Sbjct  403   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHTDKVKQTE--G  460

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
             + K  K+        G TWA E+ +++++CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  461   ESKIMKEEGG-----GATWAFEVGSKSLMCPIVVEDINPPRIFQVEMLCEQRGFFLEIAD  515

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  516   WIRSLGLTILKGVIETRVDKIWARFTV--EASRDVTRME  552


 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 83/152 (55%), Gaps = 18/152 (12%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGG------LIDDMLL--QVN  2186
             K  L+S+C  N WSYAVFW    QNS  L   + Y E  + G      L + M+L  ++ 
Sbjct  6     KEALRSICVNNQWSYAVFWKIGCQNSSLLIWEECYNETSLSGNENVQLLTNRMMLNNRII  65

Query  2185  ILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIA  2006
             ++G G+VG+ AFT +H+W+L+D+ +    H     N          E   QFS GI+T+A
Sbjct  66    LVGEGLVGRAAFTGHHQWILADSFNRGGVHPPEVIN----------EMLLQFSAGIQTVA  115

Query  2005  VISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             V+ V P GVVQ GS+  + E + FV+E K L 
Sbjct  116   VVPVVPHGVVQLGSSFPIMENLGFVNEVKGLI  147



>ref|XP_010256801.1| PREDICTED: transcription factor bHLH155-like isoform X3 [Nelumbo 
nucifera]
Length=642

 Score =   147 bits (370),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/148 (51%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP P+DR    +R+ ELREL+P G K SID LL QT+K +LFL+SVT  +  L+     K
Sbjct  467   RPRPRDRQMIQDRVKELRELVPKGEKCSIDSLLDQTVKHILFLRSVTSQSNKLRHCMRPK  526

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
                G K+S  +   NG  W  ++ +Q  ICP+VVEDL  PG +LIE+LC E G FLEI  
Sbjct  527   -VSGWKNSKPSGTQNGTNWTFQMGSQLGICPIVVEDLDYPGHLLIEMLCDEHGLFLEIAQ  585

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVE  575
             +IR   L ILKG +E R  K WAHFIVE
Sbjct  586   VIRHLELTILKGVLENRSNKTWAHFIVE  613



>emb|CDY04483.1| BnaA07g13090D [Brassica napus]
Length=599

 Score =   146 bits (369),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 106/159 (67%), Gaps = 9/159 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++  + +K+TE   
Sbjct  403   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHTDKVKQTE--G  460

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
             + K  K+        G TWA E+ +++++CP+VVED+  P    +E+LC+++GFFLEI D
Sbjct  461   ESKIMKEEG-----GGATWAFEVGSKSLMCPIVVEDITPPRIFQVEMLCEQRGFFLEIAD  515

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  GL ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  516   WIRSLGLTILKGVIESRVDKIWARFTV--EASRDVTRME  552


 Score = 77.4 bits (189),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 82/152 (54%), Gaps = 18/152 (12%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGG------LIDDMLL--QVN  2186
             +  L+S+C  N WSYAVFW    QNS  L   + Y E    G      L + M+L  ++ 
Sbjct  6     REALRSICVNNQWSYAVFWKIGCQNSSLLIWEECYDETSPSGNENVQLLTNRMMLNNRII  65

Query  2185  ILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIA  2006
             ++G G+VG+ AFT +H+W+L+D+ +    H     N          E   QFS GI+T+A
Sbjct  66    LVGEGLVGRAAFTGHHQWILADSFNRGGVHPPEVIN----------EMLLQFSAGIQTVA  115

Query  2005  VISVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
             V+ V P GVVQ GS+  + E + FV+E K L 
Sbjct  116   VVPVVPHGVVQLGSSFPIMENLGFVNEVKGLI  147



>ref|XP_002988707.1| hypothetical protein SELMODRAFT_46989, partial [Selaginella moellendorffii]
 gb|EFJ10218.1| hypothetical protein SELMODRAFT_46989, partial [Selaginella moellendorffii]
Length=149

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 96/148 (65%), Gaps = 9/148 (6%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR +  +R+ ELR+++PN  K SID LL +TI+ + FLQSVT+  +  K   ++K
Sbjct  11    RPRPKDRQQIQDRVRELRDIVPNATKCSIDALLEKTIRHMKFLQSVTQHGDKWKAGGDVK  70

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               +GR         NG +WA E++ +    P++VE+L  P QML+E+LC+E+G F EI D
Sbjct  71    VNEGR---------NGASWAMELDAKGSGVPILVENLKQPRQMLVEMLCEERGLFWEIAD  121

