BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21837_g3_i2 len=1390 path=[3402:0-191 2038:192-421 3822:422-1389]

Length=1390
                                                                      Score     E

ref|XP_009801337.1|  PREDICTED: myosin-2-like                           244   3e-71   
ref|XP_009617838.1|  PREDICTED: myosin-2-like                           234   1e-67   
ref|XP_004233819.1|  PREDICTED: myosin-3-like isoform X1                230   2e-66   
ref|XP_010316685.1|  PREDICTED: myosin-3-like isoform X2                228   2e-65   
ref|XP_010268832.1|  PREDICTED: myosin-2                                173   7e-43   
ref|XP_006841789.1|  hypothetical protein AMTR_s00003p00267250          166   2e-40   
ref|XP_011096207.1|  PREDICTED: myosin-2-like                           160   2e-40   
ref|XP_010278386.1|  PREDICTED: myosin-2 isoform X2                     164   1e-39   
ref|XP_010278387.1|  PREDICTED: myosin-1 isoform X3                     163   1e-39   
ref|XP_010278385.1|  PREDICTED: myosin-2 isoform X1                     164   1e-39   
ref|XP_006847798.1|  hypothetical protein AMTR_s00029p00027850          160   2e-38   
ref|XP_002281748.1|  PREDICTED: myosin-2                                159   6e-38   Vitis vinifera
emb|CBI20376.3|  unnamed protein product                                158   9e-38   
gb|EYU19161.1|  hypothetical protein MIMGU_mgv1a000383mg                157   2e-37   
gb|KHF99826.1|  Unconventional myosin-Va                                156   3e-37   
ref|XP_008806763.1|  PREDICTED: myosin-1-like                           156   3e-37   
ref|XP_006370337.1|  hypothetical protein POPTR_0001s41770g             155   7e-37   
ref|XP_009622620.1|  PREDICTED: myosin-1-like                           155   8e-37   
ref|XP_007043232.1|  Myosin 1 isoform 2                                 154   9e-37   
gb|AAB71526.1|  unconventional myosin                                   155   1e-36   Helianthus annuus
ref|XP_011022005.1|  PREDICTED: myosin-1-like isoform X1                155   1e-36   
ref|XP_011022009.1|  PREDICTED: myosin-1-like isoform X2                154   1e-36   
ref|XP_010324344.1|  PREDICTED: myosin-2-like isoform X2                154   2e-36   
ref|XP_007043231.1|  Myosin 1 isoform 1                                 154   2e-36   
ref|XP_010103613.1|  Myosin-2 heavy chain                               153   4e-36   
ref|XP_010067014.1|  PREDICTED: myosin-1                                152   5e-36   
ref|XP_007142759.1|  hypothetical protein PHAVU_007G014600g             150   6e-36   
ref|XP_011012310.1|  PREDICTED: myosin-1-like isoform X1                152   6e-36   
ref|XP_011012313.1|  PREDICTED: myosin-1-like isoform X3                152   7e-36   
ref|XP_010905572.1|  PREDICTED: myosin-1-like                           152   8e-36   
ref|XP_009783184.1|  PREDICTED: myosin-1-like                           152   8e-36   
ref|XP_006345301.1|  PREDICTED: myosin-1-like                           152   9e-36   
emb|CDP18554.1|  unnamed protein product                                152   1e-35   
ref|XP_002307152.1|  myosin-related family protein                      152   1e-35   Populus trichocarpa [western balsam poplar]
ref|XP_002525757.1|  myosin vIII, putative                              152   1e-35   Ricinus communis
ref|XP_011012312.1|  PREDICTED: myosin-1-like isoform X2                152   1e-35   
ref|XP_011095261.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-2-like      151   1e-35   
ref|XP_004231522.1|  PREDICTED: myosin-1                                151   1e-35   
ref|XP_004497240.1|  PREDICTED: myosin-J heavy chain-like isoform X1    151   2e-35   
ref|XP_004147135.1|  PREDICTED: myosin-J heavy chain-like               150   3e-35   
ref|XP_010249396.1|  PREDICTED: myosin-1-like                           150   3e-35   
ref|XP_004497241.1|  PREDICTED: myosin-J heavy chain-like isoform X2    150   3e-35   
gb|KDO69897.1|  hypothetical protein CISIN_1g0010671mg                  148   4e-35   
ref|XP_007142760.1|  hypothetical protein PHAVU_007G014600g             150   4e-35   
gb|KDO69895.1|  hypothetical protein CISIN_1g0010671mg                  149   5e-35   
ref|XP_008340434.1|  PREDICTED: myosin-1 isoform X2                     149   5e-35   
ref|XP_008340433.1|  PREDICTED: myosin-1 isoform X1                     149   5e-35   
ref|XP_010324342.1|  PREDICTED: myosin-2-like isoform X1                149   5e-35   
ref|XP_006451994.1|  hypothetical protein CICLE_v10007271mg             149   7e-35   
emb|CDY29324.1|  BnaA05g15910D                                          149   8e-35   
gb|KDO74222.1|  hypothetical protein CISIN_1g000931mg                   149   8e-35   
ref|XP_011044539.1|  PREDICTED: myosin-2                                149   8e-35   
ref|XP_006464677.1|  PREDICTED: myosin-2-like isoform X6                149   8e-35   
ref|XP_009351748.1|  PREDICTED: myosin-1-like isoform X1                149   8e-35   
ref|XP_009351750.1|  PREDICTED: myosin-1-like isoform X2                149   8e-35   
emb|CDP05853.1|  unnamed protein product                                148   9e-35   
gb|ABJ53200.1|  myosin VIII-1                                           149   1e-34   Nicotiana benthamiana
gb|KDO69889.1|  hypothetical protein CISIN_1g0010671mg                  148   1e-34   
ref|XP_002310637.2|  hypothetical protein POPTR_0007s07320g             149   1e-34   Populus trichocarpa [western balsam poplar]
gb|KDO69891.1|  hypothetical protein CISIN_1g0010671mg                  148   1e-34   
emb|CDY53932.1|  BnaCnng25790D                                          148   1e-34   
ref|XP_010523208.1|  PREDICTED: myosin-1-like                           148   2e-34   
ref|XP_009406771.1|  PREDICTED: myosin-1-like                           148   2e-34   
ref|XP_010905050.1|  PREDICTED: myosin-1                                148   2e-34   
ref|XP_004297721.1|  PREDICTED: unconventional myosin-Va-like           148   2e-34   
ref|XP_011070461.1|  PREDICTED: myosin-1                                147   2e-34   
ref|XP_006484499.1|  PREDICTED: myosin-1-like                           147   3e-34   
ref|XP_006437635.1|  hypothetical protein CICLE_v10030552mg             147   3e-34   
ref|XP_009124542.1|  PREDICTED: myosin-3-like                           147   4e-34   
ref|XP_007153036.1|  hypothetical protein PHAVU_003G002200g             147   4e-34   
ref|XP_008389065.1|  PREDICTED: myosin-1-like                           147   5e-34   
ref|XP_002316933.2|  hypothetical protein POPTR_0011s12670g             146   7e-34   Populus trichocarpa [western balsam poplar]
ref|XP_008445889.1|  PREDICTED: myosin-1-like                           146   7e-34   
ref|XP_009792549.1|  PREDICTED: myosin-2-like isoform X2                146   9e-34   
ref|XP_004487658.1|  PREDICTED: myosin-J heavy chain-like isoform X1    145   1e-33   
ref|XP_002523758.1|  myosin vIII, putative                              145   1e-33   Ricinus communis
gb|KHN23106.1|  Unconventional myosin-Va                                145   2e-33   
ref|XP_004487659.1|  PREDICTED: myosin-J heavy chain-like isoform X2    145   2e-33   
ref|XP_001774306.1|  predicted protein                                  145   2e-33   
gb|KEH19592.1|  P-loop nucleoside triphosphate hydrolase superfam...    145   2e-33   
ref|XP_006605841.1|  PREDICTED: myosin-1-like isoform X3                145   2e-33   
ref|XP_008812673.1|  PREDICTED: myosin-1-like isoform X4                144   2e-33   
ref|XP_006605839.1|  PREDICTED: myosin-1-like isoform X1                144   3e-33   
ref|XP_008812671.1|  PREDICTED: myosin-1-like isoform X2                144   3e-33   
ref|XP_008812670.1|  PREDICTED: myosin-1-like isoform X1                144   3e-33   
ref|XP_003592738.1|  Myosin-like protein                                144   3e-33   
emb|CBI35399.3|  unnamed protein product                                144   3e-33   
ref|XP_008812672.1|  PREDICTED: myosin-1-like isoform X3                144   3e-33   
ref|XP_002273898.1|  PREDICTED: myosin-1                                144   4e-33   Vitis vinifera
emb|CAN82090.1|  hypothetical protein VITISV_032704                     144   4e-33   Vitis vinifera
ref|XP_006362935.1|  PREDICTED: myosin-2-like isoform X2                144   4e-33   
ref|XP_006589741.1|  PREDICTED: myosin-1-like isoform X2                143   5e-33   
ref|XP_003541108.1|  PREDICTED: myosin-2-like                           144   5e-33   
ref|XP_003536741.2|  PREDICTED: myosin-1-like isoform X1                143   6e-33   
gb|KHN37364.1|  Myosin-J heavy chain                                    143   6e-33   
emb|CDO99630.1|  unnamed protein product                                135   9e-33   
ref|XP_006306608.1|  hypothetical protein CARUB_v10008120mg             142   1e-32   
ref|XP_010688651.1|  PREDICTED: myosin-1-like                           142   2e-32   
ref|XP_006393159.1|  hypothetical protein EUTSA_v10011193mg             142   2e-32   
ref|XP_006362934.1|  PREDICTED: myosin-2-like isoform X1                142   2e-32   
gb|KHN46956.1|  Myosin-J heavy chain                                    142   2e-32   
gb|ABJ53202.1|  myosin VIII-B                                           141   2e-32   Nicotiana benthamiana
ref|XP_003526112.1|  PREDICTED: myosin-2-like isoform X1                141   3e-32   
ref|XP_009792547.1|  PREDICTED: myosin-2-like isoform X1                141   3e-32   
ref|XP_008221075.1|  PREDICTED: myosin-1                                141   4e-32   
ref|XP_007225432.1|  hypothetical protein PRUPE_ppa000435mg             140   5e-32   
ref|XP_009773270.1|  PREDICTED: myosin-2-like isoform X1                140   6e-32   
ref|XP_009589781.1|  PREDICTED: myosin-2-like isoform X2                140   8e-32   
ref|XP_011029402.1|  PREDICTED: myosin-2-like                           140   8e-32   
ref|XP_008800396.1|  PREDICTED: myosin-1-like                           140   9e-32   
gb|EPS68761.1|  hypothetical protein M569_06006                         139   1e-31   
ref|XP_010479488.1|  PREDICTED: myosin-3-like                           139   1e-31   
ref|XP_007133144.1|  hypothetical protein PHAVU_011G155300g             139   2e-31   
ref|XP_010062907.1|  PREDICTED: myosin-2                                139   2e-31   
ref|XP_010557555.1|  PREDICTED: myosin-1-like                           139   2e-31   
ref|XP_009603974.1|  PREDICTED: myosin-2-like isoform X1                138   2e-31   
ref|XP_010694427.1|  PREDICTED: myosin-2 isoform X2                     138   3e-31   
gb|KDO74218.1|  hypothetical protein CISIN_1g000931mg                   138   3e-31   
ref|XP_006464672.1|  PREDICTED: myosin-2-like isoform X1                138   3e-31   
ref|XP_006451996.1|  hypothetical protein CICLE_v10007271mg             138   3e-31   
gb|EYU39409.1|  hypothetical protein MIMGU_mgv1a000419mg                138   3e-31   
gb|ACN26349.1|  unknown                                                 134   3e-31   Zea mays [maize]
ref|XP_009135657.1|  PREDICTED: myosin-1-like                           138   3e-31   
ref|XP_006582193.1|  PREDICTED: myosin-2-like isoform X2                138   3e-31   
ref|XP_003533701.1|  PREDICTED: myosin-1-like isoform X1                138   3e-31   
gb|KDP38945.1|  hypothetical protein JCGZ_00702                         137   3e-31   
emb|CDX82270.1|  BnaA03g35510D                                          138   3e-31   
gb|KDO74224.1|  hypothetical protein CISIN_1g000931mg                   138   3e-31   
ref|XP_003541859.1|  PREDICTED: myosin-2-like                           137   5e-31   
gb|KDP37497.1|  hypothetical protein JCGZ_05936                         137   5e-31   
ref|XP_006296853.1|  hypothetical protein CARUB_v10012840mg             137   8e-31   
ref|XP_010536993.1|  PREDICTED: myosin-2-like isoform X1                137   9e-31   
ref|XP_004498109.1|  PREDICTED: myosin-J heavy chain-like               136   9e-31   
ref|XP_010520892.1|  PREDICTED: myosin-2-like                           136   1e-30   
gb|KHG13556.1|  Myosin-2 heavy chain                                    136   1e-30   
ref|XP_010508266.1|  PREDICTED: myosin-1-like                           136   1e-30   
ref|XP_010482837.1|  PREDICTED: myosin-2-like                           136   1e-30   
gb|EYU35564.1|  hypothetical protein MIMGU_mgv1a000458mg                136   1e-30   
ref|XP_010466165.1|  PREDICTED: myosin-1                                136   2e-30   
ref|XP_003556592.1|  PREDICTED: myosin-1-like                           135   2e-30   
gb|KHM99077.1|  Myosin-J heavy chain                                    135   2e-30   
emb|CDY25361.1|  BnaA05g19230D                                          135   2e-30   
ref|XP_010500596.1|  PREDICTED: myosin-3                                135   2e-30   
ref|XP_010694426.1|  PREDICTED: myosin-2 isoform X1                     135   2e-30   
ref|NP_175453.2|  myosin VIIIA                                          135   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009589778.1|  PREDICTED: myosin-2-like isoform X1                135   3e-30   
emb|CDY42506.1|  BnaC06g03520D                                          135   3e-30   
dbj|BAD93813.1|  myosin                                                 135   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147843.1|  PREDICTED: myosin-3                                135   3e-30   
ref|XP_010918414.1|  PREDICTED: myosin-1-like                           135   3e-30   
ref|XP_010487954.1|  PREDICTED: myosin-1-like                           135   3e-30   
emb|CDY14319.1|  BnaA10g07360D                                          135   3e-30   
gb|AAD50052.1|AC007980_17  Highly similar to myosin                     135   3e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007021261.1|  Myosin 2 isoform 1                                 135   3e-30   
ref|XP_009119961.1|  PREDICTED: myosin-2-like                           135   3e-30   
emb|CDY22791.1|  BnaA06g02860D                                          135   4e-30   
ref|XP_002891568.1|  hypothetical protein ARALYDRAFT_474163             135   4e-30   
emb|CDY18321.1|  BnaC09g30710D                                          135   4e-30   
gb|ABJ53201.1|  myosin VIII-2                                           135   4e-30   Nicotiana benthamiana
ref|XP_007021262.1|  Myosin 2 isoform 2                                 135   4e-30   
ref|XP_009145709.1|  PREDICTED: myosin-1 isoform X2                     134   5e-30   
ref|NP_188630.1|  myosin 1                                              134   5e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAM14075.1|  putative myosin                                         134   6e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145706.1|  PREDICTED: myosin-1 isoform X1                     134   6e-30   
ref|XP_011098363.1|  PREDICTED: myosin-2-like                           134   7e-30   
ref|XP_008664832.1|  PREDICTED: myosin-1                                134   7e-30   
gb|KHN28019.1|  Myosin-J heavy chain                                    134   8e-30   
ref|NP_001154628.2|  myosin 1                                           134   8e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAD31926.1|AF147738_1  myosin VIII ZMM3                              133   8e-30   Zea mays [maize]
ref|XP_006592898.1|  PREDICTED: myosin-2-like isoform X3                133   9e-30   
gb|KHN46512.1|  Myosin-J heavy chain                                    133   1e-29   
emb|CDY24591.1|  BnaC05g32750D                                          133   1e-29   
ref|XP_009412435.1|  PREDICTED: myosin-1-like                           133   1e-29   
emb|CDY36068.1|  BnaC03g41300D                                          133   1e-29   
ref|XP_009389227.1|  PREDICTED: myosin-1-like                           133   1e-29   
emb|CDY52239.1|  BnaC02g44600D                                          133   1e-29   
gb|AAG49341.1|  myosin subfamily VIII heavy chain                       133   1e-29   Petroselinum crispum
ref|XP_006592897.1|  PREDICTED: myosin-2-like isoform X2                133   1e-29   
ref|XP_010933291.1|  PREDICTED: myosin-1-like                           132   2e-29   
ref|XP_007149632.1|  hypothetical protein PHAVU_005G085900g             132   2e-29   
gb|AES66739.2|  P-loop nucleoside triphosphate hydrolase superfam...    132   2e-29   
ref|XP_003539582.1|  PREDICTED: myosin-2-like isoform X1                132   2e-29   
ref|XP_007149633.1|  hypothetical protein PHAVU_005G085900g             132   3e-29   
ref|XP_009127101.1|  PREDICTED: myosin-2                                132   4e-29   
ref|XP_010935561.1|  PREDICTED: myosin-1-like                           132   4e-29   
ref|XP_009773271.1|  PREDICTED: myosin-2-like isoform X2                132   4e-29   
ref|XP_010446745.1|  PREDICTED: myosin-2-like                           131   4e-29   
ref|XP_002883217.1|  hypothetical protein ARALYDRAFT_479514             131   4e-29   
ref|XP_006401589.1|  hypothetical protein EUTSA_v10012475mg             131   6e-29   
ref|XP_007149634.1|  hypothetical protein PHAVU_005G085900g             131   6e-29   
ref|XP_002866036.1|  predicted protein                                  130   7e-29   
ref|XP_010443003.1|  PREDICTED: myosin-2                                130   7e-29   
emb|CAB61875.1|  myosin                                                 130   1e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009420769.1|  PREDICTED: myosin-2-like isoform X2                127   1e-28   
ref|XP_009420767.1|  PREDICTED: myosin-2-like isoform X1                127   1e-28   
gb|KEH40947.1|  P-loop nucleoside triphosphate hydrolase superfam...    130   1e-28   
emb|CDY28777.1|  BnaA02g09690D                                          130   1e-28   
ref|XP_010279450.1|  PREDICTED: myosin-1-like                           130   1e-28   
ref|XP_002467046.1|  hypothetical protein SORBIDRAFT_01g018770          130   2e-28   Sorghum bicolor [broomcorn]
ref|NP_001078755.1|  myosin 2                                           130   2e-28   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF01329.1|  myosin heavy chain                                     129   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009603975.1|  PREDICTED: myosin-2-like isoform X2                129   2e-28   
ref|XP_008802972.1|  PREDICTED: myosin-1-like                           129   2e-28   
ref|XP_006657835.1|  PREDICTED: myosin-2-like                           129   2e-28   
ref|NP_568806.3|  myosin 2                                              129   2e-28   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194467.5|  myosin heavy chain-like protein                       129   2e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CAA84065.1|  myosin                                                 129   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|AFW68522.1|  hypothetical protein ZEAMMB73_631881                    129   3e-28   
dbj|BAB10751.1|  myosin heavy chain                                     129   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|EEC67214.1|  hypothetical protein OsI_34110                          129   3e-28   Oryza sativa Indica Group [Indian rice]
ref|NP_001064913.1|  Os10g0488800                                       128   4e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010327147.1|  PREDICTED: myosin-2-like isoform X2                128   4e-28   
ref|XP_006661886.1|  PREDICTED: myosin-1-like                           128   4e-28   
gb|AAL31066.1|AC090120_12  putative myosin                              128   5e-28   Oryza sativa [red rice]
gb|ABB47808.1|  Myosin head family protein, expressed                   127   6e-28   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006406435.1|  hypothetical protein EUTSA_v10019925mg             128   6e-28   
ref|XP_004510018.1|  PREDICTED: unconventional myosin-Va-like           127   7e-28   
ref|XP_010536994.1|  PREDICTED: myosin-2-like isoform X2                127   8e-28   
ref|XP_001755337.1|  predicted protein                                  127   9e-28   
dbj|BAJ99526.1|  predicted protein                                      127   1e-27   
ref|XP_004248278.1|  PREDICTED: myosin-2-like isoform X1                126   2e-27   
gb|KFK29252.1|  hypothetical protein AALP_AA7G109000                    125   2e-27   
gb|EMT12170.1|  Myosin-J heavy chain                                    126   2e-27   
gb|KFK29251.1|  hypothetical protein AALP_AA7G109000                    125   3e-27   
ref|XP_004982778.1|  PREDICTED: myosin-J heavy chain-like isoform X2    125   3e-27   
emb|CAB81387.1|  myosin heavy chain-like protein                        125   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003562871.1|  PREDICTED: myosin-3                                125   4e-27   
emb|CAA19731.1|  myosin heavy chain-like protein                        125   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002975651.1|  hypothetical protein SELMODRAFT_103418             125   5e-27   
gb|EEC82270.1|  hypothetical protein OsI_26483                          125   6e-27   Oryza sativa Indica Group [Indian rice]
gb|KHG19058.1|  Myosin-2 heavy chain                                    124   7e-27   
ref|XP_003574095.1|  PREDICTED: myosin-1-like                           124   1e-26   
ref|XP_008797209.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-1-like      123   1e-26   
ref|XP_002867507.1|  hypothetical protein ARALYDRAFT_492062             123   2e-26   
ref|XP_010448147.1|  PREDICTED: myosin-4-like                           122   3e-26   
ref|XP_002978834.1|  hypothetical protein SELMODRAFT_109322             122   3e-26   
gb|KDO74223.1|  hypothetical protein CISIN_1g000931mg                   122   5e-26   
gb|EEE67412.1|  hypothetical protein OsJ_24744                          121   6e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010438625.1|  PREDICTED: myosin-4-like                           121   7e-26   
ref|XP_006283030.1|  hypothetical protein CARUB_v10004022mg             121   8e-26   
tpg|DAA63129.1|  TPA: hypothetical protein ZEAMMB73_109792              120   1e-25   
ref|XP_006279905.1|  hypothetical protein CARUB_v10025758mg             120   2e-25   
ref|XP_004982777.1|  PREDICTED: myosin-J heavy chain-like isoform X1    120   2e-25   
ref|XP_009382696.1|  PREDICTED: myosin-2-like                           117   2e-25   
ref|XP_003596488.1|  Myosin-like protein                                119   4e-25   
ref|XP_004146844.1|  PREDICTED: myosin-2 heavy chain-like               118   9e-25   
ref|XP_008454630.1|  PREDICTED: myosin-2-like                           115   5e-24   
gb|EMS67686.1|  Myosin-J heavy chain                                    114   2e-23   
ref|XP_008654108.1|  PREDICTED: myosin-1-like                           114   2e-23   
ref|XP_009143365.1|  PREDICTED: myosin-4                                110   2e-22   
ref|XP_006413084.1|  hypothetical protein EUTSA_v10024254mg             109   4e-22   
ref|XP_001768683.1|  predicted protein                                  107   2e-21   
gb|AEM05969.1|  myosin VIII E                                           107   2e-21   
ref|XP_001777862.1|  predicted protein                                  107   2e-21   
ref|XP_001775964.1|  predicted protein                                  107   2e-21   
gb|AEM05968.1|  myosin VIII D                                           103   4e-20   
gb|EPS70501.1|  hypothetical protein M569_04240                         103   6e-20   
ref|XP_002463024.1|  hypothetical protein SORBIDRAFT_02g036390          102   1e-19   Sorghum bicolor [broomcorn]
ref|XP_009105704.1|  PREDICTED: LOW QUALITY PROTEIN: myosin-4-like      100   2e-19   
ref|XP_009334585.1|  PREDICTED: myosin-2 isoform X2                     100   4e-19   
gb|EYU33558.1|  hypothetical protein MIMGU_mgv1a000433mg              99.8    8e-19   
ref|XP_009334584.1|  PREDICTED: myosin-2 isoform X1                   97.4    4e-18   
ref|NP_001059992.1|  Os07g0562800                                     97.4    5e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004958024.1|  PREDICTED: unconventional myosin-Va-like         97.4    5e-18   
ref|XP_009334586.1|  PREDICTED: myosin-2 isoform X3                   96.7    9e-18   
ref|XP_008366419.1|  PREDICTED: myosin-2 isoform X2                   96.3    1e-17   
ref|XP_008345270.1|  PREDICTED: myosin-2-like isoform X2              95.5    2e-17   
ref|XP_008366413.1|  PREDICTED: myosin-2 isoform X1                   95.1    3e-17   
ref|XP_008366425.1|  PREDICTED: myosin-2 isoform X3                   95.1    3e-17   
ref|XP_008345269.1|  PREDICTED: myosin-2-like isoform X1              92.0    3e-16   
ref|XP_008345271.1|  PREDICTED: myosin-2-like isoform X3              92.0    3e-16   
gb|ABK94124.1|  unknown                                               87.4    5e-16   Populus trichocarpa [western balsam poplar]
gb|EPS65807.1|  hypothetical protein M569_08970                       90.9    6e-16   
ref|XP_009342450.1|  PREDICTED: myosin-2 isoform X2                   90.5    8e-16   
ref|XP_004294488.1|  PREDICTED: myosin-J heavy chain-like             90.5    9e-16   
ref|XP_009342454.1|  PREDICTED: myosin-2 isoform X5                   89.7    1e-15   
ref|XP_008805849.1|  PREDICTED: myosin-1-like                         89.7    1e-15   
ref|XP_008226710.1|  PREDICTED: myosin-2 isoform X1                   89.7    1e-15   
ref|XP_009342449.1|  PREDICTED: myosin-2 isoform X1                   89.7    2e-15   
ref|XP_007212835.1|  hypothetical protein PRUPE_ppa020758mg           89.4    2e-15   
ref|XP_009342451.1|  PREDICTED: myosin-2 isoform X3                   88.6    3e-15   
gb|AEM05967.1|  myosin VIII B                                         81.6    6e-13   
gb|KHF97725.1|  Membrane antigen containing repeating peptides        78.2    8e-13   
gb|KDO69892.1|  hypothetical protein CISIN_1g0010671mg                80.5    1e-12   
ref|XP_009603977.1|  PREDICTED: myosin-2-like isoform X3              80.5    1e-12   
ref|XP_010922002.1|  PREDICTED: myosin-1-like                         80.1    2e-12   
ref|XP_009773272.1|  PREDICTED: myosin-2-like isoform X3              79.7    2e-12   
gb|AAQ87013.1|  myosin heavy chain class VIII A2 protein              76.6    2e-11   
dbj|BAK01852.1|  predicted protein                                    71.6    1e-10   
ref|XP_010324345.1|  PREDICTED: myosin-2-like isoform X3              74.3    1e-10   
ref|XP_010101784.1|  Myosin-2 heavy chain                             73.2    2e-10   
emb|CDY42503.1|  BnaC06g03550D                                        70.5    3e-10   
ref|XP_003589756.1|  LRR receptor-like protein kinase                 72.0    4e-10   
gb|EMS56234.1|  Myosin-2 heavy chain                                  70.9    2e-09   
ref|XP_009792550.1|  PREDICTED: myosin-2-like isoform X3              69.7    3e-09   
gb|EMT14738.1|  Myosin-2 heavy chain                                  69.7    3e-09   
ref|XP_009792551.1|  PREDICTED: myosin-2-like isoform X4              69.7    3e-09   
gb|KDO69893.1|  hypothetical protein CISIN_1g0010671mg                69.3    3e-09   
ref|XP_003589748.1|  Myosin-like protein                              69.7    4e-09   
ref|XP_006362936.1|  PREDICTED: myosin-2-like isoform X3              68.9    6e-09   
dbj|BAL60532.2|  myosin VIII                                          68.6    7e-09   
ref|XP_003589382.1|  Unconventional myosin                            63.5    3e-08   
ref|XP_010327148.1|  PREDICTED: myosin-2-like isoform X3              66.6    3e-08   
ref|XP_010327149.1|  PREDICTED: myosin-2-like isoform X4              66.2    3e-08   
ref|XP_002972734.1|  hypothetical protein SELMODRAFT_98074            65.9    5e-08   
ref|XP_008671324.1|  PREDICTED: uncharacterized protein LOC103648678  65.1    9e-08   
ref|XP_002993349.1|  hypothetical protein SELMODRAFT_137032           64.7    1e-07   
ref|XP_009589782.1|  PREDICTED: myosin-2-like isoform X3              64.3    2e-07   
ref|XP_009589783.1|  PREDICTED: myosin-2-like isoform X4              64.3    2e-07   
ref|XP_002451578.1|  hypothetical protein SORBIDRAFT_04g004170        60.8    5e-07   
ref|XP_010463346.1|  PREDICTED: myosin-3-like                         62.8    5e-07   
gb|EPS62979.1|  hypothetical protein M569_11810                       59.3    9e-07   
ref|XP_005348509.1|  PREDICTED: LOW QUALITY PROTEIN: abnormal spi...  59.3    6e-06   
ref|XP_002458046.1|  hypothetical protein SORBIDRAFT_03g026110        58.9    7e-06   
tpg|DAA58705.1|  TPA: hypothetical protein ZEAMMB73_629283            58.5    1e-05   
ref|NP_001104925.1|  myosin1                                          58.5    1e-05   
ref|XP_004969408.1|  PREDICTED: unconventional myosin-Vb-like iso...  56.2    5e-05   
ref|XP_004969407.1|  PREDICTED: unconventional myosin-Vb-like iso...  56.2    5e-05   
ref|XP_009420533.1|  PREDICTED: myosin-2-like                         54.3    1e-04   
ref|XP_009861105.1|  PREDICTED: unconventional myosin-Va              54.7    2e-04   
ref|XP_009534547.1|  hypothetical protein PHYSODRAFT_338448           54.3    2e-04   
emb|CAE54277.1|  putative myosin heavy chain class VIII A1 protein    51.6    2e-04   
ref|XP_007096338.1|  PREDICTED: abnormal spindle-like microcephal...  53.9    3e-04   
ref|XP_009385074.1|  PREDICTED: myosin-2-like                         52.8    4e-04   
ref|XP_006270211.1|  PREDICTED: unconventional myosin-Va              53.5    4e-04   
ref|XP_002954496.1|  type XI myosin heavy chain MyoA                  52.4    8e-04   
ref|XP_007233292.1|  PREDICTED: abnormal spindle-like microcephal...  52.4    0.001   



>ref|XP_009801337.1| PREDICTED: myosin-2-like [Nicotiana sylvestris]
Length=449

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 166/409 (41%), Positives = 231/409 (56%), Gaps = 48/409 (12%)
 Frame = -3

Query  1151  RPVKNSRLPRARKKLPLNLRSGCCDQEMG----KINDLSASRGMEKRAFLD---------  1011
             RP+  +RLP+ R+KLP   +    D+E G    K     ++R  E   FLD         
Sbjct  42    RPITKARLPKGRRKLPEFGKEKNRDEEDGYSQVKCGLFESTRTKED-VFLDQPVHQWDSA  100

Query  1010  ---SDNLKIQISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGEN  840
                S  +  +  +  D ++ A    V  IQRC+ G+QAR YY+++K G + LQ FVRGE 
Sbjct  101   ERDSVAMTDKFCLVVDLREGAELSAVVGIQRCFRGYQARRYYHQIKIGVVALQQFVRGEI  160

Query  839   ARKDYQFLVTRLRAIVTIQKHMKEQQSRRLE-QLAAVICLQSGIRGWLTRIEFN----KK  675
             ARK +Q L  RL AI+ IQKH+KE + RR+E QL A   LQS +RGWLTR +FN     K
Sbjct  161   ARKYHQDLTRRLTAIIIIQKHIKEHRHRRIERQLTAATRLQSVVRGWLTRKQFNLLGNGK  220

Query  674   ITSRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
              T   N R+  +   K+++ KV RSVLLDLQR +  TEAALER ++ENA+L+ +I  ++K
Sbjct  221   PTCDQNIRKKNDHAEKEQETKVPRSVLLDLQRHILRTEAALERKKEENAALRLHIQHYEK  280

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV----------------AENGLSRT  363
             K  +YE+KM+ +EK WQDQL S+QTSL A  ++                    ++G  RT
Sbjct  281   KWNQYESKMKAMEKMWQDQLTSVQTSLAAERKTHSGEKTKGELRLLMHQDQDEDDGFPRT  340

Query  362   EP--PSERFIPFERSDAGLVVNNRLDFASPLDQEN-----GSHQNMI-TWVKSGHDEPLN  207
                  S   +  E  D+    N R++  + L+  +        QN +    KSG  E   
Sbjct  341   TSLQSSALNLSNEVHDSQSQQNGRINSENQLNNHHVMDMVNHFQNFVHDQCKSGQ-ETST  399

Query  206   LSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             L P N ++ K+K+RF+AWKKDYKS+L+ VKAT+KQL H +RGK T IWC
Sbjct  400   LRP-NDELQKLKVRFEAWKKDYKSKLREVKATMKQLGHPERGKGTKIWC  447



>ref|XP_009617838.1| PREDICTED: myosin-2-like [Nicotiana tomentosiformis]
Length=451

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 166/413 (40%), Positives = 233/413 (56%), Gaps = 54/413 (13%)
 Frame = -3

Query  1151  RPVKNSRLPRARKKLPLNLRSGCCDQEMG----KINDLSASRGMEKRAFLD---------  1011
             RP+  +RLP+ R+KLP   +     +E G    K     ++R  E   FLD         
Sbjct  42    RPITKARLPKGRRKLPEFSKEKNRVEEDGYSQVKCGMFESTRTKED-VFLDQPVHQWDST  100

Query  1010  ---SDNLKIQISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGEN  840
                S  +  +I +  D ++ A    V  IQRC+ G+QAR Y+++LK G + LQ FVRGE 
Sbjct  101   DRDSAAMTDKICLMIDLREGAGLNAVVAIQRCFRGYQARRYFHQLKTGVVALQQFVRGEI  160

Query  839   ARKDYQFLVTRLRAIVTIQKHMKEQQSRRLE-QLAAVICLQSGIRGWLTRIEFNK----K  675
             ARK +Q    RL AI+ IQKH+KE   +R+E QL A   LQS IRGWLTR +FN     K
Sbjct  161   ARKYHQDRRRRLTAIIIIQKHIKEHHHKRIERQLTAATRLQSVIRGWLTRKQFNTLGNGK  220

Query  674   ITSRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
              T     R+  + + K+++ KV RSVLLDLQR +  TEAALER ++ENA+L+ +I  ++K
Sbjct  221   PTCGRYIREKNDLDEKEQETKVPRSVLLDLQRHILRTEAALERKKEENAALRLHIQHYEK  280

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSE-GVAENG----LSRTEPPSERFIPFE  330
             K  +YE+KM+ +EK WQDQL S+QTSL A  ++  G    G    L   +   +    F 
Sbjct  281   KWNQYESKMKAMEKMWQDQLTSVQTSLAAERKTHSGEKTKGELRLLMHQDQDQDEDDEFP  340

Query  329   RSD----AGLVVNNRLDFASPLDQENG---------SHQ--NMITWV--------KSGHD  219
             R+     + L ++N +    P  Q+NG         +H   NM+           KSG +
Sbjct  341   RTTTLQRSELNLSNEVHDTRP--QQNGGTNSENQLNNHHVMNMVNHFQNFVHDQCKSGQE  398

Query  218   EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
               + L P N ++ K+K+RF+AWKKDYKS+L+ VKAT+KQL H +RGK T IWC
Sbjct  399   ASI-LWP-NDELQKLKVRFEAWKKDYKSKLREVKATMKQLGHSERGKGTKIWC  449



>ref|XP_004233819.1| PREDICTED: myosin-3-like isoform X1 [Solanum lycopersicum]
Length=424

 Score =   230 bits (587),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 152/389 (39%), Positives = 213/389 (55%), Gaps = 38/389 (10%)
 Frame = -3

Query  1136  SRLPRARKKLPLNLRSGCCDQEMGKINDLSASRGM------EKRAFLDSDNLKIQISIEE  975
             +RLP+ R+KL          +E   + D+     +         A  DS  +  +I +  
Sbjct  42    ARLPKGRRKLAFG-------KEKSNLEDIRVQENVFVDQWSTSAAERDSVAMTDKICLMV  94

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             D+++ A   GV  IQRC+ G+QAR YY+ELK GA+ LQSFVRGE  RK YQ L  RL A+
Sbjct  95    DQREGAELSGVLQIQRCFRGYQARQYYHELKTGAVALQSFVRGEITRKCYQDLTRRLTAV  154

Query  794   VTIQKHMKEQQSRRLE-QLAAVICLQSGIRGWLTRIEFN----KKITSRLNSRQMLNPEL  630
             + IQKH+K+   +R E Q  A +CLQS IRG LTR +FN     K +   N R+  + + 
Sbjct  155   IIIQKHIKKYLHKRTERQRTAALCLQSVIRGCLTRKQFNLSGDGKRSCVQNIREKNDLDN  214

Query  629   KDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKS  450
             K+ + KV RSVLLDLQR +  TEAALER ++ENA+L+ +I  ++ K  +YE+KM+ +EK 
Sbjct  215   KEPETKVPRSVLLDLQRHILKTEAALERKKEENAALRLHIQHYEIKWNQYESKMKAMEKM  274

Query  449   WQDQLMSIQTSLGAASRSEG------------------VAENGL-SRTEPPSERFIPFER  327
             WQDQL SIQ SL A     G                     NG  S    P E      +
Sbjct  275   WQDQLTSIQISLAAEREKHGDEKTKGKLRLLILQDQDENVHNGFPSALNHPDEVHDTQPQ  334

Query  326   SDAGLVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKK  147
                 L   N+ +    +D  N  +QN +   +    E  +    N ++ K+K+RF+AWKK
Sbjct  335   PSGRLNPKNKCNNHHVMDMVN-HYQNFVVHDQCNTGEEASALRPNDELQKLKIRFEAWKK  393

Query  146   DYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             DYK++L+  KAT+KQL H +RGK + IWC
Sbjct  394   DYKNKLREAKATMKQLGHSERGKGSKIWC  422



>ref|XP_010316685.1| PREDICTED: myosin-3-like isoform X2 [Solanum lycopersicum]
Length=417

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/386 (39%), Positives = 216/386 (56%), Gaps = 39/386 (10%)
 Frame = -3

Query  1136  SRLPRARKKLPLNLRSGCCDQEMGKINDLSASRGMEKRAFLD--SDNLKIQISIE-EDEK  966
             +RLP+ R+KL          +E   + D+     +++  F+D  S +   + S+   D++
Sbjct  42    ARLPKGRRKLAFG-------KEKSNLEDIR----VQENVFVDQWSTSAAERDSVAMTDKR  90

Query  965   QLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTI  786
             + A   GV  IQRC+ G+QAR YY+ELK GA+ LQSFVRGE  RK YQ L  RL A++ I
Sbjct  91    EGAELSGVLQIQRCFRGYQARQYYHELKTGAVALQSFVRGEITRKCYQDLTRRLTAVIII  150

Query  785   QKHMKEQQSRRLE-QLAAVICLQSGIRGWLTRIEFN----KKITSRLNSRQMLNPELKDE  621
             QKH+K+   +R E Q  A +CLQS IRG LTR +FN     K +   N R+  + + K+ 
Sbjct  151   QKHIKKYLHKRTERQRTAALCLQSVIRGCLTRKQFNLSGDGKRSCVQNIREKNDLDNKEP  210

Query  620   DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQD  441
             + KV RSVLLDLQR +  TEAALER ++ENA+L+ +I  ++ K  +YE+KM+ +EK WQD
Sbjct  211   ETKVPRSVLLDLQRHILKTEAALERKKEENAALRLHIQHYEIKWNQYESKMKAMEKMWQD  270

Query  440   QLMSIQTSLGAASRSEG------------------VAENGL-SRTEPPSERFIPFERSDA  318
             QL SIQ SL A     G                     NG  S    P E      +   
Sbjct  271   QLTSIQISLAAEREKHGDEKTKGKLRLLILQDQDENVHNGFPSALNHPDEVHDTQPQPSG  330

Query  317   GLVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYK  138
              L   N+ +    +D  N  +QN +   +    E  +    N ++ K+K+RF+AWKKDYK
Sbjct  331   RLNPKNKCNNHHVMDMVN-HYQNFVVHDQCNTGEEASALRPNDELQKLKIRFEAWKKDYK  389

Query  137   SRLQVVKATLKQLRHCDRGKST*IWC  60
             ++L+  KAT+KQL H +RGK + IWC
Sbjct  390   NKLREAKATMKQLGHSERGKGSKIWC  415



>ref|XP_010268832.1| PREDICTED: myosin-2 [Nelumbo nucifera]
Length=1223

 Score =   173 bits (439),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 123/356 (35%), Positives = 192/356 (54%), Gaps = 52/356 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GHQAR Y+ ++K+G   LQS++RGENARK+YQ LV
Sbjct  865   QIGILEDARKKTLQ-GILCVQKWFRGHQARCYFQKIKKGITNLQSYIRGENARKEYQDLV  923

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKK---ITSRLNSRQ  648
              R +A+  IQ+HM++Q + R   ++  AVI LQS  RGWL R   N     + S  ++ +
Sbjct  924   KRQKAVALIQRHMRKQITWRTQNDRKRAVILLQSVTRGWLVRRHLNDMENLVKSNFSNTK  983

Query  647   MLNPEL-----KDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
              +  +      + E  +VQ SVL +LQRRV + EAAL R  +ENA+L+E + QF+K+  +
Sbjct  984   PIAKQAAKILERKEHTQVQSSVLEELQRRVLMAEAALVRKEEENAALQEQLQQFEKRWSD  1043

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIP----FERSDAG  315
             YEAKM+ +E+ WQ ++ S+Q SL    RS    +N     EP     +P    ++  D  
Sbjct  1044  YEAKMKSMEEMWQKEMTSLQRSLAIVKRSLAADDNA---GEPGRPDALPVLHCYDSEDIT  1100

Query  314   LVVNNRLDFASP-----LDQENGSHQ---------------------------NMITWVK  231
                 +  D  +P     L  +NG  Q                             +  VK
Sbjct  1101  SPGAHTPDVTTPEKLSNLTPDNGFGQASDAGLNAVSHLVKEFEKRKQVFEEDAGFLVEVK  1160

Query  230   SGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             SGH    + +P++ ++ K+KLRF+ WKK+YK +L+  K+TL +L + +  K+   W
Sbjct  1161  SGHSAS-SANPRD-ELRKLKLRFETWKKEYKLKLRETKSTLHRLGNSEVEKTRRRW  1214



>ref|XP_006841789.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
 gb|ERN03464.1| hypothetical protein AMTR_s00003p00267250 [Amborella trichopoda]
Length=1232

 Score =   166 bits (421),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 117/345 (34%), Positives = 180/345 (52%), Gaps = 40/345 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +Q G+  +Q+C+ G QAR ++ ELK G   LQS+VRGE ARK+++ L+
Sbjct  884   QIGALEDTRNRTLQ-GILGVQKCFRGRQARRHFQELKNGVAFLQSYVRGERARKEFELLI  942

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNS  654
              R RA++ IQ+ +K   +R+   + L A I +QS +RGWL R ++       +   +   
Sbjct  943   RRHRAVIAIQRQIKRWITRKRYNDGLRATIFVQSFVRGWLARRDYTIMREFGEANVQHAD  1002

Query  653   RQMLNPEL---KDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
              Q+  P+    K + + V+ S L +LQRR+   EAAL    ++N  L + + Q++K+  E
Sbjct  1003  GQLQAPKRILEKKDSVSVKPSALAELQRRILKAEAALRNKEEDNLVLNQQLQQYEKRWSE  1062

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAG----  315
             YE +M+ +E++WQ Q+ S+Q SL AA RS    +       P +  +   E +  G    
Sbjct  1063  YETRMRSMEETWQKQMTSLQMSLAAAKRSLAADDAVRLDASPLAHSYDSEESTSIGTRTP  1122

Query  314   ------------------LVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSP  198
                                VV  R+  A   DQ           I  VKSGH E  +L+P
Sbjct  1123  DYIGGTPSKPTVGRPSEATVVVGRM--AKEFDQRAQVFNDDAGFIVEVKSGHSEA-SLNP  1179

Query  197   KNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             ++ ++ K+KLRF+ WKKDYK RL+  KATL +L   +  KS   W
Sbjct  1180  ED-ELRKLKLRFEGWKKDYKVRLRETKATLHKLGDSNVEKSKKKW  1223



>ref|XP_011096207.1| PREDICTED: myosin-2-like [Sesamum indicum]
Length=425

 Score =   160 bits (405),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 111/319 (35%), Positives = 171/319 (54%), Gaps = 35/319 (11%)
 Frame = -3

Query  947  GVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKE  768
            G   IQ+ Y GH+ R YY EL+RG I LQSFVRGENAR+ Y++  TRLRAI+ IQKHM++
Sbjct  112  GASNIQKWYRGHKVRCYYKELRRGVIELQSFVRGENARRSYKYRSTRLRAIILIQKHMRK  171

Query  767  QQSRRL--EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPELKD----------  624
                R+  ++ AAVI L SG +         ++    ++ R +   E  D          
Sbjct  172  YFEHRVLEDEHAAVISLPSGCQD-------PRRSNGTMHERMLRTDEAGDSKNLGLVADP  224

Query  623  -EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSW  447
             + I+V   VL+DLQ++V  +EA +   ++EN +LK  + + +KK Q+YE +M+C+EKSW
Sbjct  225  KDRIQVPYGVLIDLQKQVLRSEAKVREKKEENTALKLQLQEMEKKWQQYEERMKCMEKSW  284

Query  446  QDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSD-----AGLVVNNRLDFA-  285
            QDQ   IQ  L AA ++      G  R +  S +    +  D     +GL     LDF+ 
Sbjct  285  QDQFTYIQKCLAAAKKNPAP---GSRRAQCNSMQRHCDQNHDTSTIVSGLPNGGSLDFSM  341

Query  284  -----SPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVV  120
                   +D+ + ++    T +         L P   ++ K+K RFK WKKDYK++L+  
Sbjct  342  NCISHHQVDRHDLAYSEDSTEIGPEMQVCSKLHPL-EELRKLKRRFKTWKKDYKNKLREA  400

Query  119  KATLKQLRHCDRGKST*IW  63
            +AT K+L + +  ++   W
Sbjct  401  QATFKKLGNSENARNQKNW  419



>ref|XP_010278386.1| PREDICTED: myosin-2 isoform X2 [Nelumbo nucifera]
Length=1084