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVE  575
              IRG GL ILKG ME R  KIWA F VE
Sbjct  122   NIRGLGLTILKGVMESRNDKIWARFNVE  149



>ref|XP_009112862.1| PREDICTED: transcription factor bHLH157-like [Brassica rapa]
Length=526

 Score =   145 bits (366),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 134/222 (60%), Gaps = 19/222 (9%)
 Frame = -1

Query  1192  LSSTKKRRIEHPLASEREVTKLETIVSL-----IGENCSTNVMNTKDHEkpskavkkkak  1028
             L+ +K+R++++  +S   +T+ ET+  L     I E+ + N    ++     K  + KA 
Sbjct  291   LNQSKRRKLDNSTSSSFFMTQAETLTPLNPPMWIDEDMAGNWKKPQEEGVKKKKKRAKAG  350

Query  1027  PGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTE  848
                +P PKDR    +R+ ELR +IPNG K SID LL  TI+ ++F+QS+ + A+ LK+  
Sbjct  351   ESRKPRPKDRQMIQDRIKELRGMIPNGAKCSIDTLLDLTIRHMVFMQSIAKYADKLKQPY  410

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEI-ENQTMICPLVVEDLCTPGQMLIEILCQEQG-FF  674
             + K  K ++           TWA E+ ++++++CP++VEDL   GQM IE++CQE G  F
Sbjct  411   QPKLVKEKER----------TWALEVGDDESVVCPIIVEDLKPQGQMQIEMVCQENGDEF  460

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             LEI  ++RG GLNILKG M  R+ +IWAH IV  EA   ++R
Sbjct  461   LEIAHVVRGLGLNILKGVMVTRQGRIWAHLIV--EAKPHITR  500


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 91/164 (55%), Gaps = 27/164 (16%)
 Frame = -1

Query  2344  AKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVV  2165
              K +LKSLC   GWSYAV+W  +  N + L + + + +E+   L+DDM+L+ ++LG G+V
Sbjct  6     VKQILKSLCFSYGWSYAVYWRSDPINPMLLRVEETHNDEQSATLVDDMILKTHVLGQGIV  65

Query  2164  GQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             G+ A T N++W+ SDT  + Q  H               EF  QF  G K+IA+I +   
Sbjct  66    GEAALTGNYQWLFSDT--LVQCEH---------------EFQNQFISGFKSIAIIPIGSS  108

Query  1984  GVVQFGSNQKLPERMEFVDETKKLF----------QGTDIETIF  1883
             GVVQ GS QK+ E  E ++ET++            Q  D++T+F
Sbjct  109   GVVQLGSTQKIVESREMLEETERALQEKHSLKVKDQSVDLDTLF  152



>ref|XP_007026936.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 8 [Theobroma cacao]
 gb|EOY07438.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 8 [Theobroma cacao]
Length=525

 Score =   145 bits (365),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             RP P+DR    +RL ELREL+PNG K SID LL  T+K + +L SVT  AE LK+    E
Sbjct  346   RPRPRDRQMIQDRLKELRELVPNGDKHSIDALLDHTVKHMRYLSSVTNQAEKLKQWVHRE  405

Query  844   LKDKKGRKDSNS-NSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S S +    G +WA EI ++   CP+VVEDL  PG  LIE+LC E   FLE
Sbjct  406   VTVRKNMRSSESKDCYQMGASWAFEIGDELKACPIVVEDLAYPGHFLIEMLCNEHCLFLE  465

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR F L ILKG ME      WAHFIVE
Sbjct  466   IAQVIRSFNLTILKGVMESCSNNTWAHFIVE  496



>emb|CDY53900.1| BnaA09g53070D [Brassica napus]
Length=526

 Score =   145 bits (365),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 86/222 (39%), Positives = 134/222 (60%), Gaps = 19/222 (9%)
 Frame = -1

Query  1192  LSSTKKRRIEHPLASEREVTKLETIVSL-----IGENCSTNVMNTKDHEkpskavkkkak  1028
             L+ +K+R++++  +S   +T+ ET+  L     I E+ + N    ++     K  + KA 
Sbjct  292   LNQSKRRKLDNSTSSSFFMTQAETLTPLNPPMWIDEDMAGNWKKPQEEGVKKKKKRAKAG  351

Query  1027  PGTRPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTE  848
                +P PKDR    +R+ ELR +IPNG K SID LL  TI+ ++F+QS+ + A+ LK+  
Sbjct  352   ESRKPRPKDRQMIQDRIKELRGMIPNGAKCSIDTLLDLTIRHVVFMQSIAKYADKLKQPY  411

Query  847   ELKDKKGRKDSNSNSNTNGVTWACEI-ENQTMICPLVVEDLCTPGQMLIEILCQEQG-FF  674
             + K  K ++           TWA E+ ++++++CP++VEDL   GQM IE++CQE G  F
Sbjct  412   QPKLVKEKER----------TWALEVGDDESVVCPIIVEDLKPQGQMQIEMVCQENGDEF  461

Query  673   LEIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSR  548
             LEI  ++RG GLNILKG M  R+ +IWAH IV  EA   ++R
Sbjct  462   LEIAHVVRGLGLNILKGVMVTRQGRIWAHLIV--EAKPHITR  501


 Score =   114 bits (285),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 91/164 (55%), Gaps = 27/164 (16%)
 Frame = -1

Query  2344  AKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNILGSGVV  2165
              K +LKSLC   GWSYAV+W  +  N + L + + + +E+   L+DDM+L+ ++LG G+V
Sbjct  5     VKQILKSLCFSYGWSYAVYWRSDPINPMLLRVEETHNDEQSATLVDDMILKTHVLGQGIV  64

Query  2164  GQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPL  1985
             G+ A T N++W+ SDT  + Q  H               EF  QF  G K+IA+I +   
Sbjct  65    GEAALTGNYQWLFSDT--LVQCEH---------------EFQNQFLSGFKSIAIIPIGSS  107

Query  1984  GVVQFGSNQKLPERMEFVDETKKLF----------QGTDIETIF  1883
             GVVQ GS QK+ E  E ++ET++            Q  D++T+F
Sbjct  108   GVVQLGSTQKIVESREMLEETERALQEKHSLKVKDQSVDLDTLF  151



>ref|XP_007026930.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 ref|XP_007026931.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 ref|XP_007026932.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 ref|XP_007026933.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07432.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07433.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07434.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY07435.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 2 [Theobroma cacao]
Length=650

 Score =   145 bits (367),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             RP P+DR    +RL ELREL+PNG K SID LL  T+K + +L SVT  AE LK+    E
Sbjct  471   RPRPRDRQMIQDRLKELRELVPNGDKHSIDALLDHTVKHMRYLSSVTNQAEKLKQWVHRE  530

Query  844   LKDKKGRKDSNS-NSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S S +    G +WA EI ++   CP+VVEDL  PG  LIE+LC E   FLE
Sbjct  531   VTVRKNMRSSESKDCYQMGASWAFEIGDELKACPIVVEDLAYPGHFLIEMLCNEHCLFLE  590

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR F L ILKG ME      WAHFIVE
Sbjct  591   IAQVIRSFNLTILKGVMESCSNNTWAHFIVE  621


 Score = 60.5 bits (145),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 55/112 (49%), Gaps = 7/112 (6%)
 Frame = -1

Query  2224  MGGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSE  2045
             +G ++ +M       G GVVG+VA+T  H W+  D     +++  L   C E       E
Sbjct  51    IGLVVANMSHLKYAWGEGVVGKVAYTGKHCWVSYDDIFTGKANSKLVPECPE-------E  103

Query  2044  FYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDETKKLFQGTDIET  1889
             +  QF+ GIKTI ++ V P GV Q GS + +PE +      K  F   DI T
Sbjct  104   WLLQFASGIKTIVLVPVLPHGVFQLGSLEMVPEDLSTPAYIKDRFSCKDIHT  155



>ref|XP_006341000.1| PREDICTED: transcription factor EMB1444-like [Solanum tuberosum]
Length=744

 Score =   146 bits (369),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 98/151 (65%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             +P P+DR    +RL ELR+L+P+G K SID LL +TIK +LFL+SVT  A+ LK   +++
Sbjct  565   KPRPRDRQLIQDRLKELRQLVPSGAKCSIDSLLDKTIKHMLFLRSVTNQADKLKFQSQIE  624

Query  838   ---DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
                DK  +     +SN  G +WA E+ +   ICP++V+DL  PG MLIE++C + G FLE
Sbjct  625   VDPDKSLQSPQVKSSNQQGTSWALELGSADQICPIIVKDLEYPGHMLIEMMCDDHGRFLE  684

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I D+I    L ILKG ME R    WAHFIVE
Sbjct  685   ISDVIHRLELTILKGVMEKRSESTWAHFIVE  715



>ref|XP_010262623.1| PREDICTED: transcription factor bHLH155-like isoform X2 [Nelumbo 
nucifera]
Length=708

 Score =   146 bits (368),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP P+DR    +R+ ELREL+PNG K SID LL QTIK +LFL+SV   A+ L +    K
Sbjct  532   RPRPRDRQMIQDRVKELRELVPNGAKFSIDALLDQTIKHMLFLRSVANQAKKLGQCMRPK  591