 Score =   164 bits (414),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 183/357 (51%), Gaps = 53/357 (15%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
              + ED +   +Q G+ I+Q+ + G QAR Y+ EL RG   +QSFVRGENARK+YQ LV R
Sbjct  723   GVLEDARNRLLQ-GIVIVQKLFRGCQARRYFRELNRGISTMQSFVRGENARKEYQVLVKR  781

Query  806   LRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKK---ITSRL-NSRQM  645
              +A+  IQKH++ + + R   ++  A I +QS  R WL R  FN     + S L N +  
Sbjct  782   QKAVFLIQKHLRRKIALRKINDKQKAAILMQSATRAWLARRRFNDMKNLVNSNLSNEKPE  841

Query  644   LNPE-------LKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
              NP+       ++ E ++VQ S L +LQ+RV   EAAL +  +ENA L+  + Q++++  
Sbjct  842   ANPDKEIPQRDVEQEHVQVQSSALAELQKRVLKAEAALAQKEEENAKLQLQLQQYEQRWL  901

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRS---------------------EGVAENGLS  369
              YEAKM+ +E+ WQ Q+ S+Q SL AA +S                      G  E+   
Sbjct  902   HYEAKMKSMEEMWQKQITSLQMSLAAAKKSLVADEIAGQLGRPVASPVPHNNGYEESMSV  961

Query  368   RTEPPSERF-------------IPFERSDAGLVVNNRL--DFASPLDQENGSHQNMITWV  234
              T+ P +               +P   SD GL+  N+L  +F     Q        I  V
Sbjct  962   GTQNPDDTMRIILPNPLSGSGNVPGRVSDTGLIAVNQLRKEFEKR-KQVFDDDLECILEV  1020

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             KSG     N +P + ++ K+KLRF AWKKDYK RL   KA   +L + D  K+   W
Sbjct  1021  KSGQSTS-NRNP-DDELRKLKLRFMAWKKDYKIRLWETKAMSHKLGNSDMDKNHKKW  1075



>ref|XP_010278387.1| PREDICTED: myosin-1 isoform X3 [Nelumbo nucifera]
Length=1053

 Score =   163 bits (413),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 183/357 (51%), Gaps = 53/357 (15%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
              + ED +   +Q G+ I+Q+ + G QAR Y+ EL RG   +QSFVRGENARK+YQ LV R
Sbjct  692   GVLEDARNRLLQ-GIVIVQKLFRGCQARRYFRELNRGISTMQSFVRGENARKEYQVLVKR  750

Query  806   LRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKK---ITSRL-NSRQM  645
              +A+  IQKH++ + + R   ++  A I +QS  R WL R  FN     + S L N +  
Sbjct  751   QKAVFLIQKHLRRKIALRKINDKQKAAILMQSATRAWLARRRFNDMKNLVNSNLSNEKPE  810

Query  644   LNPE-------LKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
              NP+       ++ E ++VQ S L +LQ+RV   EAAL +  +ENA L+  + Q++++  
Sbjct  811   ANPDKEIPQRDVEQEHVQVQSSALAELQKRVLKAEAALAQKEEENAKLQLQLQQYEQRWL  870

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRS---------------------EGVAENGLS  369
              YEAKM+ +E+ WQ Q+ S+Q SL AA +S                      G  E+   
Sbjct  871   HYEAKMKSMEEMWQKQITSLQMSLAAAKKSLVADEIAGQLGRPVASPVPHNNGYEESMSV  930

Query  368   RTEPPSERF-------------IPFERSDAGLVVNNRL--DFASPLDQENGSHQNMITWV  234
              T+ P +               +P   SD GL+  N+L  +F     Q        I  V
Sbjct  931   GTQNPDDTMRIILPNPLSGSGNVPGRVSDTGLIAVNQLRKEFEKR-KQVFDDDLECILEV  989

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             KSG     N +P + ++ K+KLRF AWKKDYK RL   KA   +L + D  K+   W
Sbjct  990   KSGQSTS-NRNP-DDELRKLKLRFMAWKKDYKIRLWETKAMSHKLGNSDMDKNHKKW  1044



>ref|XP_010278385.1| PREDICTED: myosin-2 isoform X1 [Nelumbo nucifera]
Length=1248

 Score =   164 bits (414),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/357 (35%), Positives = 183/357 (51%), Gaps = 53/357 (15%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
              + ED +   +Q G+ I+Q+ + G QAR Y+ EL RG   +QSFVRGENARK+YQ LV R
Sbjct  887   GVLEDARNRLLQ-GIVIVQKLFRGCQARRYFRELNRGISTMQSFVRGENARKEYQVLVKR  945

Query  806   LRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKK---ITSRL-NSRQM  645
              +A+  IQKH++ + + R   ++  A I +QS  R WL R  FN     + S L N +  
Sbjct  946   QKAVFLIQKHLRRKIALRKINDKQKAAILMQSATRAWLARRRFNDMKNLVNSNLSNEKPE  1005

Query  644   LNPE-------LKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
              NP+       ++ E ++VQ S L +LQ+RV   EAAL +  +ENA L+  + Q++++  
Sbjct  1006  ANPDKEIPQRDVEQEHVQVQSSALAELQKRVLKAEAALAQKEEENAKLQLQLQQYEQRWL  1065

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRS---------------------EGVAENGLS  369
              YEAKM+ +E+ WQ Q+ S+Q SL AA +S                      G  E+   
Sbjct  1066  HYEAKMKSMEEMWQKQITSLQMSLAAAKKSLVADEIAGQLGRPVASPVPHNNGYEESMSV  1125

Query  368   RTEPPSERF-------------IPFERSDAGLVVNNRL--DFASPLDQENGSHQNMITWV  234
              T+ P +               +P   SD GL+  N+L  +F     Q        I  V
Sbjct  1126  GTQNPDDTMRIILPNPLSGSGNVPGRVSDTGLIAVNQLRKEFEKR-KQVFDDDLECILEV  1184

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             KSG     N +P + ++ K+KLRF AWKKDYK RL   KA   +L + D  K+   W
Sbjct  1185  KSGQSTS-NRNP-DDELRKLKLRFMAWKKDYKIRLWETKAMSHKLGNSDMDKNHKKW  1239



>ref|XP_006847798.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
 gb|ERN09379.1| hypothetical protein AMTR_s00029p00027850 [Amborella trichopoda]
Length=1164

 Score =   160 bits (404),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 114/314 (36%), Positives = 173/314 (55%), Gaps = 26/314 (8%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q+C+ GHQ R ++ ELK+G  VLQSFVRGE AR++Y+ L+
Sbjct  837   QIGVLEDTRNRTLH-GILGVQKCFRGHQVRGHFQELKKGVAVLQSFVRGERARREYEILI  895

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNK----KITSRLNSR  651
              R RA V IQ+ +K + +++   +   A + +QS IRGWL R         ++T ++N  
Sbjct  896   RRHRAAVVIQREVKRKVAKKHFTDYRDAAVVIQSVIRGWLVRRCSGNLSLLELTMKMNGL  955

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             +    EL    I ++   L +LQRRV   EA+L    +EN  L + + Q++ +  EYE+K
Sbjct  956   KDSGTEL----ITMKAWELAELQRRVVRAEASLREKDEENELLHQKLHQYESRWSEYESK  1011

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAEN-------GLSRTEPPSERFIPFERSDAGL  312
             M+ +E+ WQ+Q+ S+QT+L +A RS    E        G  + E    R +  E S AGL
Sbjct  1012  MKSMEEVWQNQMGSLQTTLASAKRSLEGDEGWNFGISPGQKKEEAAGSRHLEREMS-AGL  1070

Query  311   VVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDY  141
              V  RL  A   +      G   + +  VKSG  E   L P + ++ K+K  F AWKKDY
Sbjct  1071  SVIERL--AEEFEGRRRVFGDDADFLVEVKSGRAEA-GLDP-DIELRKLKRLFDAWKKDY  1126

Query  140   KSRLQVVKATLKQL  99
              SRL+  K+ L +L
Sbjct  1127  NSRLRETKSVLHKL  1140



>ref|XP_002281748.1| PREDICTED: myosin-2 [Vitis vinifera]
Length=1229

 Score =   159 bits (401),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 121/340 (36%), Positives = 168/340 (49%), Gaps = 43/340 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q G+ ++Q+ + G QAR Y+ ELK G   LQSF  GENAR+    LV
Sbjct  878   QIDELEDMRKQVLQ-GIIVVQKRFRGRQARRYFYELKGGVTTLQSFGHGENARRGNDVLV  936

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSR------LNSR  651
                RA +  QKHMK+Q + +     A+I LQS IRG L R  FN    S+       NSR
Sbjct  937   KTWRADIPTQKHMKQQVAPQTPDEGAIIHLQSVIRGLLARKHFNHMQGSKKLNLENANSR  996

Query  650   QMLNPELKD------EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
             Q  +  + D      E  +V  S L  LQ RV   EA L +  +ENA+L+E + Q + K 
Sbjct  997   QKSDRRISDVKDLPQEQGQVLPSDLSKLQHRVLKAEATLGQKEEENAALREQLKQSEAKW  1056

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG------------------LSRT  363
              EYEAKM+ +E++WQ Q+ S+Q SL AA ++    ++G                  +   
Sbjct  1057  SEYEAKMKAMEETWQKQMASLQMSLAAAKKNHAAGQDGRLDTPSSPGYYDSEGTPSMETR  1116

Query  362   EPPSERFIPFERSDAGLVVNNRLDFASPLDQE-------NGSHQNMITWVKSGHDEPLNL  204
              P +   +      AG   N  L+  S L +E              +  VKSG       
Sbjct  1117  TPGANTPVKLSNVGAGRESNGNLNTVSHLAKEFEQRKQSFDDDAKTLVEVKSGQPS----  1172

Query  203   SPKNSD-VHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCD  87
             S  N D + K+K RF+AWKKDYK RL+  KA L +L H +
Sbjct  1173  SNMNHDELKKLKQRFEAWKKDYKVRLRETKARLHKLGHSE  1212



>emb|CBI20376.3| unnamed protein product [Vitis vinifera]
Length=1197

 Score =   158 bits (399),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 121/340 (36%), Positives = 168/340 (49%), Gaps = 43/340 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q G+ ++Q+ + G QAR Y+ ELK G   LQSF  GENAR+    LV
Sbjct  846   QIDELEDMRKQVLQ-GIIVVQKRFRGRQARRYFYELKGGVTTLQSFGHGENARRGNDVLV  904

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSR------LNSR  651
                RA +  QKHMK+Q + +     A+I LQS IRG L R  FN    S+       NSR
Sbjct  905   KTWRADIPTQKHMKQQVAPQTPDEGAIIHLQSVIRGLLARKHFNHMQGSKKLNLENANSR  964

Query  650   QMLNPELKD------EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
             Q  +  + D      E  +V  S L  LQ RV   EA L +  +ENA+L+E + Q + K 
Sbjct  965   QKSDRRISDVKDLPQEQGQVLPSDLSKLQHRVLKAEATLGQKEEENAALREQLKQSEAKW  1024

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG------------------LSRT  363
              EYEAKM+ +E++WQ Q+ S+Q SL AA ++    ++G                  +   
Sbjct  1025  SEYEAKMKAMEETWQKQMASLQMSLAAAKKNHAAGQDGRLDTPSSPGYYDSEGTPSMETR  1084

Query  362   EPPSERFIPFERSDAGLVVNNRLDFASPLDQE-------NGSHQNMITWVKSGHDEPLNL  204
              P +   +      AG   N  L+  S L +E              +  VKSG       
Sbjct  1085  TPGANTPVKLSNVGAGRESNGNLNTVSHLAKEFEQRKQSFDDDAKTLVEVKSGQPS----  1140

Query  203   SPKNSD-VHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCD  87
             S  N D + K+K RF+AWKKDYK RL+  KA L +L H +
Sbjct  1141  SNMNHDELKKLKQRFEAWKKDYKVRLRETKARLHKLGHSE  1180



>gb|EYU19161.1| hypothetical protein MIMGU_mgv1a000383mg [Erythranthe guttata]
Length=1199

 Score =   157 bits (396),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 123/342 (36%), Positives = 182/342 (53%), Gaps = 53/342 (15%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             S+E   KQ  V +G   +Q+C+ GH+AR Y++ELK G + LQS+VRGE ARK+Y  L++ 
Sbjct  869   SLENVRKQ--VLQGTLEVQKCFRGHRARRYFHELKGGVVTLQSYVRGEIARKEYSILLS-  925

Query  806   LRAIVTIQKHMKEQQS-RRL-EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP-  636
                       +K+Q + ++L EQL AV+ +QS IRGWL R  F+    S+ ++     P 
Sbjct  926   ----------LKKQAACKKLDEQLMAVVQIQSVIRGWLVRRYFSSLQDSKESNVSKRRPG  975

Query  635   ----ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
                 E+KD  ++V  S++ +LQ+R+ +TEAAL R   ENA+L+E + QF+ +  EYE KM
Sbjct  976   RRSSEIKDLPLEVLPSIVEELQKRILMTEAALGRKEKENAALREQVQQFESRWSEYETKM  1035

Query  467   QCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTE------PPS------ERFIPFERS  324
             + +E+ WQ Q+ S+Q SL AA +S G  +N   + E       PS        F P   S
Sbjct  1036  KSMEEMWQKQMASLQMSLAAAKKSLGT-DNTTGQPEKHHGAQSPSFYDSEEMSFGPHTPS  1094

Query  323   DA--------GLVVNNRLDFASPLDQE------NGSHQ-NMITWVKSGHDEPLNLSPKNS  189
              +        G   N  L+  S L  E      N  H+   I  VKS   + +N      
Sbjct  1095  GSTPTRILNNGTNTNGGLNSISTLANEFEQSRRNFDHEAQAIVEVKSA--DTVN---SVE  1149

Query  188   DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             D+  +K +F+AWKKD+K RL+  KA   +L + D  K    W
Sbjct  1150  DIRSLKYKFEAWKKDFKVRLREAKAKAHRLGYGDAEKYRRKW  1191



>gb|KHF99826.1| Unconventional myosin-Va [Gossypium arboreum]
Length=1179

 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 115/325 (35%), Positives = 168/325 (52%), Gaps = 40/325 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQARH + EL+RG   LQSFVRGE  RK+Y  L+
Sbjct  844   QIGALEDTRNRTLH-GILRVQSCFRGHQARHCFKELQRGIATLQSFVRGEKTRKEYAVLL  902

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLT-RIEFNKKITSRLNSRQML  642
              R RA +TIQK +K +  R+   E   A + +QS IRGWL  R   N  +     S+   
Sbjct  903   QRHRAAITIQKQIKGRNGRKTFKEISDASVVIQSVIRGWLVRRCSGNTGLLKYGASKGN-  961

Query  641   NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
                 + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  962   ----ESDEVMVKGSFLAELQRRVLRAEAALREKEEENDILHQRLQQYESRWSEYELKMKS  1017

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAEN---------------------GLSRTEPPSER  345
             +E+ WQ Q+ S+Q+SL  A +S  V ++                     G +   P S  
Sbjct  1018  MEEVWQKQMRSLQSSLSIAKKSLAVDDSERNSDASVNNASDDREYSWDTGTNHNGPESNG  1077

Query  344   FIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
               P   + AGL V +RL  A   +Q +   G     +  VKSG  E  NL+P + ++ ++
Sbjct  1078  LRP---TSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLNP-DRELRRL  1130

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+ WKKDY  RL+  K  L +L
Sbjct  1131  KQMFETWKKDYSVRLRETKVVLNKL  1155



>ref|XP_008806763.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1252

 Score =   156 bits (395),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 126/366 (34%), Positives = 180/366 (49%), Gaps = 73/366 (20%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED +   + +G+  +Q+ + GHQA  Y+  LK+G   LQSFVRGE AR  ++ L+
Sbjct  874   QVAALEDARNHTL-RGILWVQKNFRGHQACRYFQALKKGVTTLQSFVRGEKARSKFKVLI  932

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR----IEFNKKITS----R  663
              R RA V IQKH++ + +R +  +Q   +I LQS IRGWL R    +  N+ ++     +
Sbjct  933   KRWRAAVLIQKHVRRRIARTMFDDQQKDIILLQSAIRGWLARNHLAVTKNRMMSKFDHVK  992

Query  662   LNSRQMLN-PELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
              NS    N PE+K    E  +V  SVL +LQRRV   EAA     +ENA LK+ +  ++ 
Sbjct  993   ANSDPDKNLPEMKGTNKEHSQVHPSVLAELQRRVLKAEAAWREKEEENAILKQQLQHYEM  1052

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENGLSRTEPPSERFI----  339
             +  EYEAKM+ +E++W+ QL S+Q SL AA +S    +  +  G     P    F     
Sbjct  1053  RWSEYEAKMKSMEETWKKQLTSLQVSLAAAKKSLTADDIASPQGRLDISPLQYSFDSEDT  1112

Query  338   --------------PFERSDAGLVVNN--RLDFASPLD--------QENGSHQ-------  252
                           PF  SDAGLV N+      AS LD          NG+         
Sbjct  1113  MFAGTHTPEGTPAKPFHASDAGLVRNSDGTQSAASHLDASDAGFARNSNGTQSAVSHLVK  1172

Query  251   -------------NMITWVKSGHDEPLNLSPKNSD--VHKVKLRFKAWKKDYKSRLQVVK  117
                            +  VKSG       S +N D  +HK+K RF  WKKD+K RL+  K
Sbjct  1173  EFEQQRQVFEDDAGFLLEVKSGQSG----SSRNPDEELHKLKARFVTWKKDFKVRLRETK  1228

Query  116   ATLKQL  99
               L++L
Sbjct  1229  IALRKL  1234



>ref|XP_006370337.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
 gb|ERP66906.1| hypothetical protein POPTR_0001s41770g [Populus trichocarpa]
Length=1192

 Score =   155 bits (392),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 113/353 (32%), Positives = 179/353 (51%), Gaps = 58/353 (16%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++EE  KQ    +G+  +Q+ + G QARH ++ELK+G ++LQSFVRGEN R+ +  +  +
Sbjct  850   TLEEQRKQFL--QGIVGVQKYFRGGQARHNFHELKQGVMILQSFVRGENLRRKFNHIKKK  907

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKK------ITSRLNSRQM  645
               A   I            EQL A + LQS IRGWL R  FN        I    NS++ 
Sbjct  908   CTARAPIAMD---------EQLVAAVYLQSVIRGWLARKHFNNMHKMKWLIHENSNSKRK  958

Query  644   LNPELKD------EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
                ++ +      E I +Q S+L +LQ+RV   EA + +  +ENA+L+E + Q++K+  +
Sbjct  959   PGKKISEVKVIPQEQIDIQTSILAELQKRVVKAEATIGQKEEENAALQEQLQQYEKRWSD  1018

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRS---------EGVAENGLSRTEPPSERFIPFE  330
             YEAKM+ +E+ WQ Q++S+QTSL AA +S          G  ++  S  +  SE  +  E
Sbjct  1019  YEAKMKAMEEMWQMQMLSLQTSLAAARKSLAADNTAAQPGKLDSSTSPRDYDSEDNVSME  1078

Query  329   RSDAGLVVNNRLDFASP---LDQENGSHQNMITW---------------------VKSGH  222
                 G    N    A P     +EN    N++                       V++G 
Sbjct  1079  SRTPGGNTPNIFANAFPDLRAGRENNGSVNVVNTLAKEFELQKQNFDDDAKALVEVRAGQ  1138

Query  221   DEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                 N++P + ++ ++KL+F+ WKKDYK RL+  KA L +L H +  ++   W
Sbjct  1139  SAS-NMNP-DEELRRLKLKFETWKKDYKVRLRETKARLHKLGHGEVDRNRRKW  1189



>ref|XP_009622620.1| PREDICTED: myosin-1-like [Nicotiana tomentosiformis]
Length=1151

 Score =   155 bits (392),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 118/329 (36%), Positives = 173/329 (53%), Gaps = 34/329 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+ + ED +   +  G+  +Q C+ GHQAR +  +L RG   LQSFVRGE ARK+Y  L+
Sbjct  817   QVGVLEDTRNRTLH-GILRVQSCFRGHQARRHLKQLGRGIATLQSFVRGEKARKEYAILL  875

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K +  R+  +    A I +QS IRGWL R     + +  +   Q   
Sbjct  876   QRHRAAVCIQKQIKYRTKRKTYRNIHNASIVIQSVIRGWLVR-----RCSGDIGLLQFGG  930

Query  638   PELKD-EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + E++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  931   RKGNESEEVLVKSSFLAELQRRVLRAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  990

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-----------  324
             +E+ WQ Q+ S+Q+SL  A RS  + +   N  +   P  E+   +E             
Sbjct  991   MEEIWQKQMRSLQSSLSIAKRSLTLDDSRRNSDASVNPTDEKESSWETGSNHRARESNGA  1050

Query  323   ---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +RL  A   +Q +   G     +  VKSG  E  NL+P + ++ ++K  F
Sbjct  1051  RPMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLNP-DRELRRLKQMF  1106

Query  161   KAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             +AWKKDY SRL+  K  L +L   D G S
Sbjct  1107  EAWKKDYGSRLRETKVILNKL-GSDEGAS  1134



>ref|XP_007043232.1| Myosin 1 isoform 2 [Theobroma cacao]
 gb|EOX99063.1| Myosin 1 isoform 2 [Theobroma cacao]
Length=920

 Score =   154 bits (390),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 115/323 (36%), Positives = 171/323 (53%), Gaps = 37/323 (11%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q C+ GHQAR Y+ EL+RG   LQSFV+GE  RK+Y  L+
Sbjct  586  QIGVLEDTRNHTLH-GILRVQSCFRGHQARCYFKELQRGIATLQSFVKGEKTRKEYAVLL  644

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
             R RA V IQK +K + +R + + ++ A I +QS IRGWL R   +  I    +     N
Sbjct  645  QRHRAAVVIQKQIKSRNARKKFKNISHASIVIQSVIRGWLVR-RCSGDIGLLTSGGCKAN  703

Query  638  PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
               + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  704  ---ESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSM  760

Query  458  EKSWQDQLMSIQTSLGAASRSEGVAEN--------------------GLSRTEPPSERFI  339
            E+ WQ Q+ S+Q+SL  A +S  V E+                    G +   P S    
Sbjct  761  EEVWQKQMRSLQSSLSIAKKSLAVDESERNSDASVNASDDREYSWDTGSNHKGPESNGLR  820

Query  338  PFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKL  168
            P     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K 
Sbjct  821  PM---SAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRLKQ  873

Query  167  RFKAWKKDYKSRLQVVKATLKQL  99
             F+ WKKDY SRL+  K  L +L
Sbjct  874  MFETWKKDYASRLRETKVILNKL  896



>gb|AAB71526.1| unconventional myosin [Helianthus annuus]
Length=1120

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 168/326 (52%), Gaps = 34/326 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+AR Y  ELKRG   LQ+F RGE  RK++  LV
Sbjct  785   QIGKLEDTRNRTLN-GILRVQSCFRGHKARQYMKELKRGIFNLQAFARGEKTRKEFAILV  843

Query  812   TRLRAIVTIQKHMKEQQS-RRLEQL-AAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQKH+K + S +R E +  A I LQ+ IRGWL R     + +  +   Q  +
Sbjct  844   HRHRAAVHIQKHIKAKISKKRFEDVHGATITLQAVIRGWLVR-----RCSGDIALLQFGS  898

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +    D + V+ S L +LQRR+   EA L    +EN  L + + Q++ +  EYE KM+ 
Sbjct  899   GKGNGSDEVLVKSSYLAELQRRILKAEAGLREKEEENDILHQRLQQYENRWSEYELKMKS  958

Query  461   LEKSWQDQLMSIQTSLGAASR----------SEGVAENGLSRTEPPSERFIPFERS----  324
             +E+ WQ Q+ S+Q+SL  A +          S+         T PP +      R+    
Sbjct  959   MEEVWQKQMRSLQSSLSIAKKSLSYDDSERNSDASINTANDETNPPWDAATNGRRNGVEN  1018

Query  323   ----DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                  AGL V +RL  A   +Q +   G     +  VKSG  E  NL+P + ++ ++K  
Sbjct  1019  VRPMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLNP-DHELRRLKQM  1074

Query  164   FKAWKKDYKSRLQVVKATLKQLRHCD  87
             F+ WKKDY +RL+  K  L +L H D
Sbjct  1075  FEGWKKDYTARLRETKVILNKLGHED  1100



>ref|XP_011022005.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022006.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022007.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011022008.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1173

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 168/320 (53%), Gaps = 31/320 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  E KRG  VLQSFVRGE  RK+Y  L 
Sbjct  839   QIGVLEDTRNHTLH-GILRVQSCFRGHQARAYLREFKRGICVLQSFVRGEKIRKEYAILQ  897

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ+H+K    R+   +   A I +QS IRGWL R  F+  +   L S     
Sbjct  898   QRHRAAVVIQRHIKSTIRRKKYKDMHQASIIIQSVIRGWLVR-RFSGDV-GLLKSGATKG  955

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
              E   +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  956   NE--SDEVLVKASFLAELQRRVLKAEAALREKEEENDVLHQRLQQYENRWSEYELKMKSM  1013

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++              
Sbjct  1014  EEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERECSWDTGSNHRGQESNSAR  1073

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AGL V +R+  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F+
Sbjct  1074  PMSAGLSVISRM--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRLKQMFE  1129

Query  158   AWKKDYKSRLQVVKATLKQL  99
             AWKKDY SRL+  K  L +L
Sbjct  1130  AWKKDYGSRLRETKVILNKL  1149



>ref|XP_011022009.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1118

 Score =   154 bits (390),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 116/320 (36%), Positives = 168/320 (53%), Gaps = 31/320 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  E KRG  VLQSFVRGE  RK+Y  L 
Sbjct  784   QIGVLEDTRNHTLH-GILRVQSCFRGHQARAYLREFKRGICVLQSFVRGEKIRKEYAILQ  842

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ+H+K    R+   +   A I +QS IRGWL R  F+  +   L S     
Sbjct  843   QRHRAAVVIQRHIKSTIRRKKYKDMHQASIIIQSVIRGWLVR-RFSGDV-GLLKSGATKG  900

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
              E   +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  901   NE--SDEVLVKASFLAELQRRVLKAEAALREKEEENDVLHQRLQQYENRWSEYELKMKSM  958

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++              
Sbjct  959   EEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERECSWDTGSNHRGQESNSAR  1018

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AGL V +R+  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F+
Sbjct  1019  PMSAGLSVISRM--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRLKQMFE  1074

Query  158   AWKKDYKSRLQVVKATLKQL  99
             AWKKDY SRL+  K  L +L
Sbjct  1075  AWKKDYGSRLRETKVILNKL  1094



>ref|XP_010324344.1| PREDICTED: myosin-2-like isoform X2 [Solanum lycopersicum]
Length=1177

 Score =   154 bits (389),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 119/350 (34%), Positives = 180/350 (51%), Gaps = 57/350 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ GH+AR +++ELK G I+LQSF+RGE  R+ Y    
Sbjct  839   QIASLEDARNQVLQGTLEL-QKCFRGHRARRHFHELKGGVIILQSFIRGEIERRLYN---  894

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN--  639
             T++ +   + +   +      EQL AV+ +QS IRGWL R    K     L + +MLN  
Sbjct  895   TKVMSKAKVAREGSD------EQLVAVVQIQSAIRGWLARRGLRK-----LRNSKMLNVD  943

Query  638   -------PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
                     E+K+   ++  SV+ DL+RRVA  EA  E+   ENA+LKE + QF+ +  EY
Sbjct  944   KRRSGRKTEVKELPREILPSVVEDLERRVAKAEATTEQKEKENAALKEQVNQFETRCLEY  1003

Query  479   EAKMQCLEKSWQDQLMSIQTSLGAASRS-------------EGV-------AENGLSRTE  360
             E KM+ +E+ WQ Q+ S+Q SL AA  S             EG        +++  S   
Sbjct  1004  EVKMRSMEEMWQKQMTSLQVSLAAARNSLTAADTTGRPGKLEGSPSPQYYDSDDATSMDT  1063

Query  359   PPSERFIPFERSDAGLV----VNNRLDFASPLDQE------NGSHQNM-ITWVKSGHDEP  213
             P     + F  +  G+V    VN  L   S L  E      N  ++ M I  +K G  + 
Sbjct  1064  PAGRTPVSFSNNSLGVVANREVNGGLSLISHLAMEFEQRKQNFDNEAMAIVHLKPGQLQS  1123

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              N +P + +  ++K RF+ WKK+YK RL+  K+ + +L H   GKS   W
Sbjct  1124  TN-NPAD-EYRRLKHRFEEWKKEYKVRLKETKSKVHKLVHSKAGKSRRKW  1171



>ref|XP_007043231.1| Myosin 1 isoform 1 [Theobroma cacao]
 gb|EOX99062.1| Myosin 1 isoform 1 [Theobroma cacao]
Length=1153

 Score =   154 bits (388),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 115/323 (36%), Positives = 171/323 (53%), Gaps = 37/323 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y+ EL+RG   LQSFV+GE  RK+Y  L+
Sbjct  819   QIGVLEDTRNHTLH-GILRVQSCFRGHQARCYFKELQRGIATLQSFVKGEKTRKEYAVLL  877

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K + +R + + ++ A I +QS IRGWL R   +  I    +     N
Sbjct  878   QRHRAAVVIQKQIKSRNARKKFKNISHASIVIQSVIRGWLVR-RCSGDIGLLTSGGCKAN  936

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  937   ---ESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSM  993

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAEN--------------------GLSRTEPPSERFI  339
             E+ WQ Q+ S+Q+SL  A +S  V E+                    G +   P S    
Sbjct  994   EEVWQKQMRSLQSSLSIAKKSLAVDESERNSDASVNASDDREYSWDTGSNHKGPESNGLR  1053

Query  338   PFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKL  168
             P     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K 
Sbjct  1054  PMS---AGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRLKQ  1106

Query  167   RFKAWKKDYKSRLQVVKATLKQL  99
              F+ WKKDY SRL+  K  L +L
Sbjct  1107  MFETWKKDYASRLRETKVILNKL  1129



>ref|XP_010103613.1| Myosin-2 heavy chain [Morus notabilis]
 gb|EXB96390.1| Myosin-2 heavy chain [Morus notabilis]
Length=1149

 Score =   153 bits (386),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 112/321 (35%), Positives = 169/321 (53%), Gaps = 34/321 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ GHQAR Y  EL+RG   LQSFVRGE AR++Y+  V
Sbjct  816   QIGVLEDTRNRTLH-GVLRVQSCFRGHQARCYLKELRRGITTLQSFVRGEKARREYEVSV  874

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLA--AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ+ +K + +R+  +    A I +QS IRGWL R     + +  +   ++  
Sbjct  875   QRHRAAVIIQRKIKNRIARKNLKSTHDASIVIQSAIRGWLVR-----RYSGDIGLLKLTG  929

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + D + V+ SVL +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  930   TKANESDEVLVKASVLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  989

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-----------  324
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++             
Sbjct  990   MEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASEDREYSWDTGSHKGQESNGVR  1049

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDVHKVKLRF  162
                AGL V +RL  A   +Q +   G     +  VKSG  D  LN    + ++ ++K  F
Sbjct  1050  PMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVDASLN---PDKELRRLKQMF  1104

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY  RL+  K  L +L
Sbjct  1105  EAWKKDYGGRLRETKVILHKL  1125



>ref|XP_010067014.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 ref|XP_010067015.1| PREDICTED: myosin-1 [Eucalyptus grandis]
 gb|KCW65077.1| hypothetical protein EUGRSUZ_G02585 [Eucalyptus grandis]
Length=1175

 Score =   152 bits (385),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 112/321 (35%), Positives = 172/321 (54%), Gaps = 34/321 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+ + ED +   +  G+  +Q C+ GHQAR +  +LK+G + LQSFVRG+ ARK+Y  L+
Sbjct  842   QVGVLEDTRNRTLH-GILRVQSCFRGHQARLHLRKLKKGIVTLQSFVRGQKARKEYAVLI  900

Query  812   TRLRAIVTIQKHMKEQQS-RRLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA VTIQK +K + S ++  +L  A + +QSGIRGWL R     + +  +   +   
Sbjct  901   KRHRAAVTIQKRVKGRVSMKKYHKLCDASVMVQSGIRGWLVR-----RCSGDIGFLKSGM  955

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ED+ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  956   KGGEPEDVLVKASYLAELQRRVLRAEAALREKEEENDILHQRLQQYESRWSEYELKMKSM  1015

Query  458   EKSWQDQLMSIQTSLGAASRSEGV---AENGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  +   A N  +      +R   ++              
Sbjct  1016  EEVWQKQMRSLQSSLSIAKKSLAIDDSARNSDASVNNSDDRDSNWDTGSSYKGQDSNGMR  1075

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDVHKVKLRF  162
               +AGL V +RL  A   +Q +   G     +  VKSG  D  LN    + ++ ++K  F
Sbjct  1076  PMNAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVDASLN---PDRELRRLKQMF  1130

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY  RL+  K  L +L
Sbjct  1131  EAWKKDYGVRLRETKVILHKL  1151



>ref|XP_007142759.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14753.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=745

 Score =   150 bits (380),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 173/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q C+ GH+AR Y  EL RG   LQSF+RGE +RK+Y  L+
Sbjct  411  QIGVLEDTRNRTLH-GILRVQSCFRGHRARCYRKELWRGITTLQSFIRGEKSRKEYADLL  469

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             R RA V IQK MK   +R R++    A + +QS IRGWL R     I  +K   ++ N 
Sbjct  470  HRHRAAVIIQKRMKTVFARNRMKSTKEAAVFIQSFIRGWLVRRCSGNIGLSKSGVTKAN-  528

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                    + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q+D +  EYE 
Sbjct  529  --------ESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYDSRWSEYEL  580

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE---------  330
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++         
Sbjct  581  KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDERDFSWDVGTNHRRQE  640

Query  329  ----RS-DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                RS  AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  641  SNGVRSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  696

Query  173  KLRFKAWKKDYKSRLQVVKATLKQL  99
            K  F+AWKKDY +RL+  K  L +L
Sbjct  697  KQMFEAWKKDYNARLRETKVILHKL  721



>ref|XP_011012310.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
 ref|XP_011012311.1| PREDICTED: myosin-1-like isoform X1 [Populus euphratica]
Length=1198

 Score =   152 bits (385),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 171/328 (52%), Gaps = 36/328 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSFVRGE  RK+Y  L 
Sbjct  853   QIGVLEDTRNRTLH-GILRVQSCFRGHQARSYLRELRRGVCALQSFVRGEKFRKEYAVLQ  911

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQ+H+K    R + E +  A I +QS IRGWL R     +   K   S+L  
Sbjct  912   QRHRAAVVIQRHIKSTICRKKYENMHQASILIQSVIRGWLVRRFSGDVGLLKSGASKLRY  971

Query  653   RQMLNPELKDE--DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
               + + +  +E  ++ ++ S L +LQRRV   EAAL    +EN  L + + Q++ +  EY
Sbjct  972   LTIRSSQQGNESDEVLMKASYLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEY  1031

Query  479   EAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---SRTEPPSERFIPFERS-----  324
             E KM+ +E+ WQ Q+ S+Q+SL  A +S  V ++G    +      ER + ++       
Sbjct  1032  ELKMKSMEEVWQKQMRSLQSSLSIAKKSLSVDDSGRNSDASVNASDERDVSWDTGSNHRG  1091

Query  323   ---------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDV  183
                       AG  V +RL  A   +Q +   G     +  VKSG  D  +N    + ++
Sbjct  1092  QENNGVRPISAGFSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVDASMN---ADREL  1146

Query  182   HKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              ++K  F+AWKKDY SRL+  K  L +L
Sbjct  1147  RRLKQMFEAWKKDYGSRLRETKLILNKL  1174



>ref|XP_011012313.1| PREDICTED: myosin-1-like isoform X3 [Populus euphratica]
Length=1185

 Score =   152 bits (384),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 115/328 (35%), Positives = 171/328 (52%), Gaps = 36/328 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSFVRGE  RK+Y  L 
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSCFRGHQARSYLRELRRGVCALQSFVRGEKFRKEYAVLQ  898

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQ+H+K    R + E +  A I +QS IRGWL R     +   K   S+L  
Sbjct  899   QRHRAAVVIQRHIKSTICRKKYENMHQASILIQSVIRGWLVRRFSGDVGLLKSGASKLRY  958

Query  653   RQMLNPELKDE--DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
               + + +  +E  ++ ++ S L +LQRRV   EAAL    +EN  L + + Q++ +  EY
Sbjct  959   LTIRSSQQGNESDEVLMKASYLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEY  1018

Query  479   EAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---SRTEPPSERFIPFERS-----  324
             E KM+ +E+ WQ Q+ S+Q+SL  A +S  V ++G    +      ER + ++       
Sbjct  1019  ELKMKSMEEVWQKQMRSLQSSLSIAKKSLSVDDSGRNSDASVNASDERDVSWDTGSNHRG  1078

Query  323   ---------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDV  183
                       AG  V +RL  A   +Q +   G     +  VKSG  D  +N    + ++
Sbjct  1079  QENNGVRPISAGFSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVDASMN---ADREL  1133

Query  182   HKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              ++K  F+AWKKDY SRL+  K  L +L
Sbjct  1134  RRLKQMFEAWKKDYGSRLRETKLILNKL  1161



>ref|XP_010905572.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1243

 Score =   152 bits (384),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 122/364 (34%), Positives = 182/364 (50%), Gaps = 70/364 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED +   +Q  +  +Q+ + GHQAR YY  LK+G   LQSFVRGE AR +++  +
Sbjct  866   QVAALEDARNRTLQ-AILWVQKKFRGHQARRYYQALKKGVTTLQSFVRGEKARCEFEVSM  924

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEF----NKKIT----SR  663
              R +A + IQKH++ Q +R +   Q   +I LQ  IRGWL R  F    N++I+     +
Sbjct  925   KRWKAAILIQKHVRRQIARTMFDNQQKDIILLQCVIRGWLARNRFVHLKNQEISELDHGK  984

Query  662   LNSRQMLNP-ELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
             +N+    +P E+KD   E  +V  SVL +LQRR    EA L    +ENA LK+ + Q++ 
Sbjct  985   VNTDANEDPPEMKDTNEEHSQVHPSVLAELQRRALKAEALLREKEEENAILKQQLQQYEM  1044

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENGLSRTEPPSERF-----  342
             +  EYEAKM+ +E++WQ QL S+Q SL AA +S    +  +  G     P    +     
Sbjct  1045  RWSEYEAKMKFMEETWQKQLSSLQVSLAAARKSLADDDMASHQGKLDASPVQHSYDSEDA  1104

Query  341   ----------IPFERS---DAGLVVNN--------RLDF--ASPLDQENGSHQNM-----  246
                        P +RS   DAG+V N+         LD   A  +   NG+   +     
Sbjct  1105  ISAGTRTPEGTPAKRSHACDAGVVRNSNGTWSAVKHLDASDAGLIRYSNGTQSAVSHLVK  1164

Query  245   ---------------ITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKAT  111
                            +  VKS  D  +N    + ++ K+K RF  WKKDYK RL+  K  
Sbjct  1165  EFEQQTQVFEDDAVFLVEVKSRQDSSIN---PDEELQKLKARFVTWKKDYKVRLKETKIA  1221

Query  110   LKQL  99
             L++L
Sbjct  1222  LQKL  1225



>ref|XP_009783184.1| PREDICTED: myosin-1-like [Nicotiana sylvestris]
Length=1151

 Score =   152 bits (384),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 117/329 (36%), Positives = 172/329 (52%), Gaps = 34/329 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+ + ED +   +  G+  +Q C+ GHQAR +  +L RG   LQSFVRGE ARK+Y  L+
Sbjct  817   QVGVLEDTRNRTLH-GILRVQSCFRGHQARRHLKQLGRGIATLQSFVRGEKARKEYAILL  875

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ  +K +  R+  +    A I +QS IRGWL R     + +  +   Q   
Sbjct  876   QRHRAAVCIQTQIKCRTKRKTYRNIHDASIVIQSVIRGWLVR-----RCSGDIGLLQFGG  930

Query  638   PELKD-EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + E++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  931   RKGNESEEVLVKSSFLAELQRRVLRAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  990

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-----------  324
             +E+ WQ Q+ S+Q+SL  A RS  + +   N  +   P  E+   +E             
Sbjct  991   MEEIWQKQMRSLQSSLSIAKRSLTLDDSRRNSDASVNPTDEKESSWETGSNHRARESNGA  1050

Query  323   ---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +RL  A   +Q +   G     +  VKSG  E  NL+P + ++ ++K  F
Sbjct  1051  RPMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLNP-DRELRRLKQMF  1106

Query  161   KAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             +AWKKDY SRL+  K  L +L   D G S
Sbjct  1107  EAWKKDYGSRLRETKVILNKL-GSDEGAS  1134



>ref|XP_006345301.1| PREDICTED: myosin-1-like [Solanum tuberosum]
Length=1157

 Score =   152 bits (383),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 116/329 (35%), Positives = 171/329 (52%), Gaps = 34/329 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR      +RG   LQSFVRGE ARK+Y  L+
Sbjct  823   QIGVLEDTRNRTLH-GILRVQSCFRGHQARRDLKHFRRGIATLQSFVRGEKARKEYAILL  881

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLA--AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              + +A V IQK ++ +  R+  +    A I +QS IRGWL R     + +  +   Q   
Sbjct  882   QKHKAAVCIQKQIRGRTKRKTYENVHDASIVIQSVIRGWLVR-----RCSGDIGLLQFGG  936

Query  638   PELKD-EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + E++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  937   RKGNESEEVLVKSSFLAELQRRVLRAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  996

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-----------  324
             +E+ WQ Q+ S+Q+SL  A RS  + +   N  +   P  E+   +E             
Sbjct  997   MEEIWQKQMRSLQSSLSIAKRSLALDDSRRNSDASVNPTDEKESSWETGSNQRARESNGV  1056

Query  323   ---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +RL  A   +Q +   G     +  VKSG  E  NLSP + ++ ++K  F
Sbjct  1057  RPMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLSP-DRELRRLKQMF  1112

Query  161   KAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             +AWKKDY SRL+  K  L +L   D G S
Sbjct  1113  EAWKKDYGSRLRETKVILNKL-GSDEGGS  1140



>emb|CDP18554.1| unnamed protein product [Coffea canephora]
Length=1129

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 115/321 (36%), Positives = 171/321 (53%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+QAR +   L+RG   LQSF+RGE ARK+Y  L+
Sbjct  795   QIGVLEDTRNRTLH-GILRVQSCFRGYQARCHIRNLRRGIATLQSFIRGEKARKEYAILL  853

Query  812   TRLRAIVTIQKHMKEQQS-RRLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K + + +R + ++ A I +QS IRGWL R     + +  +   Q  +
Sbjct  854   ERHRAAVCIQKQVKARHTTKRFKNVSDASILIQSVIRGWLVR-----RCSGDIGLLQFGS  908

Query  638   P-ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
               +   ED+ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  909   EKDNGSEDVLVKSSYLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  968

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---------NGLSRTEPPSERFIPFERSD----  321
             +E+ WQ Q+ S+Q+SL  A +S  + +         N     E   +    F  SD    
Sbjct  969   MEEVWQKQMRSLQSSLSIAKKSLALDDSHRNSDASVNASDDRETSWDAGSNFRVSDSNGM  1028

Query  320   ----AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +RL  A   +Q +   G     +  VKSG  E  NL P + ++ ++K  F
Sbjct  1029  RPMNAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQAEA-NLDP-DRELRRLKQMF  1084

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY SRL+  K  L +L
Sbjct  1085  EAWKKDYGSRLRETKVILHKL  1105



>ref|XP_002307152.1| myosin-related family protein [Populus trichocarpa]
 gb|EEE94148.1| myosin-related family protein [Populus trichocarpa]
Length=1173

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 116/322 (36%), Positives = 170/322 (53%), Gaps = 35/322 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  ELKRG  VLQSFVRGE  RK+Y    
Sbjct  839   QIGVLEDTRNHTLH-GILRVQSCFRGHQARAYLRELKRGICVLQSFVRGEKIRKEYAVSQ  897

Query  812   TRLRAIVTIQKHMKE----QQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQM  645
              R RA V IQ+H+K     ++ + + Q  A I +QS IRGWL R  F+  +   L S   
Sbjct  898   QRHRAAVVIQRHIKSTICGKKYKDMHQ--ASIMIQSVIRGWLVR-RFSGDV-GLLKSGAT  953

Query  644   LNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQ  465
                E   +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+
Sbjct  954   KGNE--SDEVLVKASFLAELQRRVLKAEAALREKEEENDVLHQRLQQYENRWSEYELKMK  1011

Query  464   CLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS----------  324
              +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++            
Sbjct  1012  SMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEREFSWDTGSNHRGQESNS  1071

Query  323   ----DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                  AGL V +R+  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  
Sbjct  1072  ARPMSAGLSVISRM--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRLKQM  1127

Query  164   FKAWKKDYKSRLQVVKATLKQL  99
             F+AWKKDY SRL+  K  L +L
Sbjct  1128  FEAWKKDYGSRLRETKVILNKL  1149



>ref|XP_002525757.1| myosin vIII, putative [Ricinus communis]
 gb|EEF36593.1| myosin vIII, putative [Ricinus communis]
Length=1223

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 115/359 (32%), Positives = 179/359 (50%), Gaps = 54/359 (15%)
 Frame = -3

Query  983   IEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRL  804
             +EE  KQ  V +G+  +Q+ + G Q R   NELKRG  ++QSFVRGENAR++Y  +  R 
Sbjct  868   LEESRKQ--VLQGILGVQKYFRGSQVRRDLNELKRGVTIIQSFVRGENARRNYNSIANRC  925

Query  803   RAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQMLN  639
                      M +++      L AVI LQS IRGWL R +F+     K++   +NSR+   
Sbjct  926   AFRNEGPPTMVDKK------LMAVIFLQSAIRGWLARKQFSDKRKLKELHENINSRRKHV  979

Query  638   PELKD------EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYE  477
              ++ +      E + +Q  +L +L RRVA  E AL +  DENASL+E + QF+++  EYE
Sbjct  980   KKISEVKVLPQEQVDIQAMILTELHRRVAKAEVALLQKEDENASLREQLQQFERRWSEYE  1039

Query  476   AKMQCLEKSWQDQLMSIQTSLGAASRSEGV--------------------AENGLSR---  366
              KM+ +E++WQ Q+ S+Q SL AA +S                       +E+ +S    
Sbjct  1040  TKMKTMEQTWQMQMESLQASLAAARKSLAADSTAGQHGKLESFSSPHYYDSEDNMSTGVQ  1099

Query  365   ---TEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN-------GSHQNMITWVKSGHDE  216
                +  P++  I       G   N  ++  S L +E          H   +  VK G   
Sbjct  1100  TPGSNTPNKSSIAIPDVKLGRETNGSINAVSILAKEFEQQRQNFDDHAKALAEVKLGQQS  1159

Query  215   PLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST-*IWCTMAPCG  42
               + +P + ++ K+K+RF+ WKKDYK RL+  K  L ++   +  + T   W  + P G
Sbjct  1160  ASDKNP-DEELRKLKIRFEDWKKDYKVRLRETKVRLHKVGRGEGDRRTRRWWGKIGPRG  1217



>ref|XP_011012312.1| PREDICTED: myosin-1-like isoform X2 [Populus euphratica]
Length=1187

 Score =   152 bits (383),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 168/321 (52%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSFVRGE  RK+Y  L 
Sbjct  853   QIGVLEDTRNRTLH-GILRVQSCFRGHQARSYLRELRRGVCALQSFVRGEKFRKEYAVLQ  911

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ+H+K    R + E +  A I +QS IRGWL R  F+  +    +     N
Sbjct  912   QRHRAAVVIQRHIKSTICRKKYENMHQASILIQSVIRGWLVR-RFSGDVGLLKSGASKGN  970

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + +++ ++ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  971   ---ESDEVLMKASYLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKSM  1027

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAENGL---SRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  V ++G    +      ER + ++              
Sbjct  1028  EEVWQKQMRSLQSSLSIAKKSLSVDDSGRNSDASVNASDERDVSWDTGSNHRGQENNGVR  1087

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDVHKVKLRF  162
                AG  V +RL  A   +Q +   G     +  VKSG  D  +N    + ++ ++K  F
Sbjct  1088  PISAGFSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVDASMN---ADRELRRLKQMF  1142

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY SRL+  K  L +L
Sbjct  1143  EAWKKDYGSRLRETKLILNKL  1163



>ref|XP_011095261.1| PREDICTED: LOW QUALITY PROTEIN: myosin-2-like [Sesamum indicum]
Length=1028

 Score =   151 bits (381),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 116/345 (34%), Positives = 185/345 (54%), Gaps = 45/345 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q  +E+ Q+C+ GH+AR Y++ELK G + LQS+VRGE ARK+Y    
Sbjct  686   QIGSLEDVRKQVLQGTLEV-QKCFRGHRARQYFHELKEGVVTLQSYVRGELARKEYN---  741

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP-  636
                 A++++++ +  ++    +QL AV+ +QS IRGWL R   ++   S+ ++     P 
Sbjct  742   ----ALLSLKEQVACKKLNLDKQLMAVVQIQSVIRGWLVRRRSSRIRNSKQSNVSKRKPG  797

Query  635   ----ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
                 E+KD   ++  SV+ +L +RV + EAAL R   ENA+L+E + QF+ +  EYE+KM
Sbjct  798   RRISEVKDLSPEMLPSVVEELHKRVVMAEAALGRKERENAALREQVQQFEARWLEYESKM  857

Query  467   QCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIP-FERS-DAGL------  312
             + +E+ WQ Q+ S+Q SL AA+R   V +N +S+     +  +P F  S D  L      
Sbjct  858   KSMEEMWQKQMASLQMSL-AAARKSLVTDNTISQPGKHHDAQLPNFNDSEDTSLGPQTPD  916

Query  311   -------VVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLN-------------LSPKN  192
                     +NN +  A+  D+ NG H  +   +K       N             ++P N
Sbjct  917   AAAPPIRYLNNGIKAAASGDK-NGGHDPVSPLMKEFEQRKRNFDNEVQAIVEVKSVAPLN  975

Query  191   --SDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                +V K+K RF  WKKDYK RL+  KA  +++ H +  K    W
Sbjct  976   PTEEVRKLKHRFDVWKKDYKFRLREAKAKAQRMGHAEAEKHRRNW  1020



>ref|XP_004231522.1| PREDICTED: myosin-1 [Solanum lycopersicum]
Length=1157

 Score =   151 bits (382),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 115/329 (35%), Positives = 171/329 (52%), Gaps = 34/329 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR      +RG   LQS+VRGE ARK+Y  L+
Sbjct  823   QIGVLEDTRNRTLH-GILCVQSCFRGHQARRDLKHFQRGIATLQSYVRGEKARKEYAILL  881

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLA--AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              + +A V IQK ++ +  R+  +    A I +QS IRGWL R     + +  +   Q   
Sbjct  882   QKHKAAVCIQKQIRGRTKRKTYENVHDASIVIQSVIRGWLVR-----RCSGDIGLLQFGG  936

Query  638   PELKD-EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + E++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  937   RKGNESEEVLVKSSFLAELQRRVLRAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  996

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-----------  324
             +E+ WQ Q+ S+Q+SL  A RS  + +   N  +   P  E+   +E             
Sbjct  997   MEEIWQKQMRSLQSSLSIAKRSLALDDSRRNSDASVNPTDEKESSWETGSNQRARESNGV  1056

Query  323   ---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +RL  A   +Q +   G     +  VKSG  E  NLSP + ++ ++K  F
Sbjct  1057  RPMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLSP-DRELRRLKQMF  1112

Query  161   KAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             +AWKKDY SRL+  K  L +L   D G S
Sbjct  1113  EAWKKDYGSRLRETKVILNKL-GSDEGGS  1140



>ref|XP_004497240.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1176

 Score =   151 bits (381),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 172/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+QAR + NEL RG   LQSF+RGE +RK +  L+
Sbjct  842   QIGVLEDTRNRTLH-GILRVQSCFRGYQARCHRNELWRGITALQSFIRGEKSRKGFATLL  900

Query  812   TRLRAIVTIQKHMKEQ--QSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA VTIQKH+K +  ++R    + A + +QS IRGWL R     I F K    + N 
Sbjct  901   QRHRAAVTIQKHVKTEFARNRMKNTIDAAVVIQSFIRGWLVRRCSGDIGFLKSGGMKTN-  959

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ S L +LQRRV   EAAL    +EN  L + + Q+D +  EYE 
Sbjct  960   --------ESGEVLVKSSFLAELQRRVLKAEAALREKDEENDILHQRLQQYDNRWSEYEL  1011

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ++   ++  +      
Sbjct  1012  KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDKEYSWDIGNHHRRQE  1071

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1072  SSGTRSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELGRL  1127

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY SRL+  K  L +L
Sbjct  1128  KQMFEAWKKDYGSRLRETKVILHKL  1152



>ref|XP_004147135.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
 ref|XP_004162042.1| PREDICTED: myosin-J heavy chain-like [Cucumis sativus]
 gb|KGN51557.1| hypothetical protein Csa_5G577960 [Cucumis sativus]
Length=1175

 Score =   150 bits (380),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 168/325 (52%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q CY GH AR +  ELKRG  VLQSF RGE ARK+Y  L+
Sbjct  842   QIGVLEDTRNRTLH-GILSVQSCYRGHLARRHLKELKRGISVLQSFARGEKARKEYSILI  900

Query  812   TRLRAIVTIQKHMKEQ-QSRRLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA ++IQK +K +  S+RL+ +  A + +QS IRGWL R     I   K      N 
Sbjct  901   QRHRAAISIQKSVKARIASKRLKNVCDASLTIQSVIRGWLVRRCSGDIGLMKPGGLTANG  960

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                        ++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  961   ---------SGEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYEL  1011

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +   N  +      +R   +E         
Sbjct  1012  KMKSMEEVWQRQMRSLQSSLSIAKKSLAVDDSERNSDASVNASDDRGYSWEVGSNNTANE  1071

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    +AGL V +RL  A   +Q +   G     +  VKSG  E  +L P + ++ ++
Sbjct  1072  SNGVRPMNAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLDP-DRELRRL  1127

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY  RL+  K  L +L
Sbjct  1128  KQMFEAWKKDYGGRLRETKVILTKL  1152



>ref|XP_010249396.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1280

 Score =   150 bits (380),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 119/332 (36%), Positives = 171/332 (52%), Gaps = 42/332 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GH+AR Y  EL+RG ++LQSFVRGE  RK+Y   V
Sbjct  933   QIGVLEDTRNRTLH-GILRVQSCFRGHKARCYLKELRRGIVMLQSFVRGEKTRKEYAVFV  991

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
                RA V IQK +K + +R+  +    A I +QS IRGWL R          LN+ Q   
Sbjct  992   QNHRAAVVIQKQIKGRIARKKFINVRCASILIQSVIRGWLVRRCSGD--VGLLNTTQKFE  1049

Query  638   PE--LKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQ  465
                  + E I V+ SVL +LQRRV   EAA     +EN  L + + Q++ +  EYE KM+
Sbjct  1050  GTKGSEPEQILVKASVLAELQRRVLKAEAAFREKEEENDILHQRLQQYESRWSEYELKMK  1109

Query  464   CLEKSWQDQLMSIQTSLGAASRSEGVAE----NGLSRTEPP-------------------  354
              +E+ WQ Q+ S+Q+SL  A +S  V +    +G S T                      
Sbjct  1110  SMEEVWQKQMRSLQSSLSVARKSLAVDDTERSSGSSVTVAHDRAYSWDLGSNSNKGRENS  1169

Query  353   ----SERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPK  195
                   RF+  E S AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P 
Sbjct  1170  GLRLGSRFLEREMS-AGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQAEA-SLNP-  1224

Query  194   NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             + ++ ++K  F+AWKKDY +RL+  K  L +L
Sbjct  1225  DQELRRLKQIFEAWKKDYGARLRETKVILHKL  1256



>ref|XP_004497241.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1159

 Score =   150 bits (379),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 172/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+QAR + NEL RG   LQSF+RGE +RK +  L+
Sbjct  825   QIGVLEDTRNRTLH-GILRVQSCFRGYQARCHRNELWRGITALQSFIRGEKSRKGFATLL  883

Query  812   TRLRAIVTIQKHMKEQ--QSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA VTIQKH+K +  ++R    + A + +QS IRGWL R     I F K    + N 
Sbjct  884   QRHRAAVTIQKHVKTEFARNRMKNTIDAAVVIQSFIRGWLVRRCSGDIGFLKSGGMKTN-  942

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ S L +LQRRV   EAAL    +EN  L + + Q+D +  EYE 
Sbjct  943   --------ESGEVLVKSSFLAELQRRVLKAEAALREKDEENDILHQRLQQYDNRWSEYEL  994

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ++   ++  +      
Sbjct  995   KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDKEYSWDIGNHHRRQE  1054

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1055  SSGTRSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELGRL  1110

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY SRL+  K  L +L
Sbjct  1111  KQMFEAWKKDYGSRLRETKVILHKL  1135



>gb|KDO69897.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69898.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=745

 Score =   148 bits (374),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 171/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q C+ GHQAR    EL+RG + LQSF+RGE  RK+Y  ++
Sbjct  411  QIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVL  469

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             R RA V IQ+ +K + +R +L+ +  + I +QS IRGWL R     I   K + S+ N 
Sbjct  470  QRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSVIRGWLVRRCSGDICLLKSVESKGND  529

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                      +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  530  ---------SDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEQ  580

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      E    ++         
Sbjct  581  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEVEYSWDTGSNCKGQE  640

Query  320  --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    AGL V +RL  A   DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  641  SNGVRPMSAGLSVISRL--AEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DKELRRL  696

Query  173  KLRFKAWKKDYKSRLQVVKATLKQL  99
            K  F+AWKKDY SRL+  K  L +L
Sbjct  697  KQMFEAWKKDYGSRLRETKVILNKL  721



>ref|XP_007142760.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
 gb|ESW14754.1| hypothetical protein PHAVU_007G014600g [Phaseolus vulgaris]
Length=1177

 Score =   150 bits (378),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 116/325 (36%), Positives = 173/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GH+AR Y  EL RG   LQSF+RGE +RK+Y  L+
Sbjct  843   QIGVLEDTRNRTLH-GILRVQSCFRGHRARCYRKELWRGITTLQSFIRGEKSRKEYADLL  901

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK MK   +R R++    A + +QS IRGWL R     I  +K   ++ N 
Sbjct  902   HRHRAAVIIQKRMKTVFARNRMKSTKEAAVFIQSFIRGWLVRRCSGNIGLSKSGVTKAN-  960

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q+D +  EYE 
Sbjct  961   --------ESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYDSRWSEYEL  1012

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE---------  330
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++         
Sbjct  1013  KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDERDFSWDVGTNHRRQE  1072

Query  329   ----RS-DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                 RS  AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1073  SNGVRSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1128

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY +RL+  K  L +L
Sbjct  1129  KQMFEAWKKDYNARLRETKVILHKL  1153



>gb|KDO69895.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
 gb|KDO69896.1| hypothetical protein CISIN_1g0010671mg [Citrus sinensis]
Length=793

 Score =   149 bits (375),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 171/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q C+ GHQAR    EL+RG + LQSF+RGE  RK+Y  ++
Sbjct  459  QIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVL  517

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             R RA V IQ+ +K + +R +L+ +  + I +QS IRGWL R     I   K + S+ N 
Sbjct  518  QRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSVIRGWLVRRCSGDICLLKSVESKGND  577

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                      +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  578  ---------SDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEQ  628

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      E    ++         
Sbjct  629  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEVEYSWDTGSNCKGQE  688

Query  320  --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    AGL V +RL  A   DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  689  SNGVRPMSAGLSVISRL--AEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DKELRRL  744

Query  173  KLRFKAWKKDYKSRLQVVKATLKQL  99
            K  F+AWKKDY SRL+  K  L +L
Sbjct  745  KQMFEAWKKDYGSRLRETKVILNKL  769



>ref|XP_008340434.1| PREDICTED: myosin-1 isoform X2 [Malus domestica]
Length=1165

 Score =   149 bits (377),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 173/333 (52%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSF+RG+  RK+Y  L+
Sbjct  830   QIGVLEDTRNRTLH-GILRVQSCFRGHQARCYLKELRRGITTLQSFIRGQKTRKEYSILL  888

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK +K + +R+       A I +QS +RGWL R     I   K  +++ N 
Sbjct  889   ERHRAAVVIQKQVKSRFARKKFNNIYDASIVVQSVLRGWLVRRCSGSIGLLKPGSTKAN-  947

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +D+ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  948   --------ESDDVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEL  999

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  1000  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDDREYGWDTGSNHRGQD  1059

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1060  SNGVRPMSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1115

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K  F+AWKKDY +RL+  K  L ++ + + G +
Sbjct  1116  KQMFEAWKKDYGTRLRETKVILHKIGNEEGGSA  1148



>ref|XP_008340433.1| PREDICTED: myosin-1 isoform X1 [Malus domestica]
Length=1166

 Score =   149 bits (377),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 173/333 (52%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSF+RG+  RK+Y  L+
Sbjct  831   QIGVLEDTRNRTLH-GILRVQSCFRGHQARCYLKELRRGITTLQSFIRGQKTRKEYSILL  889

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK +K + +R+       A I +QS +RGWL R     I   K  +++ N 
Sbjct  890   ERHRAAVVIQKQVKSRFARKKFNNIYDASIVVQSVLRGWLVRRCSGSIGLLKPGSTKAN-  948

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +D+ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  949   --------ESDDVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEL  1000

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  1001  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDDREYGWDTGSNHRGQD  1060

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1061  SNGVRPMSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1116

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K  F+AWKKDY +RL+  K  L ++ + + G +
Sbjct  1117  KQMFEAWKKDYGTRLRETKVILHKIGNEEGGSA  1149



>ref|XP_010324342.1| PREDICTED: myosin-2-like isoform X1 [Solanum lycopersicum]
Length=1178

 Score =   149 bits (377),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 119/351 (34%), Positives = 180/351 (51%), Gaps = 58/351 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ GH+AR +++ELK G I+LQSF+RGE  R+ Y    
Sbjct  839   QIASLEDARNQVLQGTLEL-QKCFRGHRARRHFHELKGGVIILQSFIRGEIERRLYN---  894

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN--  639
             T++ +   + +   +      EQL AV+ +QS IRGWL R    K     L + +MLN  
Sbjct  895   TKVMSKAKVAREGSD------EQLVAVVQIQSAIRGWLARRGLRK-----LRNSKMLNVD  943

Query  638   -------PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
                     E+K+   ++  SV+ DL+RRVA  EA  E+   ENA+LKE + QF+ +  EY
Sbjct  944   KRRSGRKTEVKELPREILPSVVEDLERRVAKAEATTEQKEKENAALKEQVNQFETRCLEY  1003

Query  479   EAKMQCLEKSWQDQLMSI-QTSLGAASRS-------------EGV-------AENGLSRT  363
             E KM+ +E+ WQ Q+ S+ Q SL AA  S             EG        +++  S  
Sbjct  1004  EVKMRSMEEMWQKQMTSLQQVSLAAARNSLTAADTTGRPGKLEGSPSPQYYDSDDATSMD  1063

Query  362   EPPSERFIPFERSDAGLV----VNNRLDFASPLDQE------NGSHQNM-ITWVKSGHDE  216
              P     + F  +  G+V    VN  L   S L  E      N  ++ M I  +K G  +
Sbjct  1064  TPAGRTPVSFSNNSLGVVANREVNGGLSLISHLAMEFEQRKQNFDNEAMAIVHLKPGQLQ  1123

Query  215   PLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
               N +P + +  ++K RF+ WKK+YK RL+  K+ + +L H   GKS   W
Sbjct  1124  STN-NPAD-EYRRLKHRFEEWKKEYKVRLKETKSKVHKLVHSKAGKSRRKW  1172



>ref|XP_006451994.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451995.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65234.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65235.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1193

 Score =   149 bits (376),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 104/326 (32%), Positives = 163/326 (50%), Gaps = 28/326 (9%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------KIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAGLVV  306
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S  +A +       P +       + +G   
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQMSLAAARKS--LASDNTPGGSTPMKFLNIVPDAGSGRES  1098

Query  305   NNRLDFASPLDQE-----NGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDY  141
             N  L   + L +E          +    ++    +P +    + ++ K+K+RF+ WKKDY
Sbjct  1099  NGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDY  1158

Query  140   KSRLQVVKATLKQLRHCDRGKST*IW  63
             K+RL+  K  L +L   +  K+   W
Sbjct  1159  KTRLREAKVRLNKLGQSEVEKTRRKW  1184



>emb|CDY29324.1| BnaA05g15910D [Brassica napus]
Length=1148

 Score =   149 bits (376),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 121/326 (37%), Positives = 168/326 (52%), Gaps = 36/326 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    E KRG   LQSFVRGE  RK+Y  L+
Sbjct  820   QIGVLEDTRNRTLH-GILRLQSCFRGHQARSRLREYKRGITYLQSFVRGEKIRKEYTELL  878

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K   ++R    ++ A + +QS IRG L R     I++    T R  S
Sbjct  879   RRHRACSAIQSHVKRSIAKRQYKAKVDASLVIQSAIRGQLVRRCGGDIKYGG--TKRNES  936

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
              ++L          VQ SVL +LQRRV  TEAAL    +EN  L++ + Q+D +  EYE 
Sbjct  937   GEVL----------VQASVLSELQRRVLRTEAALREKEEENDILRQRLQQYDNRWSEYEM  986

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EG--------VAENGLSRTEPPSERFIPFER  327
             KM+ +E+ WQ Q+ S+Q+SL  A RS   EG        V  +  S      +   P   
Sbjct  987   KMKSMEEIWQKQMRSLQSSLSIAKRSLDVEGSPRYSDASVNASDASDFSVSGDFRTPGRS  1046

Query  326   SDAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAW  153
                GL V +RL  +F     Q  G     +  VKSG  E  NLSP+  ++ ++K  F+ W
Sbjct  1047  GSVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGKVEA-NLSPER-ELRRLKQMFETW  1103

Query  152   KKDYKSRLQVVKATLKQLRHCDRGKS  75
             KKDY  RL+  K  L +L + + G S
Sbjct  1104  KKDYGGRLRETKTILSRLGNEETGGS  1129



>gb|KDO74222.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1193

 Score =   149 bits (376),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 104/326 (32%), Positives = 163/326 (50%), Gaps = 28/326 (9%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------EIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAGLVV  306
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S  +A +       P +       + +G   
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQMSLAAARKS--LASDNTPGGSTPMKFLNIVPDAGSGRES  1098

Query  305   NNRLDFASPLDQE-----NGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDY  141
             N  L   + L +E          +    ++    +P +    + ++ K+K+RF+ WKKDY
Sbjct  1099  NGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDY  1158

Query  140   KSRLQVVKATLKQLRHCDRGKST*IW  63
             K+RL+  K  L +L   +  K+   W
Sbjct  1159  KTRLREAKVRLNKLGQSEVEKTRRKW  1184



>ref|XP_011044539.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044540.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044541.1| PREDICTED: myosin-2 [Populus euphratica]
 ref|XP_011044543.1| PREDICTED: myosin-2 [Populus euphratica]
Length=1197

 Score =   149 bits (376),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 111/353 (31%), Positives = 178/353 (50%), Gaps = 58/353 (16%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++EE  KQ    +G+  +Q+ + G QAR  +NELK+G ++LQSFVRGEN R+ +  +  +
Sbjct  855   TLEEQRKQFL--RGIVGVQKYFRGGQARRNFNELKQGVMMLQSFVRGENIRRKFNHIKKK  912

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN------KKITSRLNSRQM  645
               A                EQL AV+ LQS IRGWL R +FN      + I    NS++ 
Sbjct  913   CTASAPTAMD---------EQLVAVVYLQSVIRGWLARKQFNNMHKMKRLIHENSNSKRK  963

Query  644   LNPELKD------EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
                ++ +      E I +Q S+L +LQ+RV   EA + +  +ENA+L+E + Q++K+  +
Sbjct  964   PVKKISEVKVIPQEQIDIQTSILAELQKRVVKAEATIGKKEEENAALQEQLQQYEKRWSD  1023

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRS---------EGVAENGLSRTEPPSERFIPFE  330
             YEAKM+ +E+ WQ Q++S+QTSL AA +S          G  ++  S  +  SE  +  E
Sbjct  1024  YEAKMKAMEEMWQMQMLSLQTSLAAARKSLAADNTAAQPGKLDSSTSPRDYDSEDNVSME  1083

Query  329   RSDAGLVVNNRLDFASP-----------------------LDQEN-GSHQNMITWVKSGH  222
                 G    N    A P                       L ++N       +  V++G 
Sbjct  1084  SRTPGGNTPNIFANAFPDLRAGRENNGPVNVVNNLAKEFELQKQNFDDDAKALVEVRAGQ  1143

Query  221   DEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                 N++P + ++ ++KL+F+ WKKDYK RL+  K  L +L H +  ++   W
Sbjct  1144  SAS-NMNP-DEELRRLKLKFETWKKDYKVRLRETKTRLHKLGHGEVDRNRRKW  1194



>ref|XP_006464677.1| PREDICTED: myosin-2-like isoform X6 [Citrus sinensis]
Length=1193

 Score =   149 bits (376),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 104/326 (32%), Positives = 163/326 (50%), Gaps = 28/326 (9%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------EIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAGLVV  306
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S  +A +       P +       + +G   
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQMSLAAARKS--LASDNTPGGSTPMKFLNIVPDAGSGRES  1098

Query  305   NNRLDFASPLDQE-----NGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDY  141
             N  L   + L +E          +    ++    +P +    + ++ K+K+RF+ WKKDY
Sbjct  1099  NGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTTQPASTVHPDVELRKLKMRFETWKKDY  1158

Query  140   KSRLQVVKATLKQLRHCDRGKST*IW  63
             K+RL+  K  L +L   +  K+   W
Sbjct  1159  KTRLREAKVRLNKLGQSEVEKTRRKW  1184



>ref|XP_009351748.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009351749.1| PREDICTED: myosin-1-like isoform X1 [Pyrus x bretschneideri]
Length=1175

 Score =   149 bits (376),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 172/333 (52%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSF+RG+  RK+Y  L+
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSCFRGHQARCYLKELRRGITTLQSFIRGQKTRKEYSILL  898

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK +K + +R+       A I +QS +RGWL R     I   K  +++ N 
Sbjct  899   ERHRAAVVIQKQVKSRFARKKFNNIYDASIVIQSVLRGWLVRRCSGSIGLLKPGSTKAN-  957

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +D+ V+ S L +LQRRV   EA L    +EN  L + + Q++ +  EYE 
Sbjct  958   --------ESDDVLVKASFLAELQRRVLKAEAGLREKEEENDILHQRLQQYESRWSEYEL  1009

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  1010  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDDREYSWDTGSNHRGQD  1069

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1070  SNGVRPMSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1125

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K  F+AWKKDY +RL+  K  L ++ + + G +
Sbjct  1126  KQMFEAWKKDYGTRLRETKVILHKIGNEEGGSA  1158



>ref|XP_009351750.1| PREDICTED: myosin-1-like isoform X2 [Pyrus x bretschneideri]
Length=1163

 Score =   149 bits (376),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 110/333 (33%), Positives = 172/333 (52%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSF+RG+  RK+Y  L+
Sbjct  828   QIGVLEDTRNRTLH-GILRVQSCFRGHQARCYLKELRRGITTLQSFIRGQKTRKEYSILL  886

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK +K + +R+       A I +QS +RGWL R     I   K  +++ N 
Sbjct  887   ERHRAAVVIQKQVKSRFARKKFNNIYDASIVIQSVLRGWLVRRCSGSIGLLKPGSTKAN-  945

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +D+ V+ S L +LQRRV   EA L    +EN  L + + Q++ +  EYE 
Sbjct  946   --------ESDDVLVKASFLAELQRRVLKAEAGLREKEEENDILHQRLQQYESRWSEYEL  997

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  998   KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDDREYSWDTGSNHRGQD  1057

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1058  SNGVRPMSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1113

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K  F+AWKKDY +RL+  K  L ++ + + G +
Sbjct  1114  KQMFEAWKKDYGTRLRETKVILHKIGNEEGGSA  1146



>emb|CDP05853.1| unnamed protein product [Coffea canephora]
Length=882

 Score =   148 bits (374),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 112/339 (33%), Positives = 172/339 (51%), Gaps = 53/339 (16%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI   ED ++  +Q  +E+ Q+C+  H+AR ++++LK+G   LQSFVRGE ARK+Y  LV
Sbjct  559  QIGALEDTRKQVLQGTLEV-QKCFRAHRARRHFHDLKQGVTALQSFVRGEIARKEYDVLV  617

Query  812  TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
               + +          +S+  EQL AV+ +QS IRGWL R    + I    NS+ M+  +
Sbjct  618  NLSKQVA---------ESKFEEQLVAVVQIQSVIRGWLAR----RNIDRLQNSKMMIFDK  664

Query  632  ------------LKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
                        L  E++    SV+ +LQRRV + EA L +   ENA+L+E + +F+ + 
Sbjct  665  RRRGKKFSEVMGLAQENLP---SVVEELQRRVLIAEANLGKKETENAALREQVQEFEVRW  721

Query  488  QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL-------SRTEP---PSERFI  339
             EYE KM+ +E +WQ Q+ S+Q SL AA +S G     +         T P    SE  +
Sbjct  722  LEYEGKMKAMEDTWQKQMASLQVSLAAAKKSLGADHTAVQPAGRLDGLTSPRYYDSEDTM  781

Query  338  PFERSDAGLVVNNRLDFASPLDQENGSHQNM-------ITWVKSGHDEPLNLSPKNSDVH  180
                   G   N  L+    L +E  + + +       I  VKSG +          +  
Sbjct  782  SGGARTPGGEANGGLNSVGHLAKEFENRKQIFDEDAKAIVEVKSGQN-------PGEEYR  834

Query  179  KVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
            ++K RF+AWKKDYK+RL+  K+ L++  H +  K    W
Sbjct  835  RLKHRFEAWKKDYKARLREAKSRLQKHGHLEGEKRNRKW  873



>gb|ABJ53200.1| myosin VIII-1 [Nicotiana benthamiana]
Length=1150

 Score =   149 bits (375),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 116/328 (35%), Positives = 172/328 (52%), Gaps = 33/328 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+ + ED +   +  G+  +Q  + GHQAR +  +L RG   LQSFVRGE ARK+Y  L+
Sbjct  817   QVGVLEDTRNRTLH-GILRVQSFFRGHQARRHLKQLGRGIATLQSFVRGEKARKEYAILL  875

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + IQK +K +  R   +    A I +QS IRGWL R     + +  +   Q   
Sbjct  876   QRHRAALCIQKQIKCRSKRNTYRNIHDASIVIQSVIRGWLVR-----RCSGDIGLLQFGG  930

Query  638   PELKD-EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + E++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  931   RKGNESEEVLVKSSFLAELQRRVLRAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  990

Query  461   LEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFERS------------  324
             +E+ WQ Q+ S+Q+SL  A RS  +  + N  +   P  E+   +E              
Sbjct  991   MEEIWQKQMRSLQSSLSIAKRSLTLDDSRNSDASVNPTDEKESSWETGSNHRARESNGAR  1050

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
               +AGL V +RL  A   +Q +   G     +  VKSG  E  NL+P + ++ ++K  F+
Sbjct  1051  PMNAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-NLNP-DHELRRLKQMFE  1106

Query  158   AWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             AWKKDY SRL+  K  L +L   D G S
Sbjct  1107  AWKKDYGSRLRETKVILSKL-GSDEGAS  1133



>gb|KDO69889.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
 gb|KDO69890.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=907

 Score =   148 bits (373),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 171/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q C+ GHQAR    EL+RG + LQSF+RGE  RK+Y  ++
Sbjct  573  QIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVL  631

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             R RA V IQ+ +K + +R +L+ +  + I +QS IRGWL R     I   K + S+ N 
Sbjct  632  QRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSVIRGWLVRRCSGDICLLKSVESKGND  691

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                      +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  692  ---------SDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEQ  742

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      E    ++         
Sbjct  743  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEVEYSWDTGSNCKGQE  802

Query  320  --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    AGL V +RL  A   DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  803  SNGVRPMSAGLSVISRL--AEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DKELRRL  858

Query  173  KLRFKAWKKDYKSRLQVVKATLKQL  99
            K  F+AWKKDY SRL+  K  L +L
Sbjct  859  KQMFEAWKKDYGSRLRETKVILNKL  883



>ref|XP_002310637.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
 gb|EEE91087.2| hypothetical protein POPTR_0007s07320g [Populus trichocarpa]
Length=1174

 Score =   149 bits (375),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 115/323 (36%), Positives = 167/323 (52%), Gaps = 37/323 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  +L+RG   LQSFVRGE  RK+Y  L 
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSCFRGHQARSYLRQLRRGVCALQSFVRGEKFRKEYAVLQ  898

Query  812   TRLRAIVTIQKHMKEQQSRR----LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQM  645
              R RA V IQ+H+K    R+    + Q  A I +QS IRGWL R  F+  +   L S   
Sbjct  899   QRHRAAVVIQRHIKSTICRKKYKNMHQ--ASILIQSVIRGWLVR-RFSGDV-GLLKSGAT  954

Query  644   LNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQ  465
                E   +++ ++ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+
Sbjct  955   KGNE--SDEVLMKASYLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMK  1012

Query  464   CLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS----------  324
              +E+ WQ Q+ S+Q+SL  A +S  V +   N  +      ER   ++            
Sbjct  1013  SMEEMWQKQMRSLQSSLSIAKKSLSVDDSERNSDASVNASEERDFSWDTGSNHRGQENNG  1072

Query  323   ----DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDVHKVKL  168
                  AGL V +RL  A   +Q +   G     +  VKSG  D  +N    + ++ ++K 
Sbjct  1073  VRPISAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVDASMN---ADRELRRLKQ  1127

Query  167   RFKAWKKDYKSRLQVVKATLKQL  99
              F+AWKKDY SRL+  K  L +L
Sbjct  1128  MFEAWKKDYGSRLRETKLILNKL  1150



>gb|KDO69891.1| hypothetical protein CISIN_1g0010671mg, partial [Citrus sinensis]
Length=906

 Score =   148 bits (373),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 171/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q C+ GHQAR    EL+RG + LQSF+RGE  RK+Y  ++
Sbjct  572  QIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVL  630

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             R RA V IQ+ +K + +R +L+ +  + I +QS IRGWL R     I   K + S+ N 
Sbjct  631  QRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSVIRGWLVRRCSGDICLLKSVESKGND  690

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                      +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  691  ---------SDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEQ  741

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      E    ++         
Sbjct  742  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEVEYSWDTGSNCKGQE  801

Query  320  --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    AGL V +RL  A   DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  802  SNGVRPMSAGLSVISRL--AEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DKELRRL  857

Query  173  KLRFKAWKKDYKSRLQVVKATLKQL  99
            K  F+AWKKDY SRL+  K  L +L
Sbjct  858  KQMFEAWKKDYGSRLRETKVILNKL  882



>emb|CDY53932.1| BnaCnng25790D [Brassica napus]
Length=1181

 Score =   148 bits (374),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 120/326 (37%), Positives = 169/326 (52%), Gaps = 36/326 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    E KRG   LQSF+RGE  RKDY  L+
Sbjct  853   QIGVLEDTRNRTLH-GILRLQSCFRGHQARSRLREFKRGITALQSFIRGEKIRKDYTELL  911

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ ++K + ++R    ++ A + +QS IRG L R     I++    T R  S
Sbjct  912   RRHRACSAIQSYVKSRIAKRQYKAKVDASLVIQSAIRGELVRRCGGDIKYGG--TKRNES  969

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
              ++L          VQ SVL +LQRRV  TEAAL    +EN  L++ + Q+D +  EYE 
Sbjct  970   GEVL----------VQASVLSELQRRVLRTEAALREKEEENDILRQRLQQYDNRWSEYET  1019

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EG--------VAENGLSRTEPPSERFIPFER  327
             KM+ +E+ WQ Q+ S+Q+SL  A RS   EG        V  +  S      +   P   
Sbjct  1020  KMKSMEEIWQKQIRSLQSSLSIAKRSLNVEGSPRYSDASVNASDASDFSVSGDFRTPGRS  1079

Query  326   SDAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAW  153
                GL V +RL  +F     Q  G     +  VKSG  E  NLSP+  ++ ++K  F+ W
Sbjct  1080  GSVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGKVEA-NLSPER-ELRRLKQMFETW  1136

Query  152   KKDYKSRLQVVKATLKQLRHCDRGKS  75
             KKDY  RL+  K  L +L + + G S
Sbjct  1137  KKDYGRRLRETKTILSRLGNEETGGS  1162



>ref|XP_010523208.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1176

 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/333 (35%), Positives = 173/333 (52%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQ R +  ELKRG   LQSFVRGE  RK+Y  L+
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSSFRGHQVRCHMKELKRGIANLQSFVRGEKVRKEYMELL  898

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA + IQ  +K + SR+  +  L A + +QS IRGWL R     I + K   ++ N 
Sbjct  899   RRHRAAIVIQSQVKSKISRKQYMGMLDASVVIQSVIRGWLVRRCSGDIGWLKFGGTKRN-  957

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ SVL +LQR+V   EAAL    +EN  LK+ + Q++ +  EYE 
Sbjct  958   --------ESDEVLVKASVLAELQRKVLKAEAALREKEEENDILKQRLQQYENRWSEYET  1009

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE----------NGLSRTEPPSERFIPFERS  324
             KM+ +E+ WQ Q+ S+Q+SL  A RS G A           N    T+  S      + S
Sbjct  1010  KMKSMEEIWQKQMRSLQSSLSIAKRSLGGANDSERNSDASVNASDGTDWDSAGNFRSQTS  1069

Query  323   D-------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
             +       AGL V +RL  A   +Q     G     +  VKSG  E  NL P + ++ ++
Sbjct  1070  NGGTRPMSAGLSVISRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLYP-DRELRRL  1125

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K  F+ WKKDY +RL+  K  L +L + + G S
Sbjct  1126  KEMFEKWKKDYGTRLRETKVILNKLGNDESGGS  1158



>ref|XP_009406771.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1222

 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 115/337 (34%), Positives = 173/337 (51%), Gaps = 44/337 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR Y  E K+G + LQSF+RGE  R+ Y  L+
Sbjct  879   QIGALEDTRNRTLH-GILRVQSCFRGHQARRYVKERKKGIVALQSFIRGEKTRQTYVVLL  937

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q++M+ +  RR  +    A I +QS IRGWL R   +  I S LN+ + + 
Sbjct  938   QRHRAAIVLQRNMRCRSVRRDFVSVRNASIVIQSVIRGWLVR-RCSGNI-SLLNATEYIG  995

Query  638   PEL--KDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQ  465
                  + E + V+ +VL +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM+
Sbjct  996   VTKGGESEQVSVKATVLAELQRRILKAEAALRDKEEENDILHQRLQQYESRWSEYEQKMR  1055

Query  464   CLEKSWQDQLMSIQTSLGAAS--------------------------RSEGVAENGLSRT  363
              +E+ WQ Q+MS+Q+SL  A                           R++G  ENG  R 
Sbjct  1056  SMEEVWQKQMMSLQSSLSVAKKSLAIDDVERSSDASVDHSWGSAEHVRTKGREENGTPRL  1115

Query  362   EPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKN  192
                  R +  E S AGL V +RL  A   DQ           +  VKSG  +  +L+P +
Sbjct  1116  ---VSRVLDREMS-AGLSVISRL--AEEFDQRTQVFADDAKFLVEVKSGQSDA-SLNP-D  1167

Query  191   SDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRG  81
              ++ ++K  F+ WKKD+ SRL+  K  + +L   D G
Sbjct  1168  KELRRLKQNFELWKKDFSSRLRETKVIINKLGTDDAG  1204



>ref|XP_010905050.1| PREDICTED: myosin-1 [Elaeis guineensis]
Length=1266

 Score =   148 bits (374),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 121/371 (33%), Positives = 175/371 (47%), Gaps = 78/371 (21%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED +   +Q G+  +Q+ + GHQAR YY  LK+G   LQSFVRGE +R +++ LV
Sbjct  883   QVAALEDARNRTLQ-GILWVQKNFRGHQARCYYQALKKGVTTLQSFVRGEKSRCEFKVLV  941

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSG------IRGWLTRIEFNKKITSRLN  657
              R RA V IQKH+K Q +R +  + L  +I LQSG      IRG L R  F    T  ++
Sbjct  942   KRWRAAVLIQKHVKHQIARTMFDDPLKDIILLQSGSVVAAFIRGLLARNNFVVMKTREMS  1001

Query  656   SRQMLN---------PELK--DEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYI  510
                 +          PE+K  ++D +V  S L +LQRRV   EAA     +ENA LK+ +
Sbjct  1002  KLDHVKDNSDPDKDLPEMKATNKDSQVHPSALAELQRRVLKAEAAWREKEEENAILKQQV  1061

Query  509   LQFDKKSQEYEAKMQCLEKSWQDQLMSIQ------------------------TSLGAAS  402
               ++ +  EY+AKM+ +E+ WQ QL S+Q                        + L  + 
Sbjct  1062  QHYEMRWSEYDAKMKSMEEKWQKQLTSLQVSLAAAKKSLAADDLASQQGRLDISPLQYSY  1121

Query  401   RSEGVAENGLSRTEPPSERFIPFERSDAGLVVNNR-------------LDFASPLDQENG  261
              SE     G    E    +  P   SDAGLV N+                F    D  +G
Sbjct  1122  DSEDTMSAGTHTPEGTPAK--PSHASDAGLVRNSNGTQSAVSHLVASDAGFVRNSDGTHG  1179

Query  260   SHQNMITW-----------------VKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSR  132
             +  +++                   VKSGH    +++P   ++HK+K RF  WKKDYK R
Sbjct  1180  AVSHLVKEFEQQRQVFEDDARFLLKVKSGHSGS-SINPAE-ELHKLKARFVTWKKDYKVR  1237

Query  131   LQVVKATLKQL  99
             L+  K  L +L
Sbjct  1238  LRETKIVLHKL  1248



>ref|XP_004297721.1| PREDICTED: unconventional myosin-Va-like [Fragaria vesca subsp. 
vesca]
Length=1168

 Score =   148 bits (373),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 168/325 (52%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSFVRGE  RK+Y  L+
Sbjct  834   QIGVLEDTRNRTLH-GILRVQSCFRGHQARCYLKELRRGITTLQSFVRGEKMRKEYAVLL  892

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK MK + +R + + +  A I +QS  RGW  R     I   K  +++ N 
Sbjct  893   QRHRAAVFIQKLMKSRIARQKFKNICDASIVIQSVYRGWFVRRCSGGIGLTKSGSTKAN-  951

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  952   --------ESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYEL  1003

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  1004  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDDRDYSWDTGSNHRGQD  1063

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +         +  VKSG  E  +L+P + ++ ++
Sbjct  1064  SNGGRPMSAGLSVISRL--TEEFDQRSQVFADDAKFLVEVKSGQVEA-SLNP-DRELRRL  1119

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY +RL+  K  L +L
Sbjct  1120  KQMFEAWKKDYGARLRETKVVLTKL  1144



>ref|XP_011070461.1| PREDICTED: myosin-1 [Sesamum indicum]
Length=1163

 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/320 (34%), Positives = 166/320 (52%), Gaps = 31/320 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+ + ED +   +  G+  +Q C+ GH+AR Y  EL+RG   LQSF+RGE  R++Y   +
Sbjct  828   QMGVLEDTRNRTLH-GILRVQSCFRGHKARCYLKELRRGIATLQSFIRGEKTREEYAISL  886

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA ++IQKH+K +  R+    +  A   +QS IRGWL R         +   R+   
Sbjct  887   RRHRAAISIQKHVKARICRKKFKRKTEASTVIQSVIRGWLVRRCSGDIGLLQFGGRKGNE  946

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
             P    E++ V+ S L +LQRRV   EA+L    +EN  L + + Q++ +  EYE KM+ +
Sbjct  947   P----EEVLVKSSFLAELQRRVLRAEASLREKEEENDILHQRLQQYENRWSEYELKMRSM  1002

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE---------NGLSRTEPPSERFIPFERSD-----  321
             E+ WQ Q+ S+Q+SL  A +S  + +         NG    E   E    F   +     
Sbjct  1003  EEVWQKQMRSLQSSLSIAKKSLALDDSQRNSDASVNGNDEKETSWETHNNFRLHENNRGR  1062

Query  320   ---AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AG+ V  RL  A   +Q +   G     +  VKSG  E  +L P +S++ ++K  F+
Sbjct  1063  SMSAGISVITRL--AEEFEQRSQVFGDDAKFLVEVKSGQAEA-SLDP-DSELRRLKQMFE  1118

Query  158   AWKKDYKSRLQVVKATLKQL  99
             AWKKDY +RL+  K  L +L
Sbjct  1119  AWKKDYGARLRETKVILNKL  1138



>ref|XP_006484499.1| PREDICTED: myosin-1-like [Citrus sinensis]
Length=1167

 Score =   147 bits (372),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 171/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    EL+RG + LQSF+RGE  RK+Y  ++
Sbjct  833   QIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVL  891

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQ+ +K + +R +L+ +  + I +QS IRGWL R     I   K + S+ N 
Sbjct  892   QRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSVIRGWLVRRCSGDICLLKSVESKGND  951

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                       +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  952   ---------SDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEQ  1002

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      E    ++         
Sbjct  1003  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEVEYSWDTGSNCKGQE  1062

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL  A   DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1063  SNGVRPMSAGLSVISRL--AEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DKELRRL  1118

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY SRL+  K  L +L
Sbjct  1119  KQMFEAWKKDYGSRLRETKVILNKL  1143



>ref|XP_006437635.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
 gb|ESR50875.1| hypothetical protein CICLE_v10030552mg [Citrus clementina]
Length=1168

 Score =   147 bits (371),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 112/325 (34%), Positives = 171/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    EL+RG + LQSF+RGE  RK+Y  ++
Sbjct  834   QIGMLEDTRNRTLH-GILRVQSCFRGHQARLCLKELRRGIVALQSFIRGEKIRKEYALVL  892

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQ+ +K + +R +L+ +  + I +QS IRGWL R     I   K + S+ N 
Sbjct  893   QRHRAAVVIQRQIKSRVARQKLKNIKYSSIMIQSVIRGWLVRRCSGDICLLKSVESKGND  952

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                       +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  953   ---------SDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEQ  1003

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      E    ++         
Sbjct  1004  KMKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDEVEYSWDTGSNCKGQE  1063

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL  A   DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1064  SNGVRPMSAGLSVISRL--AEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DKELRRL  1119

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY SRL+  K  L +L
Sbjct  1120  KQMFEAWKKDYGSRLRETKVILNKL  1144



>ref|XP_009124542.1| PREDICTED: myosin-3-like [Brassica rapa]
 ref|XP_009124543.1| PREDICTED: myosin-3-like [Brassica rapa]
Length=1148

 Score =   147 bits (371),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 120/326 (37%), Positives = 167/326 (51%), Gaps = 36/326 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    E KRG   LQSFVRGE  RK+Y  L+
Sbjct  820   QIGVLEDTRNRTLH-GILRLQSCFRGHQARSRLREYKRGITYLQSFVRGEKIRKEYTELL  878

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K   ++R    ++ A + +QS IRG L R     I++    T R  S
Sbjct  879   RRHRACSAIQSHVKRSIAKRRYKAKVDASLVIQSAIRGELVRRCGGDIKYGG--TKRNES  936

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
              ++L          VQ SVL +LQRR   TEAAL    +EN  L++ + Q+D +  EYE 
Sbjct  937   GEVL----------VQASVLSELQRRALRTEAALREKEEENDILRQRLQQYDNRWSEYEM  986

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EG--------VAENGLSRTEPPSERFIPFER  327
             KM+ +E+ WQ Q+ S+Q+SL  A RS   EG        V  +  S      +   P   
Sbjct  987   KMKSMEEIWQKQMRSLQSSLSIAKRSLDVEGSPRYSDASVNASDASDFSVSGDFRTPGRS  1046

Query  326   SDAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAW  153
                GL V +RL  +F     Q  G     +  VKSG  E  NLSP+  ++ ++K  F+ W
Sbjct  1047  GSVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGKVEA-NLSPER-ELRRLKQMFETW  1103