Query  838   DKKGRK-DSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIV  662
             +   +   S S S+ NG T   ++  Q   CP+VVEDL  PG MLIE+LC E G FLEI 
Sbjct  592   NIGCKNWKSGSQSHQNG-TRPFQMGTQLGACPIVVEDLDYPGHMLIEMLCDEHGLFLEIA  650

Query  661   DIIRGFGLNILKGTMELRETKIWAHFIVE  575
              +IR   L I+KG ME R  KIWAHFIVE
Sbjct  651   QVIRHLELTIIKGVMESRSNKIWAHFIVE  679



>ref|XP_007026929.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007026934.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07431.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY07436.1| Basic helix-loop-helix DNA-binding superfamily protein, putative 
isoform 1 [Theobroma cacao]
Length=682

 Score =   146 bits (368),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKK--TEE  845
             RP P+DR    +RL ELREL+PNG K SID LL  T+K + +L SVT  AE LK+    E
Sbjct  503   RPRPRDRQMIQDRLKELRELVPNGDKHSIDALLDHTVKHMRYLSSVTNQAEKLKQWVHRE  562

Query  844   LKDKKGRKDSNS-NSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLE  668
             +  +K  + S S +    G +WA EI ++   CP+VVEDL  PG  LIE+LC E   FLE
Sbjct  563   VTVRKNMRSSESKDCYQMGASWAFEIGDELKACPIVVEDLAYPGHFLIEMLCNEHCLFLE  622

Query  667   IVDIIRGFGLNILKGTMELRETKIWAHFIVE  575
             I  +IR F L ILKG ME      WAHFIVE
Sbjct  623   IAQVIRSFNLTILKGVMESCSNNTWAHFIVE  653


 Score = 73.2 bits (178),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 77/191 (40%), Gaps = 44/191 (23%)
 Frame = -1

Query  2350  TVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAY----------------------  2237
             +  + LLKS C  + W YAV W    ++ + LT  D Y                      
Sbjct  4     SALRQLLKSFCSNSPWKYAVLWKLRHRSPMSLTWEDGYCVYPRPRESVESISSDVHSNSE  63

Query  2236  -----YEEEM----------GGLIDDMLLQVNILGSGVVGQVAFTKNHKWMLSDTNSVWQ  2102
                  +E  +          G ++ +M       G GVVG+VA+T  H W+  D     +
Sbjct  64    IIPSHFETSIHDGCFGGYPIGLVVANMSHLKYAWGEGVVGKVAYTGKHCWVSYDDIFTGK  123

Query  2101  SHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVISVEPLGVVQFGSNQKLPERMEFVDET  1922
             ++  L   C E       E+  QF+ GIKTI ++ V P GV Q GS + +PE +      
Sbjct  124   ANSKLVPECPE-------EWLLQFASGIKTIVLVPVLPHGVFQLGSLEMVPEDLSTPAYI  176

Query  1921  KKLFQGTDIET  1889
             K  F   DI T
Sbjct  177   KDRFSCKDIHT  187



>ref|XP_009140783.1| PREDICTED: transcription factor LHW [Brassica rapa]
Length=620

 Score =   145 bits (365),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ +K T E K
Sbjct  422   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKVKHTGESK  481

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K              TWA E+ ++++ CP+VVEDL  P    +E+LC+++GFFLEI D
Sbjct  482   IMKEEGAFEGGGGG--ATWAFEVGSKSLRCPIVVEDLNPPRIFQVEMLCEQRGFFLEIAD  539

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  G+ ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  540   WIRSLGMTILKGVIETRINKIWARFTV--EASRDVTRME  576


 Score = 92.4 bits (228),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 82/150 (55%), Gaps = 17/150 (11%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE----EEMGGLIDDMLL--QVNIL  2180
             +  L S+C  N WSYAVFW    QNS  L   + Y E    E +  L + M+L  ++ ++
Sbjct  6     REALSSICVNNQWSYAVFWKIGCQNSSLLIWEECYNETEGNENVQLLTNRMMLNNRIILV  65

Query  2179  GSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVI  2000
             G G+VG+ AFT +H+W+L++T            N D    +  +E   QFS GI+T+AV 
Sbjct  66    GEGLVGRAAFTGHHQWLLANTF-----------NRDVHPPEVINEMLLQFSAGIQTVAVF  114

Query  1999  SVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   PVVPHGVVQLGSSLPIMENLGFVNDVKGLI  144



>ref|XP_010430608.1| PREDICTED: transcription factor bHLH157 [Camelina sativa]
Length=535