Query  152   KKDYKSRLQVVKATLKQLRHCDRGKS  75
             KKDY  RL+  K  L +L + + G S
Sbjct  1104  KKDYGGRLRETKTILSRLGNEETGGS  1129



>ref|XP_007153036.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 ref|XP_007153037.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25030.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
 gb|ESW25031.1| hypothetical protein PHAVU_003G002200g [Phaseolus vulgaris]
Length=1194

 Score =   147 bits (371),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 110/325 (34%), Positives = 172/325 (53%), Gaps = 33/325 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    EL+ G   LQS +RG   RK+Y  LV
Sbjct  860   QIGVLEDTRNRTLH-GILRVQSCFRGHQARRSLKELQGGICTLQSLIRGNKTRKEYSALV  918

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K   +R R++ ++ A   +Q+ IRGWL R     + +  +   +  +
Sbjct  919   KRHRAAVIIQKRVKAVFARNRMKTISDAATVIQAVIRGWLVR-----RCSGNIGFLKSGD  973

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++KD D + V+ S L +LQRRV   EAAL    DEN  +++ + Q++ +  EYE KM+ 
Sbjct  974   MKMKDSDEVVVKASFLAELQRRVLKAEAALREKEDENDIIRQRLQQYESRWSEYELKMKS  1033

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE-------------  330
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++             
Sbjct  1034  MEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERDYSWDVGGNHRRQESNGA  1093

Query  329   -RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
               + AGL V +RL  A   +  +   G     +  VKSG  E  +LSP + ++ ++K  F
Sbjct  1094  RSTSAGLSVISRL--AEEFEHRSQVFGDDAKFLVEVKSGQVEA-SLSP-DQELRRLKQMF  1149

Query  161   KAWKKDYKSRLQVVKATLKQLRHCD  87
             +AWKKDY +RL+  K  L +L + D
Sbjct  1150  EAWKKDYGTRLRETKVILNKLGNED  1174



>ref|XP_008389065.1| PREDICTED: myosin-1-like [Malus domestica]
Length=1175

 Score =   147 bits (370),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 174/332 (52%), Gaps = 39/332 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  EL+RG   LQSF RG+  RK+Y  L+
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSCFRGHQARCYLKELRRGITTLQSFXRGQKTRKEYSILL  898

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K + +R+      AA I +QS +RGWL R     K +  +    +L 
Sbjct  899   ERHRAAVVIQKQVKSRFARKKFNNIYAASIVIQSVLRGWLVR-----KCSGSIG---LLK  950

Query  638   PEL----KDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             P      + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE K
Sbjct  951   PGSMKANESDEVLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELK  1010

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---SRTEPPSERFIPFERSD-------  321
             M+ +E+ WQ Q+ S+Q+SL  A +S  + ++G    +      +R   ++          
Sbjct  1011  MKSMEEVWQKQMRSLQSSLSIAKKSLAIDDSGRNSDASVNASDDRDQSWDTGSNHRGQDS  1070

Query  320   -------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVK  171
                    AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++K
Sbjct  1071  NGVRPLSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGKVEA-SLNP-DQELRRLK  1126

Query  170   LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
               F+AWKKDY +RL+  K  + ++ + + G +
Sbjct  1127  QMFEAWKKDYGARLRETKLIMHKIGNEEGGSA  1158



>ref|XP_002316933.2| hypothetical protein POPTR_0011s12670g [Populus trichocarpa]
 gb|EEE97545.2| hypothetical protein POPTR_0011s12670g [Populus trichocarpa]
Length=1191

 Score =   146 bits (369),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 115/354 (32%), Positives = 179/354 (51%), Gaps = 62/354 (18%)
 Frame = -3

Query  983   IEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRL  804
             +EE  KQ  +  G+  +Q+ + G QAR +++ELK+G ++LQSF+RGEN R+ Y  ++ R 
Sbjct  850   LEEQRKQFLL--GIVEVQKYFRGGQARRHFHELKQGVVILQSFIRGENMRRKYNHMIKRR  907

Query  803   RAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQMLN  639
              A   +            +QL A + LQS IRGWL R +FN     K++T   NS     
Sbjct  908   TANAPLAVD---------DQLVAALYLQSVIRGWLARKQFNSMHKMKQLTHE-NSNSKRK  957

Query  638   PELKDEDIKV--------QRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
             P  K  ++KV        Q S+L +LQ+RV   E  + +  +ENA+LK+ + Q +K+  +
Sbjct  958   PGKKISEVKVIPQEQVDIQTSILAELQKRVVKAEVTVAQKEEENAALKDQLQQNEKRWLD  1017

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL-------SRTEP---PSERFIPF  333
             YEAKM+ +E+ WQ Q+ S+QTSL AA +S   A+N         S T P    SE ++  
Sbjct  1018  YEAKMKAMEEMWQVQMASLQTSLAAARKSLA-ADNTAGQPGKLDSSTSPHYYDSEDYVST  1076

Query  332   ERSDAG-----LVVNNRLDFASPLDQENGSH-------------QNM------ITWVKSG  225
             E    G     +  N   D  +  +     H             QN       +  V++G
Sbjct  1077  ESRTPGGNTPNIFANTFPDLRAVRENNGPVHAVSNLTKEFEQQKQNFDDNVKALVEVRAG  1136

Query  224   HDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                  N++P + ++ ++KL F+ WKKDYK RL+  KA L +L H +  ++   W
Sbjct  1137  QSAS-NMNP-DEELRRLKLGFETWKKDYKVRLRETKARLHKLGHGEVDRNRRKW  1188



>ref|XP_008445889.1| PREDICTED: myosin-1-like [Cucumis melo]
Length=1175

 Score =   146 bits (369),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 114/325 (35%), Positives = 167/325 (51%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q CY GH AR +  ELKRG  VLQSF RG+ ARK+Y  L+
Sbjct  842   QIGVLEDTRNRTLH-GILSVQSCYRGHLARRHLKELKRGISVLQSFARGQKARKEYAILI  900

Query  812   TRLRAIVTIQKHMKEQ-QSRRLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA ++IQK +K +  S+ L+ +  A + +QS IRGWL R     I   K      N 
Sbjct  901   QRHRAAISIQKCVKARIASKHLKNVCDASLTIQSVIRGWLVRRCSGDIGLMKPGGLTANG  960

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                        ++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  961   ---------SGEVLVKSSFLSELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYEL  1011

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS-------  324
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +   N  +      +R   +E         
Sbjct  1012  KMKSMEEVWQRQMRSLQSSLSIAKKSLAVDDSERNSDASVNASDDRGYSWEVGSNNTANE  1071

Query  323   -------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    +AGL V +RL  A   +Q +   G     +  VKSG  E  +L P + ++ ++
Sbjct  1072  SNGVRPMNAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLDP-DRELRRL  1127

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY  RL+  K  L +L
Sbjct  1128  KQMFEAWKKDYGGRLRETKVILNKL  1152



>ref|XP_009792549.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1196

 Score =   146 bits (368),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 109/348 (31%), Positives = 172/348 (49%), Gaps = 51/348 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED ++  +Q  +E+  +CY GH AR +++EL+ G I+LQSFVRGE AR+ Y    
Sbjct  855   QIAALEDVRKQVLQGTLEV-PKCYSGHCARRHFHELEGGVIILQSFVRGEIARRQYN---  910

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQ  648
                    +++   K       +QL AV+ +QS IR WL +   N     KK+      + 
Sbjct  911   ------ASLESKRKAANKENDKQLVAVVQIQSAIRCWLAQRHLNQLQSLKKLNQDREKQG  964

Query  647   MLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
                 E+KD   ++  SV+ DL+RRV V EA+L+    ENA+LKE + Q + +  +YE +M
Sbjct  965   RKTSEVKDLPAEILPSVVEDLERRVMVAEASLDEKDKENAALKEQVNQLEARWSDYEVRM  1024

Query  467   QCLEKSWQDQLMSIQTSLGAASRSEGVAE----------------------NGLSRTEPP  354
             + +E+ WQ Q++S+Q SL AA +S GV                          +    P 
Sbjct  1025  RSMEEMWQKQMVSLQASLAAAKKSLGVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTPG  1084

Query  353   SERFIPFE----------RSDAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPLN  207
                 I F            ++ GL V N L+    L ++N   + M I  +KS   E L+
Sbjct  1085  GSTPIEFASNGVDFGGIRENNGGLCVVNYLNREFELRRQNFDDEAMAIAQLKS---EQLH  1141

Query  206   LSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              +    D  +++ RF+ WKKDYK+RL+  KA + +  + +  K+   W
Sbjct  1142  STNPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKFGYSEAEKTRRNW  1189



>ref|XP_004487658.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Cicer arietinum]
Length=1205

 Score =   145 bits (367),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 119/357 (33%), Positives = 177/357 (50%), Gaps = 64/357 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+   ED+++  +Q GV  +Q+C  GHQAR  YN+LK     LQSFVRGE AR  Y  +V
Sbjct  857   QVGALEDKRKQVLQ-GVLGVQKCVRGHQARSQYNKLKNAVTTLQSFVRGEIARSKYGVMV  915

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN---------KKITSRL  660
                ++ +TI        +  +E++ A+I LQS IRGWL R+ ++         +   SR 
Sbjct  916   ---KSSITIS-------TENIEEIQAIIILQSVIRGWLVRMHYSSLNKFKKHPENAKSRR  965

Query  659   NSRQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              SR  + PE+KD   + +    S L +LQRRV   EA +E+  +ENA L+E + QF+K+ 
Sbjct  966   RSRSKI-PEVKDASKDRVPNLPSALAELQRRVVKAEATIEQKEEENAELREQLKQFEKRW  1024

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---------------------  372
              EYE KM+ +E+ WQ Q+ S+Q SL AA+R+   +EN                       
Sbjct  1025  IEYETKMKTMEEMWQRQMSSLQMSL-AAARTSLASENATGQPVRHDITASPLGYDSEDTM  1083

Query  371   ---SRTEPPSERFIPFERSD------AGLVVNNRL-DFASPLDQENGSHQN----MITWV  234
                SRT        PF+ S       AG   N  L +     +Q   +  N    ++   
Sbjct  1084  SMGSRTPRTPGCGTPFKYSGSLAEARAGREGNGSLNNLMKEFEQRRQTFDNNARALVEVK  1143

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              +G     N      ++H +K RF+ WKK+YK+RL+  KA LK L H +  ++   W
Sbjct  1144  TTGQSANTN---SIEELHNLKHRFEGWKKEYKTRLRETKARLK-LGHSEMDRNRRKW  1196



>ref|XP_002523758.1| myosin vIII, putative [Ricinus communis]
 gb|EEF38607.1| myosin vIII, putative [Ricinus communis]
Length=1181

 Score =   145 bits (367),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 110/323 (34%), Positives = 166/323 (51%), Gaps = 37/323 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GH AR Y+ EL+RG  +LQSF RGE  RK+Y  L+
Sbjct  847   QIGVLEDTRNRTLH-GILAVQSCFRGHLARRYHRELRRGIAILQSFARGEKVRKEYAVLL  905

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ+ ++   SR+   +   A I +QS IRGWL R   +  I   ++     N
Sbjct  906   QRHRATVVIQRQIRSTISRKRYKDVHEASIVIQSVIRGWLVR-RCSGNIGLLISGGTKGN  964

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + +++ V+ S L +LQRRV   EAAL    +EN  L++ + Q++ +  EYE KM+ +
Sbjct  965   ---ESDEVLVKASFLAELQRRVLKAEAALREKEEENDILQQRLQQYESRWSEYELKMKSM  1021

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE--------------------NGLSRTEPPSERFI  339
             E+ WQ Q+ S+Q+SL  A +S  + +                    N     E       
Sbjct  1022  EEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERDWDTGNNYRGQESNGHSVR  1081

Query  338   PFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKL  168
             P     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K 
Sbjct  1082  PMS---AGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRLKQ  1134

Query  167   RFKAWKKDYKSRLQVVKATLKQL  99
              F+AWKKDY  RL+  K  L +L
Sbjct  1135  MFEAWKKDYGVRLRETKVILNKL  1157



>gb|KHN23106.1| Unconventional myosin-Va [Glycine soja]
Length=947

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 173/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  GV  +Q C+ G++AR Y  EL RG   LQSF+RGE +RK+Y  L+
Sbjct  613  QIGVLEDTRNRTLH-GVLRVQSCFRGYRARCYRKELWRGITTLQSFIRGEKSRKEYAALL  671

Query  812  TRLRAIVTIQKHMKEQQSR-RLEQL-AAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             R RA V IQK MK   +R R++ +  A + +QS IRGWL R     I  +K    + N 
Sbjct  672  QRHRAAVIIQKRMKTVLARNRMKSINGAAVVIQSFIRGWLVRRCSGDIGLSKPRGIKTN-  730

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                    + +++ V+ S L +LQRRV   EA+L    +EN  L + + Q++ +  EYE 
Sbjct  731  --------ESDEVLVKSSFLAELQRRVLKAEASLREKEEENDILHQRLQQYENRWSEYEL  782

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE---------  330
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  783  KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDRDFSWDVGTNHRRQE  842

Query  329  ----RS-DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                RS  AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  843  SNGARSMSAGLSVISRL--AEEFEQRSQVFGDDSKFLVEVKSGQVEA-SLNP-DRELRRL  898

Query  173  KLRFKAWKKDYKSRLQVVKATLKQL  99
            K  F+AWKKDY +RL+  K  L +L
Sbjct  899  KQMFEAWKKDYGARLRETKVILHKL  923



>ref|XP_004487659.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Cicer arietinum]
Length=1077

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 119/357 (33%), Positives = 177/357 (50%), Gaps = 64/357 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+   ED+++  +Q GV  +Q+C  GHQAR  YN+LK     LQSFVRGE AR  Y  +V
Sbjct  729   QVGALEDKRKQVLQ-GVLGVQKCVRGHQARSQYNKLKNAVTTLQSFVRGEIARSKYGVMV  787

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN---------KKITSRL  660
                ++ +TI        +  +E++ A+I LQS IRGWL R+ ++         +   SR 
Sbjct  788   ---KSSITIS-------TENIEEIQAIIILQSVIRGWLVRMHYSSLNKFKKHPENAKSRR  837

Query  659   NSRQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              SR  + PE+KD   + +    S L +LQRRV   EA +E+  +ENA L+E + QF+K+ 
Sbjct  838   RSRSKI-PEVKDASKDRVPNLPSALAELQRRVVKAEATIEQKEEENAELREQLKQFEKRW  896

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---------------------  372
              EYE KM+ +E+ WQ Q+ S+Q SL AA+R+   +EN                       
Sbjct  897   IEYETKMKTMEEMWQRQMSSLQMSL-AAARTSLASENATGQPVRHDITASPLGYDSEDTM  955

Query  371   ---SRTEPPSERFIPFERSD------AGLVVNNRL-DFASPLDQENGSHQN----MITWV  234
                SRT        PF+ S       AG   N  L +     +Q   +  N    ++   
Sbjct  956   SMGSRTPRTPGCGTPFKYSGSLAEARAGREGNGSLNNLMKEFEQRRQTFDNNARALVEVK  1015

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              +G     N      ++H +K RF+ WKK+YK+RL+  KA LK L H +  ++   W
Sbjct  1016  TTGQSANTN---SIEELHNLKHRFEGWKKEYKTRLRETKARLK-LGHSEMDRNRRKW  1068



>ref|XP_001774306.1| predicted protein [Physcomitrella patens]
 gb|EDQ60942.1| predicted protein [Physcomitrella patens]
Length=1019

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 116/324 (36%), Positives = 174/324 (54%), Gaps = 30/324 (9%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +Q GV  +Q  Y G++AR  Y + +   I+LQ  VRG  ARK +  L+
Sbjct  686   QIGHLEDVRLRTLQ-GVTRVQAVYKGYKARCIYKQRRMTTIILQCMVRGAIARKRFGRLL  744

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAA--VICLQSGIRGWLTRIEF---NKKITSRLNSRQ  648
              R RA V +QK+ ++Q + R  Q     ++ +Q+ IR WL R +F    ++   RL +  
Sbjct  745   ERHRAAVIVQKYARQQSACRKYQSIKEKIVKVQAVIRMWLARKQFLAQRREAEERLATEA  804

Query  647   MLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
              L  EL++  IKV+ S LL+LQRR  + E AL    +ENAS+++ IL ++ +  EYEAKM
Sbjct  805   KLR-ELQEVTIKVRPSYLLELQRRAVMAEKALREKEEENASMRQKILHYEARWMEYEAKM  863

Query  467   QCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPS-------ERF-------IPFE  330
               +E+ WQ Q+ S+Q SL AA RS  +A +  S  + P+       +RF        P  
Sbjct  864   TSMEEMWQKQMSSLQLSLSAAKRS--LATDDYSMLQTPTKDHDSINDRFSAGRECSTPRG  921

Query  329   RSDAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDE-PLNLSPKNSDVHKVKLRFK  159
               DA   V N L  +F       N     +I  VKSG  E PL+      ++ K+++RF 
Sbjct  922   DVDAARSVVNHLVREFDHRTQVFNDDADFLIE-VKSGLTEAPLD---PEEELRKLRMRFD  977

Query  158   AWKKDYKSRLQVVKATLKQLRHCD  87
              WKKD+K+RL+  K  L++L + D
Sbjct  978   TWKKDFKTRLRETKLVLQRLCNVD  1001



>gb|KEH19592.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1178

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 118/339 (35%), Positives = 175/339 (52%), Gaps = 55/339 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED+++  +Q  V I Q+C+ GHQ R Y+ ELK G   LQSF+RGE  R+ +  L 
Sbjct  836   QIGALEDKRKHFLQATVGI-QKCFRGHQVRSYFCELKNGVTTLQSFIRGEVTRRKHGVLT  894

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE---------FNKKITSRL  660
                ++ +T+        S+++E++ A+I LQS IRGW  R +         +++    R 
Sbjct  895   ---KSSITVY-------SKKIEEIHAIILLQSVIRGWKVRRDSSNINKLRKYHENAQPRR  944

Query  659   NSRQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              SR  + PE+KD   E ++ + S L +LQ+RV   EA +E+  DEN  LKE + Q ++K 
Sbjct  945   KSRVKM-PEVKDLSNELVQNRPSALAELQKRVYRAEAIIEQKEDENTELKEKLKQSERKR  1003

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---SRTEPPSERFI-------  339
              EYEAKM+ +E +WQ Q+ S+QTSL AA +S   +ENG     R +  S R+        
Sbjct  1004  IEYEAKMKSMEDAWQKQMASLQTSLAAARKSLA-SENGTVQPVRHDLVSPRYYDSEDATL  1062

Query  338   ----------------PFERSDAGLVVNNRLDFASPLDQE-NGSHQNMITWVKSGHD-EP  213
                              F  SDAG   N  L   S L +E     Q     VK+ ++ +P
Sbjct  1063  LGSQTTNGSTHMKLSGSFSVSDAGRQANGTLTTVSNLMKEFEQRRQTFNDEVKALNEVKP  1122

Query  212   LNLSPKNS--DVHKVKLRFKAWKKDYKSRLQVVKATLKQ  102
                   NS  ++ K+K RF+ WKK YK RL+  KA + +
Sbjct  1123  GQSGNTNSADELRKLKQRFEGWKKQYKVRLRETKARISE  1161



>ref|XP_006605841.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1059

 Score =   145 bits (365),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 173/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ G++AR Y  EL RG   LQSF+RGE +RK+Y  L+
Sbjct  725   QIGVLEDTRNRTLH-GVLRVQSCFRGYRARCYRKELWRGITTLQSFIRGEKSRKEYAALL  783

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQL-AAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK MK   +R R++ +  A + +QS IRGWL R     I  +K    + N 
Sbjct  784   QRHRAAVIIQKRMKTVLARNRMKSINGAAVVIQSFIRGWLVRRCSGDIGLSKPRGIKTN-  842

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EA+L    +EN  L + + Q++ +  EYE 
Sbjct  843   --------ESDEVLVKSSFLAELQRRVLKAEASLREKEEENDILHQRLQQYENRWSEYEL  894

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE---------  330
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  895   KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDRDFSWDVGTNHRRQE  954

Query  329   ----RS-DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                 RS  AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  955   SNGARSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1010

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY +RL+  K  L +L
Sbjct  1011  KQMFEAWKKDYGARLRETKVILHKL  1035



>ref|XP_008812673.1| PREDICTED: myosin-1-like isoform X4 [Phoenix dactylifera]
Length=1064

 Score =   144 bits (364),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 178/349 (51%), Gaps = 36/349 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+ARH+  E ++  + LQSF+RGE  R+ Y  L+
Sbjct  723   QIGALEDTRNRTLH-GILRVQSCFRGHKARHHVKERRKAIVTLQSFIRGEKTRQIYSGLL  781

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q+++K Q SR+  ++   A + +QS IRGWL R          LN+ + L 
Sbjct  782   QRHRAAIVLQRYIKSQSSRKSFIDVRNATVVIQSVIRGWLVRRCSGD--AGLLNTAKKLE  839

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ++++V+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  840   GTKESDEVQVKASFLAELQRRILKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSM  899

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAEN-------------------GLSRTEPPSERF--  342
             E+ WQ Q+ S+Q+SL  A +S    +                    G    E   +R   
Sbjct  900   EEVWQKQMRSLQSSLSVAKKSLATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGS  959

Query  341   -IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
              +      AGL V + L  A   +Q++       N +  VKSGH E  +L+P+  ++ ++
Sbjct  960   RVLHRDMSAGLNVISCL--AEEFEQQSQVFADDVNFLVEVKSGHAEA-SLNPEK-ELRRL  1015

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRG--KST*IWCTMAPCGKII  33
             K  F++WKKD+  RL+  K  + +LR  D    K+   W T     +II
Sbjct  1016  KQNFESWKKDFSLRLRESKVIINKLRTDDANSDKAKRKWWTRLNSTRII  1064



>ref|XP_006605839.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006605840.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1170

 Score =   144 bits (364),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 113/325 (35%), Positives = 173/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ G++AR Y  EL RG   LQSF+RGE +RK+Y  L+
Sbjct  836   QIGVLEDTRNRTLH-GVLRVQSCFRGYRARCYRKELWRGITTLQSFIRGEKSRKEYAALL  894

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQL-AAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK MK   +R R++ +  A + +QS IRGWL R     I  +K    + N 
Sbjct  895   QRHRAAVIIQKRMKTVLARNRMKSINGAAVVIQSFIRGWLVRRCSGDIGLSKPRGIKTN-  953

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EA+L    +EN  L + + Q++ +  EYE 
Sbjct  954   --------ESDEVLVKSSFLAELQRRVLKAEASLREKEEENDILHQRLQQYENRWSEYEL  1005

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE---------  330
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++         
Sbjct  1006  KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDRDFSWDVGTNHRRQE  1065

Query  329   ----RS-DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                 RS  AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1066  SNGARSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1121

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY +RL+  K  L +L
Sbjct  1122  KQMFEAWKKDYGARLRETKVILHKL  1146



>ref|XP_008812671.1| PREDICTED: myosin-1-like isoform X2 [Phoenix dactylifera]
Length=1196

 Score =   144 bits (364),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 178/349 (51%), Gaps = 36/349 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+ARH+  E ++  + LQSF+RGE  R+ Y  L+
Sbjct  855   QIGALEDTRNRTLH-GILRVQSCFRGHKARHHVKERRKAIVTLQSFIRGEKTRQIYSGLL  913

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q+++K Q SR+  ++   A + +QS IRGWL R          LN+ + L 
Sbjct  914   QRHRAAIVLQRYIKSQSSRKSFIDVRNATVVIQSVIRGWLVRRCSGD--AGLLNTAKKLE  971

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ++++V+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  972   GTKESDEVQVKASFLAELQRRILKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSM  1031

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAEN-------------------GLSRTEPPSERF--  342
             E+ WQ Q+ S+Q+SL  A +S    +                    G    E   +R   
Sbjct  1032  EEVWQKQMRSLQSSLSVAKKSLATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGS  1091

Query  341   -IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
              +      AGL V + L  A   +Q++       N +  VKSGH E  +L+P+  ++ ++
Sbjct  1092  RVLHRDMSAGLNVISCL--AEEFEQQSQVFADDVNFLVEVKSGHAEA-SLNPEK-ELRRL  1147

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRG--KST*IWCTMAPCGKII  33
             K  F++WKKD+  RL+  K  + +LR  D    K+   W T     +II
Sbjct  1148  KQNFESWKKDFSLRLRESKVIINKLRTDDANSDKAKRKWWTRLNSTRII  1196



>ref|XP_008812670.1| PREDICTED: myosin-1-like isoform X1 [Phoenix dactylifera]
Length=1197

 Score =   144 bits (364),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 178/349 (51%), Gaps = 36/349 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+ARH+  E ++  + LQSF+RGE  R+ Y  L+
Sbjct  856   QIGALEDTRNRTLH-GILRVQSCFRGHKARHHVKERRKAIVTLQSFIRGEKTRQIYSGLL  914

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q+++K Q SR+  ++   A + +QS IRGWL R          LN+ + L 
Sbjct  915   QRHRAAIVLQRYIKSQSSRKSFIDVRNATVVIQSVIRGWLVR--RCSGDAGLLNTAKKLE  972

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ++++V+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  973   GTKESDEVQVKASFLAELQRRILKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRSM  1032

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAEN-------------------GLSRTEPPSERF--  342
             E+ WQ Q+ S+Q+SL  A +S    +                    G    E   +R   
Sbjct  1033  EEVWQKQMRSLQSSLSVAKKSLATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVGS  1092

Query  341   -IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
              +      AGL V + L  A   +Q++       N +  VKSGH E  +L+P+  ++ ++
Sbjct  1093  RVLHRDMSAGLNVISCL--AEEFEQQSQVFADDVNFLVEVKSGHAEA-SLNPEK-ELRRL  1148

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRG--KST*IWCTMAPCGKII  33
             K  F++WKKD+  RL+  K  + +LR  D    K+   W T     +II
Sbjct  1149  KQNFESWKKDFSLRLRESKVIINKLRTDDANSDKAKRKWWTRLNSTRII  1197



>ref|XP_003592738.1| Myosin-like protein [Medicago truncatula]
 gb|AES62989.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1159

 Score =   144 bits (364),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/325 (33%), Positives = 172/325 (53%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+QAR +  EL RG   LQSF+RGE +RK++  L+
Sbjct  825   QIGVLEDTRNRTLH-GILRVQSCFRGYQARCHCKELWRGITTLQSFIRGEKSRKEFATLL  883

Query  812   TRLRAIVTIQKHMKE-QQSRRL-EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQKH+K   QS+R+ + + + + +QS IRGWL R     I F K    + N 
Sbjct  884   QRHRAAVIIQKHVKTVYQSKRMKDTIDSAVVIQSFIRGWLVRRCSGDIGFLKSGGMKTN-  942

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EA L    +EN  L + + Q++ +  EYE 
Sbjct  943   --------ESDEVLVKASFLAELQRRVLKAEAGLREKDEENDILHQRLQQYESRWSEYEL  994

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ++   ++  +      
Sbjct  995   KMKSMEEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDKEYSWDMGNNHRRQE  1054

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1055  SSGTRSMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQIEA-SLNP-DRELRRL  1110

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+ WKKDY +RL+  K  L +L
Sbjct  1111  KQMFEGWKKDYAARLRETKVILNKL  1135



>emb|CBI35399.3| unnamed protein product [Vitis vinifera]
Length=1135

 Score =   144 bits (363),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 108/321 (34%), Positives = 169/321 (53%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR +  +L+ G   LQSFVRGE  RK++  L+
Sbjct  801   QIGVLEDTRNHTLH-GILRVQSCFRGHQARCHLRDLRGGIATLQSFVRGEKTRKEFAILL  859

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK ++ +  R+  +    A I +QS IRGWL R     + +  L    +  
Sbjct  860   QRHRAAVVIQKQIRSRIGRKKFMSIYDASIVIQSVIRGWLVR-----RCSGDLGLLTVGG  914

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              + K+ D + V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  915   RKDKESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  974

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD----------  321
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++             
Sbjct  975   MEEVWQKQMRSLQSSLSIAKKSLAMDDSRRNSDASVNLTDDRDSSWDTGSNFRGQESNGM  1034

Query  320   ----AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +R+  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  1035  RPMSAGLTVISRM--AEEFEQRSQVFGDDAKFLVEVKSGQTEA-SLNP-DRELRRLKQMF  1090

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY SRL+  K  L++L
Sbjct  1091  EAWKKDYGSRLRETKVILQKL  1111



>ref|XP_008812672.1| PREDICTED: myosin-1-like isoform X3 [Phoenix dactylifera]
Length=1191

 Score =   144 bits (363),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 176/350 (50%), Gaps = 44/350 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+ARH+  E ++  + LQSF+RGE  R+ Y  L+
Sbjct  856   QIGALEDTRNRTLH-GILRVQSCFRGHKARHHVKERRKAIVTLQSFIRGEKTRQIYSGLL  914

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQ-ML  642
              R RA + +Q+++K Q SR+  ++   A + +QS IRGWL R         R +    +L
Sbjct  915   QRHRAAIVLQRYIKSQSSRKSFIDVRNATVVIQSVIRGWLVR---------RCSGDAGLL  965

Query  641   NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
             N   K E  KV+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  966   NTAKKLEGTKVKASFLAELQRRILKAEAALREKEEENDILHQRLQQYENRWSEYEQKMRS  1025

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAEN-------------------GLSRTEPPSERF-  342
             +E+ WQ Q+ S+Q+SL  A +S    +                    G    E   +R  
Sbjct  1026  MEEVWQKQMRSLQSSLSVAKKSLATDDAERRSDASVDQSWDSNGNHIGTKWGEESGKRVG  1085

Query  341   --IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHK  177
               +      AGL V + L  A   +Q++       N +  VKSGH E  +L+P+  ++ +
Sbjct  1086  SRVLHRDMSAGLNVISCL--AEEFEQQSQVFADDVNFLVEVKSGHAEA-SLNPEK-ELRR  1141

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQLRHCDRG--KST*IWCTMAPCGKII  33
             +K  F++WKKD+  RL+  K  + +LR  D    K+   W T     +II
Sbjct  1142  LKQNFESWKKDFSLRLRESKVIINKLRTDDANSDKAKRKWWTRLNSTRII  1191



>ref|XP_002273898.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656029.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656030.1| PREDICTED: myosin-1 [Vitis vinifera]
 ref|XP_010656031.1| PREDICTED: myosin-1 [Vitis vinifera]
Length=1197

 Score =   144 bits (363),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 108/321 (34%), Positives = 169/321 (53%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR +  +L+ G   LQSFVRGE  RK++  L+
Sbjct  863   QIGVLEDTRNHTLH-GILRVQSCFRGHQARCHLRDLRGGIATLQSFVRGEKTRKEFAILL  921

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK ++ +  R+  +    A I +QS IRGWL R     + +  L    +  
Sbjct  922   QRHRAAVVIQKQIRSRIGRKKFMSIYDASIVIQSVIRGWLVR-----RCSGDLGLLTVGG  976

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              + K+ D + V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  977   RKDKESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  1036

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD----------  321
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++             
Sbjct  1037  MEEVWQKQMRSLQSSLSIAKKSLAMDDSRRNSDASVNLTDDRDSSWDTGSNFRGQESNGM  1096

Query  320   ----AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +R+  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  1097  RPMSAGLTVISRM--AEEFEQRSQVFGDDAKFLVEVKSGQTEA-SLNP-DRELRRLKQMF  1152

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY SRL+  K  L++L
Sbjct  1153  EAWKKDYGSRLRETKVILQKL  1173



>emb|CAN82090.1| hypothetical protein VITISV_032704 [Vitis vinifera]
Length=1161

 Score =   144 bits (363),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 108/321 (34%), Positives = 169/321 (53%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR +  +L+ G   LQSFVRGE  RK++  L+
Sbjct  827   QIGVLEDTRNHTLH-GILRVQSCFRGHQARCHLRDLRGGIATLQSFVRGEKTRKEFAILL  885

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK ++ +  R+  +    A I +QS IRGWL R     + +  L    +  
Sbjct  886   QRHRAAVVIQKQIRSRIGRKKFMSIYDASIVIQSVIRGWLVR-----RCSGDLGLLTVGG  940

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              + K+ D + V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  941   RKDKESDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKS  1000

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERSD----------  321
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++             
Sbjct  1001  MEEVWQKQMRSLQSSLSIAKKSLAMDDSRRNSDASVNLTDDRDSSWDTGSNFRGQESNGM  1060

Query  320   ----AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                 AGL V +R+  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  1061  RPMSAGLTVISRM--AEEFEQRSQVFGDDAKFLVEVKSGQTEA-SLNP-DRELRRLKQMF  1116

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY SRL+  K  L++L
Sbjct  1117  EAWKKDYGSRLRETKVILQKL  1137



>ref|XP_006362935.1| PREDICTED: myosin-2-like isoform X2 [Solanum tuberosum]
Length=1202

 Score =   144 bits (363),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 111/350 (32%), Positives = 174/350 (50%), Gaps = 54/350 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI++ E+ ++  +Q  +E+ Q+CY G  AR +++ELK   I+LQSFVRGE AR+ Y+   
Sbjct  860   QIAVLEEVRKQVLQGTLEV-QKCYSGPHARRHFHELKGVVIILQSFVRGEIARRQYK---  915

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP-  636
                    +++   K+      EQL AV+ +QS IR WL +   N+   S+  ++    P 
Sbjct  916   ------DSLESKQKDANKENDEQLVAVLQIQSAIRCWLAQRHLNQLQKSKKLNQDRPKPA  969

Query  635   ----ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
                 E+KD   ++  SV+ DL+RRV V EA LE    ENA+LKE + Q + +  +YE +M
Sbjct  970   KKTTEVKDLPAEILPSVVEDLERRVLVAEATLEEKEKENAALKEQVNQLESRWSDYEVRM  1029

Query  467   QCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIP--FERSD---------  321
             + +E+ WQ Q+ S+Q SL +A +S GV +N  S    P     P  +E  D         
Sbjct  1030  RSMEEMWQKQMASLQASLVSAKKSLGV-DNSASHPGKPEGSPSPCGYESEDTTTTMGTRT  1088

Query  320   -----------------------AGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEP  213
                                     GL V N L     L ++N   + M I+ +KSG    
Sbjct  1089  PGGSTPIEYASNGVDFGGIREINGGLCVVNYLSREFELRKQNFDDEAMAISQLKSGQ---  1145

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             L  +    D  +++ +F  WKKDYK+RL+  K  + +L + +  K+   W
Sbjct  1146  LQSTSPAEDFRRLRHKFDEWKKDYKARLKETKLKVHKLGYSEAEKTRRNW  1195



>ref|XP_006589741.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
Length=1059

 Score =   143 bits (361),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 114/320 (36%), Positives = 170/320 (53%), Gaps = 31/320 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ G++AR Y  EL RG   LQSF+RGE +RK+Y   +
Sbjct  725   QIGVLEDTRNRTLH-GVLRVQSCFRGYRARCYRKELWRGITTLQSFIRGEKSRKEYAASL  783

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK MK   SR R++ +  A + +QS IRGWL R   +  I   L+  Q + 
Sbjct  784   QRHRAAVIIQKRMKTVFSRNRMKNINDAAVVIQSFIRGWLVR-RCSGDIG--LSKSQGIK  840

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                 DE + V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  841   TNESDE-VLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSM  899

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++              
Sbjct  900   EEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGAK  959

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F+
Sbjct  960   SMSAGLSVISRL--AEEFEQRSQVFGDDSKFLVEVKSGQVEA-SLNP-DRELRRLKQMFE  1015

Query  158   AWKKDYKSRLQVVKATLKQL  99
             AWKKDY +RL+  K  L +L
Sbjct  1016  AWKKDYGARLRETKVILHKL  1035



>ref|XP_003541108.1| PREDICTED: myosin-2-like [Glycine max]
Length=1180

 Score =   144 bits (362),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 166/336 (49%), Gaps = 56/336 (17%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             S+E   KQ  V +G+  IQ+C+ GH+AR Y+ ELK G   LQSF+RGEN R+ Y   V  
Sbjct  838   SLENKRKQ--VLQGILGIQKCFRGHRARVYFCELKNGVTTLQSFIRGENTRRKYGVTV--  893

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR------IEFNKKITSRLNSRQM  645
              ++ VTI        SR LE++ A+I LQS IRGWL R      I  +K+       R  
Sbjct  894   -KSSVTIY-------SRILEEIHAIILLQSVIRGWLVRRGDASHINRSKRYPENAKPRWK  945

Query  644   --------LNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
                     + P+L  E ++   S L DLQRRV   +A +++  DEN  L+E + Q ++K 
Sbjct  946   SFMKIIPEVKPDLSKEPVQNLLSALADLQRRVDKADAIVKQKEDENTELREQLKQSERKR  1005

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRS-----------------------EGVAEN  378
              EYE KM+ +E++WQ Q+ S+Q SL AA +S                       E     
Sbjct  1006  IEYETKMKSMEEAWQKQMASLQMSLVAARKSLAPENASVQPVRRDFVLPRGYDSEDATSM  1065

Query  377   GLSRTEPPSERFIP--FERSDAGLVVNNRLDFASPLDQE-NGSHQNMITWVKSGHD-EPL  210
             G SRT   S   +      SDAG  VN  L     L +E     QN    VK+ +D +P 
Sbjct  1066  G-SRTPGGSTPMLSGSLSASDAGRQVNGTLTTVGNLMKEFEQERQNFDDEVKALNDVKPE  1124

Query  209   NLSPKNS--DVHKVKLRFKAWKKDYKSRLQVVKATL  108
               +  NS  ++ K+K RF+ WK  YK RL+  K  L
Sbjct  1125  QSANTNSFEELRKLKQRFEGWKNQYKVRLRETKTRL  1160



>ref|XP_003536741.2| PREDICTED: myosin-1-like isoform X1 [Glycine max]
Length=1176

 Score =   143 bits (361),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 114/320 (36%), Positives = 170/320 (53%), Gaps = 31/320 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ G++AR Y  EL RG   LQSF+RGE +RK+Y   +
Sbjct  842   QIGVLEDTRNRTLH-GVLRVQSCFRGYRARCYRKELWRGITTLQSFIRGEKSRKEYAASL  900

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK MK   SR R++ +  A + +QS IRGWL R   +  I   L+  Q + 
Sbjct  901   QRHRAAVIIQKRMKTVFSRNRMKNINDAAVVIQSFIRGWLVR-RCSGDIG--LSKSQGIK  957

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                 DE + V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  958   TNESDE-VLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSM  1016

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++              
Sbjct  1017  EEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGAK  1076

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F+
Sbjct  1077  SMSAGLSVISRL--AEEFEQRSQVFGDDSKFLVEVKSGQVEA-SLNP-DRELRRLKQMFE  1132

Query  158   AWKKDYKSRLQVVKATLKQL  99
             AWKKDY +RL+  K  L +L
Sbjct  1133  AWKKDYGARLRETKVILHKL  1152



>gb|KHN37364.1| Myosin-J heavy chain [Glycine soja]
Length=1176

 Score =   143 bits (361),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 114/320 (36%), Positives = 170/320 (53%), Gaps = 31/320 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ G++AR Y  EL RG   LQSF+RGE +RK+Y   +
Sbjct  842   QIGVLEDTRNRTLH-GVLRVQSCFRGYRARCYRKELWRGITTLQSFIRGEKSRKEYAASL  900

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK MK   SR R++ +  A + +QS IRGWL R   +  I   L+  Q + 
Sbjct  901   QRHRAAVIIQKRMKTVFSRNRMKNINDAAVVIQSFIRGWLVR-RCSGDIG--LSKSQGIK  957

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                 DE + V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  958   TNESDE-VLVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYENRWSEYELKMKSM  1016

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  + +   N  +      +R   ++              
Sbjct  1017  EEVWQKQMRSLQSSLSIAKKSLAMDDSERNSDASVNASDDRDFSWDVGTNHRRQESNGAK  1076

Query  323   --DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ ++K  F+
Sbjct  1077  SMSAGLSVISRL--AEEFEQRSQVFGDDSKFLVEVKSGQVEA-SLNP-DRELRRLKQMFE  1132

Query  158   AWKKDYKSRLQVVKATLKQL  99
             AWKKDY +RL+  K  L +L
Sbjct  1133  AWKKDYGARLRETKVILHKL  1152



>emb|CDO99630.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   135 bits (341),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 102/285 (36%), Positives = 159/285 (56%), Gaps = 38/285 (13%)
 Frame = -3

Query  860  SFVRGENARKDYQFLVTRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIE  687
            + VRGENAR  +   + +++AI  IQK +K Q    +  E+  A I LQ+ IRGWL    
Sbjct  7    AIVRGENARICF---MKKMKAIRAIQKCVKSQLRSTMLDEKDQAAIFLQASIRGWLAWRH  63

Query  686  FNK--KITSRLN--SRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLK  519
            +N   K   + N  +R + N E KD+ I V  SVL+DLQRRV  TEA L++ ++ENA+LK
Sbjct  64   YNSTDKRERQFNEEARNVKNLENKDQ-IMVPYSVLVDLQRRVLKTEALLDKKKEENATLK  122

Query  518  EYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGA--ASRSEGVAENGLSRTEP----  357
              I Q ++K Q+YE KM+ +EK+WQDQL S+Q +L    +S    V + GL    P    
Sbjct  123  LQIKQHERKRQQYETKMKLMEKTWQDQLTSMQMNLATKKSSSKHAVGKLGLLLALPEIQD  182

Query  356  -------PSERFIPFERSDAGLVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSP  198
                   P+ RF    RS++  ++++       LD++ G            H EP  ++ 
Sbjct  183  EDAPDPSPTSRFQLNGRSNSDQLIDHE---KGILDEDTGIFI---------HIEPGRMAS  230

Query  197  KNS---DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
              +   ++ ++K +FK WKKD+K++L V K T+K+L + + GK++
Sbjct  231  STNPEEELERLKFKFKTWKKDFKNKLMVAKTTIKKLGNSETGKNS  275



>ref|XP_006306608.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
 gb|EOA39506.1| hypothetical protein CARUB_v10008120mg [Capsella rubella]
Length=1192

 Score =   142 bits (359),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 115/331 (35%), Positives = 173/331 (52%), Gaps = 37/331 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    +LK+G  +LQSF+RGEN RK+Y  L+
Sbjct  859   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRIKDLKKGITILQSFIRGENIRKEYTELL  917

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K + +RR  +  + A + +QS IRG L R     I + K   ++ N 
Sbjct  918   QRHRASAAIQSHVKRRIARRQYKATVDASVVIQSAIRGELVRRCAGDIGWLKSGGTKRN-  976

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ SVL +LQRRV  TEAAL    +EN  L++ + Q+D +  EYE 
Sbjct  977   --------ESDEVLVKASVLSELQRRVLKTEAALREKEEENDILRQRLQQYDNRWSEYET  1028

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------AENGLSRTEPPSERFIPFE  330
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V            A +G       +   +   
Sbjct  1029  KMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASDGTDLDSGGNHFQMGHG  1088

Query  329   RS---DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
             RS     GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++K  
Sbjct  1089  RSRSVGVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRLKQM  1145

Query  164   FKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
             F+ WKKDY  RL+  K  L +L   + G S 
Sbjct  1146  FETWKKDYGGRLRETKLILSKLGSEETGGSA  1176



>ref|XP_010688651.1| PREDICTED: myosin-1-like [Beta vulgaris subsp. vulgaris]
Length=1178

 Score =   142 bits (358),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 109/323 (34%), Positives = 163/323 (50%), Gaps = 34/323 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +      G+  +Q C+ G+ AR +  E ++G   LQSF+RGE  RK++  L+
Sbjct  841   QIGVLEDTRNRTFH-GILRVQSCFRGYIARSFVKETRKGICTLQSFIRGEKTRKEFAVLL  899

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA +TIQK +K +  R+  LE   A I +QS IRGWL R + +  I   LN  +   
Sbjct  900   LRHRAAITIQKQIKGRMRRKQFLESTNATIVMQSVIRGWLVR-KCSGNIGLLLNLGEKAG  958

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
              E   +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  959   NE--SDEVLVKASYLAELQRRVLKAEAALREKEEENEILHQRLRQYENRWSEYELKMKSM  1016

Query  458   EKSWQDQLMSIQTSLGAASRSEGV---AENGLSRTEPPSERFIPFERS------------  324
             E+ WQ Q+ S+Q+SL  A +S  V   A N  +      ER    +              
Sbjct  1017  EEVWQKQMRSLQSSLSIAKKSLAVDDSARNSDASVNASEEREYSGDTGGNITLRSHESNG  1076

Query  323   ----DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGH-DEPLNLSPKNSDVHKVKL  168
                  A L V +R+  A   +Q     G     +  VKSG  D  LN    + ++ ++K 
Sbjct  1077  VRPMSASLSVISRM--AEEFEQRKQVFGDDAKFLVEVKSGQVDASLN---PDRELRRLKQ  1131

Query  167   RFKAWKKDYKSRLQVVKATLKQL  99
              F+ WKKDY +RL+  K  L +L
Sbjct  1132  MFETWKKDYGTRLRETKVILNKL  1154



>ref|XP_006393159.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
 gb|ESQ30445.1| hypothetical protein EUTSA_v10011193mg [Eutrema salsugineum]
Length=1148

 Score =   142 bits (358),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 118/331 (36%), Positives = 169/331 (51%), Gaps = 37/331 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    +LK G  VLQSFVRGE  RKDY  L+
Sbjct  815   QIGVLEDTRNRTLH-GILRLQSCFRGHQARCRLKDLKGGITVLQSFVRGEKIRKDYAELL  873

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K + ++R    ++ A I LQS IRG L R     I + K    + N 
Sbjct  874   RRHRACTDIQSHVKRRIAKRQYKAKVDASIVLQSAIRGELVRRCAGDIGWLKSGGFKGN-  932

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ SVL +LQRRV  +EAAL    +EN  L++ + Q+D +  EYE 
Sbjct  933   --------ESKEVLVKASVLSELQRRVLKSEAALREKEEENDILRQRLQQYDNRWSEYET  984

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S   E  A N  +     S+        D      
Sbjct  985   KMKSMEEIWQKQMRSLQSSLSIAKKSLEVEDSARNSDASVNAFSDATDLSGSGDFRTHGR  1044

Query  320   ------AGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                    GL V +RL  +F     Q  G     +  VKSG  E  NL+P+  ++ ++K  
Sbjct  1045  TRSVGVVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGQVEA-NLNPER-ELRRLKQM  1101

Query  164   FKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
             F+ WKKDY  RL+  K  L +L   + G S 
Sbjct  1102  FETWKKDYGGRLKETKLILSKLGSEETGGSV  1132



>ref|XP_006362934.1| PREDICTED: myosin-2-like isoform X1 [Solanum tuberosum]
Length=1203

 Score =   142 bits (357),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 110/351 (31%), Positives = 173/351 (49%), Gaps = 55/351 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI++ E+ ++  +Q  +E+ Q+CY G  AR +++ELK   I+LQSFVRGE AR+ Y+   
Sbjct  860   QIAVLEEVRKQVLQGTLEV-QKCYSGPHARRHFHELKGVVIILQSFVRGEIARRQYK---  915

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                    +++   K+      EQL AV+ +QS IR WL +   N+   S+  ++    P 
Sbjct  916   ------DSLESKQKDANKENDEQLVAVLQIQSAIRCWLAQRHLNQLQKSKKLNQDRPKPA  969

Query  632   LKDEDIK------VQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
              K  ++K      +  SV+ DL+RRV V EA LE    ENA+LKE + Q + +  +YE +
Sbjct  970   KKTTEVKQDLPAEILPSVVEDLERRVLVAEATLEEKEKENAALKEQVNQLESRWSDYEVR  1029

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIP--FERSD--------  321
             M+ +E+ WQ Q+ S+Q SL +A +S GV +N  S    P     P  +E  D        
Sbjct  1030  MRSMEEMWQKQMASLQASLVSAKKSLGV-DNSASHPGKPEGSPSPCGYESEDTTTTMGTR  1088

Query  320   ------------------------AGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDE  216
                                      GL V N L     L ++N   + M I+ +KSG   
Sbjct  1089  TPGGSTPIEYASNGVDFGGIREINGGLCVVNYLSREFELRKQNFDDEAMAISQLKSGQ--  1146

Query  215   PLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              L  +    D  +++ +F  WKKDYK+RL+  K  + +L + +  K+   W
Sbjct  1147  -LQSTSPAEDFRRLRHKFDEWKKDYKARLKETKLKVHKLGYSEAEKTRRNW  1196



>gb|KHN46956.1| Myosin-J heavy chain [Glycine soja]
Length=1146

 Score =   142 bits (357),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 115/336 (34%), Positives = 169/336 (50%), Gaps = 58/336 (17%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++E   KQ  V +G+  IQ+C+ GHQAR Y+ ELK G   LQSF+RGEN R+ Y  +V  
Sbjct  806   ALENKRKQ--VFQGILEIQKCFRGHQARGYFCELKNGMTTLQSFIRGENTRRRYGVMV--  861

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE---------FNKKITSRLNS  654
              ++ +TI        SR+LE++ A+I LQS IRGWL R +         + +    R  S
Sbjct  862   -KSSITIY-------SRKLEEIHAIILLQSVIRGWLVRRDASHVNRSKRYPENAKPRRKS  913

Query  653   RQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
                + PE+KD   E ++   S L  LQRRV   +A +E+  +EN  L+E + Q ++K  E
Sbjct  914   FMKITPEVKDLSKEPVQNLVSALAGLQRRVDKADAIVEQKEEENTELREQLRQSERKRIE  973

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFI------------  339
             YE KM+ +E++WQ Q+ S+Q SL AA +S    EN  +  +P    F+            
Sbjct  974   YETKMKSMEEAWQKQMASLQMSLVAARKSLA-PEN--ATVQPVRRDFVLPRGYDSEDATS  1030

Query  338   ---------------PFERSDAGLVVNNRLDFASPLDQE-NGSHQNMITWVKSGHD-EPL  210
                                SDAG  VN  L     L +E     QN    VK+ ++ +P 
Sbjct  1031  MGSQTPGGSTPMLSGSLSVSDAGRQVNGTLTTVGNLMKEFEQQRQNFDDEVKALNEVKPE  1090

Query  209   NLSPKNS--DVHKVKLRFKAWKKDYKSRLQVVKATL  108
               +  NS  ++ K+K +F+ WK  YK RL+  K  L
Sbjct  1091  QSANMNSFEELRKLKQKFEGWKNQYKVRLRETKTRL  1126



>gb|ABJ53202.1| myosin VIII-B [Nicotiana benthamiana]
Length=1156

 Score =   141 bits (356),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 120/344 (35%), Positives = 167/344 (49%), Gaps = 48/344 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ G++AR Y +ELK G I LQSF+RGE AR  Y   V
Sbjct  821   QIAALEDVRNQVLQGTLEV-QKCFRGYRARRYLHELKGGVITLQSFIRGEIARNRYNTSV  879

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSR-LN------S  654
                  +     H  +      EQL AV+ +QS IRGWL R + NK  +++ LN       
Sbjct  880   GSKAKVA----HKSD------EQLVAVVQIQSAIRGWLARKDLNKLQSAKTLNVDIPKTG  929

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
             R+M   EL  E   +  SV+ DL+RR+   EA L     EN +LKE +  F  +  EYE 
Sbjct  930   RKMEAKELPRE---ILPSVVEDLERRLLKAEATLGEKEMENVALKEQLNLFKARCLEYEV  986

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEP---PSERF-------------  342
             KM+ +E  WQ Q+ S+Q SL AA  S G  +      +P   PS R+             
Sbjct  987   KMRSMEDMWQKQMTSLQASLVAAKNSVGAGDTTGRPGKPEGSPSPRYYDSDDATCMDTLA  1046

Query  341   --IPFERSDAGLV-----VNNRLDFASPLDQE-NGSHQNMIT-WVKSGHDEPLNLSPKN-  192
                P + +D+  V     VN  L   S L  E     QN     +   H +P  L P N 
Sbjct  1047  GCTPVKFTDSLGVGANREVNGGLAIVSHLTLEFEQRKQNFDDEALAIVHLKPEQLHPTNP  1106

Query  191   -SDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
               +  ++K RF+ WKKDYK RL+  KA + +L     GK+   W
Sbjct  1107  ADEYRRLKCRFEEWKKDYKVRLKETKAKVHKLGCSKAGKNRRKW  1150



>ref|XP_003526112.1| PREDICTED: myosin-2-like isoform X1 [Glycine max]
Length=1174

 Score =   141 bits (356),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 171/338 (51%), Gaps = 57/338 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   E++++  +Q G+  IQ+C+ GHQAR Y+ ELK G   LQSF+RGEN R+ Y  +V
Sbjct  831   QIDALENKRKQVLQ-GILEIQKCFRGHQARGYFCELKNGMTTLQSFIRGENTRRRYGVMV  889

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE---------FNKKITSRL  660
                ++ +TI        SR+LE++ A+I LQS IRGWL R +         + +    R 
Sbjct  890   ---KSSITIY-------SRKLEEIHAIILLQSVIRGWLVRRDASHVNRSKRYPENAKPRR  939

Query  659   NSRQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              S   + PE+KD   E ++   S L  LQRRV   +A +E+  +EN  L+E + Q ++K 
Sbjct  940   KSFMKIIPEVKDLSKEPVQNLLSALAGLQRRVDKADAIVEQKEEENTELREQLRQSERKR  999

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFI----------  339
              EYE KM+ +E++WQ Q+ S+Q SL AA +S    EN  +  +P    F+          
Sbjct  1000  IEYETKMKSMEEAWQKQMASLQMSLVAARKSLA-PEN--ATVQPVRRDFVLPRGYDSEDA  1056

Query  338   -----------------PFERSDAGLVVNNRLDFASPLDQE-NGSHQNMITWVKSGHD-E  216
                                  SDAG  VN  L     L +E     QN    VK+ ++ +
Sbjct  1057  TSMGSQTPGGSTPMLSGSLSVSDAGRQVNGTLTTVGNLMKEFEQQRQNFDDEVKALNEVK  1116

Query  215   PLNLSPKNS--DVHKVKLRFKAWKKDYKSRLQVVKATL  108
             P   +  NS  ++ K+K +F+ WK  YK RL+  K  L
Sbjct  1117  PEQSANMNSFEELRKLKQKFEGWKNQYKVRLRETKTRL  1154



>ref|XP_009792547.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009792548.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1197

 Score =   141 bits (356),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 172/349 (49%), Gaps = 52/349 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED ++  +Q  +E+  +CY GH AR +++EL+ G I+LQSFVRGE AR+ Y    
Sbjct  855   QIAALEDVRKQVLQGTLEV-PKCYSGHCARRHFHELEGGVIILQSFVRGEIARRQYN---  910

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQ  648
                    +++   K       +QL AV+ +QS IR WL +   N     KK+      + 
Sbjct  911   ------ASLESKRKAANKENDKQLVAVVQIQSAIRCWLAQRHLNQLQSLKKLNQDREKQG  964

Query  647   MLNPELK-DEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
                 E+K D   ++  SV+ DL+RRV V EA+L+    ENA+LKE + Q + +  +YE +
Sbjct  965   RKTSEVKQDLPAEILPSVVEDLERRVMVAEASLDEKDKENAALKEQVNQLEARWSDYEVR  1024

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE----------------------NGLSRTEP  357
             M+ +E+ WQ Q++S+Q SL AA +S GV                          +    P
Sbjct  1025  MRSMEEMWQKQMVSLQASLAAAKKSLGVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTP  1084

Query  356   PSERFIPFE----------RSDAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPL  210
                  I F            ++ GL V N L+    L ++N   + M I  +KS   E L
Sbjct  1085  GGSTPIEFASNGVDFGGIRENNGGLCVVNYLNREFELRRQNFDDEAMAIAQLKS---EQL  1141

Query  209   NLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             + +    D  +++ RF+ WKKDYK+RL+  KA + +  + +  K+   W
Sbjct  1142  HSTNPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKFGYSEAEKTRRNW  1190



>ref|XP_008221075.1| PREDICTED: myosin-1 [Prunus mume]
 ref|XP_008221076.1| PREDICTED: myosin-1 [Prunus mume]
Length=1182

 Score =   141 bits (355),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 167/325 (51%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQ R Y  EL+RG   LQSFVRGE  RK+Y  L+
Sbjct  848   QIGVLEDTRNRTLH-GILRVQSCFRGHQDRCYLKELRRGIATLQSFVRGEKTRKEYTILL  906

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R R+ V IQK MK +  RR  +    A + +QS  RGW  R     I   K  +++ N 
Sbjct  907   QRHRSAVIIQKQMKSRIERRKFKNIYDASVVIQSVFRGWSVRRCSGGIGLLKPGSTQAN-  965

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  966   --------EVDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEL  1017

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE------RSD  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +   N  +      +    ++      R D
Sbjct  1018  KMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDSERNSDASVNASDDHDYSWDTGSNHRRQD  1077

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1078  SNGARPMSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1133

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY +RL+  K  L ++
Sbjct  1134  KQMFEAWKKDYGARLRETKLILHKI  1158



>ref|XP_007225432.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
 gb|EMJ26631.1| hypothetical protein PRUPE_ppa000435mg [Prunus persica]
Length=1185

 Score =   140 bits (353),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 167/325 (51%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQ R Y  EL+RG   LQSFVRGE  RK+Y  L+
Sbjct  851   QIGVLEDTRNRTLH-GILRVQSCFRGHQDRCYLKELRRGIATLQSFVRGEKTRKEYTILL  909

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R R+ V IQK MK +  RR  +    A + +QS  RGW  R     I   K  +++ N 
Sbjct  910   QRHRSAVIIQKQMKRRIERRKFKNIYDASVVIQSVFRGWSVRRCSGGIGLLKPGSTQAN-  968

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE 
Sbjct  969   --------EVDEVLVKSSFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYEL  1020

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE------RSD  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +   N  +      +    ++      R D
Sbjct  1021  KMKSMEEVWQKQMRSLQSSLSIAKKSLAVDDSERNSDASVNASDDHDYSWDTGSNHRRQD  1080

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V +RL      DQ +   G     +  VKSG  E  +L+P + ++ ++
Sbjct  1081  SNGARPMSAGLSVISRL--TEEFDQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRRL  1136

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F+AWKKDY +RL+  K  L ++
Sbjct  1137  KQMFEAWKKDYGARLRETKLILHKI  1161



>ref|XP_009773270.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana sylvestris]
Length=1157

 Score =   140 bits (353),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 115/348 (33%), Positives = 170/348 (49%), Gaps = 55/348 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ GH+AR Y++ELK G I LQSF+RGE AR  Y   V
Sbjct  821   QIAALEDVRNQVLQGTLEV-QKCFRGHRARCYFHELKGGVITLQSFIRGEIARNRYNTSV  879

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSR-LN------S  654
                  +     H  +      EQL AV+ +QS IRGWL R + NK  +++ LN       
Sbjct  880   GSKAKVA----HKSD------EQLVAVVQIQSAIRGWLARKDLNKLQSAKTLNVDIPKTG  929

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
             R+M   EL  E   +  SV+ DL+RR+   EA L     EN +LKE +  F+ +  EYE 
Sbjct  930   RKMEAKELPRE---ILPSVVEDLERRLLKAEATLGEKEMENVALKEQLNLFEARCLEYEV  986

Query  473   KMQCLEKSWQDQLMSI-QTSLGAASRSEGVAENGLSRTEP---PSERF------------  342
             KM+ +E+ WQ Q+ S+ Q SL AA  S G  +      +P   PS R+            
Sbjct  987   KMRSMEEMWQKQMASLQQASLAAAKNSLGAGDTTGRPGKPEGSPSPRYYDSDDATSMDTP  1046

Query  341   -----IPFERS---------DAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPLN  207
                  + F  S         + GL + + L       ++N   + + I  +K G    L+
Sbjct  1047  AGCTPVKFTNSLGVGANREVNGGLAIVSHLTLEFEQRKQNFDDEALAIVHLKPGQ---LH  1103

Query  206   LSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              +    +  ++K RF+ WKKDYK RL+  KA + +L     GK+   W
Sbjct  1104  STNPADEYRRLKCRFEEWKKDYKVRLKETKAKVHKLGCSKAGKNRRKW  1151



>ref|XP_009589781.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana tomentosiformis]
Length=1194

 Score =   140 bits (352),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 108/348 (31%), Positives = 170/348 (49%), Gaps = 51/348 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED ++  +Q  +E+  +CY GH AR ++ EL+   I+LQSFVRGE AR+ Y    
Sbjct  853   QIAALEDVRKQVLQGTLEV-PKCYSGHCARRHFLELEGVIIILQSFVRGEIARRQYN---  908

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQ  648
                    +++   K       +QL AV+ +QS IR WL +   N     KK+      + 
Sbjct  909   ------ASLESKRKAANKENDKQLVAVVQIQSAIRCWLAQRHLNQLQSLKKLNQDREKQG  962

Query  647   MLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
                 E+KD   ++  SV+ D +RRV V EA+L+    ENA+LKE + Q + +  +YE +M
Sbjct  963   RKTLEVKDFPAEILPSVVEDFERRVMVAEASLDEKDKENAALKEQVNQLEARWSDYEVRM  1022

Query  467   QCLEKSWQDQLMSIQTSLGAASRSEGVAE----------------------NGLSRTEPP  354
             + +E+ WQ Q++S+Q SL AA +S GV                          +    P 
Sbjct  1023  RSMEEMWQKQMVSLQVSLAAAKKSLGVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTPG  1082

Query  353   SERFIPFE----------RSDAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPLN  207
                 I F            ++ GL V N L+    L ++N   + M I  +KS   E L+
Sbjct  1083  GSTPIEFASNGVDFGGIRENNGGLCVVNYLNREFELRRQNFDDEAMAIAQLKS---EQLH  1139

Query  206   LSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              +    D  +++ RF+ WKKDYK+RL+  KA + +L + +  K+   W
Sbjct  1140  STNPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKLSYSEAEKTRRNW  1187



>ref|XP_011029402.1| PREDICTED: myosin-2-like [Populus euphratica]
Length=1199

 Score =   140 bits (352),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 114/353 (32%), Positives = 176/353 (50%), Gaps = 57/353 (16%)
 Frame = -3

Query  983   IEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRL  804
             +EE  KQ    +G+  +Q+ +   QAR ++ ELK+G ++LQSF+RGEN R+ Y  ++ R 
Sbjct  855   LEEQRKQFL--QGIVEVQKYFRAGQARQHFRELKQGVVMLQSFIRGENMRRKYNHMIKRR  912

Query  803   RAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQMLN  639
                 T+   +   +    +QL A + LQS IRGWL R + N     K++T   NS     
Sbjct  913   ----TVNAPLAVDEVD--DQLLAALYLQSVIRGWLARKQLNSMHKMKQLTHE-NSNSKRK  965

Query  638   PELKDEDIKV--------QRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
             P  K  ++KV        Q S+L DLQ+RV   E  + +  +ENA+LK+ + Q +K+  +
Sbjct  966   PGKKISEVKVIPQEQVDIQASILADLQKRVVKAEVTVAQKEEENAALKDQLQQNEKRWLD  1025

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL-------SRTEP---PSERFIPF  333
             YEAKM+ +E+ WQ Q+ S+QTSL AA +S   A+N         S T P    SE ++  
Sbjct  1026  YEAKMKAMEEMWQVQMASLQTSLAAARKSLA-ADNTAGQPGKLDSSTSPHYYDSEDYVST  1084

Query  332   ERSDAG-----LVVNNRLDFASPLDQENGSH-------------QNMITWVKS-----GH  222
             E    G     +  N   D  +  +     H             QN    VK+       
Sbjct  1085  ESRTPGGNTPSIFANTFPDLRAVRENNGPLHAVSNLTREFEQQKQNFDDNVKALVEARAG  1144

Query  221   DEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                 N++P + ++ ++KLRF+ WKKDYK RL+  K  L +L H +  ++   W
Sbjct  1145  QSASNMNP-DEELRRLKLRFETWKKDYKVRLRETKVRLHKLGHGEVDRNRRKW  1196



>ref|XP_008800396.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1247

 Score =   140 bits (352),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 121/373 (32%), Positives = 173/373 (46%), Gaps = 87/373 (23%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED +   +Q G+  +Q+ + GHQAR YY  LK+G   LQSFVRGE AR +++   
Sbjct  869   QVAALEDVRNHTLQ-GILSVQKNFRGHQARRYYQALKKGVTTLQSFVRGEKARCEFEVSR  927

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTR---IEFNKKITSRLNSRQ  648
              R +A V IQKH + + +R +  +Q   +I LQ  IRGWL R   +    +  S LN  +
Sbjct  928   KRWKASVLIQKHARRRIARTMFDDQQKDIILLQCVIRGWLARNCFVLLQNQEMSELNHGK  987

Query  647   ML------NPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
                      PE+KD   E  +V  SVL +LQRRV   EA+L    +ENA LK+ + Q++ 
Sbjct  988   ANKDADKDTPEMKDTNKEPAQVHPSVLAELQRRVLKAEASLREKEEENAILKQQLQQYET  1047

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQT----------------------------------S  417
             +  EYEAKM+ +E++WQ QL S+Q                                   +
Sbjct  1048  RWSEYEAKMKSMEETWQKQLTSLQVSLAAAKKSLAADDMASHHGRLDASPVQHSYDSEDT  1107

Query  416   LGAASRS-EGV-------AENGLSRTEPPSERFI-PFERSDAGLVVNNRLDFASPLDQEN  264
             L A +R+ EG         + GL R    +   +   + SD GLV              N
Sbjct  1108  LSAGTRTPEGTPAKKFHACDAGLGRNSNGTRSAVRHLDASDGGLV-----------RYSN  1156

Query  263   GSHQNMITWVKS-------GHDEPLNL---------SPKNSD--VHKVKLRFKAWKKDYK  138
             G+H  +   VK          D+   L         S  N D  + K+K RF  WKKDYK
Sbjct  1157  GAHSAVSNLVKEFEQQTQVFEDDAAFLVEVKSRQSGSSINPDEELQKLKGRFGTWKKDYK  1216

Query  137   SRLQVVKATLKQL  99
              RL+  K  L++L
Sbjct  1217  VRLRETKIALQKL  1229



>gb|EPS68761.1| hypothetical protein M569_06006, partial [Genlisea aurea]
Length=1053

 Score =   139 bits (351),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 167/330 (51%), Gaps = 40/330 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  GV  +Q C+ GHQAR    E +RG   LQSF+RGE ARK +  L+
Sbjct  717   QIGVLEDTRNRTLH-GVLRVQSCFRGHQARCLTRETRRGIASLQSFIRGEKARKSFSVLL  775

Query  812   TRLRAIVTIQKHMKEQQSRR----LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQM  645
              R RA  TIQK +K ++ R+    LE  + VI  QS IRGW+ R     + +  +   Q 
Sbjct  776   QRHRAATTIQKRVKARRIRKKFKKLEHASTVI--QSVIRGWIVR-----RCSGDIVLLQF  828

Query  644   LNPELKD-EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
                +  + E++ V+ S L +LQRRV   EA+L    +EN  L + + Q+D +  EYE KM
Sbjct  829   AGTKTNEQEEVLVKSSFLAELQRRVLRAEASLRDKEEENDILFQRLQQYDSRWSEYELKM  888

Query  467   QCLEKSWQDQLMSIQTSLGAASRS---------EGVAENGLSRTEPPSERFIPFERSDAG  315
             + +E+ WQ Q+ S+Q+SL  A RS            + NG    E       P    ++ 
Sbjct  889   KSMEEIWQKQMRSLQSSLSIAKRSLAFDDSHRNSDASVNGGGNEESWETGSNPARTQESN  948

Query  314   -----------LVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHK  177
                        + V +RL  A   DQ +   G     +  VKSG  E  +L P + ++ +
Sbjct  949   GARTSGGGGTGISVISRL--AQEFDQRSQVFGDDAKFLVEVKSGQVEA-SLDP-DQELRR  1004

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQLRHCD  87
             +K  F+AWKKDY SRL+  K  L ++ + D
Sbjct  1005  LKHMFEAWKKDYGSRLRETKMILSKIGNDD  1034



>ref|XP_010479488.1| PREDICTED: myosin-3-like [Camelina sativa]
Length=1153

 Score =   139 bits (351),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 117/334 (35%), Positives = 172/334 (51%), Gaps = 44/334 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    ELKRG  VLQSFVRGE  RK+Y  L+
Sbjct  821   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRIKELKRGITVLQSFVRGEKIRKEYTELL  879

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ ++K + +RR  +  + A + +QS IRG L R     I + +   ++ N 
Sbjct  880   QRHRASAAIQSNVKRRIARRQYKATVDASVVIQSAIRGELVRRCAGDIGWLQSGGTKRN-  938

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +D+ V+ S L  LQRRV  TEAAL    +EN  L++ + Q+D +  EYE 
Sbjct  939   --------ESDDVLVKASYLSQLQRRVLKTEAALREKEEENYILRQRLQQYDNRWSEYET  990

Query  473   KMQCLEKSWQDQLMSIQTSLGAASR-----------------SEGVAENGLSRTEPPSER  345
             KM+ +E+ WQ Q+ S+Q+SL  A +                 S+G  ++G S  +    R
Sbjct  991   KMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASDGTVDSGGSHFQMGHGR  1050

Query  344   FIPFERS-DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                  RS   GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++
Sbjct  1051  ----SRSVGVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRL  1103

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
             K  F+ WKKDY  RL+  K  L +L   + G S 
Sbjct  1104  KQMFETWKKDYGGRLRETKLILSKLGSEETGGSA  1137



>ref|XP_007133144.1| hypothetical protein PHAVU_011G155300g [Phaseolus vulgaris]
 gb|ESW05138.1| hypothetical protein PHAVU_011G155300g [Phaseolus vulgaris]
Length=1176

 Score =   139 bits (350),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 113/330 (34%), Positives = 170/330 (52%), Gaps = 49/330 (15%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++E   KQ  + +G+  IQ+C+ GHQAR  + ELK G   LQSF+RGEN+R+ Y      
Sbjct  839   ALENTRKQ--ILQGILGIQKCFRGHQARGCFCELKNGVTTLQSFIRGENSRRKYGVTA--  894

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE---------FNKKITSRLNS  654
              ++ +TI        SR+LE++ A+I LQS IRGWL R +         + +    R  S
Sbjct  895   -KSSITIY-------SRKLEEIHAIILLQSVIRGWLVRRDASHVNRSKKYPENAKPRRKS  946

Query  653   RQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
                + PE++D   E ++   S L +LQR+V   +A +E+  +E   L+E + Q ++K  E
Sbjct  947   FMKIIPEVQDLSKEPVQNLLSALAELQRQVDKADAIVEQKEEEYIELREQMKQSERKRIE  1006

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRS-------------EGVAENGL--------SR  366
             YE KM+ +E++WQ Q+ S+Q SL AA +S             + V   G         SR
Sbjct  1007  YETKMKSMEEAWQKQMASLQMSLVAARKSLAPENATVQPVRHDFVLPRGYDSEDTSMGSR  1066

Query  365   TEPPSERFIPFERSDAGLVVNNRLDFASPLDQENGSHQNMI-TWVKSGHD-EPLNLSPKN  192
             T   S   +     DAG  VN  L+  S L +E     ++    VKS +D +P   +  N
Sbjct  1067  TPGESTPMLSLSIPDAGRQVNGTLNTVSNLMKEFEQRTHIFDDEVKSLNDVKPGQCANIN  1126

Query  191   S--DVHKVKLRFKAWKKDYKSRLQVVKATL  108
             S  ++ K+K RF+ WKK YK RL+  K  L
Sbjct  1127  SVEELRKLKQRFEGWKKQYKIRLRETKTRL  1156



>ref|XP_010062907.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 ref|XP_010062908.1| PREDICTED: myosin-2 [Eucalyptus grandis]
 gb|KCW70053.1| hypothetical protein EUGRSUZ_F03356 [Eucalyptus grandis]
Length=1222

 Score =   139 bits (349),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 114/360 (32%), Positives = 179/360 (50%), Gaps = 60/360 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  E  ++  +Q G+  +Q+C+  H ARH + ELK G   LQSFVRGE  RK+Y  L 
Sbjct  870   QIATLEGRRKRILQ-GIVGVQKCFRRHLARHQFYELKNGVTTLQSFVRGEVTRKEYSTLR  928

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN--  639
                    ++    +EQ+        A++ LQS IRGWL R +FN  +  + +S Q L   
Sbjct  929   DSCLDGASMLGTDEEQR--------AIVGLQSVIRGWLVRRKFNDSLKMKRSSLQTLKST  980

Query  638   -------------PELKDE----DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYI  510
                          P+ ++E      +V  +VL +LQ+R    EA L++  +ENA+L+E +
Sbjct  981   YKSGRRFSGVKDKPQKREEKPQKQTEVMPAVLAELQKRALKAEAMLKQKEEENAALREEL  1040

Query  509   LQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG---------LSRTEP  357
              QF+ K  EYE++M+ +E++WQ Q+ S+Q SL AA +S    +NG         LS  + 
Sbjct  1041  QQFETKWSEYESRMKSMEETWQKQMASLQMSLAAARKSLMTDDNGGQPKRPDVALSPRDY  1100

Query  356   PSERF-----------IPFERSD------AGLVVNNRLDFASPLDQENGSHQNMI-----  243
              SE             +P + S+      AG   N  L+  S L +E    +        
Sbjct  1101  DSEDTTSMGSRTPGGSMPVKFSNAVTDGRAGRDTNGTLNAVSDLMKEFEIRKQTFDDDAR  1160

Query  242   TWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             + V+   +   N SP + ++ K+K+RF++WKK+YK RL+  K  L++  H D  K    W
Sbjct  1161  SLVEVRSELASNASP-DEELRKLKVRFESWKKEYKVRLRETKVRLRKRGHLDADKGRRKW  1219



>ref|XP_010557555.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
 ref|XP_010557556.1| PREDICTED: myosin-1-like [Tarenaya hassleriana]
Length=1171

 Score =   139 bits (349),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 114/329 (35%), Positives = 168/329 (51%), Gaps = 31/329 (9%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GH AR +  ELKRG   LQSFVRGE  RK+Y  L+
Sbjct  835   QIGVLEDTRSRTLH-GILRVQSFFRGHLARLHMKELKRGIANLQSFVRGEKVRKEYMKLL  893

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQ+ +K + +R+  +  L A + +QS IRGWL R   +  I   L S  +  
Sbjct  894   QRHRAAVAIQRQVKSKIARKQYKGMLDASVVIQSVIRGWLVR-RCSGDI-GWLKSGGVKR  951

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
              E   E++ V+ SVL +LQRRV   EA L    +EN  L++ + Q++ +  EYE KM+ +
Sbjct  952   DE--SEEVLVKASVLAELQRRVLKAEAGLREKEEENDILQQRLQQYENRWSEYETKMKSM  1009

Query  458   EKSWQDQLMSIQTSLGAASR-----------------SEGVAENGLSRTEPPSERFIPFE  330
             E+ WQ Q+ S+Q+SL  A R                 S+G   +  S     +       
Sbjct  1010  EEIWQKQMRSLQSSLSIAKRGLAADDSERNSDASVNASDGTDLDSASNFRAQTSNGGGTR  1069

Query  329   RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFK  159
                AGL V  R+  A    Q +         +  VKSG  E  NL+P + ++ ++K  F+
Sbjct  1070  PMSAGLSVIGRM--AEEFGQRSQVFSDDAKFLVEVKSGQVEA-NLNP-DMELRRLKQMFE  1125

Query  158   AWKKDYKSRLQVVKATLKQLRHCDRGKST  72
             AWKKDY +RL+  K  L +L + + G S 
Sbjct  1126  AWKKDYGARLRETKLILGKLGNEESGSSV  1154



>ref|XP_009603974.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
Length=1158

 Score =   138 bits (348),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 117/353 (33%), Positives = 169/353 (48%), Gaps = 64/353 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ GH+AR Y++ELK G I LQSF+RGE AR  Y    
Sbjct  821   QIAALEDVRNQVLQGTLEV-QKCFRGHRARRYFHELKGGVITLQSFIRGEIARNRYN---  876

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP-  636
             T + + V +         +  EQL AV+ +QS IRGWL R + NK     L S + LN  
Sbjct  877   TSVGSKVKVAH-------KNDEQLVAVVQIQSAIRGWLARKDLNK-----LQSAKTLNVD  924

Query  635   --------ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
                     E+K+   ++  S + DL+RRV   EA L     EN +LKE +  F+ +  EY
Sbjct  925   IPKTGRKMEVKELPREILPSAVEDLERRVLKAEATLGEKEMENVALKEQVNLFEARCLEY  984

Query  479   EAKMQCLEKSWQDQLMSI-QTSLGAASRSEGVAENGLSRTEP---PSERFIPFERSDAGL  312
             E KM+ +E+ WQ Q  S+ Q SL AA  S G  +      +P   PS R+  ++  DA  
Sbjct  985   EVKMRSMEEMWQKQTASLQQASLAAAKNSLGAGDTTGRPGKPEGSPSPRY--YDSDDATS  1042

Query  311   V-----------VNNRLDFASPLDQENG----SH---------QNM------ITWVKSGH  222
             +            NN L   +  +   G    SH         QN       I  +K G 
Sbjct  1043  MDTPAGCTPVKFTNNSLGVGANREVNGGLAIVSHLTLEFEQRKQNFDDEALAIVHLKPGQ  1102

Query  221   DEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                L+ +    +  ++K RF+ WKKDYK RL+  K  + +L     GK+   W
Sbjct  1103  ---LHSTNPADEYRRLKCRFEEWKKDYKVRLKETKTKVHKLGCSKAGKNRRKW  1152



>ref|XP_010694427.1| PREDICTED: myosin-2 isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1236

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 114/348 (33%), Positives = 180/348 (52%), Gaps = 42/348 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q  + + Q+CY G++AR  + ELK     LQSF+RGE+ R  Y  L+
Sbjct  884   QIGALEDTRKQVLQSVIGL-QKCYRGYRARAQFLELKTRISSLQSFIRGESTRSKYDSLL  942

Query  812   TRLRAIV---TIQKHMKEQQSRRL-EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQM  645
                RA +     +   K   S+ L EQ  A+I LQS +RGWL R  F+  +T+  +  + 
Sbjct  943   QINRANLQKHKNKHKHKHSASKALDEQQKAIIQLQSVVRGWLARKHFDDMLTAEDSDVKD  1002

Query  644   LNPELKDE---DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
              N  +KD     +KV  +V+ +LQRRVA  EA L +  +ENASLK+ + Q++ +  +YEA
Sbjct  1003  KNKVIKDSKSGQMKVSNNVVEELQRRVARAEATLVQKEEENASLKKQLQQYEMRWSDYEA  1062

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSDAGLVVN  303
             KM+ +E  WQ Q+ S+Q SL AA +S   E V      +   PS R      SD  L + 
Sbjct  1063  KMRSMEDMWQKQISSLQMSLAAARKSLPPEDVTGQPGRQEASPSPRSYD---SDDNLFMG  1119

Query  302   NR-------LDFASPLD---QENGSHQNMITWV-------KSGHDEP----LNLSPKNS-  189
              +         +++P+    + NG   N +  +       +   DE      ++ P+++ 
Sbjct  1120  PQTPGESTPTKYSNPIAEAREANGGGLNPVNRLAKEFEQQRQAFDEDARALFDVRPQSTP  1179

Query  188   ------DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                   ++ ++K+RF+ WKK+YK RL+  K TL +L H D  K+   W
Sbjct  1180  GMSSFNELRRLKMRFEVWKKEYKVRLKETKGTLHKLGHADMEKNRRKW  1227



>gb|KDO74218.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74219.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74220.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
 gb|KDO74221.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1221

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/352 (32%), Positives = 169/352 (48%), Gaps = 52/352 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------EIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENG-LSRTEPP----SERFIPF  333
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S        E G L  +  P    SE  +  
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEPGRLDASTSPHLYDSEDTMSM  1100

Query  332   -ERSDAGLVVNNRLDF---ASPLDQENGSHQ--NMIT----------------WVKSGHD  219
               R+  G      L+    A    + NGS    N +T                 ++    
Sbjct  1101  GSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTT  1160

Query  218   EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             +P +    + ++ K+K+RF+ WKKDYK+RL+  K  L +L   +  K+   W
Sbjct  1161  QPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSEVEKTRRKW  1212



>ref|XP_006464672.1| PREDICTED: myosin-2-like isoform X1 [Citrus sinensis]
 ref|XP_006464673.1| PREDICTED: myosin-2-like isoform X2 [Citrus sinensis]
 ref|XP_006464674.1| PREDICTED: myosin-2-like isoform X3 [Citrus sinensis]
 ref|XP_006464675.1| PREDICTED: myosin-2-like isoform X4 [Citrus sinensis]
 ref|XP_006464676.1| PREDICTED: myosin-2-like isoform X5 [Citrus sinensis]
Length=1221

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/352 (32%), Positives = 169/352 (48%), Gaps = 52/352 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------EIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENG-LSRTEPP----SERFIPF  333
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S        E G L  +  P    SE  +  
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEPGRLDASTSPHLYDSEDTMSM  1100

Query  332   -ERSDAGLVVNNRLDF---ASPLDQENGSHQ--NMIT----------------WVKSGHD  219
               R+  G      L+    A    + NGS    N +T                 ++    
Sbjct  1101  GSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTT  1160

Query  218   EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             +P +    + ++ K+K+RF+ WKKDYK+RL+  K  L +L   +  K+   W
Sbjct  1161  QPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSEVEKTRRKW  1212



>ref|XP_006451996.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 ref|XP_006451997.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65236.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
 gb|ESR65237.1| hypothetical protein CICLE_v10007271mg [Citrus clementina]
Length=1221

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/352 (32%), Positives = 169/352 (48%), Gaps = 52/352 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------KIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENG-LSRTEPP----SERFIPF  333
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S        E G L  +  P    SE  +  
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEPGRLDASTSPHLYDSEDTMSM  1100

Query  332   -ERSDAGLVVNNRLDF---ASPLDQENGSHQ--NMIT----------------WVKSGHD  219
               R+  G      L+    A    + NGS    N +T                 ++    
Sbjct  1101  GSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTT  1160

Query  218   EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             +P +    + ++ K+K+RF+ WKKDYK+RL+  K  L +L   +  K+   W
Sbjct  1161  QPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSEVEKTRRKW  1212



>gb|EYU39409.1| hypothetical protein MIMGU_mgv1a000419mg [Erythranthe guttata]
Length=1168

 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 167/330 (51%), Gaps = 45/330 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR +  EL+RG   LQSF+R E  RK+Y  L+
Sbjct  827   QIGVLEDTRNHTLH-GILRVQSCFRGHQARCHIKELRRGISTLQSFIRAEKTRKEYAILL  885

Query  812   TRLRAIVTIQKHMKEQQSRR-LEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA ++IQ  +K +  R+ L++L+ A   +QS IRGWL R         +   R M N
Sbjct  886   QRHRAAISIQTQVKAKIFRKNLKRLSDASTVVQSVIRGWLVRRCSGDIALLQFGGR-MGN  944

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + E++ V+   L +LQRRV   EAAL    +EN  L + + Q+D +  EYE KM+ +
Sbjct  945   ---ETEEVVVKSLFLAELQRRVLRAEAALRVKEEENDILHQRLQQYDNRWSEYELKMKSM  1001

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAEN-------------------------GLSRTEPP  354
             E+ WQ Q+ S+Q+SL  A +S    +N                         G+ R    
Sbjct  1002  EEVWQKQMRSLQSSLSIAKKSLSFDDNSHRNSDASVNGNNDERDSSSSWDTGGILRIHQS  1061

Query  353   SERFIPFERSDA--GLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNS  189
             S       RS A  GL V +RL  A   +Q +   G     +  VKSG  E  +L P + 
Sbjct  1062  SNG----GRSAASPGLTVISRL--AQEFEQRSQIFGDDAKFLVEVKSGQTEA-SLDP-DR  1113

Query  188   DVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             ++ ++K  F+ WKKDY SRL+  K  L +L
Sbjct  1114  ELRRLKQMFEGWKKDYGSRLRETKLILNKL  1143



>gb|ACN26349.1| unknown [Zea mays]
Length=456

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 105/326 (32%), Positives = 168/326 (52%), Gaps = 39/326 (12%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI   ED +   +  G+  +Q C+ GHQARH+  E  RG + LQSF+RGENAR+ Y  L+
Sbjct  117  QIGNLEDTRNRTLH-GILRVQSCFRGHQARHHARERTRGVLTLQSFIRGENARQIYSSLL  175

Query  812  TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
             + RA V +Q++++   +RR  +    A + +QSGIRG L R     I+    +     S
Sbjct  176  RKHRAAVVLQRNVRCWLARRYFINVRKASVIIQSGIRGSLVRRCNGNIDL-INVLREFES  234

Query  653  RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
            +Q    E   + I ++ SVL +LQRR+   EA +    +EN  L + + Q++ +  EYE 
Sbjct  235  KQ----EAHGDQILIKASVLAELQRRILKAEATVREKDEENEMLHQRLQQYENRWLEYEQ  290

Query  473  KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFI  339
            KM+ +E+ WQ Q+ S+Q+SL  A +S  + E               NG       S+  +
Sbjct  291  KMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMSDSSVDQSWESNGNHHVSSGSQ-LV  349

Query  338  PFERS---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHK  177
            P       +AGL V +RL  A   +Q +         +  VKSG  +  +L+P + ++ +
Sbjct  350  PHTGGREMNAGLSVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRR  405

Query  176  VKLRFKAWKKDYKSRLQVVKATLKQL  99
            +K  F +WKKD+  R++  K  L +L
Sbjct  406  LKQNFDSWKKDFSGRMRETKVILNKL  431



>ref|XP_009135657.1| PREDICTED: myosin-1-like [Brassica rapa]
Length=1136

 Score =   138 bits (347),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 167/330 (51%), Gaps = 41/330 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G++AR +  EL+ G   LQSFVRGE  RK++ +L 
Sbjct  807   QIGVLEDTRNRTLH-GILRVQSSFRGYKARCHLKELRMGIYTLQSFVRGEKVRKEFAYLR  865

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA  TIQ  +K + +R+  Q    A + +QS IRGWL R     + +  +       
Sbjct  866   KRHRAAATIQSQVKSKIARKQYQDVTEASLVIQSAIRGWLVR-----RCSGDIG------  914

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
               LK  ++ V+ SVL +LQRRV  +EAAL    +EN  L++ + Q++ +  EYE KM+ +
Sbjct  915   -WLKSGEVLVKASVLSELQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSM  973

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAENG-----------LSRTEPPSERFIPFERS----  324
             E+ WQ Q+ S+Q+SL  A +S  V ++             +  +  S +F          
Sbjct  974   EEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFKGGGGRQQQQ  1033

Query  323   ----DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                  AGL V  RL  A   +Q     G     +  VKSG  E  NL+P + ++ ++K  
Sbjct  1034  QRPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP-DRELRRLKQM  1089

Query  164   FKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             F+ WKKDY  RL+  K  L +L   + G S
Sbjct  1090  FETWKKDYGGRLRETKMILSKLGSEESGGS  1119



>ref|XP_006582193.1| PREDICTED: myosin-2-like isoform X2 [Glycine max]
Length=1175

 Score =   138 bits (347),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 114/339 (34%), Positives = 170/339 (50%), Gaps = 58/339 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   E++++  +Q G+  IQ+C+ GHQAR Y+ ELK G   LQSF+RGEN R+ Y  +V
Sbjct  831   QIDALENKRKQVLQ-GILEIQKCFRGHQARGYFCELKNGMTTLQSFIRGENTRRRYGVMV  889

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE---------FNKKITSRL  660
                ++ +TI        SR+LE++ A+I LQS IRGWL R +         + +    R 
Sbjct  890   ---KSSITIY-------SRKLEEIHAIILLQSVIRGWLVRRDASHVNRSKRYPENAKPRR  939

Query  659   NSRQMLNPELKD----EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
              S   + PE+K     E ++   S L  LQRRV   +A +E+  +EN  L+E + Q ++K
Sbjct  940   KSFMKIIPEVKQDLSKEPVQNLLSALAGLQRRVDKADAIVEQKEEENTELREQLRQSERK  999

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFI---------  339
               EYE KM+ +E++WQ Q+ S+Q SL AA +S    EN  +  +P    F+         
Sbjct  1000  RIEYETKMKSMEEAWQKQMASLQMSLVAARKSLA-PEN--ATVQPVRRDFVLPRGYDSED  1056

Query  338   ------------------PFERSDAGLVVNNRLDFASPLDQE-NGSHQNMITWVKSGHD-  219
                                   SDAG  VN  L     L +E     QN    VK+ ++ 
Sbjct  1057  ATSMGSQTPGGSTPMLSGSLSVSDAGRQVNGTLTTVGNLMKEFEQQRQNFDDEVKALNEV  1116

Query  218   EPLNLSPKNS--DVHKVKLRFKAWKKDYKSRLQVVKATL  108
             +P   +  NS  ++ K+K +F+ WK  YK RL+  K  L
Sbjct  1117  KPEQSANMNSFEELRKLKQKFEGWKNQYKVRLRETKTRL  1155



>ref|XP_003533701.1| PREDICTED: myosin-1-like isoform X1 [Glycine max]
 ref|XP_006587966.1| PREDICTED: myosin-1-like isoform X2 [Glycine max]
 ref|XP_006587967.1| PREDICTED: myosin-1-like isoform X3 [Glycine max]
Length=1177

 Score =   138 bits (347),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 169/321 (53%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+QARH   +L+ G   LQSF+RG+  RK Y  L+
Sbjct  843   QIGVLEDTRNRTLH-GILRVQSCFRGYQARHSLKDLRGGITTLQSFIRGDKTRKAYSALL  901

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K   +R R+  ++ A I +Q+ I GWL R     + +  +   +  +
Sbjct  902   KRHRAAVIIQKRIKAVFARNRMRTISDAAIVIQAVIHGWLVR-----RCSGNIGFLKSGD  956

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++K+ D + V+ S L +LQ RV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  957   MKMKESDEVLVKSSFLAELQCRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKS  1016

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE-------------  330
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++             
Sbjct  1017  MEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERDYSWDVGGNHKRQESNGA  1076

Query  329   -RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
               + AGL V +RL  A   +  +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  1077  RSTSAGLSVISRL--AEEFEHRSQVFGDDAKFLVEVKSGQVEA-SLNP-DQELRRLKQMF  1132

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY +RL+  K  + +L
Sbjct  1133  EAWKKDYGARLRETKVIINKL  1153



>gb|KDP38945.1| hypothetical protein JCGZ_00702 [Jatropha curcas]
Length=771

 Score =   137 bits (345),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 108/337 (32%), Positives = 173/337 (51%), Gaps = 48/337 (14%)
 Frame = -3

Query  956  VQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKH  777
            V +G+  +Q+ + G  AR   NELK G  +LQSFVRGENAR+ Y  +VTR    V+    
Sbjct  431  VLQGILGVQKHFRGFLARRDLNELKTGVTILQSFVRGENARRRYSSMVTR--CTVSAPDT  488

Query  776  MKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSR------LNSRQMLNPELKD---  624
            + +Q       L A ICLQ+ IRGWL R +F+ K   +       NS++    ++ +   
Sbjct  489  LDQQ-------LVATICLQAAIRGWLARKQFSDKWKLKSLNQDNTNSKRKPGKKISEVKV  541

Query  623  ---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEK  453
               E +++Q S+L++LQR+VA  E  +E+  +ENA+L+E + Q+++K  EYE KM+ +E+
Sbjct  542  IPQEQVEIQASILVELQRKVAKAEEIIEQKEEENAALREQLQQYERKWSEYETKMKTMEE  601

Query  452  SWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFE-------RSDAGLVVN  303
            +WQ Q+ S+Q SL AA +S   +  A         PS  +   E       R+ +    +
Sbjct  602  TWQMQMESLQGSLAAARKSLTTDNAAPQHAKADSFPSPYYYDCEDNPSTDVRTPSASTPS  661

Query  302  NRLDFASPLDQENGSHQNMITWVKSGHDE-------------PLNLSPKNSDV----HKV  174
                  +  ++E     N +T +    ++              +  S K++ V     K+
Sbjct  662  KNPTTDARAEKETNDPINAVTMLTKEFEQRKQNFDNDAKALAEVKASGKSASVDDELRKL  721