 Score =   144 bits (363),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 105/163 (64%), Gaps = 15/163 (9%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELR +IPNG K SID LL  TIK + F+QS+ + A+ LK+  E K
Sbjct  368   RPRPKDRQMIQDRIKELRGMIPNGAKCSIDTLLDLTIKHMEFMQSLAKYADRLKQPYESK  427

Query  838   DKKGRKDSNSNSNTNGVTWACEI----ENQTMICPLVVEDLCTPGQMLIEILCQEQGFFL  671
               K ++           TWA E+    E + ++CP++VED+   G+M IE++C+E+G FL
Sbjct  428   LVKEKER----------TWAVEVGDDDEEEAVVCPIIVEDMNRQGEMQIEMVCEERGEFL  477

Query  670   EIVDIIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
             EI D++RG GL ILKG ME R+ +IWAH IV+   N  V+RH+
Sbjct  478   EIGDVVRGLGLKILKGVMETRKGQIWAHMIVQAN-NPQVTRHQ  519


 Score =   122 bits (306),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 97/165 (59%), Gaps = 24/165 (15%)
 Frame = -1

Query  2362  GKSETVAKALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYEEEMGGLIDDMLLQVNI  2183
             G SE   K +LKSLC  +GWSYAVFW ++  NS+ L+  +AY + +   L+DDM+L+ ++
Sbjct  2     GSSEI--KQILKSLCFSHGWSYAVFWRYDPINSMLLSFEEAYNDVQSVALVDDMILKGHV  59

Query  2182  LGSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAV  2003
             LG G VG+VA T  H+W+ SDT  ++Q  H               EF  QF  G KTIA+
Sbjct  60    LGQGTVGEVALTGVHQWLFSDT--LFQCEH---------------EFQNQFLSGFKTIAI  102

Query  2002  ISVEPLGVVQFGSNQKLPERMEFVDETKKLF-----QGTDIETIF  1883
             I V   GV+QFGS QK+ E  E +++T +       Q  D++T+F
Sbjct  103   IPVGSRGVLQFGSVQKIVESPEMLEQTTRAMQEKPDQSVDLDTLF  147



>emb|CDX77102.1| BnaC04g38970D [Brassica napus]
Length=620

 Score =   145 bits (365),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = -1

Query  1018  RPIPKDRVRTYERLAELRELIPNGGKMSIDRLLHQTIKQLLFLQSVTRLAEGLKKTEELK  839
             RP PKDR    +R+ ELRE+IPNG K SID LL +TIK +LFLQ+V++ A+ +K T E K
Sbjct  422   RPRPKDRQMIQDRVKELREIIPNGAKCSIDALLERTIKHMLFLQNVSKHADKVKHTGESK  481

Query  838   DKKGRKDSNSNSNTNGVTWACEIENQTMICPLVVEDLCTPGQMLIEILCQEQGFFLEIVD  659
               K              TWA E+ ++++ CP+VVEDL  P    +E+LC+++GFFLEI D
Sbjct  482   IMKEEGAFEGGGGG--ATWAFEVGSKSLRCPIVVEDLNPPRIFQVEMLCEQRGFFLEIAD  539

Query  658   IIRGFGLNILKGTMELRETKIWAHFIVEPEANAFVSRHE  542
              IR  G+ ILKG +E R  KIWA F V  EA+  V+R E
Sbjct  540   WIRSLGMTILKGVIETRINKIWARFTV--EASRDVTRME  576


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 82/150 (55%), Gaps = 17/150 (11%)
 Frame = -1

Query  2341  KALLKSLCCGNGWSYAVFWGFNQQNSLFLTLRDAYYE----EEMGGLIDDMLL--QVNIL  2180
             +  L S+C  N WSYAVFW    QNS  L   + Y E    E +  L + M+L  ++ ++
Sbjct  6     REALSSICVNNQWSYAVFWKIGCQNSSLLIWEECYNETASNENVQLLTNRMMLNNRIILV  65

Query  2179  GSGVVGQVAFTKNHKWMLSDTNSVWQSHHGLADNCDELLQDDDSEFYGQFSCGIKTIAVI  2000
             G G+VG+ AFT +H+W+L+++            N D    +  +E   QFS GI+T+AV 
Sbjct  66    GEGLVGRAAFTGHHQWLLANSF-----------NRDVHPPEVINEMLLQFSAGIQTVAVF  114

Query  1999  SVEPLGVVQFGSNQKLPERMEFVDETKKLF  1910
              V P GVVQ GS+  + E + FV++ K L 
Sbjct  115   PVVPHGVVQLGSSLPIMENLGFVNDVKGLI  144



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8783226496374