Query  173  KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
            K RF++WKKDYK RL+ VKA   +L H +  + T  W
Sbjct  722  KARFESWKKDYKVRLRDVKARFSKLGHGEFERRTRKW  758



>emb|CDX82270.1| BnaA03g35510D [Brassica napus]
Length=1196

 Score =   138 bits (347),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 109/330 (33%), Positives = 167/330 (51%), Gaps = 41/330 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G++AR +  EL+ G   LQSFVRGE  RK++ +L 
Sbjct  867   QIGVLEDTRNRTLH-GILRVQSSFRGYKARCHLKELRMGIYTLQSFVRGEKVRKEFAYLR  925

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA  TIQ  +K + +R+  Q    A + +QS IRGWL R     + +  +       
Sbjct  926   KRHRAAATIQSQVKSKIARKQYQDVTEASLVIQSAIRGWLVR-----RCSGDIG------  974

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
               LK  ++ V+ SVL +LQRRV  +EAAL    +EN  L++ + Q++ +  EYE KM+ +
Sbjct  975   -WLKSGEVLVKASVLSELQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSM  1033

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAENG-----------LSRTEPPSERFIPFERS----  324
             E+ WQ Q+ S+Q+SL  A +S  V ++             +  +  S +F          
Sbjct  1034  EEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFKGGGGRQQQQ  1093

Query  323   ----DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                  AGL V  RL  A   +Q     G     +  VKSG  E  NL+P + ++ ++K  
Sbjct  1094  QRPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP-DRELRRLKQM  1149

Query  164   FKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             F+ WKKDY  RL+  K  L +L   + G S
Sbjct  1150  FETWKKDYGGRLRETKMILSKLGSEESGGS  1179



>gb|KDO74224.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1048

 Score =   138 bits (347),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 112/352 (32%), Positives = 169/352 (48%), Gaps = 52/352 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  698   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  756

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  757   KSCSAVVP---------EIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  807

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  808   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  867

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV----AENG-LSRTEPP----SERFIPF  333
             EYEAKM+ +E+ WQ Q+ S+Q SL AA +S        E G L  +  P    SE  +  
Sbjct  868   EYEAKMKSMEEMWQKQMASLQMSLAAARKSLASDNTPGEPGRLDASTSPHLYDSEDTMSM  927

Query  332   -ERSDAGLVVNNRLDF---ASPLDQENGSHQ--NMIT----------------WVKSGHD  219
               R+  G      L+    A    + NGS    N +T                 ++    
Sbjct  928   GSRTPGGSTPMKFLNIVPDAGSGRESNGSLTAVNHLTKEFEQRRQNFDDDAKALIEIKTT  987

Query  218   EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             +P +    + ++ K+K+RF+ WKKDYK+RL+  K  L +L   +  K+   W
Sbjct  988   QPASTVHPDVELRKLKMRFETWKKDYKTRLREAKVRLNKLGQSEVEKTRRKW  1039



>ref|XP_003541859.1| PREDICTED: myosin-2-like [Glycine max]
 gb|KHN36777.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   137 bits (346),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 118/344 (34%), Positives = 171/344 (50%), Gaps = 66/344 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +Q  +Q G+  IQ+ + G+QAR +Y+ELK G  +LQSFVRGE AR+ Y  +V
Sbjct  849   QIGALEDRRQHLLQ-GILGIQKSFRGYQARCHYHELKNGVTILQSFVRGEIARRKYGVMV  907

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNSRQ  648
                ++ +TI           +E++ A   LQS IRGWL R     +  +KK      SR+
Sbjct  908   ---KSSMTIT-------FENIEEIQAATTLQSVIRGWLVRRHASGLHKSKKSPENARSRR  957

Query  647   ---MLNPELKDEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
                +  PE+KD  +  +R     S L +LQRRV   EA +E+  +ENA LKE + QF+++
Sbjct  958   RSRVKMPEVKD--VSSERGQNLPSALAELQRRVIKAEATIEQKEEENAELKEQLKQFERR  1015

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-----------------------SEGVAE  381
               EYE +M+ +E+ WQ Q+ S+Q SL AA +                       SE  A 
Sbjct  1016  WIEYEKRMKSMEEMWQKQMSSLQMSLAAARKSLASENVSGQIARRDVASPLGYDSEDAAS  1075

Query  380   NGLSRTEPPSERFIPFERSD------AGLVVNNRLDFASPLDQENGSHQNM-------IT  240
              G SRT        P + S       AG  VN  L   S L +E    ++        + 
Sbjct  1076  MG-SRTPRTPHASTPLKYSSSLTEAGAGRDVNGTLTSVSNLMKEFEQRRHTFDDDARALV  1134

Query  239   WVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
              +K+G     N      ++ K+K RF+ WKK+YK+RL+  KA L
Sbjct  1135  EIKTGQSANTN---SVEELRKLKHRFEGWKKEYKARLRETKARL  1175



>gb|KDP37497.1| hypothetical protein JCGZ_05936 [Jatropha curcas]
Length=923

 Score =   137 bits (345),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 106/326 (33%), Positives = 167/326 (51%), Gaps = 40/326 (12%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI + ED +   +  G+  +Q  + GHQAR +   L+ G   LQS +RGE  RK+Y  L+
Sbjct  586  QIGVLEDTRNRTLH-GILRVQSSFRGHQARRHLRALREGIATLQSVIRGEKIRKEYAVLL  644

Query  812  TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
             R RA + IQ+ +K + +R+  +    A I +QS +RGWL R           N   M++
Sbjct  645  QRQRAAIVIQRQIKSRITRKKYKDIHEASIIIQSVVRGWLVR-------RCSGNIGLMIS  697

Query  638  PELK---DEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
              +K    +++ V+ S L +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM
Sbjct  698  GGIKGNESDEVVVKASFLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKM  757

Query  467  QCLEKSWQDQLMSIQTSLGAASRSEGVAE----NGLSRTEPPSERFIPFERS--------  324
            + +E+ WQ Q+ S+Q+SL  A +S  + +    +  S   P  ER   ++          
Sbjct  758  KSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNAPSDERDYSWDTGSNNRGQES  817

Query  323  --------DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHK  177
                     AGL V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ +
Sbjct  818  NGHGVKPMSAGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-SLNP-DRELRR  873

Query  176  VKLRFKAWKKDYKSRLQVVKATLKQL  99
            +K  F+AWKKDY +RL+  K  L +L
Sbjct  874  LKQMFEAWKKDYGARLRETKVILNKL  899



>ref|XP_006296853.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
 gb|EOA29751.1| hypothetical protein CARUB_v10012840mg [Capsella rubella]
Length=1182

 Score =   137 bits (344),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 167/338 (49%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSF+RGE  RK++  L 
Sbjct  844   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFIRGEKIRKEFADLR  902

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ H+K + +R+  +    A + +QS IRGWL R     I + K   +++N 
Sbjct  903   RRHRAAATIQSHVKSKIARQQYKGITDASVVIQSVIRGWLVRRCSGDIRWLKSGGTKVN-  961

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  962   --------ESGEVLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  1013

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------------------------A  384
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V                              +
Sbjct  1014  KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1073

Query  383   ENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
               G SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1074  NGGGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDVKFLVEVKSGQVEA  1121

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL+P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1122  -NLNP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1157



>ref|XP_010536993.1| PREDICTED: myosin-2-like isoform X1 [Tarenaya hassleriana]
Length=1208

 Score =   137 bits (344),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 110/335 (33%), Positives = 169/335 (50%), Gaps = 51/335 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I E  ++L + KGV  IQ+ + G  +R Y+ +L+ GA++LQS++RGEN+R+ Y  ++
Sbjct  872   QIGILEGRRKL-ILKGVIGIQKHFRGRWSRQYFRQLRNGAMLLQSYIRGENSRRKYD-VI  929

Query  812   TRLRAIVTIQKHMKEQQSRRL-EQLAAVICLQSGIRGWLTRIEFNK------------KI  672
              R  ++           SR + E++ A I LQS +RGWL R +FN             K 
Sbjct  930   YRAASV-----------SRAIAEEITAAIFLQSVVRGWLARNKFNSLQCKKQSHGEKTKP  978

Query  671   TSRLNSRQMLNPELKDEDIKVQ--RSVLLDLQRRVAVTEAALERTRDENASLKEYILQFD  498
               R N R   + +L  E ++     S + +LQRRV   EAAL +  +EN  L+  + QF+
Sbjct  979   KRRSNRRISEDKDLLQEQVQAPPPTSAMAELQRRVQKAEAALVQKEEENTELRGQLRQFE  1038

Query  497   KKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDA  318
              K  +YEAKM+ +E++WQ Q+ S+Q SL AA+R      NG   T P +   +    S+ 
Sbjct  1039  AKWSDYEAKMKSVEEAWQKQMASLQMSL-AAARKSLADNNGGHPTRPDTSISLFGYDSED  1097

Query  317   GLVVNNRLDFASPLDQENGSHQNMITWV------KSGHDE------PLNLSPKNS-----  189
              +         +P    NGS  ++          K   DE         + P+ S     
Sbjct  1098  TVTSIGTPGICTPTKFTNGSLNSVSNLAREFEQRKFSFDEDARSLVEAKMGPQLSISDGQ  1157

Query  188   -----DVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
                  ++ K+KLRF+ WKKDYK+RL+  KA L +L
Sbjct  1158  HHPEEELKKLKLRFETWKKDYKARLRETKARLHRL  1192



>ref|XP_004498109.1| PREDICTED: myosin-J heavy chain-like [Cicer arietinum]
Length=1174

 Score =   136 bits (343),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 111/325 (34%), Positives = 163/325 (50%), Gaps = 41/325 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+Q R    +L+ G   LQSF+RG+  RK Y  L+
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSCFRGYQGRRSVKKLQGGISTLQSFIRGDKTRKAYALLL  898

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLA--AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA V IQK MK    R   +    A I +QS IRGWL R     I F       L S
Sbjct  899   QRHRAAVIIQKRMKALFVRNRTRTIRNATIVIQSVIRGWLVRRCSVDIGF-------LKS  951

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
               M   EL  ++I V+ S L +LQRRV   EAAL    +EN  L + I Q++ +  EYE 
Sbjct  952   GDMKTKEL--DEILVKSSFLAELQRRVLKAEAALREKEEENDILNQRIQQYESRWSEYEL  1009

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE---------  330
             KMQ +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   +E         
Sbjct  1010  KMQSMEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERDYSWEVGSNHRRQE  1069

Query  329   -----RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                   + A L V +RL  A   +Q +         +  VKSG  E  +L+P + ++ ++
Sbjct  1070  SNGTRSTSASLSVISRL--AEEFEQRSQVFSDDAKFLVEVKSGQAEA-SLNP-DQELRRL  1125

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F++WK+DY +RL+  K  + +L
Sbjct  1126  KQMFESWKRDYGARLRETKLIINKL  1150



>ref|XP_010520892.1| PREDICTED: myosin-2-like [Tarenaya hassleriana]
Length=1207

 Score =   136 bits (343),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 104/336 (31%), Positives = 169/336 (50%), Gaps = 49/336 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + E+ + L + + V  +Q+C+ G ++R  + +L+ GAI+LQS++RGENAR+ Y  + 
Sbjct  867   QIGVLENRRTL-ILRCVLGVQKCFRGQRSRRCFQQLRSGAILLQSYIRGENARRKYD-VE  924

Query  812   TRLRAIVTIQKHMKEQQSRRL-EQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSR  651
              ++RA            SR + E+L A I LQS +RGWL R +F      KK+       
Sbjct  925   AKIRAAAI---------SRSIDEELTATIFLQSAVRGWLARKQFERMQRQKKLHGEKTEL  975

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             +  +     ED     S L +LQRRV   EAAL +  DEN +L++ + QF+ +  +YE K
Sbjct  976   RRKSSGTVPEDKIPPSSALAELQRRVQKAEAALLQKEDENVALRDQLRQFEARWSDYEVK  1035

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEP-PSERFIPFER-SDAGLVVNN-  300
             M+ +E++W  Q+ S+Q SL AA ++     NG+  T+P PS   + +   S+  L +   
Sbjct  1036  MKSMEETWLKQVASLQMSLAAARKTLASDNNGIHTTKPEPSISPLGYGYDSEDTLSIGTP  1095

Query  299   -------RLDFASPLDQENGSHQNMITWVKSGHDEPLNL------------SPKNS----  189
                     ++  +P  + NGS   +    +       N              P ++    
Sbjct  1096  GVNTPTKYINGGTPEIRINGSLNAVTNLAREFEQRKFNFDEDVRFLAEEKPGPTSTSSEG  1155

Query  188   ------DVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
                   ++ K+K RFK WKKDYK+RL+  +A L +L
Sbjct  1156  QHHPEEELKKLKQRFKTWKKDYKARLRETRARLHRL  1191



>gb|KHG13556.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1072

 Score =   136 bits (343),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 123/358 (34%), Positives = 179/358 (50%), Gaps = 64/358 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QIS  ED ++  V +GV  +Q+ + GH+AR  ++E  +GA  +QSFV GEN R+ Y    
Sbjct  723   QISALEDRRK-QVLRGVIEVQKYFRGHRARRLFHEHNKGAKSIQSFVCGENIRRKYAAES  781

Query  812   TRLRAIVTIQKHMKEQQSRRL-EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP  636
              R  A            S+ L EQL AVI LQS IRGWL R  FN     + ++R  +  
Sbjct  782   NRCSAFA----------SQLLDEQLTAVIYLQSVIRGWLARRHFNNMHNLKQSNRGSVKS  831

Query  635   ---------ELKD----EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
                      E KD    + I+V  SV+ +LQRRV   E  L +   ENA+L+E + + + 
Sbjct  832   RRKIGRKIFEAKDMPHEQQIQVLPSVMAELQRRVLKAETNLRQKEQENATLREQLQKSEA  891

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG---LSRTEPPSERFIPFE--  330
             +  +YEAKM+ +E+ WQ Q++S+QTSL AA +S   A+NG   L R +  S R    E  
Sbjct  892   RWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSLA-ADNGAGQLGRADVLSPRCYDSEDN  950

Query  329   -----RSDAGLVVNNRLDFASPL-----DQENGS--------------HQNMITWVKSGH  222
                  R+  G   N  + F+  +      +ENGS               QN     KS  
Sbjct  951   VSMGSRTTGG---NTPVLFSGAMPDVVGGRENGSLNALGNLLKEFEQRKQNFDADAKSLI  1007

Query  221   D-----EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             D     +  N++P + ++  ++LRF+ WKKDYK RL+  KA L +  H +  K+   W
Sbjct  1008  DIRVPQQASNVNP-DDELRTLRLRFETWKKDYKLRLKAAKARLHKRGHPESDKARRKW  1064



>ref|XP_010508266.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508273.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508281.1| PREDICTED: myosin-1-like [Camelina sativa]
 ref|XP_010508289.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   136 bits (343),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 166/338 (49%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSF+RGE  RK++  L+
Sbjct  830   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFIRGEKIRKEFAELL  888

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + LQS IRGWL R     I + K   ++ N 
Sbjct  889   RRHRAAATIQSQVKSKIARQQYKGITDASVSLQSAIRGWLVRRCSGDIGWLKSGGTKTN-  947

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  948   --------ESGEVLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  999

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------------------------A  384
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V                              +
Sbjct  1000  KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1059

Query  383   ENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
               G SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1060  NGGGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDVKFLVEVKSGQVEA  1107

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL+P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1108  -NLNP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1143



>ref|XP_010482837.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1215

 Score =   136 bits (343),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 108/364 (30%), Positives = 173/364 (48%), Gaps = 69/364 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  ++  A+VLQS+VRGENAR+ +    
Sbjct  863   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSREYFQNMRAVALVLQSYVRGENARRKFD---  918

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L AVI LQS +RGWL R  FN    S    +++LN  
Sbjct  919   ------AEAKIHADSDSETSTDELTAVIHLQSAVRGWLARKRFN----SMQRQKELLNVT  968

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ   + DLQ+RV  +EAAL +  +EN +L+E + QF
Sbjct  969   TKSKKKAGMRSSDDKDIPLEQFQVQPKTMSDLQKRVLKSEAALAQKEEENTALREQLRQF  1028

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS-------------------------  396
             +++  EYE KM+ +E +WQ Q+ S+Q SL AA +S                         
Sbjct  1029  EERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYES  1088

Query  395   EGVAENGLSRTEPPSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-NMITWVKSGH  222
             E     G      P+ +F      +  +  +N  L+  + L +E    + N     ++  
Sbjct  1089  EDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1148

Query  221   DEPLNLSPKNS-----------DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             D  L + P+ +           +  ++K RF+ WKKDYK+RL+  KA L ++   D+G+ 
Sbjct  1149  DVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDTKARLHRV-DGDKGRH  1207

Query  74    T*IW  63
                W
Sbjct  1208  RKWW  1211



>gb|EYU35564.1| hypothetical protein MIMGU_mgv1a000458mg [Erythranthe guttata]
Length=1138

 Score =   136 bits (342),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 158/322 (49%), Gaps = 35/322 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    ELKRG + LQSF RGE  RK+Y  L+
Sbjct  807   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRLKELKRGIVTLQSFFRGEKTRKEYSVLL  865

Query  812   TRLRAIVTIQKHMKEQ----QSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQM  645
              R RA + IQK +K +    + RRL + +  I  QS IRGWL R         +   R+ 
Sbjct  866   QRHRAAIHIQKRIKARICRNKFRRLNEASTAI--QSVIRGWLVRRCSGDIGLLQFGERKG  923

Query  644   LNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQ  465
               PE    ++ V+ + L +LQRRV   EA L    +EN  L + + Q++ +  EYE KM 
Sbjct  924   TEPE----EVLVKSTFLAELQRRVLRAEATLREKEEENEILSQRLQQYENRWSEYELKMN  979

Query  464   CLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPS---------------ERFIPFE  330
              +E+ WQ Q+ S+Q+SL  A +S     +   R    S                  I   
Sbjct  980   SMEQVWQKQMRSLQSSLSIAKKSLAFESDYSQRNSDASVNENDDQESTIWETKAHEINGV  1039

Query  329   RS--DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
             RS   AG  V  RL  A   +Q +   G     +  VKSG  E   L P +S++ ++K  
Sbjct  1040  RSSTSAGTGVIGRL--AEEFEQRSQVFGDDAKFLVEVKSGQVEA-GLDP-DSELRRLKQM  1095

Query  164   FKAWKKDYKSRLQVVKATLKQL  99
             F+ WKKDY +RL+  K  L +L
Sbjct  1096  FEGWKKDYGARLRETKVILHKL  1117



>ref|XP_010466165.1| PREDICTED: myosin-1 [Camelina sativa]
Length=1166

 Score =   136 bits (342),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 112/338 (33%), Positives = 166/338 (49%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  VLQSF+RGE  RK++  L+
Sbjct  828   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISVLQSFIRGEKIRKEFAELL  886

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     I + K   ++ N 
Sbjct  887   RRHRAAATIQSQVKSKIARQQYKGITDASVSIQSAIRGWLVRRCSGDIGWLKSGGTKTN-  945

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  946   --------ESGEVLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  997

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------------------------A  384
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V                              +
Sbjct  998   KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQAS  1057

Query  383   ENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
               G SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1058  NGGGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDVKFLVEVKSGQVEA  1105

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL+P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1106  -NLNP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1141



>ref|XP_003556592.1| PREDICTED: myosin-1-like [Glycine max]
Length=1176

 Score =   135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 168/321 (52%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G QAR    +L+ G   LQSF+RG+  RK Y  L+
Sbjct  842   QIGVLEDTRNRTLH-GILRVQSCFRGFQARRSLKDLRGGITTLQSFIRGDKTRKAYSALL  900

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K   +R R+  ++ A I +Q+ IRGWL R     + +  +   +  +
Sbjct  901   KRHRAAVIIQKQIKAVFARNRMRTISDAAIVIQAVIRGWLVR-----RCSGNIGFLKSGD  955

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++K+ D + V+ S L +LQ RV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  956   MKMKESDEVLVKSSFLAELQCRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKS  1015

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE-------------  330
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++             
Sbjct  1016  MEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDTSVNASDERDYSWDVGGNHRRQESNGA  1075

Query  329   -RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
               + AGL V +RL  A   +  +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  1076  RSTSAGLSVISRL--AEEFEHRSQVFGDDAKFLVEVKSGQVEA-SLNP-DQELRRLKQMF  1131

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY +RL+  K  + +L
Sbjct  1132  EAWKKDYGARLRETKVIINKL  1152



>gb|KHM99077.1| Myosin-J heavy chain [Glycine soja]
Length=1150

 Score =   135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 168/321 (52%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G QAR    +L+ G   LQSF+RG+  RK Y  L+
Sbjct  816   QIGVLEDTRNRTLH-GILRVQSCFRGFQARRSLKDLRGGITTLQSFIRGDKTRKAYSALL  874

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K   +R R+  ++ A I +Q+ IRGWL R     + +  +   +  +
Sbjct  875   KRHRAAVIIQKQIKAVFARNRMRTISDAAIVIQAVIRGWLVR-----RCSGNIGFLKSGD  929

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++K+ D + V+ S L +LQ RV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  930   MKMKESDEVLVKSSFLAELQCRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKS  989

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE-------------  330
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++             
Sbjct  990   MEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDTSVNASDERDYSWDVGGNHRRQESNGA  1049

Query  329   -RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
               + AGL V +RL  A   +  +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  1050  RSTSAGLSVISRL--AEEFEHRSQVFGDDAKFLVEVKSGQVEA-SLNP-DQELRRLKQMF  1105

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY +RL+  K  + +L
Sbjct  1106  EAWKKDYGARLRETKVIINKL  1126



>emb|CDY25361.1| BnaA05g19230D [Brassica napus]
Length=1549

 Score =   135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 109/333 (33%), Positives = 168/333 (50%), Gaps = 52/333 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSFVRG+  RK++  L 
Sbjct  1209  QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFVRGDKVRKEFAELR  1267

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     + + K + ++ N 
Sbjct  1268  RRHRAAATIQSQVKSKFARKQYKGITDASVLIQSAIRGWLVRRCSGDLRWLKSVGTKTN-  1326

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL DLQRRV  +EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  1327  --------ESGEVLVKASVLSDLQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYET  1378

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG-----------LSRTEPPSERF-----  342
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V ++             +  +  S +F     
Sbjct  1379  KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFKSQAS  1438

Query  341   ---------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSP  198
                       P     AGL V  RL  A   +Q     G     +  VKSG  E  NL+P
Sbjct  1439  NGGGGRQQQQPM---SAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP  1492

Query  197   KNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1493  -DRELRRLKQMFETWKKDYGGRLRETKMILSKL  1524


 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 126/218 (58%), Gaps = 14/218 (6%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSFVRG+  RK++  L 
Sbjct  806   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFVRGDKVRKEFAELR  864

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     + + K + +++  
Sbjct  865   RRHRAAATIQSQVKSKFARKQYKGITDASVLIQSAIRGWLVRRCSGDLRWLKSVGTKVLV  924

Query  653   RQMLNPELK-----DEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
             R + +P  +       ++ V+ SVL DLQRRV  +EAAL    +EN  L++ + Q++ + 
Sbjct  925   R-LYSPSYRLTTNESGEVLVKASVLSDLQRRVLKSEAALREKEEENDILQQRLQQYENRW  983

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG  375
              EYE KM+ +E+ WQ Q+ S+Q+SL  A +S  V ++ 
Sbjct  984   SEYETKMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSA  1021



>ref|XP_010500596.1| PREDICTED: myosin-3 [Camelina sativa]
Length=1154

 Score =   135 bits (340),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 115/331 (35%), Positives = 169/331 (51%), Gaps = 37/331 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    +LKRG  VLQSFVRGE  RK+Y  L+
Sbjct  821   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRIKDLKRGITVLQSFVRGEKIRKEYTELL  879

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ ++K + +RR  +  + A + +QS IRG L R     I + +   ++ N 
Sbjct  880   QRHRASAAIQSNVKRRIARRQYKATVDASVVIQSAIRGELVRRCAGDIGWLESGGTKRN-  938

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ S L  LQRRV  TEAAL    +EN  L++ + Q+D +  EYE 
Sbjct  939   --------ESDEVLVKASYLSQLQRRVLKTEAALREKEEENDILRQRLQQYDNRWSEYET  990

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------AENGLSRTEPPSERFIPFE  330
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V            A +G       S   +   
Sbjct  991   KMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASDGTDLDSGGSHFQMGHG  1050

Query  329   RS---DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
             RS     GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++K  
Sbjct  1051  RSRSVGVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRLKQM  1107

Query  164   FKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
             F  WKKDY  RL+  K  L +L   + G S 
Sbjct  1108  FDTWKKDYGGRLRETKLILSKLGSEETGGSA  1138



>ref|XP_010694426.1| PREDICTED: myosin-2 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1244

 Score =   135 bits (341),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 113/356 (32%), Positives = 181/356 (51%), Gaps = 50/356 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q  + + Q+CY G++AR  + ELK     LQSF+RGE+ R  Y  L+
Sbjct  884   QIGALEDTRKQVLQSVIGL-QKCYRGYRARAQFLELKTRISSLQSFIRGESTRSKYDSLL  942

Query  812   TRLRAIV---TIQKHMKEQQSRRL-EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQM  645
                RA +     +   K   S+ L EQ  A+I LQS +RGWL R  F+  +T+  +  + 
Sbjct  943   QINRANLQKHKNKHKHKHSASKALDEQQKAIIQLQSVVRGWLARKHFDDMLTAEDSDVKD  1002

Query  644   LNPELKDE-----------DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFD  498
              N  +KD            +++V  +V+ +LQRRVA  EA L +  +ENASLK+ + Q++
Sbjct  1003  KNKVIKDSKSGQMKDLLPANVQVSNNVVEELQRRVARAEATLVQKEEENASLKKQLQQYE  1062

Query  497   KKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFER  327
              +  +YEAKM+ +E  WQ Q+ S+Q SL AA +S   E V      +   PS R      
Sbjct  1063  MRWSDYEAKMRSMEDMWQKQISSLQMSLAAARKSLPPEDVTGQPGRQEASPSPRSYD---  1119

Query  326   SDAGLVVNNR-------LDFASPLD---QENGSHQNMITWV-------KSGHDEP----L  210
             SD  L +  +         +++P+    + NG   N +  +       +   DE      
Sbjct  1120  SDDNLFMGPQTPGESTPTKYSNPIAEAREANGGGLNPVNRLAKEFEQQRQAFDEDARALF  1179

Query  209   NLSPKNS-------DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             ++ P+++       ++ ++K+RF+ WKK+YK RL+  K TL +L H D  K+   W
Sbjct  1180  DVRPQSTPGMSSFNELRRLKMRFEVWKKEYKVRLKETKGTLHKLGHADMEKNRRKW  1235



>ref|NP_175453.2| myosin VIIIA [Arabidopsis thaliana]
 sp|F4I507.1|MYO3_ARATH RecName: Full=Myosin-3; AltName: Full=Myosin VIII A; Short=AtVIIIA 
[Arabidopsis thaliana]
 gb|AEE32540.1| myosin VIIIA [Arabidopsis thaliana]
Length=1153

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 166/333 (50%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    ELK G  +LQSFVRGE  RK+Y  L+
Sbjct  820   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRLKELKTGITILQSFVRGEKMRKEYTELL  878

Query  812   TRLRAIVTIQKHMK----EQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRL  660
              R RA   IQ H+K     QQ +     +AVI  QS IRG L R     I +     ++ 
Sbjct  879   QRHRASAAIQSHVKRRIASQQYKATVDASAVI--QSAIRGELVRRCAGDIGWLSSGGTKR  936

Query  659   NSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
             N         + +++ V+ S L DLQRRV  TEAAL    +EN  L++ + Q+D +  EY
Sbjct  937   N---------ESDEVLVKASYLSDLQRRVLRTEAALREKEEENDILRQRVQQYDNRWSEY  987

Query  479   EAKMQCLEKSWQDQLMSIQTSLGAASRSEGV------------AENGLSRTEPPSERFIP  336
             E KM+ +E+ WQ Q+ S+Q+SL  A +S  V            A +        S   + 
Sbjct  988   ETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASDATDLDSGGSHYQMG  1047

Query  335   FERS---DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVK  171
               RS     GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++K
Sbjct  1048  HGRSRSVGVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRLK  1104

Query  170   LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
               F+ WKKDY  RL+  K  L +L   + G S 
Sbjct  1105  QMFETWKKDYGGRLRETKLILSKLGSEETGGSA  1137



>ref|XP_009589778.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009589780.1| PREDICTED: myosin-2-like isoform X1 [Nicotiana tomentosiformis]
Length=1195

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 108/349 (31%), Positives = 170/349 (49%), Gaps = 52/349 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED ++  +Q  +E+  +CY GH AR ++ EL+   I+LQSFVRGE AR+ Y    
Sbjct  853   QIAALEDVRKQVLQGTLEV-PKCYSGHCARRHFLELEGVIIILQSFVRGEIARRQYN---  908

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQ  648
                    +++   K       +QL AV+ +QS IR WL +   N     KK+      + 
Sbjct  909   ------ASLESKRKAANKENDKQLVAVVQIQSAIRCWLAQRHLNQLQSLKKLNQDREKQG  962

Query  647   MLNPELK-DEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
                 E+K D   ++  SV+ D +RRV V EA+L+    ENA+LKE + Q + +  +YE +
Sbjct  963   RKTLEVKQDFPAEILPSVVEDFERRVMVAEASLDEKDKENAALKEQVNQLEARWSDYEVR  1022

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE----------------------NGLSRTEP  357
             M+ +E+ WQ Q++S+Q SL AA +S GV                          +    P
Sbjct  1023  MRSMEEMWQKQMVSLQVSLAAAKKSLGVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTP  1082

Query  356   PSERFIPFE----------RSDAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPL  210
                  I F            ++ GL V N L+    L ++N   + M I  +KS   E L
Sbjct  1083  GGSTPIEFASNGVDFGGIRENNGGLCVVNYLNREFELRRQNFDDEAMAIAQLKS---EQL  1139

Query  209   NLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             + +    D  +++ RF+ WKKDYK+RL+  KA + +L + +  K+   W
Sbjct  1140  HSTNPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKLSYSEAEKTRRNW  1188



>emb|CDY42506.1| BnaC06g03520D [Brassica napus]
Length=1149

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 111/330 (34%), Positives = 166/330 (50%), Gaps = 36/330 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    E KR   VLQSFVRGE  RK+Y  L+
Sbjct  817   QIGVLEDTRNRTLH-GILRLQSCFRGHQARSRLREHKRRVTVLQSFVRGEKVRKEYTELL  875

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K + ++R  +  + A + +QS IRG L R     I + K   ++ N 
Sbjct  876   RRHRASAAIQSHVKRRIAKRQYKATVDASVVIQSAIRGELVRRCAGDIGWLKSGGTKRN-  934

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ SV+ +LQRRV  +EAAL    +EN  L++ + Q+D +  EYE 
Sbjct  935   --------ESDEVLVKASVISELQRRVLKSEAALREKEEENDILRQRLQQYDNRWSEYET  986

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q++L  A +S   E  A N  +         +     D      
Sbjct  987   KMKSMEEIWQKQMRSLQSNLSIAKKSLEVEDSARNSDASVNASDATELSGSGGDFRTHGR  1046

Query  320   -----AGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                   GL V +RL  +F     Q  G     +  VKSG  E  +L P+  ++ ++K  F
Sbjct  1047  TRSVGVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGQVEA-SLDPER-ELRRLKQMF  1103

Query  161   KAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
               WKKDY  RL+  K  L +L   + G S 
Sbjct  1104  DTWKKDYGGRLRETKLILGKLGSGESGGSA  1133



>dbj|BAD93813.1| myosin [Arabidopsis thaliana]
 dbj|BAD94158.1| myosin [Arabidopsis thaliana]
 dbj|BAD94177.1| myosin [Arabidopsis thaliana]
Length=1153

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 166/333 (50%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    ELK G  +LQSFVRGE  RK+Y  L+
Sbjct  820   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRLKELKTGITILQSFVRGEKMRKEYTELL  878

Query  812   TRLRAIVTIQKHMK----EQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRL  660
              R RA   IQ H+K     QQ +     +AVI  QS IRG L R     I +     ++ 
Sbjct  879   QRHRASAAIQSHVKRRIASQQYKATVDASAVI--QSAIRGELVRRCAGDIGWLSSGGTKR  936

Query  659   NSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
             N         + +++ V+ S L DLQRRV  TEAAL    +EN  L++ + Q+D +  EY
Sbjct  937   N---------ESDEVLVKASYLSDLQRRVLRTEAALREKEEENDILRQRVQQYDNRWSEY  987

Query  479   EAKMQCLEKSWQDQLMSIQTSLGAASRSEGV------------AENGLSRTEPPSERFIP  336
             E KM+ +E+ WQ Q+ S+Q+SL  A +S  V            A +        S   + 
Sbjct  988   ETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASDATDLDSGGSHYQMG  1047

Query  335   FERS---DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVK  171
               RS     GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++K
Sbjct  1048  HGRSRSVGVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRLK  1104

Query  170   LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
               F+ WKKDY  RL+  K  L +L   + G S 
Sbjct  1105  QMFETWKKDYGGRLRETKLILSKLGSEETGGSA  1137



>ref|XP_009147843.1| PREDICTED: myosin-3 [Brassica rapa]
Length=1152

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 110/315 (35%), Positives = 160/315 (51%), Gaps = 36/315 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    E KR   VLQSFVRGE  RK+Y  L+
Sbjct  820   QIGVLEDTRNRTLH-GILRLQSCFRGHQARSRLREHKRRVTVLQSFVRGEKVRKEYTELL  878

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K + ++R  +  + A + +QS IRG L R     I + K   ++ N 
Sbjct  879   RRHRASAAIQSHVKRRIAKRQYKATVDASVVIQSAIRGELVRRCAGDIGWLKSGGTKRN-  937

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ SVL +LQRRV  +EAAL    +EN  L++ + Q+D +  EYE 
Sbjct  938   --------ESDEVLVKASVLSELQRRVLKSEAALREKEEENDILRQRLQQYDNRWSEYET  989

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S   E  A N  +         +     D      
Sbjct  990   KMKSMEEIWQKQMRSLQSSLSIAKKSLEVEDSARNSDASVNASDATELSGSGGDFRTHGR  1049

Query  320   -----AGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                   GL V +RL  +F     Q  G     +  VKSG  E  NL P+  ++ ++K  F
Sbjct  1050  TRSVGVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGQVEA-NLDPER-ELRRLKQMF  1106

Query  161   KAWKKDYKSRLQVVK  117
               WKKDY  RL+  K
Sbjct  1107  DTWKKDYGGRLRETK  1121



>ref|XP_010918414.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1195

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 106/349 (30%), Positives = 178/349 (51%), Gaps = 36/349 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+AR +  E ++  + LQSF+RGE  R+ Y  L+
Sbjct  854   QIGALEDTRNRTLH-GILRVQSCFRGHKARCHVKERRKAIVTLQSFIRGEKTRQIYSGLL  912

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q+++K Q SR+  ++   A + +QS IRGWL R          LN+ + L 
Sbjct  913   QRHRAAIVLQRYIKSQSSRKSFIDVRNAAVVIQSVIRGWLVRRCSGD--VGLLNTAKKLE  970

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ++++V+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM  +
Sbjct  971   GTKESDEVQVKASFLAELQRRILKAEAALREKEEENEILHQRLQQYENRWSEYEQKMSSM  1030

Query  458   EKSWQDQLMSIQTSLGAASRS------EGVAENGLSRTEPPSERFIPFERSD--------  321
             E+ WQ Q+ S+Q+SL  A +S      E  ++  + ++   +   I  +  D        
Sbjct  1031  EEVWQKQMRSLQSSLSVAKKSLATDDAERRSDASMDQSWDSNGNHIATKGQDERGKRLGS  1090

Query  320   --------AGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     +GL V +RL  A   +Q++       N +  VKS   E  +L+P+  ++  +
Sbjct  1091  RVLDRDMSSGLNVISRL--AEEFEQQSQVFADDVNFLVEVKSRQAEA-SLNPEK-ELKSL  1146

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRG--KST*IWCTMAPCGKII  33
             K  F++WKKD+  RL+  K  + +LR  D    K+   W T     +II
Sbjct  1147  KQNFESWKKDFSLRLRESKVIINKLRTDDANSDKAKRKWWTRLNSTRII  1195



>ref|XP_010487954.1| PREDICTED: myosin-1-like [Camelina sativa]
Length=1168

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 111/338 (33%), Positives = 166/338 (49%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSF+RGE  RK++  L+
Sbjct  830   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFIRGEKIRKEFAELL  888

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     I + K   ++ N 
Sbjct  889   RRHRAAATIQSQVKSKIARQQYKGMTDASVSIQSAIRGWLVRRCSGNIGWLKSGGTKTN-  947

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  948   --------ESGEVLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  999

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------------------------A  384
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V                              +
Sbjct  1000  KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1059

Query  383   ENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
               G SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1060  NGGGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDVKFLVEVKSGQVEA  1107

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL+P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1108  -NLNP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1143



>emb|CDY14319.1| BnaA10g07360D [Brassica napus]
Length=1205

 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 110/358 (31%), Positives = 164/358 (46%), Gaps = 64/358 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED ++  +Q G+  +Q+   G  +R Y+  ++ GA+VLQS+VRGEN R+ +    
Sbjct  860   QIGVFEDRRKKVLQ-GIVGLQKHLRGRLSREYFQNMRNGALVLQSYVRGENGRRMFD-TK  917

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNK------------KIT  669
              ++ A+   +    E        L AVI LQS +RGWL+R  FN             K  
Sbjct  918   AKIHAVSVSEASAGE--------LTAVINLQSAVRGWLSRKRFNSMQRQKELVDVTTKSK  969

Query  668   SRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              +   R   + +L  E  +VQ+S + DLQ+RV  +E AL +  +EN +L++ + QF+++ 
Sbjct  970   RKGGRRVSEDKDLPVERFQVQQSAMSDLQKRVLKSEEALVQKEEENTALRDQLRQFEERW  1029

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRS-------------------------EGVA  384
              EYE KM+ +E +WQ Q+ S+Q SL AA +S                         E   
Sbjct  1030  SEYEIKMKSMEDTWQKQMSSLQMSLAAARKSLATENNTGQAGGRQDASMSPFGYDSEDTM  1089

Query  383   ENGLSRTEPPSERF-------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWV  234
               G      P+ +F       +     +  L   N L  A   DQ           I  V
Sbjct  1090  STGTPGVRTPTTKFSNGNTPELRIRELNGSLNAVNHL--AREFDQRRLNFDEDARAIVEV  1147

Query  233   KSGHDEPLNLSPKNSDVHK-VKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             K G     N      D  K +KLRF+ WKKDYK+RL+  KA L    H D+G+    W
Sbjct  1148  KGGPQATPNGQQHPEDEFKRLKLRFETWKKDYKARLRETKARL----HSDKGRHRKWW  1201



>gb|AAD50052.1|AC007980_17 Highly similar to myosin [Arabidopsis thaliana]
Length=1155

 Score =   135 bits (339),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 117/333 (35%), Positives = 166/333 (50%), Gaps = 41/333 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    ELK G  +LQSFVRGE  RK+Y  L+
Sbjct  822   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRLKELKTGITILQSFVRGEKMRKEYTELL  880

Query  812   TRLRAIVTIQKHMK----EQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRL  660
              R RA   IQ H+K     QQ +     +AVI  QS IRG L R     I +     ++ 
Sbjct  881   QRHRASAAIQSHVKRRIASQQYKATVDASAVI--QSAIRGELVRRCAGDIGWLSSGGTKR  938

Query  659   NSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
             N         + +++ V+ S L DLQRRV  TEAAL    +EN  L++ + Q+D +  EY
Sbjct  939   N---------ESDEVLVKASYLSDLQRRVLRTEAALREKEEENDILRQRVQQYDNRWSEY  989

Query  479   EAKMQCLEKSWQDQLMSIQTSLGAASRSEGV------------AENGLSRTEPPSERFIP  336
             E KM+ +E+ WQ Q+ S+Q+SL  A +S  V            A +        S   + 
Sbjct  990   ETKMKSMEEIWQKQMKSLQSSLSIAKKSLEVEDSARNSDASVNASDATDLDSGGSHYQMG  1049

Query  335   FERS---DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVK  171
               RS     GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++K
Sbjct  1050  HGRSRSVGVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRLK  1106

Query  170   LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST  72
               F+ WKKDY  RL+  K  L +L   + G S 
Sbjct  1107  QMFETWKKDYGGRLRETKLILSKLGSEETGGSA  1139



>ref|XP_007021261.1| Myosin 2 isoform 1 [Theobroma cacao]
 gb|EOY12786.1| Myosin 2 isoform 1 [Theobroma cacao]
Length=1221

 Score =   135 bits (339),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 110/346 (32%), Positives = 170/346 (49%), Gaps = 64/346 (18%)
 Frame = -3

Query  956   VQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKH  777
             V +GV  +Q+ + GH+AR  ++EL + A  +QSFVRGEN R+ +            ++ +
Sbjct  884   VLQGVIEVQKYFRGHRARRLFHELNKEAKHIQSFVRGENIRRKH-----------AVEGN  932

Query  776   MKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFN----------------KKITSRLNSR  651
             M    + +L  EQL AVI LQS IRGWL R  FN                +K+  R++  
Sbjct  933   MCSAFASQLLDEQLTAVIYLQSVIRGWLARRHFNNMQNLKQLNRESVKSRRKMGRRISEA  992

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             + +  E   + I V  SV+ +LQ+RV   EA L +   ENA+L+E + Q++ +  EYE+K
Sbjct  993   KGIPHE---QQIPVLPSVMAELQKRVLKAEATLGQKEQENATLREQLQQYEARWLEYESK  1049

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFERSDAG------  315
             M+ +E+ WQ Q+ S+Q+SL AA +S         L R +  S R    E    G      
Sbjct  1050  MKSMEEMWQKQMASLQSSLAAARKSLAADSTTGQLGRVDVASPRCYDSEDMSMGSRTPGG  1109

Query  314   ----LVVNNRLDFASPLDQENGSHQNMITWVK-------SGHDE-----------PLNLS  201
                 L      DF     +ENGS   +   VK       +  D+           P +++
Sbjct  1110  NTPVLYSGAMPDFVG--GRENGSLNAVSNLVKELEQRKQTFDDDAKSLIEVRTANPGSVT  1167

Query  200   PKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
               + ++ ++KLRF+ WKKDYK+RL+  KA L +  H +  K+   W
Sbjct  1168  NPDDELRRLKLRFETWKKDYKTRLRETKARLHKRGHPESDKARRKW  1213



>ref|XP_009119961.1| PREDICTED: myosin-2-like [Brassica rapa]
Length=1205

 Score =   135 bits (339),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 110/358 (31%), Positives = 164/358 (46%), Gaps = 64/358 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED ++  +Q G+  +Q+   G  +R Y+  ++ GA+VLQS+VRGEN R+ +    
Sbjct  860   QIGVFEDRRKKVLQ-GIVGLQKHLRGRLSREYFQNMRNGALVLQSYVRGENGRRMFD-TK  917

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNK------------KIT  669
              ++ A+   +    E        L AVI LQS +RGWL+R  FN             K  
Sbjct  918   AKIHAVSVSEASAGE--------LTAVINLQSAVRGWLSRKRFNSMQRQKELVDVTTKSK  969

Query  668   SRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              +   R   + +L  E  +VQ+S + DLQ+RV  +E AL +  +EN +L++ + QF+++ 
Sbjct  970   RKGGRRVSEDKDLPVERFQVQQSAMSDLQKRVLKSEEALVQKEEENTALRDQLRQFEERW  1029

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRS-------------------------EGVA  384
              EYE KM+ +E +WQ Q+ S+Q SL AA +S                         E   
Sbjct  1030  SEYEIKMKSMEDTWQKQMSSLQMSLAAARKSLATENNTGQAGGRQDASMSPFGYDSEDTM  1089

Query  383   ENGLSRTEPPSERF-------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWV  234
               G      P+ +F       +     +  L   N L  A   DQ           I  V
Sbjct  1090  STGTPGVRTPTTKFSNGNTPELRIRELNGSLNAVNHL--AREFDQRRLNFDEDARAIVEV  1147

Query  233   KSGHDEPLNLSPKNSDVHK-VKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             K G     N      D  K +KLRF+ WKKDYK+RL+  KA L    H D+G+    W
Sbjct  1148  KGGPQATPNGQQHPEDEFKRLKLRFETWKKDYKARLRETKARL----HSDKGRHRKWW  1201



>emb|CDY22791.1| BnaA06g02860D [Brassica napus]
Length=1157

 Score =   135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 110/315 (35%), Positives = 160/315 (51%), Gaps = 36/315 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR    E KR   VLQSFVRGE  RK+Y  L+
Sbjct  825   QIGVLEDTRNRTLH-GILRLQSCFRGHQARSRLREHKRRVTVLQSFVRGEKVRKEYTELL  883

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA   IQ H+K + ++R  +  + A + +QS IRG L R     I + K   ++ N 
Sbjct  884   RRHRASAAIQSHVKRRIAKRQYKATVDASVVIQSAIRGELVRRCAGDIGWLKSGGTKRN-  942

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     + +++ V+ SVL +LQRRV  +EAAL    +EN  L++ + Q+D +  EYE 
Sbjct  943   --------ESDEVLVKASVLSELQRRVLKSEAALREKEEENDILRQRLQQYDNRWSEYET  994

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSD------  321
             KM+ +E+ WQ Q+ S+Q+SL  A +S   E  A N  +         +     D      
Sbjct  995   KMKSMEEIWQKQMRSLQSSLSIAKKSLEVEDSARNSDASVNASDATELSGSGGDFRTHGR  1054

Query  320   -----AGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
                   GL V +RL  +F     Q  G     +  VKSG  E  NL P+  ++ ++K  F
Sbjct  1055  TRSVGVGLSVISRLAEEFGQRA-QVFGDDTKFLMEVKSGQVEA-NLDPER-ELRRLKQMF  1111

Query  161   KAWKKDYKSRLQVVK  117
               WKKDY  RL+  K
Sbjct  1112  DTWKKDYGGRLRETK  1126



>ref|XP_002891568.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67827.1| hypothetical protein ARALYDRAFT_474163 [Arabidopsis lyrata subsp. 
lyrata]
Length=1153

 Score =   135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 167/326 (51%), Gaps = 27/326 (8%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + GHQAR    ELKRG  VLQSFVRG+  RK+Y  L+
Sbjct  820   QIGVLEDTRNRTLH-GILRLQSYFRGHQARCRLKELKRGITVLQSFVRGKKIRKEYTELL  878

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA   IQ H+K + + R  +  + A + +QS IRG L R          LNS  +  
Sbjct  879   QRHRASAAIQSHVKRRIASRQYKATVDASVVIQSAIRGELVRRCAGD--IGWLNSGGIKR  936

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
              E   +++ V+ S L ++QRRV  TEAAL    +EN  L++ + Q+D +  EYE KM+ +
Sbjct  937   NE--SDEVLVKASYLSEVQRRVLRTEAALREKEEENDILRQRLQQYDNRWSEYETKMKSM  994

Query  458   EKSWQDQLMSIQTSLGAASRSEGV------------AENGLSRTEPPSERFIPFERS---  324
             E+ WQ Q+ S+Q+SL  A +S  V            A +        S   +   RS   
Sbjct  995   EEIWQRQMKSLQSSLSIAKKSLEVDDSARNSDASVNASDATDLDSGGSHYQMGHGRSRSV  1054

Query  323   DAGLVVNNRL--DFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWK  150
               GL V +RL  +F     Q  G  +  +  VKSG  E  NL+P + ++ ++K  F+ WK
Sbjct  1055  GVGLSVISRLAEEFGQRA-QVFGDDRKFLMEVKSGQVEA-NLNP-DRELRRLKQMFETWK  1111

Query  149   KDYKSRLQVVKATLKQLRHCDRGKST  72
             KDY  RL+  K  L +L   + G S 
Sbjct  1112  KDYGGRLRETKLILSKLGSEETGGSA  1137



>emb|CDY18321.1| BnaC09g30710D [Brassica napus]
Length=1207

 Score =   135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 109/361 (30%), Positives = 164/361 (45%), Gaps = 67/361 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED ++  V  G+  +Q+   GH +R Y+  ++ GA+VLQS+VRG+NAR+ +    
Sbjct  859   QIGVFEDRRK-KVLYGIVGLQKHLRGHLSREYFQNMRNGALVLQSYVRGQNARRRFD---  914

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN------------KKIT  669
                   V  + H +        +L AVI LQS +RGWL R  FN             K  
Sbjct  915   ------VEAKIHAESVSEAGAGELTAVINLQSAVRGWLARKRFNIMQRQKELVDVTTKSK  968

Query  668   SRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              +   R   + +L  E  +VQ+S + DLQ+RV  +E AL +  +EN +L++ + QF+++ 
Sbjct  969   RKAGRRISEDKDLPVERFQVQQSAMSDLQKRVLKSEEALVQKEEENTALRDQLRQFEERW  1028

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------SEGVA  384
              EYE KM+ +E +WQ Q+ S+Q SL AA +                         SE   
Sbjct  1029  SEYEIKMKSMEDTWQKQMSSLQMSLAAARKSLATENNTGQAGGRQDASMSPFGYDSEDTM  1088

Query  383   ENGLSRTEPPSERF-------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWV  234
               G      P+ +F       +     +  L   N L  A   DQ           I  V
Sbjct  1089  STGTPGVRTPTTKFSNGNTPELRIRELNGSLNAVNHL--AREFDQRRLNFDEDARAIMEV  1146

Query  233   KSGHDEPLNLSPK----NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*I  66
             K G     N   +      +  ++KLRF+ WKKDYK+RL+  KA L    H D+G+    
Sbjct  1147  KGGPQATPNGQQQQQHPEDEFKRLKLRFETWKKDYKARLRETKARL----HSDKGRHRKW  1202

Query  65    W  63
             W
Sbjct  1203  W  1203



>gb|ABJ53201.1| myosin VIII-2 [Nicotiana benthamiana]
Length=1196

 Score =   135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 107/349 (31%), Positives = 171/349 (49%), Gaps = 52/349 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED ++  +Q  +E+  +CY GH AR +++EL+ G I+LQSF+RGE AR+ Y    
Sbjct  854   QIAALEDVRKQVLQGTLEV-PKCYSGHCARRHFHELEGGVIILQSFIRGEIARRQYN---  909

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----KKITSRLNSRQ  648
                    +++   K       +QL AV+ +QS IR WL +   N     KK+      + 
Sbjct  910   ------ASLESKRKAANKENDKQLVAVVQIQSAIRCWLAQRHLNQLQSLKKLNQDREKQG  963

Query  647   MLNPELK-DEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
                 E+K D   ++  SV+ DL+RRV V EA+L     ENA+LKE + Q + +  +YE +
Sbjct  964   RKTVEVKPDLPAEILPSVVEDLERRVMVAEASLGEKDKENAALKEQVNQLEARWSDYEVR  1023

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGV--------------------AENGLSRTEPPS  351
             M+ +E+ WQ Q++S+Q SL AA +S GV                    +E+  +      
Sbjct  1024  MRSMEEMWQKQMVSLQASLAAAKKSLGVDNPAGHPGKREGSQSPCGYDSEDTTTMGTHTP  1083

Query  350   ERFIPFERSDAG------------LVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPL  210
                 P E +  G            L   N L+    L ++N   + M I  +KS   E L
Sbjct  1084  GGSTPIEFASNGVDLGGIRGNNGSLCAVNYLNREFELRRQNFDDEAMAIAQLKS---EQL  1140

Query  209   NLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             + +    D  +++ RF+ WKKDYK+RL+  KA + +  + +  K+   W
Sbjct  1141  HSTNPAEDFRRLRHRFEEWKKDYKARLKETKAKVHKFGYSEAEKTRRNW  1189



>ref|XP_007021262.1| Myosin 2 isoform 2 [Theobroma cacao]
 gb|EOY12787.1| Myosin 2 isoform 2 [Theobroma cacao]
Length=1220

 Score =   135 bits (339),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 110/346 (32%), Positives = 170/346 (49%), Gaps = 64/346 (18%)
 Frame = -3

Query  956   VQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKH  777
             V +GV  +Q+ + GH+AR  ++EL + A  +QSFVRGEN R+ +            ++ +
Sbjct  883   VLQGVIEVQKYFRGHRARRLFHELNKEAKHIQSFVRGENIRRKH-----------AVEGN  931

Query  776   MKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFN----------------KKITSRLNSR  651
             M    + +L  EQL AVI LQS IRGWL R  FN                +K+  R++  
Sbjct  932   MCSAFASQLLDEQLTAVIYLQSVIRGWLARRHFNNMQNLKQLNRESVKSRRKMGRRISEA  991

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             + +  E   + I V  SV+ +LQ+RV   EA L +   ENA+L+E + Q++ +  EYE+K
Sbjct  992   KGIPHE---QQIPVLPSVMAELQKRVLKAEATLGQKEQENATLREQLQQYEARWLEYESK  1048

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFERSDAG------  315
             M+ +E+ WQ Q+ S+Q+SL AA +S         L R +  S R    E    G      
Sbjct  1049  MKSMEEMWQKQMASLQSSLAAARKSLAADSTTGQLGRVDVASPRCYDSEDMSMGSRTPGG  1108

Query  314   ----LVVNNRLDFASPLDQENGSHQNMITWVK-------SGHDE-----------PLNLS  201
                 L      DF     +ENGS   +   VK       +  D+           P +++
Sbjct  1109  NTPVLYSGAMPDFVG--GRENGSLNAVSNLVKELEQRKQTFDDDAKSLIEVRTANPGSVT  1166

Query  200   PKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
               + ++ ++KLRF+ WKKDYK+RL+  KA L +  H +  K+   W
Sbjct  1167  NPDDELRRLKLRFETWKKDYKTRLRETKARLHKRGHPESDKARRKW  1212



>ref|XP_009145709.1| PREDICTED: myosin-1 isoform X2 [Brassica rapa]
Length=1146

 Score =   134 bits (338),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 108/330 (33%), Positives = 167/330 (51%), Gaps = 46/330 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSFVRG+  RK++  L 
Sbjct  806   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFVRGDKVRKEFAELR  864

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     + + K + ++ N 
Sbjct  865   RRHRAAATIQSQVKSKIARKQYKGITDASVLIQSAIRGWLVRRCSGDLRWLKSVGTKTN-  923

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL DLQRRV  +EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  924   --------ESGEVLVKASVLSDLQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYET  975

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS-----------EGVAENGLSRTEPPSERF-----  342
             KM+ +E+ WQ Q+ S+Q+SL  A +S             V  +  +  +  S +F     
Sbjct  976   KMKSMEEIWQKQMRSLQSSLSIAKKSLAFEDSARYSDASVNASDATDWDSSSNQFKSQAS  1035

Query  341   ------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNS  189
                      +   AGL V  RL  A   +Q     G     +  VKSG  E  NL+P + 
Sbjct  1036  NGGGGRQQQQPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP-DR  1091

Query  188   DVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1092  ELRRLKQMFETWKKDYGGRLRETKMILSKL  1121



>ref|NP_188630.1| myosin 1 [Arabidopsis thaliana]
 sp|Q9LHE9.1|MYO1_ARATH RecName: Full=Myosin-1; AltName: Full=AtATM1 [Arabidopsis thaliana]
 dbj|BAB03161.1| myosin-like protein [Arabidopsis thaliana]
 gb|AAN71940.1| putative myosin [Arabidopsis thaliana]
 gb|AEE76312.1| myosin 1 [Arabidopsis thaliana]
Length=1166

 Score =   134 bits (337),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 169/338 (50%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR    ELKRG  +LQSFVRGE  RK++  L 
Sbjct  828   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCLLKELKRGISILQSFVRGEKIRKEFAELR  886

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R +A  TIQ  +K + +R + + +A A + +QS IRGWL R     I + K   ++ N 
Sbjct  887   RRHKAAATIQSQVKSKIARIQYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTN-  945

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                   EL +  + V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  946   ------ELGE--VLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  997

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE-----------------------------  381
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +                             
Sbjct  998   KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1057

Query  380   NGL-SRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
             NG+ SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1058  NGVGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA  1105

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1106  -NLDP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1141



>gb|AAM14075.1| putative myosin [Arabidopsis thaliana]
Length=1166

 Score =   134 bits (337),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 169/338 (50%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR    ELKRG  +LQSFVRGE  RK++  L 
Sbjct  828   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCLLKELKRGISILQSFVRGEKIRKEFAELR  886

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R +A  TIQ  +K + +R + + +A A + +QS IRGWL R     I + K   ++ N 
Sbjct  887   RRHKAAATIQSQVKSKIARIQYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTN-  945

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                   EL +  + V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  946   ------ELGE--VLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  997

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE-----------------------------  381
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +                             
Sbjct  998   KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1057

Query  380   NGL-SRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
             NG+ SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1058  NGVGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA  1105

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1106  -NLDP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1141



>ref|XP_009145706.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
 ref|XP_009145708.1| PREDICTED: myosin-1 isoform X1 [Brassica rapa]
Length=1180

 Score =   134 bits (337),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 108/330 (33%), Positives = 167/330 (51%), Gaps = 46/330 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  ELK G  +LQSFVRG+  RK++  L 
Sbjct  840   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKELKMGISILQSFVRGDKVRKEFAELR  898

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     + + K + ++ N 
Sbjct  899   RRHRAAATIQSQVKSKIARKQYKGITDASVLIQSAIRGWLVRRCSGDLRWLKSVGTKTN-  957

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL DLQRRV  +EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  958   --------ESGEVLVKASVLSDLQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYET  1009

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRS-----------EGVAENGLSRTEPPSERF-----  342
             KM+ +E+ WQ Q+ S+Q+SL  A +S             V  +  +  +  S +F     
Sbjct  1010  KMKSMEEIWQKQMRSLQSSLSIAKKSLAFEDSARYSDASVNASDATDWDSSSNQFKSQAS  1069

Query  341   ------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNS  189
                      +   AGL V  RL  A   +Q     G     +  VKSG  E  NL+P + 
Sbjct  1070  NGGGGRQQQQPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP-DR  1125

Query  188   DVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1126  ELRRLKQMFETWKKDYGGRLRETKMILSKL  1155



>ref|XP_011098363.1| PREDICTED: myosin-2-like [Sesamum indicum]
Length=1209

 Score =   134 bits (336),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 109/343 (32%), Positives = 168/343 (49%), Gaps = 58/343 (17%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++E+  KQ  + +G   +Q+C  GH+ R  ++ L+   + LQS+VRGE ARK+Y  L+  
Sbjct  869   ALEDVRKQ--ILQGTPWMQKCLPGHRIRRDFHALEGVIVTLQSYVRGEIARKEYNVLLQL  926

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPELK  627
              +  V   K          E+L AV+ +QS IRGWL R  F+    S+ ++   L P  +
Sbjct  927   KKKHVACDK--------LDEELMAVLQIQSAIRGWLARRHFSHLRNSKQSNASKLKPGRR  978

Query  626   DEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
               ++KV       SV+ +LQ+R+ + EA +E+   ENA+L+E + QF+ +  EYE KM+ 
Sbjct  979   SSEVKVLPPETLCSVVDELQKRILMAEATVEQKEKENAALREQVQQFEARWPEYETKMKS  1038

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTE----PPSERFIPFERSDAGL------  312
             +E+ WQ Q+ S+Q SL +A +S G A N + +        S +F   E     L      
Sbjct  1039  MEEMWQKQMASLQMSLASAQKSLG-AHNTIGQPGRLDGAQSPQFYDSEDMSMSLSMGTQT  1097

Query  311   --------VVNNRLDFASPLDQENGS--------------HQNM------ITWVKSGHDE  216
                      VNN ++   P    NG                QN       I  VK GH  
Sbjct  1098  PGGSTPMRFVNNGIE-ELPCRDTNGGLNPIGPLMKEFERRRQNFDEEAQAIVEVKPGHSP  1156

Query  215   PLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCD  87
              +N      D+ ++K RF++WKKDYK RL+  KA  ++L   D
Sbjct  1157  SVN---PVEDLRRLKHRFESWKKDYKVRLKEAKAKAQKLVQND  1196



>ref|XP_008664832.1| PREDICTED: myosin-1 [Zea mays]
 tpg|DAA49540.1| TPA: myosin VIII ZMM3 [Zea mays]
Length=1191

 Score =   134 bits (336),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 106/325 (33%), Positives = 169/325 (52%), Gaps = 37/325 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQARH+  E  RG + LQSF+RGENAR+ Y  L+
Sbjct  852   QIGNLEDTRNRTLH-GILRVQSCFRGHQARHHARERTRGVLTLQSFIRGENARQIYSSLL  910

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLT-RIEFNKKITSRL---NSR  651
              + RA V +Q++++   +RR  +    A + +QSGIRG L  R   N  + + L    S+
Sbjct  911   RKHRAAVVLQRNVRCWLARRYFINVRKASVIIQSGIRGSLVRRCNGNIDLINVLREFESK  970

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             Q    E   + I ++ SVL +LQRR+   EA +    +EN  L + + Q++ +  EYE K
Sbjct  971   Q----EAHGDQILIKASVLAELQRRILKAEATVREKDEENEMLHQRLQQYENRWLEYEQK  1026

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP  336
             M+ +E+ WQ Q+ S+Q+SL  A +S  + E               NG       S+  +P
Sbjct  1027  MKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMSDSSVDQSWESNGNHHVSSGSQ-LVP  1085

Query  335   FERS---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    +AGL V +RL  A   +Q +         +  VKSG  +  +L+P + ++ ++
Sbjct  1086  HTGGREMNAGLSVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRL  1141

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F +WKKD+  R++  K  L +L
Sbjct  1142  KQNFDSWKKDFSGRMRETKVILNKL  1166



>gb|KHN28019.1| Myosin-J heavy chain [Glycine soja]
Length=1196

 Score =   134 bits (336),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 115/344 (33%), Positives = 165/344 (48%), Gaps = 66/344 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q G+  IQ+ + G+QAR +Y+ELK G  +LQSFVRGE AR++Y  +V
Sbjct  849   QIGALEDRRKHLLQ-GILGIQKSFRGYQARRHYHELKNGVTILQSFVRGEIARREYGVMV  907

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR---IEFNKKITSRLNSR---  651
                  I T            ++++ A   LQS IRGWL R      NK   S  N+R   
Sbjct  908   KSSMTIST----------ENIKEIEAATTLQSVIRGWLVRRHASSLNKSKKSPGNARSRR  957

Query  650   --QMLNPELKDEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
               ++  PE+KD  +  +R     S L +LQRRV   EA +E+  +ENA LKE + QF+++
Sbjct  958   RSRVKMPEVKD--VSGERGQNLPSALAELQRRVIKAEATIEQKEEENAELKEQLKQFERR  1015

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS-----------------------EGVAE  381
               EYE +M+ +E  WQ Q+ S+Q SL AA +S                       E    
Sbjct  1016  WIEYEKRMKSMEDMWQKQMASLQMSLAAARKSLASENASGQIARRDVASPFGYDSEDATS  1075

Query  380   NGLSRTEPPSERFIPFERSD------AGLVVNNRLDFASPLDQENGSHQNM-------IT  240
              G SRT        P + S       AG   N  L   S L +E    ++        + 
Sbjct  1076  VG-SRTPRTPGASTPLKYSSSLTEAGAGRDANGTLTSVSNLMKEFEQRRHTFDDDARALV  1134

Query  239   WVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
              VK+G     N      ++ K+K  F+ WKK+YK+RL+  KA L
Sbjct  1135  EVKAGQSANTN---SVEELRKLKHSFEGWKKEYKARLRETKARL  1175



>ref|NP_001154628.2| myosin 1 [Arabidopsis thaliana]
 gb|AEE76313.1| myosin 1 [Arabidopsis thaliana]
Length=1176

 Score =   134 bits (336),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 116/338 (34%), Positives = 169/338 (50%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR    ELKRG  +LQSFVRGE  RK++  L 
Sbjct  838   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCLLKELKRGISILQSFVRGEKIRKEFAELR  896

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R +A  TIQ  +K + +R + + +A A + +QS IRGWL R     I + K   ++ N 
Sbjct  897   RRHKAAATIQSQVKSKIARIQYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTN-  955

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                   EL +  + V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  956   ------ELGE--VLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  1007

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE-----------------------------  381
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +                             
Sbjct  1008  KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1067

Query  380   NGL-SRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
             NG+ SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1068  NGVGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA  1115

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1116  -NLDP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1151



>gb|AAD31926.1|AF147738_1 myosin VIII ZMM3 [Zea mays]
Length=1099

 Score =   133 bits (335),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 106/325 (33%), Positives = 168/325 (52%), Gaps = 37/325 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQARH+  E  RG + LQSF+RGENAR+ Y  L+
Sbjct  760   QIGNLEDTRNRTLH-GILRVQSCFRGHQARHHARERTRGVLTLQSFIRGENARQIYSSLL  818

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLT-RIEFNKKITSRL---NSR  651
              + RA V +Q++++   +RR  +    A + +QSGIRG L  R   N  + + L    S+
Sbjct  819   RKHRAAVVLQRNVRCWLARRYFINVRKASVIIQSGIRGSLVRRCNGNIDLINVLREFESK  878

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             Q    E   + I ++ SVL +LQRR+   EA +    +EN  L + + Q++ +  EYE K
Sbjct  879   Q----EAHGDQILIKASVLAELQRRILKAEATVREKDEENEMLHQRLQQYENRWLEYEQK  934

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP  336
             M+ +E+ WQ Q+ S+Q+SL  A +S  + E               NG       S+  +P
Sbjct  935   MKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMSDSSVDQSWESNGNHHVSSGSQ-LVP  993

Query  335   FERS---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    +AGL V +RL  A   +Q           +  VKSG  +  +L+P + ++ ++
Sbjct  994   HTGGREMNAGLSVISRL--AEEFEQRTQVFADDAKFLVEVKSGQADA-SLNP-DMELRRL  1049

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F +WKKD+  R++  K  L +L
Sbjct  1050  KQNFDSWKKDFSGRMRETKVILNKL  1074



>ref|XP_006592898.1| PREDICTED: myosin-2-like isoform X3 [Glycine max]
Length=1083

 Score =   133 bits (335),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 170/345 (49%), Gaps = 67/345 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q G+  IQ+ + G+QAR +Y+ELK G  +LQSFVRGE AR++Y  +V
Sbjct  735   QIGALEDRRKHLLQ-GILGIQKSFRGYQARRHYHELKNGVTILQSFVRGEIARREYGVMV  793

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR---IEFNKKITSRLNSR---  651
                  I T            ++++ A   LQS IRGWL R      NK   S  N+R   
Sbjct  794   KSSMTIST----------ENIKEIEAATTLQSVIRGWLVRRHASSLNKSKKSPGNARSRR  843

Query  650   --QMLNPELKDEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
               ++  PE+K +D+  +R     S L +LQRRV   EA +E+  +ENA LKE + QF+++
Sbjct  844   RSRVKMPEVK-QDVSGERGQNLPSALAELQRRVIKAEATIEQKEEENAELKEQLKQFERR  902

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFERSDA  318
               EYE +M+ +E  WQ Q+ S+Q SL AA +S     A + ++R +  S     ++  DA
Sbjct  903   WIEYEKRMKSMEDMWQKQMASLQMSLAAARKSLASENASSQIARRDVASP--FGYDSEDA  960

Query  317   GLV---------VNNRLDFASPLDQENG---------SHQNM-----------------I  243
               V          +  L ++S L +            S  N+                 +
Sbjct  961   TSVGSRTPRTPGASTPLKYSSSLTEAGAGRDAKGTLTSVSNLMKEFEQRRHTFDDDARAL  1020

Query  242   TWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
               VK+G     N      ++ K+K  F+ WKK+YK+RL+  KA L
Sbjct  1021  VEVKTGQSANTN---SVEELRKLKHSFEGWKKEYKARLRETKARL  1062



>gb|KHN46512.1| Myosin-J heavy chain, partial [Glycine soja]
Length=1049

 Score =   133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 167/321 (52%), Gaps = 33/321 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G QAR    +L+ G   LQSF+RG+  RK Y  L+
Sbjct  715   QIGVLEDTRNRTLH-GILRVQSCFRGFQARRSLKDLRGGITTLQSFIRGDKTRKAYSALL  773

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK +K   +R R+  ++ A I +Q+ I GWL R     + +  +   +  +
Sbjct  774   KRHRAAVIIQKRIKAVFARNRMRTISDAAIVIQAVIHGWLVR-----RCSGNIGFLKSGD  828

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++K+ D + V+ S L +LQ RV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  829   MKMKESDEVLVKSSFLAELQCRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKS  888

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---NGLSRTEPPSERFIPFE-------------  330
             +E+ WQ Q+ S+Q+SL  A +S  + +   N  +      ER   ++             
Sbjct  889   MEEVWQKQMRSLQSSLSIAKKSLAIDDSERNSDASVNASDERDYSWDVGGNHKRQESNGA  948

Query  329   -RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
               + AGL V +RL  A   +  +   G     +  VKSG  E  +L+P + ++ ++K  F
Sbjct  949   RSTSAGLSVISRL--AEEFEHRSQVFGDDAKFLVEVKSGQVEA-SLNP-DQELRRLKQMF  1004

Query  161   KAWKKDYKSRLQVVKATLKQL  99
             +AWKKDY +RL+  K  + +L
Sbjct  1005  EAWKKDYGARLRETKVIINKL  1025



>emb|CDY24591.1| BnaC05g32750D [Brassica napus]
Length=1159

 Score =   133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 110/338 (33%), Positives = 170/338 (50%), Gaps = 46/338 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR +  +LK G  +LQSFVRG+  RK++  L 
Sbjct  819   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCHLKKLKMGISILQSFVRGDKVRKEFAELR  877

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     I + K   ++ N 
Sbjct  878   RRHRAAATIQSQVKSKIARKQYKGITEASLVIQSAIRGWLVRRCSGDIGWLKSGGTKTN-  936

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL DLQRRV  +EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  937   --------ESGEVLVKASVLSDLQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYET  988

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG-----------LSRTEPPSERF-----  342
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V ++             +  +  S +F     
Sbjct  989   KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFKSQAS  1048

Query  341   ------IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNS  189
                      +   AGL V  RL  A   +Q     G     +  VKSG  E  NL+P+  
Sbjct  1049  NGGGGRQQQQPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNPER-  1104

Query  188   DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             ++ ++K  F+ WKKDY  RL+  K  L +L   + G S
Sbjct  1105  ELRRLKQMFETWKKDYGGRLRETKMILSKLGSEESGGS  1142



>ref|XP_009412435.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1225

 Score =   133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 108/354 (31%), Positives = 182/354 (51%), Gaps = 48/354 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI++ ED +   +Q G+  +Q+ + G QA ++Y  L++GA  LQSF+RGE AR +++ L 
Sbjct  873   QIAVLEDARNRILQ-GIVWVQKNFRGLQAHNFYQRLRKGATTLQSFIRGEKARCEFEVLT  931

Query  812   TRLRAIVTIQKHMKEQ--QSRRLEQLAAVICLQSGIRGWLTRIEF-NKKI--TSRLN---  657
              R R  + IQKH+++    +R   QL  +I LQS IRGWL R  F N K+   ++LN   
Sbjct  932   RRWRFAILIQKHVRQWIVGTRFSYQLKDIILLQSAIRGWLARKTFINLKMHKMAKLNQVE  991

Query  656   ----SRQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFD  498
                 S + L   +KD   E  ++   V+ +L RR    EAAL +  +ENA L++ +  +D
Sbjct  992   VNKSSERNLAQLMKDKTSELPQIHPEVMDELHRRALRAEAALRKKEEENAILQQRLKHYD  1051

Query  497   KKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS------------------------EG  390
              +  EYE KM+ +E++WQ QL S+Q++L AA +S                        + 
Sbjct  1052  TRWSEYELKMKSMEQTWQKQLTSLQSTLAAARKSLTSDMANRPGQLNMSAVNNCYDSEDT  1111

Query  389   VAENGLSRTEPPSERFIPFE--RSDAGLVVNNRLDFASPLDQENGSHQN---MITWVKSG  225
             ++    +  + P+++ I  E  RS+    +   +   +  +Q+    ++    I   KSG
Sbjct  1112  ISTVNQTPEDTPAKQSIGAEEVRSNDSKEI-AVIHLVNEFEQQRQVFEDDAGFIVEAKSG  1170

Query  224   HDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                   ++P + ++  +K RF  WKK YK RL+  KA+L++  + +   S   W
Sbjct  1171  QSSS-KINP-DEELQNLKARFSTWKKVYKLRLRETKASLQKFGNPEEKASKKWW  1222



>emb|CDY36068.1| BnaC03g41300D [Brassica napus]
Length=1133

 Score =   133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/333 (32%), Positives = 164/333 (49%), Gaps = 44/333 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G++AR +  EL+ G   LQSFVRGE  RK++ +L 
Sbjct  801   QIGVLEDTRNRTLH-GILRVQSSFRGYKARCHLKELRMGIYTLQSFVRGEKVRKEFAYLR  859

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA  TIQ  +K + +R+  +    A + +QS IRGWL R     + +  +       
Sbjct  860   RRHRAAATIQSQVKSKIARQQYKGITEASLVIQSAIRGWLVR-----RCSGDIGW-----  909

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
               LK  ++ V+ SVL +LQRRV  +EAAL    +EN  L++ + Q++ +  EYE KM+ +
Sbjct  910   --LKSGEVLVKASVLSELQRRVLKSEAALREKEEENDILQQRLQQYENRWSEYETKMKSM  967

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAENG----------------------LSRTEPPSER  345
             E+ WQ Q+ S+Q+SL  A +S  V  +                        S+      +
Sbjct  968   EEIWQKQMRSLQSSLSIAKKSLAVENSARNSDASVNASDWDSGSNQLKSQTSKGGGGERQ  1027

Query  344   FIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                     AGL V  RL  A   +Q     G     +  VKSG  E  NL+P + ++ ++
Sbjct  1028  QQQQRPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP-DRELRRL  1083

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K  F+ WKKDY  RL+  K  L +L   + G S
Sbjct  1084  KQMFETWKKDYGGRLRETKMILSKLGSEESGGS  1116



>ref|XP_009389227.1| PREDICTED: myosin-1-like [Musa acuminata subsp. malaccensis]
Length=1277

 Score =   133 bits (335),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 109/338 (32%), Positives = 171/338 (51%), Gaps = 48/338 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ GHQAR Y  ELK+G + LQSF+R E  R+    L+
Sbjct  936   QIGLLEDTRTRTLH-GILRVQSCFRGHQARLYVKELKKGIVALQSFIRSEKTRRVSSGLL  994

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR--------IEFNKKITSR  663
              R RA++ +Q+++K + +RR  ++   A I +QS IRGWL R        +  NK I   
Sbjct  995   QRHRAVIALQRNIKCRAARRNFVDVRNASIAIQSVIRGWLVRRCSTDVALLNANKHIGG-  1053

Query  662   LNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQE  483
                      E  +E++ V+ SVL +L+RR    EAAL    +EN  L + + Q++ +  E
Sbjct  1054  ------TKGEEPEENL-VKSSVLAELERRALKAEAALRDKEEENNILHQRLQQYESRWSE  1106

Query  482   YEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV----------AENGLSRTEP--------  357
             YE KM+ +E+ WQ Q+ S+Q+SL  A  S  +           +   S T+P        
Sbjct  1107  YEQKMESMEEVWQKQMASLQSSLSVAKNSFAIDDIERHSVASLDQSWSSTDPIRAKGWEN  1166

Query  356   ---PSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPK  195
                   R I  + S +GL V +RL  +   +Q           +  VKSG  E  +L+P+
Sbjct  1167  GKRSVSRAINRDMS-SGLSVISRL--SEEFEQRTQVFADDAKFLMEVKSGKSEA-SLNPE  1222

Query  194   NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRG  81
               ++ ++K  F+ WKKD+ SRL+  K  + +L   D G
Sbjct  1223  R-ELRRLKQDFELWKKDFNSRLREAKMVINKLGTDDAG  1259



>emb|CDY52239.1| BnaC02g44600D [Brassica napus]
Length=1197

 Score =   133 bits (334),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 110/355 (31%), Positives = 170/355 (48%), Gaps = 61/355 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  ++ GA VLQS+VRGE  R+ +    
Sbjct  857   QIGIFEDRRKEVLQ-GIVGLQKRFRGHLSREYFQSVRNGASVLQSYVRGEIGRRMFD---  912

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNK--------KITSRLN  657
                   +  + H          +L AVI LQS +RGWL R  FN          +T+   
Sbjct  913   ------IEAKLHADSVTEASTGELTAVIHLQSAVRGWLARKRFNSMQRQKELLNVTTLSK  966

Query  656   SRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYE  477
              R  L      E+ +VQ S + DLQ+RV  +E A  +  +ENA+L+E + QF++K  EYE
Sbjct  967   KRAGLRISEDKEEFQVQPSAMSDLQKRVLESETAFVQKEEENAALREQLKQFEEKWSEYE  1026

Query  476   AKMQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSDA----  318
              KM+ +E++WQ Q+ S+Q SL AA +S   E V      R +  +  F  +E  D     
Sbjct  1027  IKMKSMEETWQKQMSSLQMSLAAARKSLATENVTGQAGGRQDTSTSPF-GYESEDTTSTT  1085

Query  317   ---GL--VVNNRLDFASP---LDQENGSHQNMITWVKSGHDE-------------PLNLS  201
                GL     N  +  +P     + NGS  N +  +    D+              + + 
Sbjct  1086  ATPGLRTPTTNFTNGNTPELRSRELNGS-LNAVNHLAREFDQRRLNFDEDARAIVEVKVE  1144

Query  200   PKNS---------DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             P+ +         +  ++KLRF+ WKKDYK+RL+  KA L    H D+ +    W
Sbjct  1145  PEATGQQQQHPEDEFRRLKLRFETWKKDYKARLRETKARL----HSDKRRHRKWW  1195



>gb|AAG49341.1| myosin subfamily VIII heavy chain [Petroselinum crispum]
Length=1176

 Score =   133 bits (334),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 111/354 (31%), Positives = 174/354 (49%), Gaps = 64/354 (18%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++EE  KQ  V +G   +Q+C+  HQAR Y++ELKRG   LQSFVR  NAR+ Y  L+  
Sbjct  836   ALEEARKQ--VLQGTLEVQKCFRCHQARRYFHELKRGVTSLQSFVRATNARRKYNHLINL  893

Query  806   LRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQML----N  639
              +  V  QK + EQQ        AV+ LQ+ IRGWL R +  + +  R ++++ +    N
Sbjct  894   KKQAV--QKTLDEQQR-------AVLQLQAVIRGWLVRRQSKRLLKLRKSNQENIDSSHN  944

Query  638   PELKDEDIKVQRS----------VLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
                +  D+K Q +          V+ +L+RRV + E  LE    ENA+L++ + Q++ + 
Sbjct  945   LSWRISDVKKQETHQESNQVLPLVIEELRRRVLMAETNLENKEQENAALQDQVQQYEARW  1004

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRS------------EGVA--------ENGLS  369
              EYE KM+ +E  WQ Q  S+Q SL A  +S            EG          +N   
Sbjct  1005  VEYEGKMKLMEDMWQKQTASLQMSLAAVKKSLADSTSVQSGKGEGSPSPHYYDSDDNNSM  1064

Query  368   RTEPPSERFIPFERS----DAGLVVNNRLDFASPL----DQENGSHQN---MITWVKSGH  222
             +T+ P +  I    S     AG + N   +  S L    +Q   +  N    I  VKSG 
Sbjct  1065  QTQTPDDTPIKITSSISEFGAGRLCNGNRNAVSHLMKEFEQRKQTFDNEAKAIIEVKSGG  1124

Query  221   DEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             +        + ++  +K +F+ W KDYK+RL+  K  L++L   ++ +   +WC
Sbjct  1125  N-------PDEELRSLKNKFETWMKDYKARLREAKTKLQKLPSAEKRRRN-LWC  1170



>ref|XP_006592897.1| PREDICTED: myosin-2-like isoform X2 [Glycine max]
Length=1197

 Score =   133 bits (334),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 170/345 (49%), Gaps = 67/345 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q G+  IQ+ + G+QAR +Y+ELK G  +LQSFVRGE AR++Y  +V
Sbjct  849   QIGALEDRRKHLLQ-GILGIQKSFRGYQARRHYHELKNGVTILQSFVRGEIARREYGVMV  907

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR---IEFNKKITSRLNSR---  651
                  I T            ++++ A   LQS IRGWL R      NK   S  N+R   
Sbjct  908   KSSMTIST----------ENIKEIEAATTLQSVIRGWLVRRHASSLNKSKKSPGNARSRR  957

Query  650   --QMLNPELKDEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
               ++  PE+K +D+  +R     S L +LQRRV   EA +E+  +ENA LKE + QF+++
Sbjct  958   RSRVKMPEVK-QDVSGERGQNLPSALAELQRRVIKAEATIEQKEEENAELKEQLKQFERR  1016

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFERSDA  318
               EYE +M+ +E  WQ Q+ S+Q SL AA +S     A + ++R +  S     ++  DA
Sbjct  1017  WIEYEKRMKSMEDMWQKQMASLQMSLAAARKSLASENASSQIARRDVASP--FGYDSEDA  1074

Query  317   GLV---------VNNRLDFASPLDQENG---------SHQNM-----------------I  243
               V          +  L ++S L +            S  N+                 +
Sbjct  1075  TSVGSRTPRTPGASTPLKYSSSLTEAGAGRDAKGTLTSVSNLMKEFEQRRHTFDDDARAL  1134

Query  242   TWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
               VK+G     N      ++ K+K  F+ WKK+YK+RL+  KA L
Sbjct  1135  VEVKTGQSANTN---SVEELRKLKHSFEGWKKEYKARLRETKARL  1176



>ref|XP_010933291.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1211

 Score =   132 bits (333),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 103/326 (32%), Positives = 170/326 (52%), Gaps = 36/326 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR    E ++  + LQSFVRGE  R+ Y  L+
Sbjct  870   QIGALEDTRNRTLH-GILRVQSCFRGHQARRLVKERRKAIVTLQSFVRGEKTRRIYSGLL  928

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q+++K Q +R+  ++   A + +QS IRGWL R          LN+ + L 
Sbjct  929   QRHRAAIVLQRYVKCQSARKSFIDVCNATVTIQSVIRGWLVRRCSGD--VGLLNTAKKLE  986

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ++++V+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM  +
Sbjct  987   GAKESDEVQVKASFLAELQRRILKAEAALREKEEENDILHQRLQQYESRWSEYEHKMISM  1046

Query  458   EKSWQDQLMSIQTSLGAASRS------------------EGVAENGLSRTEPPSE-----  348
             E+ WQ Q+ S+Q+SL  A +S                  +G   +  +R    S      
Sbjct  1047  EEVWQKQMRSLQSSLSIAKKSLATDDAARRSDASVDQSWDGNGNHIGTRGREESHVRLGS  1106

Query  347   RFIPFERSDAGLVVNNRLDFASPLDQENGSHQNMITW---VKSGHDEPLNLSPKNSDVHK  177
             R +  + S AGL V +RL  A   +Q +    + + +   VKSG  E  NL+P+  ++ +
Sbjct  1107  RVLDRDMS-AGLGVISRL--AEEFEQRSQVFADDVKFLVEVKSGQAEA-NLNPEK-ELRR  1161

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQL  99
             +K  F++WKK++  RL+  K  + +L
Sbjct  1162  LKQNFESWKKEFSMRLRESKVMINKL  1187



>ref|XP_007149632.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21626.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=772

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 180/361 (50%), Gaps = 66/361 (18%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI   ED ++  ++ G+ +IQ+ + G+QAR +Y+E+K+G   LQSFVRGE  R+ Y  LV
Sbjct  427  QIGALEDRRKYLLE-GLLVIQKSFRGYQARCHYHEIKKGVTTLQSFVRGEIGRRAYGVLV  485

Query  812  TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKI--TSRLNS  654
               ++ +TI        S  ++++ A   LQS IRGWL R     + ++KK    +R   
Sbjct  486  ---KSSMTIS-------SENIKEMLAATTLQSVIRGWLVRRNSGDLNYSKKSHENARSRR  535

Query  653  RQMLN-PELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
            R  +N PE KD   E ++   S L +LQRRV   E  + +   ENA LK+ + QF+ +  
Sbjct  536  RSRVNMPEEKDVPSERVQNLPSALAELQRRVVKAEVTITQKEGENAELKDQLKQFESRWM  595

Query  485  EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFER-----  327
            EYE +M+ +E+ WQ Q+ S+Q SL AA +S     A N  +R +  S    PF       
Sbjct  596  EYEKRMKSMEEMWQRQMSSLQMSLAAARKSLASENANNQHARRDVSS----PFTYDSEDA  651

Query  326  -------------------SDAGLV--VNNRLDFASPLDQE--------NGSHQNMITWV  234
                               S+AGL    N  L   S L +E        +   +N++  V
Sbjct  652  SMGSRTPSASTPLKYSTSISEAGLGRDANGALASVSHLMKEFDQRRQTFDFDARNLVD-V  710

Query  233  KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWCTM  54
            ++G    +N      ++ K+K RF+ WKK+YK RL+  KA L +L + +  K    W  +
Sbjct  711  RTGQSTNMN---SIEELRKLKHRFEGWKKEYKVRLKETKARLHKLGNSEMDKRRRWWGKL  767

Query  53   A  51
            +
Sbjct  768  S  768



>gb|AES66739.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1203

 Score =   132 bits (333),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 120/358 (34%), Positives = 185/358 (52%), Gaps = 65/358 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+   ED+++L +Q GV  +Q+   GHQAR +Y++LK G   LQSFVRGE AR+ Y  +V
Sbjct  854   QVGALEDKRKLVLQ-GVLGVQKWVRGHQARSHYDKLKNGVTTLQSFVRGEIARRKYGVMV  912

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR------IEF-----NKKITS  666
                ++ +TI        S  +E++ A+I LQS IRGWL R       +F     N K   
Sbjct  913   ---KSSITIS-------SENIEEIEAIILLQSVIRGWLVRRHNSSLCKFKIHPENGKTRR  962

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R  S+   + +   +  +   S L +LQRRV   E+ +E+  +ENA L+E + QF+K+  
Sbjct  963   RSRSKMSDDKDASKDRSQNLPSALAELQRRVVKAESTIEQKEEENAELREQLKQFEKRWI  1022

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG---LSRTEPPSERFIPFERSDAG  315
             EYE +M+ +E+ WQ Q+ S+Q SL AA+RS   +EN     SR +  S     ++  DA 
Sbjct  1023  EYETRMKTMEEMWQRQMSSLQMSL-AAARSSLASENANGQPSRHDVASPSPFCYDSEDAT  1081

Query  314   LV---------VNNRLDFASPLDQ------ENGSHQNMITWVK-----------------  231
              +          +  L ++S L +       NGS  N++   +                 
Sbjct  1082  SMGSRTPRTPGCSTPLKYSSSLSEIKAMRDGNGSLGNLMKEFEQRSQTFDEDARALVEVR  1141

Query  230   -SGHDEPLNLSPKN-SDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              +GH    +++P +  D+ K+K RF+ WKK+YK RL+  KA LK LR+ +  KS   W
Sbjct  1142  TTGH----SVNPNSIDDLRKLKHRFEGWKKEYKMRLKETKARLK-LRNSEMEKSRRRW  1194



>ref|XP_003539582.1| PREDICTED: myosin-2-like isoform X1 [Glycine max]
Length=1196

 Score =   132 bits (333),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 112/345 (32%), Positives = 169/345 (49%), Gaps = 68/345 (20%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  +Q G+  IQ+ + G+QAR +Y+ELK G  +LQSFVRGE AR++Y  +V
Sbjct  849   QIGALEDRRKHLLQ-GILGIQKSFRGYQARRHYHELKNGVTILQSFVRGEIARREYGVMV  907

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR---IEFNKKITSRLNSR---  651
                  I T            ++++ A   LQS IRGWL R      NK   S  N+R   
Sbjct  908   KSSMTIST----------ENIKEIEAATTLQSVIRGWLVRRHASSLNKSKKSPGNARSRR  957

Query  650   --QMLNPELKDEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
               ++  PE+KD  +  +R     S L +LQRRV   EA +E+  +ENA LKE + QF+++
Sbjct  958   RSRVKMPEVKD--VSGERGQNLPSALAELQRRVIKAEATIEQKEEENAELKEQLKQFERR  1015

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFERSDA  318
               EYE +M+ +E  WQ Q+ S+Q SL AA +S     A + ++R +  S     ++  DA
Sbjct  1016  WIEYEKRMKSMEDMWQKQMASLQMSLAAARKSLASENASSQIARRDVASP--FGYDSEDA  1073

Query  317   GLV---------VNNRLDFASPLDQENG---------SHQNM-----------------I  243
               V          +  L ++S L +            S  N+                 +
Sbjct  1074  TSVGSRTPRTPGASTPLKYSSSLTEAGAGRDAKGTLTSVSNLMKEFEQRRHTFDDDARAL  1133

Query  242   TWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
               VK+G     N      ++ K+K  F+ WKK+YK+RL+  KA L
Sbjct  1134  VEVKTGQSANTN---SVEELRKLKHSFEGWKKEYKARLRETKARL  1175



>ref|XP_007149633.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21627.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=1186

 Score =   132 bits (331),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 116/361 (32%), Positives = 180/361 (50%), Gaps = 66/361 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  ++ G+ +IQ+ + G+QAR +Y+E+K+G   LQSFVRGE  R+ Y  LV
Sbjct  841   QIGALEDRRKYLLE-GLLVIQKSFRGYQARCHYHEIKKGVTTLQSFVRGEIGRRAYGVLV  899

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKI--TSRLNS  654
                ++ +TI        S  ++++ A   LQS IRGWL R     + ++KK    +R   
Sbjct  900   ---KSSMTIS-------SENIKEMLAATTLQSVIRGWLVRRNSGDLNYSKKSHENARSRR  949

Query  653   RQMLN-PELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R  +N PE KD   E ++   S L +LQRRV   E  + +   ENA LK+ + QF+ +  
Sbjct  950   RSRVNMPEEKDVPSERVQNLPSALAELQRRVVKAEVTITQKEGENAELKDQLKQFESRWM  1009

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFER-----  327
             EYE +M+ +E+ WQ Q+ S+Q SL AA +S     A N  +R +  S    PF       
Sbjct  1010  EYEKRMKSMEEMWQRQMSSLQMSLAAARKSLASENANNQHARRDVSS----PFTYDSEDA  1065

Query  326   -------------------SDAGLV--VNNRLDFASPLDQE--------NGSHQNMITWV  234
                                S+AGL    N  L   S L +E        +   +N++  V
Sbjct  1066  SMGSRTPSASTPLKYSTSISEAGLGRDANGALASVSHLMKEFDQRRQTFDFDARNLVD-V  1124

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWCTM  54
             ++G    +N      ++ K+K RF+ WKK+YK RL+  KA L +L + +  K    W  +
Sbjct  1125  RTGQSTNMN---SIEELRKLKHRFEGWKKEYKVRLKETKARLHKLGNSEMDKRRRWWGKL  1181

Query  53    A  51
             +
Sbjct  1182  S  1182



>ref|XP_009127101.1| PREDICTED: myosin-2 [Brassica rapa]
Length=1206

 Score =   132 bits (331),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 112/355 (32%), Positives = 166/355 (47%), Gaps = 60/355 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+   GH +R Y+  ++ GA+VLQS+VRGE  R+ +    
Sbjct  865   QIGIFEDRRKKILQ-GIVGLQKRLRGHLSREYFQSVRNGALVLQSYVRGEIGRRMFD---  920

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNK--------KITSRLN  657
                   +  + H          +L AVI LQS +RGWL R  FN          +T+   
Sbjct  921   ------IEAKLHADSVSEASTGELTAVIHLQSAVRGWLARKRFNSMQRQKELLNVTTLSK  974

Query  656   SRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYE  477
              R  L      E+ KVQ S + DLQ+RV  +E AL +  +EN +L+E + QF++K  EYE
Sbjct  975   KRAGLRISEDKEEFKVQPSAMSDLQKRVLESETALLQKEEENTALREQLRQFEEKWSEYE  1034

Query  476   AKMQCLEKSWQDQLMSIQTSLGAASRS---EGV-AENGLSRTEPPSERFIPFERSDA---  318
              KM+ +E++WQ Q+ S+Q SL AA +S   E V  + G  R +  +  F  +E  D    
Sbjct  1035  IKMKSMEETWQKQMSSLQMSLAAARKSLATENVTGQAGGGRQDTSTSPF-GYESEDTTST  1093

Query  317   ----GL--VVNNRLDFASP---LDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVK--  171
                 GL     N  +  +P     + NGS   +    +      LN       + +VK  
Sbjct  1094  TATPGLRTPTTNFTNGNTPELRSRELNGSLNAVNHLAREFDQRRLNFDEDARAIVEVKVE  1153

Query  170   -------------------LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                                LRF+ WKKDYK+RL+  KA L    H D+ +    W
Sbjct  1154  PEATGQQQQHPEDEFRRLKLRFETWKKDYKARLRETKARL----HSDKRRHRKWW  1204



>ref|XP_010935561.1| PREDICTED: myosin-1-like [Elaeis guineensis]
Length=1166

 Score =   132 bits (331),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 101/326 (31%), Positives = 167/326 (51%), Gaps = 35/326 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+ R Y    ++  I LQSF+ G+ AR+ Y  LV
Sbjct  824   QIGALEDTRNRTLH-GILRVQSCFRGHRVRCYVKRHRQAVITLQSFIHGDKARRMYSVLV  882

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              + RA V +Q+++K Q +R+  +    A I +QS IRGWL R      + +   S+ +++
Sbjct  883   HKHRAAVILQRNLKSQTTRKEFVNVRNASIVIQSVIRGWLVRRCSGDVVPN--TSKTVVD  940

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++ + D + V+ SVL++LQRR+   E+AL    +EN  L + + Q+D +  +YE KM+ 
Sbjct  941   TKVPETDQVPVKSSVLVELQRRILKAESALREKEEENDMLHQRLQQYDSRWSDYEQKMRS  1000

Query  461   LEKSWQDQLMSIQTSLGAASRS---EGVAEN-------------------GLSRTEPPSE  348
             +E+ WQ Q+ S+Q+SL  A +S   +GV  N                   GL    P   
Sbjct  1001  MEEVWQKQMRSLQSSLSIAKKSLALDGVDVNSDGSMDQSICTNGNYTGTEGLENKGPSVG  1060

Query  347   RFIPFERSDAGLVVNNRLDFASPLDQENG---SHQNMITWVKSGHDEPLNLSPKNSDVHK  177
               +      A L + +RL  A   +Q +         +  VKSG  E  +L+P+  ++ K
Sbjct  1061  SRLTGREMSASLNIISRL--AEEFEQRSQVFIDDAKFLVEVKSGQAEA-SLNPER-ELRK  1116

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQL  99
             +K  F+ W+KDY  RL+  K  + +L
Sbjct  1117  LKQTFETWRKDYNLRLRETKVIIHKL  1142



>ref|XP_009773271.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana sylvestris]
Length=1156

 Score =   132 bits (331),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 111/347 (32%), Positives = 168/347 (48%), Gaps = 54/347 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ GH+AR Y++ELK G I LQSF+RGE AR  Y   V
Sbjct  821   QIAALEDVRNQVLQGTLEV-QKCFRGHRARCYFHELKGGVITLQSFIRGEIARNRYNTSV  879

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSR-LN------S  654
                  +     H  +      EQL AV+ +QS IRGWL R + NK  +++ LN       
Sbjct  880   GSKAKVA----HKSD------EQLVAVVQIQSAIRGWLARKDLNKLQSAKTLNVDIPKTG  929

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
             R+M   EL  E   +  SV+ DL+RR+   EA L     EN +LKE +  F+ +  EYE 
Sbjct  930   RKMEAKELPRE---ILPSVVEDLERRLLKAEATLGEKEMENVALKEQLNLFEARCLEYEV  986

Query  473   KMQCLEKSWQDQLM-------SIQTSLGAA------SRSEGV-------AENGLSRTEPP  354
             KM+ +E+ WQ Q+        + + SLGA        + EG        +++  S   P 
Sbjct  987   KMRSMEEMWQKQMASLQASLAAAKNSLGAGDTTGRPGKPEGSPSPRYYDSDDATSMDTPA  1046

Query  353   SERFIPFERS---------DAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEPLNL  204
                 + F  S         + GL + + L       ++N   + + I  +K G    L+ 
Sbjct  1047  GCTPVKFTNSLGVGANREVNGGLAIVSHLTLEFEQRKQNFDDEALAIVHLKPGQ---LHS  1103

Query  203   SPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             +    +  ++K RF+ WKKDYK RL+  KA + +L     GK+   W
Sbjct  1104  TNPADEYRRLKCRFEEWKKDYKVRLKETKAKVHKLGCSKAGKNRRKW  1150



>ref|XP_010446745.1| PREDICTED: myosin-2-like [Camelina sativa]
Length=1217

 Score =   131 bits (330),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 108/364 (30%), Positives = 177/364 (49%), Gaps = 69/364 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH  R Y+  ++  A+VLQS+VRGENAR+ +    
Sbjct  865   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLTREYFQNMRAVALVLQSYVRGENARRMFD---  920

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L AVI LQS +RGWL R  FN    S    +++LN  
Sbjct  921   ------AEAKIHADSVSEASTDELTAVIHLQSVVRGWLARKSFN----SMQRQKELLNVT  970

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+RV  +EAAL +  +EN +L+E + QF
Sbjct  971   TKSKKKAGRRISEDKDIPLEQFQVQPTTMSDLQKRVLKSEAALAQKEEENTALREQLRQF  1030

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV---------------------A  384
             +++  EYE KM+ +E +WQ Q+ S+Q SL AA +S                        +
Sbjct  1031  EERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLATESITGQAGGRQDTSISPFGYES  1090

Query  383   ENGLSRTEP----PSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-NMITWVKSGH  222
             E+ +S   P    P+ +F      +  +  +N  L+  + L +E    + N     ++  
Sbjct  1091  EDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1150

Query  221   DEPLNLSPKNS-----------DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             +  L + P+ +           +  ++K RF+ WKKDYK+RL+  KA L ++   D+G+ 
Sbjct  1151  EVKLGVGPQATPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDTKARLHRV-DGDKGRH  1209

Query  74    T*IW  63
                W
Sbjct  1210  RKWW  1213



>ref|XP_002883217.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59476.1| hypothetical protein ARALYDRAFT_479514 [Arabidopsis lyrata subsp. 
lyrata]
Length=1166

 Score =   131 bits (330),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 109/328 (33%), Positives = 167/328 (51%), Gaps = 44/328 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR    ELK G  +LQSFVRGE  RK++  L 
Sbjct  828   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCRLKELKMGISILQSFVRGEKIRKEFAELR  886

Query  812   TRLRAIVTIQKHMKEQQSRR-LEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  + +A A + +QS IRGWL R     I + K   ++ N 
Sbjct  887   RRHRAAATIQSQVKSKIARKQYKGIADASVLIQSVIRGWLVRRCSGDIGWLKSGGTKTN-  945

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  946   --------ESGEVLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  997

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLS--------------------RTEPP  354
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V ++  +                    R++  
Sbjct  998   KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1057

Query  353   SERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDV  183
             +      +   AGL V  RL  A   +Q     G     +  VKSG  E  NL+P + ++
Sbjct  1058  NGGGPRLQPMSAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA-NLNP-DREL  1113

Query  182   HKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1114  RRLKQMFETWKKDYGGRLRETKLILSKL  1141



>ref|XP_006401589.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
 gb|ESQ43042.1| hypothetical protein EUTSA_v10012475mg [Eutrema salsugineum]
Length=1217

 Score =   131 bits (329),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 106/350 (30%), Positives = 167/350 (48%), Gaps = 68/350 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  V KG+  +Q+   G+ +R Y+  ++  A VLQS+VRGENAR+ Y+  +
Sbjct  869   QIGIFEDRRK-KVLKGIVGLQKHLRGYLSREYFQNMRNAAFVLQSYVRGENARRIYETKI  927

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                        H+         +L AV  LQS +RGWL R    K++ S    +++LN  
Sbjct  928   -----------HVDSVSQASTGELTAVTHLQSAVRGWLAR----KRLKSMQRQKELLNVT  972

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+D+     +VQ S + DLQ+RV  +EAAL +  +EN +L+E + QF
Sbjct  973   TKSKRKAGRRISEDKDLPLEQFQVQPSAMSDLQKRVLKSEAALAQKEEENTALREQLRQF  1032

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------S  396
             +++  EYE KM+ +E++WQ Q+ S+Q SL AA +                         S
Sbjct  1033  EERWSEYEMKMKSMEETWQKQMSSLQMSLAAARKSLAAENMTGQAGGRQDTSISPFGYDS  1092

Query  395   EGVAENGLSRTEPPSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-------NMIT  240
             E     G      P+ +F      +  +  +N  L+  + L +E    +         I 
Sbjct  1093  EDTTSTGTPGVRTPTTKFTNGNTPELRVRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1152

Query  239   WVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++
Sbjct  1153  EVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRETKARLHRV  1202



>ref|XP_007149634.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
 gb|ESW21628.1| hypothetical protein PHAVU_005G085900g [Phaseolus vulgaris]
Length=1187

 Score =   131 bits (329),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 113/362 (31%), Positives = 179/362 (49%), Gaps = 67/362 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED ++  ++ G+ +IQ+ + G+QAR +Y+E+K+G   LQSFVRGE  R+ Y  LV
Sbjct  841   QIGALEDRRKYLLE-GLLVIQKSFRGYQARCHYHEIKKGVTTLQSFVRGEIGRRAYGVLV  899

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKI--TSRLNS  654
                ++ +TI        S  ++++ A   LQS IRGWL R     + ++KK    +R   
Sbjct  900   ---KSSMTIS-------SENIKEMLAATTLQSVIRGWLVRRNSGDLNYSKKSHENARSRR  949

Query  653   RQMLNPELKDEDIKVQR-----SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
             R  +N   + +D+  +R     S L +LQRRV   E  + +   ENA LK+ + QF+ + 
Sbjct  950   RSRVNMPEEKQDVPSERVQNLPSALAELQRRVVKAEVTITQKEGENAELKDQLKQFESRW  1009

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV--AENGLSRTEPPSERFIPFER----  327
              EYE +M+ +E+ WQ Q+ S+Q SL AA +S     A N  +R +  S    PF      
Sbjct  1010  MEYEKRMKSMEEMWQRQMSSLQMSLAAARKSLASENANNQHARRDVSS----PFTYDSED  1065

Query  326   --------------------SDAGLV--VNNRLDFASPLDQE--------NGSHQNMITW  237
                                 S+AGL    N  L   S L +E        +   +N++  
Sbjct  1066  ASMGSRTPSASTPLKYSTSISEAGLGRDANGALASVSHLMKEFDQRRQTFDFDARNLVD-  1124

Query  236   VKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWCT  57
             V++G    +N      ++ K+K RF+ WKK+YK RL+  KA L +L + +  K    W  
Sbjct  1125  VRTGQSTNMN---SIEELRKLKHRFEGWKKEYKVRLKETKARLHKLGNSEMDKRRRWWGK  1181

Query  56    MA  51
             ++
Sbjct  1182  LS  1183



>ref|XP_002866036.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42295.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1219

 Score =   130 bits (328),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 172/362 (48%), Gaps = 67/362 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  +++  +VLQS++RGENAR+ +    
Sbjct  869   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSRAYFQNMRKVTLVLQSYIRGENARRMFD---  924

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L A+I LQS +RGWL R  FN         +++LN  
Sbjct  925   ------TEAKIHADSVSEASTDELTAIIHLQSAVRGWLARKRFN----GMQRQKELLNVT  974

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ+  + DLQ+RV  +EAAL +  +EN +L+E + QF
Sbjct  975   TKSKRKAGRRISEDKDIPLEQSRVQQPSMSDLQKRVLKSEAALAQKEEENTALREQLRQF  1034

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------S  396
             +++  EY+ KM+ +E++WQ Q+ S+Q SL AA +                         S
Sbjct  1035  EERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYDS  1094

Query  395   EGVAENGLSRTEPPSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-------NMIT  240
             E     G      P+ +F      +  +  +N  L+  + L +E    +         I 
Sbjct  1095  EDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1154

Query  239   WVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*  69
              VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++   D+G+   
Sbjct  1155  EVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRDTKARLHRV-DGDKGRHRK  1213

Query  68    IW  63
              W
Sbjct  1214  WW  1215



>ref|XP_010443003.1| PREDICTED: myosin-2 [Camelina sativa]
Length=1215

 Score =   130 bits (328),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 104/360 (29%), Positives = 174/360 (48%), Gaps = 61/360 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  ++  A+VLQS+VRGENAR+ Y    
Sbjct  863   QIGIFEDRRRKVLQ-GIVGLQKHFRGHLSREYFQNMRAVALVLQSYVRGENARRMYD---  918

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNK------------KIT  669
                      + H         ++L AVI LQS +RGWL R  F+             K  
Sbjct  919   ------AEAKIHADSVSEASTDELNAVIHLQSAVRGWLARKRFSSMQRQKELLSVTTKSK  972

Query  668   SRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              +   R   + ++  E  +VQ + + DLQ+RV  +EAAL +  +EN +L+E + QF+++ 
Sbjct  973   KKAGRRSSEDKDIPLEQFQVQPTTMSDLQKRVLKSEAALAQKEEENTALREQLRQFEERW  1032

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV---------------------AENGL  372
              EYE KM+ +E +WQ Q+ S+Q SL AA +S                        +E+ +
Sbjct  1033  SEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLATESITGQAGGRQDTSISPFGYESEDTM  1092

Query  371   SRTEP----PSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-NMITWVKSGHDEPL  210
             S   P    P+ +F      +  +  +N  L+  + L +E    + N     ++  +  L
Sbjct  1093  STGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIVEVKL  1152

Query  209   NLSPKNS-----------DVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              + P+ +           +  ++K RF+ WKKDYK+RL+  KA L ++   D+G+    W
Sbjct  1153  GVGPQATPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDTKARLHRV-DGDKGRHRKWW  1211



>emb|CAB61875.1| myosin [Arabidopsis thaliana]
Length=1166

 Score =   130 bits (327),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 115/338 (34%), Positives = 168/338 (50%), Gaps = 64/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR    ELKR   +LQSFVRGE  RK++  L 
Sbjct  828   QIGVLEDTRNRTLH-GILRVQSSFRGYQARCLLKELKRRISILQSFVRGEKIRKEFAELR  886

Query  812   TRLRAIVTIQKHMKEQQSR-RLEQLA-AVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R +A  TIQ  +K + +R + + +A A + +QS IRGWL R     I + K   ++ N 
Sbjct  887   RRHKAAATIQSQVKSKIARIQYKGIADASVVIQSAIRGWLVRRCSGDIGWLKSGGAKTN-  945

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                   EL +  + V+ SVL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  946   ------ELGE--VLVKASVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  997

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE-----------------------------  381
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V +                             
Sbjct  998   KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNQFRSQTS  1057

Query  380   NGL-SRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
             NG+ SR +P S          AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1058  NGVGSRLQPMS----------AGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA  1105

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1106  -NLDP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1141



>ref|XP_009420769.1| PREDICTED: myosin-2-like isoform X2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 103/335 (31%), Positives = 166/335 (50%), Gaps = 47/335 (14%)
 Frame = -3

Query  950  KGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMK  771
            +G+  +Q+ Y G +AR  Y +LK+GA  LQSFVRGE AR +++FL+ R RA V IQKH++
Sbjct  163  QGILWLQKNYRGVRARSRYQQLKKGATTLQSFVRGERARHNFEFLMKRWRAAVFIQKHVR  222

Query  770  EQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPELKD----EDIKV  609
               +R +   Q   +I LQS IRG L    F   +  ++   ++++  +KD    E  ++
Sbjct  223  LWLARTVFKNQQKDIIFLQSVIRGCLASKHFT--VLKKVEVSKVIH--VKDTNNNEPPQI  278

Query  608  QRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMS  429
              S+L + + +++  EAAL    +EN  LK+ +  ++ +  EYE KM+ +E++WQ QL +
Sbjct  279  HPSILAEFKSQMSKAEAALREKEEENVILKQQLQAYETRWSEYELKMKSMEETWQKQLTA  338

Query  428  IQTSLGAASRS----EGVAENGL---SRT--------------EPPSERFIPFER-SDAG  315
            +Q S  A  +S    E   + G    S+T              + P +        SDA 
Sbjct  339  LQMSFTAGRKSIVPEEMTKQPGWPDASQTNHYYEAEDDESVGAQTPEDTLAKLPNASDAM  398

Query  314  LVVNNR------LDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
             V NN       +      DQ+     +   ++  VKSG   P        ++  +K  F
Sbjct  399  QVRNNDTACNAVIQLIKEFDQQRQVFDTDAGLLIEVKSGAINPY------EELRNLKSHF  452

Query  161  KAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWCT  57
             +WKKDYK RL+  K  L +L + ++      WCT
Sbjct  453  ASWKKDYKMRLRDTKTALLKLVNPEKRAYKRWWCT  487



>ref|XP_009420767.1| PREDICTED: myosin-2-like isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009420768.1| PREDICTED: myosin-2-like isoform X1 [Musa acuminata subsp. malaccensis]
Length=499

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 105/339 (31%), Positives = 166/339 (49%), Gaps = 48/339 (14%)
 Frame = -3

Query  950  KGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMK  771
            +G+  +Q+ Y G +AR  Y +LK+GA  LQSFVRGE AR +++FL+ R RA V IQKH++
Sbjct  163  QGILWLQKNYRGVRARSRYQQLKKGATTLQSFVRGERARHNFEFLMKRWRAAVFIQKHVR  222

Query  770  EQQSRRL--EQLAAVICLQSGIRGWLT--------RIEFNKKITSRLNSRQMLNPELKDE  621
               +R +   Q   +I LQS IRG L         ++E +K I  +  S  +L     +E
Sbjct  223  LWLARTVFKNQQKDIIFLQSVIRGCLASKHFTVLKKVEVSKVIHVKGWSF-VLQDTNNNE  281

Query  620  DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQD  441
              ++  S+L + + +++  EAAL    +EN  LK+ +  ++ +  EYE KM+ +E++WQ 
Sbjct  282  PPQIHPSILAEFKSQMSKAEAALREKEEENVILKQQLQAYETRWSEYELKMKSMEETWQK  341

Query  440  QLMSIQTSLGAASRS----EGVAENGL---SRT--------------EPPSERFIPFER-  327
            QL ++Q S  A  +S    E   + G    S+T              + P +        
Sbjct  342  QLTALQMSFTAGRKSIVPEEMTKQPGWPDASQTNHYYEAEDDESVGAQTPEDTLAKLPNA  401

Query  326  SDAGLVVNNR------LDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
            SDA  V NN       +      DQ+     +   ++  VKSG   P        ++  +
Sbjct  402  SDAMQVRNNDTACNAVIQLIKEFDQQRQVFDTDAGLLIEVKSGAINPY------EELRNL  455

Query  173  KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWCT  57
            K  F +WKKDYK RL+  K  L +L + ++      WCT
Sbjct  456  KSHFASWKKDYKMRLRDTKTALLKLVNPEKRAYKRWWCT  494



>gb|KEH40947.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1169

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 106/326 (33%), Positives = 163/326 (50%), Gaps = 42/326 (13%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q C+ G+QAR    +L+ G   LQSF+RG+  RK Y  L+
Sbjct  834   QIGVLEDTRNRTLH-GILRVQSCFRGYQARRSLKKLRGGISTLQSFIRGQKTRKAYAALL  892

Query  812   TRLRAIVTIQKHMKEQ--QSRRLEQLAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA + IQK +K    ++R      A I +QS IRGWL R     I F K   ++   
Sbjct  893   QRHRAAIIIQKRIKALLIRNRTGTIRDATIVIQSVIRGWLVRRCSGDIGFLKHGDTKTTG  952

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                       ++I V+ S L +LQRRV   EAAL    +EN  L + I Q++ +  EYE 
Sbjct  953   ---------SDEILVKSSFLAELQRRVLKAEAALREKDEENDILNQRIQQYENRWSEYEL  1003

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAE----NGLSRTEPPSERFIPFE--------  330
             KM+ +E  WQ Q+ S+Q+SL  A +S  + +    +  S      ER   ++        
Sbjct  1004  KMKSMEDVWQKQMRSLQSSLSIAKKSLAIDDSDRNSDASVNNASDERDYSWDAGSNHRRQ  1063

Query  329   ------RSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHK  177
                    + A L V +RL  A   +Q +   G     +  VKSG  E  +L+P + ++ +
Sbjct  1064  ESNGTRSTSASLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQAEA-SLNP-DQELRR  1119

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQL  99
             +K  F+AWK+DY +RL+  K  + +L
Sbjct  1120  LKQMFEAWKRDYGARLRETKLIINKL  1145



>emb|CDY28777.1| BnaA02g09690D [Brassica napus]
Length=1199

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 112/355 (32%), Positives = 165/355 (46%), Gaps = 60/355 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+   GH +R Y+  ++ GA+VLQS+VRGE  R+ +    
Sbjct  858   QIGIFEDRRKKVLQ-GIVGLQKRLRGHLSREYFQSVRNGALVLQSYVRGEIGRRMFD---  913

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNK--------KITSRLN  657
                   +  + H          +L AVI LQS +RGWL R  FN          +T    
Sbjct  914   ------IEAKLHADSVSEASTGELTAVIHLQSAVRGWLARKRFNSMQRQKELLNVTIISK  967

Query  656   SRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYE  477
              R  L      E+ KVQ   + DLQ+RV  +EAAL +  +EN +L+E + QF++K  EYE
Sbjct  968   KRAGLRISEDKEEFKVQPLAMSDLQKRVLESEAALVQKEEENTALREQLRQFEEKWSEYE  1027

Query  476   AKMQCLEKSWQDQLMSIQTSLGAASRS---EGV-AENGLSRTEPPSERFIPFERSDA---  318
              KM+ +E++WQ Q+ S+Q SL AA +S   E V  + G  R +  +  F  +E  D    
Sbjct  1028  IKMKSMEETWQKQMSSLQMSLAAARKSLATENVTGQAGGGRQDTSTSPF-GYESEDTTST  1086

Query  317   ----GL--VVNNRLDFASP---LDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVK--  171
                 GL     N  +  +P     + NGS   +    +      LN       + +VK  
Sbjct  1087  TATPGLRTPTTNFTNGNTPELRSRELNGSLNAVNHLAREFDQRRLNFDEDARAIVEVKVE  1146

Query  170   -------------------LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
                                LRF+ WKKDYK+RL+  KA L    H D+ +    W
Sbjct  1147  PEATGQQQQHPEDEFRRLKLRFETWKKDYKARLRETKARL----HSDKRRHRKWW  1197



>ref|XP_010279450.1| PREDICTED: myosin-1-like [Nelumbo nucifera]
Length=1327

 Score =   130 bits (326),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 173/335 (52%), Gaps = 48/335 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GH+AR Y  EL+ G   LQSFVRGE ARK+Y  L+
Sbjct  980   QIGALEDTRNRTLH-GILRVQSCFRGHKARIYLKELRSGIATLQSFVRGEKARKEYVILL  1038

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
                RA V IQK +K + +R+  +    A I +QS IRGWL R   +  +T   ++++   
Sbjct  1039  RTHRAAVFIQKLVKGRTARKKFMNVRDASIVIQSVIRGWLVR-RCSGDVTLLSSTQKFEG  1097

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              +  + D + V+ SVL +LQRRV   EAAL    +EN  L + + Q++ +  EYE KM+ 
Sbjct  1098  TKGSEPDQVLVKASVLAELQRRVLKAEAALREKEEENDILHQRLQQYESRWSEYELKMKS  1157

Query  461   LEKSWQDQLMSIQTSLGAASR-------------------------------SEGVAENG  375
             +E+ WQ Q+ S+Q+SL  A +                               S+G   NG
Sbjct  1158  MEEVWQKQMSSLQSSLSIAKKSLVIDDAERKSDASVNATDDREHNWDLGNNNSKGQENNG  1217

Query  374   LSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNL  204
             L     P  + +  E S AGL V +RL  A   +Q +   G     +  VKSG  E  ++
Sbjct  1218  LR----PGPQILDREMS-AGLSVISRL--AEEFEQRSQVFGDDAKFLVEVKSGQAEA-SI  1269

Query  203   SPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             +P + ++ ++K  F+AWKKDY +RL+  K  L +L
Sbjct  1270  NP-DRELRRLKQIFEAWKKDYGARLRETKVILHKL  1303



>ref|XP_002467046.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
 gb|EER94044.1| hypothetical protein SORBIDRAFT_01g018770 [Sorghum bicolor]
Length=1196

 Score =   130 bits (326),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 168/325 (52%), Gaps = 38/325 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQARH+  E  RG + LQSF+RGENAR+ Y  L 
Sbjct  858   QIGKLEDTRNRTLH-GILRVQSCFRGHQARHHARERIRGVLALQSFIRGENARQIYSSLS  916

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRL---NSR  651
              + RA V +Q++++   +RR  ++   A + +QSGIRG L R    N  + + L    S+
Sbjct  917   RKHRAAVILQRNVRCWLARRYFIKLRKASVIIQSGIRGSLVRRCNGNIDLINVLREFESK  976

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             Q    E + + I ++ SVL +LQRR+   EA +    +EN  L + + Q++ +  EYE K
Sbjct  977   Q----EAEGDQILIKASVLAELQRRILKAEATVREKDEENEMLHQRLQQYENRWLEYEQK  1032

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP  336
             M+ +E+ WQ Q+ S+Q+SL  A +S  + E               NG         + +P
Sbjct  1033  MKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWESNG--NHVSSGSQLVP  1090

Query  335   ---FERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    +AGL V  RL+     +Q +         +  VKSG  +  +L+P + ++ ++
Sbjct  1091  RTGGREMNAGLSVIGRLN--EEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRL  1146

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F +WKKD+  R++  K  L +L
Sbjct  1147  KQNFDSWKKDFSGRIRETKVILNKL  1171



>ref|NP_001078755.1| myosin 2 [Arabidopsis thaliana]
 sp|F4K0A6.1|MYO2_ARATH RecName: Full=Myosin-2; AltName: Full=AtATM2; AltName: Full=AtMYOS1 
[Arabidopsis thaliana]
 gb|AED96479.1| myosin 2 [Arabidopsis thaliana]
Length=1220

 Score =   130 bits (326),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 173/362 (48%), Gaps = 67/362 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  +++  +VLQS++RGENAR+ +    
Sbjct  870   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSRAYFQNMRKVTLVLQSYIRGENARRLFD---  925

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L+AVI LQS +RGWL R  FN    S    +++ N  
Sbjct  926   ------TEAKFHADSVSEASTDELSAVIHLQSAVRGWLARKHFN----SMQRQKELRNVA  975

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+R+  +EAAL +  +EN +L+E + QF
Sbjct  976   TKSKRKAGRRISEDKDIPLEQPQVQPTSMSDLQKRILKSEAALSQKEEENTALREQLRQF  1035

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------S  396
             +++  EY+ KM+ +E++WQ Q+ S+Q SL AA +                         S
Sbjct  1036  EERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYDS  1095

Query  395   EGVAENGLSRTEPPSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-------NMIT  240
             E     G      P+ +F      +  +  +N  L+  + L +E    +         I 
Sbjct  1096  EDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1155

Query  239   WVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*  69
              VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++   D+G+   
Sbjct  1156  EVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRDTKARLHRV-DGDKGRHRK  1214

Query  68    IW  63
              W
Sbjct  1215  WW  1216



>dbj|BAF01329.1| myosin heavy chain [Arabidopsis thaliana]
Length=1220

 Score =   129 bits (325),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 105/362 (29%), Positives = 173/362 (48%), Gaps = 67/362 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  +++  +VLQS++RGENAR+ +    
Sbjct  870   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSRAYFQNMRKVTLVLQSYIRGENARRLFD---  925

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L+AVI LQS +RGWL R  FN    S    +++ N  
Sbjct  926   ------TEAKFHADSVSEASTDELSAVIHLQSAVRGWLARKHFN----SMQRQKELRNVA  975

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+R+  +EAAL +  +EN +L+E + QF
Sbjct  976   TKSKRKAGRRISEDKDIPLEQPQVQPTSMSDLQKRILKSEAALSQKEEENTALREQLRQF  1035

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------S  396
             +++  EY+ KM+ +E++WQ Q+ S+Q SL AA +                         S
Sbjct  1036  EERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYDS  1095

Query  395   EGVAENGLSRTEPPSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-------NMIT  240
             E     G      P+ +F      +  +  +N  L+  + L +E    +         I 
Sbjct  1096  EDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1155

Query  239   WVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*  69
              VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++   D+G+   
Sbjct  1156  EVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRDTKARLHRV-DGDKGRHRK  1214

Query  68    IW  63
              W
Sbjct  1215  WW  1216



>ref|XP_009603975.1| PREDICTED: myosin-2-like isoform X2 [Nicotiana tomentosiformis]
Length=1157

 Score =   129 bits (325),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 113/350 (32%), Positives = 165/350 (47%), Gaps = 59/350 (17%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI+  ED +   +Q  +E+ Q+C+ GH+AR Y++ELK G I LQSF+RGE AR  Y    
Sbjct  821   QIAALEDVRNQVLQGTLEV-QKCFRGHRARRYFHELKGGVITLQSFIRGEIARNRYN---  876

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP-  636
             T + + V +         +  EQL AV+ +QS IRGWL R + NK     L S + LN  
Sbjct  877   TSVGSKVKVAH-------KNDEQLVAVVQIQSAIRGWLARKDLNK-----LQSAKTLNVD  924

Query  635   --------ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEY  480
                     E+K+   ++  S + DL+RRV   EA L     EN +LKE +  F+ +  EY
Sbjct  925   IPKTGRKMEVKELPREILPSAVEDLERRVLKAEATLGEKEMENVALKEQVNLFEARCLEY  984

Query  479   EAKMQCLEKSWQDQL-------MSIQTSLGAA------SRSEGV-------AENGLSRTE  360
             E KM+ +E+ WQ Q         + + SLGA        + EG        +++  S   
Sbjct  985   EVKMRSMEEMWQKQTASLQASLAAAKNSLGAGDTTGRPGKPEGSPSPRYYDSDDATSMDT  1044

Query  359   PPSERFIPFERSDAGLV----VNNRLDFASPLDQE-NGSHQNM------ITWVKSGHDEP  213
             P     + F  +  G+     VN  L   S L  E     QN       I  +K G    
Sbjct  1045  PAGCTPVKFTNNSLGVGANREVNGGLAIVSHLTLEFEQRKQNFDDEALAIVHLKPGQ---  1101

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             L+ +    +  ++K RF+ WKKDYK RL+  K  + +L     GK+   W
Sbjct  1102  LHSTNPADEYRRLKCRFEEWKKDYKVRLKETKTKVHKLGCSKAGKNRRKW  1151



>ref|XP_008802972.1| PREDICTED: myosin-1-like [Phoenix dactylifera]
Length=1166

 Score =   129 bits (325),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 101/326 (31%), Positives = 167/326 (51%), Gaps = 36/326 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q  + GH+ R Y    ++  I LQSF+RG+ AR+ Y  LV
Sbjct  825   QIGALEDTRNRTLH-GILRVQSFFRGHRVRCYVKRHQQAIITLQSFIRGDKARRMYSVLV  883

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              + RA V +Q+ +K Q +R+  +    A I +QS IRGWL R   +  + +   S+ +++
Sbjct  884   HKHRAAVILQRILKSQTTRKEFVNVRNASIVIQSVIRGWLVRCSGDVILNA---SKTVVD  940

Query  638   PELKDED-IKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              ++ + D + V+ SVL +LQRR+   E+AL    +EN  L + + Q++ +  +YE KM+ 
Sbjct  941   TKVAETDQVPVKSSVLAELQRRILKAESALREKDEENDMLHQRLQQYESRWSDYEQKMRS  1000

Query  461   LEKSWQDQLMSIQTSLGAASRS---EGVAEN-------------------GLSRTEPPSE  348
             +E+ WQ Q+ S+Q+SL  A +S   +GV  N                   GL    PP  
Sbjct  1001  MEEVWQKQMRSLQSSLSIAKKSLALDGVDGNSDGSTDQSFCTNGNLTGTEGLENKGPPLG  1060

Query  347   RFIPFERSDAGLVVNNRLDFASPLDQENG---SHQNMITWVKSGHDEPLNLSPKNSDVHK  177
               +      A L + +RL  A   +Q +         +  VKSG  E  +L+P + ++ K
Sbjct  1061  SRLTGREMSASLNIISRL--AEEFEQRSQVFLDDAKFLVEVKSGQAEA-SLNP-DRELRK  1116

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQL  99
             +K  F+ W+KDY  RL+  K  + +L
Sbjct  1117  LKQTFETWRKDYNLRLRETKVIIHKL  1142



>ref|XP_006657835.1| PREDICTED: myosin-2-like [Oryza brachyantha]
Length=1235

 Score =   129 bits (324),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 110/326 (34%), Positives = 161/326 (49%), Gaps = 50/326 (15%)
 Frame = -3

Query  935   IQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKEQQSR  756
             IQ+ + G   R  Y  LK+GAI+LQSFVRG+ AR  +  +V R RA + IQK+ + + + 
Sbjct  895   IQKNFRGLHTRQEYQGLKKGAIILQSFVRGQKARIHFDHVVKRRRAAIIIQKYARCRLAA  954

Query  755   RL--EQLAAVICLQSGIRGWLTRIEF-------------NKKITSRLNSRQMLNPELKDE  621
              +  +QL  VI LQS IRG L R ++             +K I +R N  Q       + 
Sbjct  955   TIYVDQLKYVIVLQSVIRGCLARNKYKCLKEEKDSKFSQSKVIHARNNVSQARMYHEMNG  1014

Query  620   DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQD  441
             D   Q  V+ +LQ RV+  EAAL    +ENA LK+ + Q++KK  EYEAKM+ +E++W+ 
Sbjct  1015  DYPRQ-PVIGELQGRVSKAEAALRDKEEENAMLKQQLDQYEKKWSEYEAKMKSMEEAWKK  1073

Query  440   QLMSIQTSLGAASR---SEGVAENGLSRTEPPSERFIPFERSDAGLVVNNRLDF------  288
             QL S+Q SL AA +   S+ VA         P+      E +  G       +F      
Sbjct  1074  QLSSLQLSLVAAKKSLTSDDVATRAARTDAAPTHAHYDSEDTSTGTHTPEGTEFKYQTHN  1133

Query  287   -----ASP-----LDQENG-------------SHQNMITWVKSGHDEPLNLSPKNSDVHK  177
                  A+P     L+  N                   +  VKSG     N++P + ++ K
Sbjct  1134  PEARVAAPNSDRRLNAVNHLAKEFEDRRQVFEDDAGFLVAVKSGQVGS-NMNP-DDELRK  1191

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQL  99
             +K RF  WKKDYKSRL+  K  L+++
Sbjct  1192  LKDRFATWKKDYKSRLKETKVNLQKV  1217



>ref|NP_568806.3| myosin 2 [Arabidopsis thaliana]
 gb|AED96478.1| myosin 2 [Arabidopsis thaliana]
Length=1030

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 108/364 (30%), Positives = 175/364 (48%), Gaps = 71/364 (20%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  +++  +VLQS++RGENAR+ +    
Sbjct  680   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSRAYFQNMRKVTLVLQSYIRGENARRLFD---  735

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L+AVI LQS +RGWL R  FN    S    +++ N  
Sbjct  736   ------TEAKFHADSVSEASTDELSAVIHLQSAVRGWLARKHFN----SMQRQKELRNVA  785

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+R+  +EAAL +  +EN +L+E + QF
Sbjct  786   TKSKRKAGRRISEDKDIPLEQPQVQPTSMSDLQKRILKSEAALSQKEEENTALREQLRQF  845

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV---------------------A  384
             +++  EY+ KM+ +E++WQ Q+ S+Q SL AA +S                        +
Sbjct  846   EERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYDS  905

Query  383   ENGLSRTEP----PSERF-------IPFERSDAGLVVNNRLDFASPLDQENGSHQN---M  246
             E+ +S   P    P+ +F       +     +  L   N L  A   DQ   +       
Sbjct  906   EDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLNAVNHL--AREFDQRRLNFDEDARA  963

Query  245   ITWVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             I  VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++   D+G+ 
Sbjct  964   IVEVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRDTKARLHRV-DGDKGRH  1022

Query  74    T*IW  63
                W
Sbjct  1023  RKWW  1026



>ref|NP_194467.5| myosin heavy chain-like protein [Arabidopsis thaliana]
 sp|F4JIU4.1|MYO4_ARATH RecName: Full=Myosin-4; AltName: Full=MYOSIN VIII B; Short=AtVIIIB 
[Arabidopsis thaliana]
 gb|AEE85329.1| myosin heavy chain-like protein [Arabidopsis thaliana]
Length=1134

 Score =   129 bits (324),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 171/340 (50%), Gaps = 61/340 (18%)
 Frame = -3

Query  989   ISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVT  810
             IS+ E+ K+  V +G+  +Q+ + G+Q R Y++ ++  A++LQS++RGENAR++Y  +V 
Sbjct  822   ISVLEERKKY-VLRGILGLQKQFRGYQTREYFHNMRNAAVILQSYIRGENARRNY--IVV  878

Query  809   RLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP--  636
                AIV+         +   ++L A I LQ  +R WL R          LNS Q  N   
Sbjct  879   GESAIVS---------TAITKELDAAIHLQYMVRKWLAR--------KLLNSTQQKNKPR  921

Query  635   ------------------ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYI  510
                               EL  E  +VQ  VL DLQ RV   EAA+ +  DEN +L+E +
Sbjct  922   NEKKKTRRKSTKRVSEDKELLSEQFEVQPCVLADLQSRVLKVEAAIMQKEDENTALQEEL  981

Query  509   LQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR--------SEGV-AENGLSRTEP  357
              +F+++  E E +M+ +E +WQ  + S+Q SL AA +        S G  +E+ +S   P
Sbjct  982   QRFEERWLENETRMKSMEDTWQKHMSSMQMSLAAACKVLAPDKTASHGTDSEDTMSFGTP  1041

Query  356   PSERFIPFERSDAGLVVNNRLDFASPLDQENG-SHQNMITWVKSGHDEPLNLSPKNSDVH  180
               E  +    SD    VNN    ++  DQ +   H++  + V+   D   N      ++ 
Sbjct  1042  TKE--LKGSLSD----VNN---LSTEFDQRSVIIHEDPKSLVEVKSDSISNRKQHAEELR  1092

Query  179   KVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             ++K RF+ WKKDYK+RL+  KA ++   + D G+    WC
Sbjct  1093  RLKSRFEKWKKDYKTRLRETKARVR--LNGDEGRHRNWWC  1130



>emb|CAA84065.1| myosin [Arabidopsis thaliana]
Length=1101

 Score =   129 bits (323),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 171/364 (47%), Gaps = 71/364 (20%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  +++  +VLQS++RGENAR+ +    
Sbjct  751   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSRAYFQNMRKVTLVLQSYIRGENARRLFD---  806

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L+AVI LQS +RGWL R  FN    S    +++ N  
Sbjct  807   ------TEAKFHADSVSEASTDELSAVIHLQSAVRGWLARKHFN----SMQRQKELRNVA  856

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+R+  +EAAL +  +EN +L+E + QF
Sbjct  857   TKSKRKAGRRISEDKDIPLEQPQVQPTSMSDLQKRILKSEAALSQKEEENTALREQLRQF  916

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------S  396
             +++  EY+ KM+ +E++WQ Q+ S+Q SL AA +                         S
Sbjct  917   EERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYDS  976

Query  395   EGVAENGLSRTEPPSERF-------IPFERSDAGLVVNNRLDFASPLDQENGSHQN---M  246
             E     G      P+ +F       +     +  L   N L  A   DQ   +       
Sbjct  977   EDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLNAVNHL--AREFDQRRLNFDEDARA  1034

Query  245   ITWVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             I  VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++   D+G+ 
Sbjct  1035  IVEVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRDTKARLHRV-DGDKGRH  1093

Query  74    T*IW  63
                W
Sbjct  1094  RKWW  1097



>gb|AFW68522.1| hypothetical protein ZEAMMB73_631881 [Zea mays]
Length=1194

 Score =   129 bits (323),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 105/324 (32%), Positives = 167/324 (52%), Gaps = 36/324 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQARH+  E  RG + LQ+F+RGE AR+ Y  L+
Sbjct  856   QIGKLEDTRNRTLH-GILRVQSCFRGHQARHHARERIRGVLALQTFIRGEKARQIYSSLL  914

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRL---NSR  651
              + RA V +Q +++   +RR  +    A + +QSGIRG L R    N  + + L    S+
Sbjct  915   RKHRAAVILQSNLRCWLARRYFINVRKASVIIQSGIRGSLVRRCNGNIDLINVLREFESK  974

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             Q    E + + I ++ SVL +LQRR+   EA +    +EN +L + + Q++ +  EYE K
Sbjct  975   Q----EAEGDQILIKASVLAELQRRILKAEATVREKEEENETLHQRLQQYENRWLEYEQK  1030

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE-----------------NGLSRTEPPSERF  342
             M+ +E+ WQ Q+ S+Q+SL  A +S  + E                 N +S       R 
Sbjct  1031  MKAMEEMWQKQMRSLQSSLSVAKKSLALHETPRMSDSSVDQSWESNGNHVSSGSQLVPRT  1090

Query  341   IPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVK  171
                E S AGL V  RL  A   +Q +         +  VKSG  +  +L+P + ++ ++K
Sbjct  1091  GGREMS-AGLSVIGRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLK  1145

Query  170   LRFKAWKKDYKSRLQVVKATLKQL  99
               F +WKKD+  R++  K  L +L
Sbjct  1146  HNFDSWKKDFSGRIRETKMILNKL  1169



>dbj|BAB10751.1| myosin heavy chain [Arabidopsis thaliana]
Length=1111

 Score =   129 bits (323),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 107/364 (29%), Positives = 171/364 (47%), Gaps = 71/364 (20%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ + GH +R Y+  +++  +VLQS++RGENAR+ +    
Sbjct  761   QIGIFEDRRKKVLQ-GIVGLQKHFRGHLSRAYFQNMRKVTLVLQSYIRGENARRLFD---  816

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         ++L+AVI LQS +RGWL R  FN    S    +++ N  
Sbjct  817   ------TEAKFHADSVSEASTDELSAVIHLQSAVRGWLARKHFN----SMQRQKELRNVA  866

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+R+  +EAAL +  +EN +L+E + QF
Sbjct  867   TKSKRKAGRRISEDKDIPLEQPQVQPTSMSDLQKRILKSEAALSQKEEENTALREQLRQF  926

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR-------------------------S  396
             +++  EY+ KM+ +E++WQ Q+ S+Q SL AA +                         S
Sbjct  927   EERWSEYDIKMKSMEETWQKQMSSLQMSLAAARKSLAAESITGQAGGRQDTSISPFGYDS  986

Query  395   EGVAENGLSRTEPPSERF-------IPFERSDAGLVVNNRLDFASPLDQENGSHQN---M  246
             E     G      P+ +F       +     +  L   N L  A   DQ   +       
Sbjct  987   EDTMSTGTPGVRTPTNKFTNGNTPELRIRELNGSLNAVNHL--AREFDQRRLNFDEDARA  1044

Query  245   ITWVKSGHDEPLNLSPK---NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             I  VK G     N   +     +  ++KLRF+ WKKDYK+RL+  KA L ++   D+G+ 
Sbjct  1045  IVEVKLGPQATPNGQQQQHPEDEFRRLKLRFETWKKDYKARLRDTKARLHRV-DGDKGRH  1103

Query  74    T*IW  63
                W
Sbjct  1104  RKWW  1107



>gb|EEC67214.1| hypothetical protein OsI_34110 [Oryza sativa Indica Group]
Length=1184

 Score =   129 bits (323),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 168/322 (52%), Gaps = 32/322 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR +  E  RG + LQSF+RGENARK Y  L 
Sbjct  846   QIGKLEDTRNRTLH-GILRVQSCFRGHQARRHARERIRGVLALQSFIRGENARKMYSSLA  904

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRLNSRQML  642
              + RA + +Q+++K   +RR  +    A + +QSGIRG L R    N  + + L   +  
Sbjct  905   RKHRAAIILQRNLKCWLARRYFVNIRKASVVIQSGIRGCLVRRCAGNVDLLNVLREFES-  963

Query  641   NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
               E++ + I ++ S L +LQRR+   EA +    +EN  L++ + Q++ +  EYE KM+ 
Sbjct  964   KKEVEGDQILIKASFLAELQRRILKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKA  1023

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP---  336
             +E+ WQ Q+ S+Q+SL  A +S  + E               NG+      + + +P   
Sbjct  1024  MEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWESNGVHIGS--ASQLVPRTV  1081

Query  335   FERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                 +A + V +RL  A   +Q +         +  VKSG  +  +L+P + ++ ++K  
Sbjct  1082  GREMNASISVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLKQN  1137

Query  164   FKAWKKDYKSRLQVVKATLKQL  99
             F +WKKD+ SR++  K  L +L
Sbjct  1138  FDSWKKDFGSRIRETKVILNKL  1159



>ref|NP_001064913.1| Os10g0488800 [Oryza sativa Japonica Group]
 dbj|BAF26827.1| Os10g0488800, partial [Oryza sativa Japonica Group]
Length=950

 Score =   128 bits (322),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 167/322 (52%), Gaps = 32/322 (10%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI   ED +   +  G+  +Q C+ GHQAR +  E  RG + LQSF+RGENARK Y  L 
Sbjct  612  QIGKLEDTRNRTLH-GILRVQSCFRGHQARRHARERIRGVLALQSFIRGENARKMYSSLA  670

Query  812  TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRLNSRQML  642
             + RA + +Q+++K   +RR  +    A + +QSGIRG L R    N  + + L   +  
Sbjct  671  RKHRAAIILQRNLKCWLARRYFVNIRKASVVIQSGIRGCLVRRCAGNVDLLNVLREFES-  729

Query  641  NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              E + + I ++ S L +LQRR+   EA +    +EN  L++ + Q++ +  EYE KM+ 
Sbjct  730  KKEAEGDQILIKASFLAELQRRILKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKA  789

Query  461  LEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP---  336
            +E+ WQ Q+ S+Q+SL  A +S  + E               NG+      + + +P   
Sbjct  790  MEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWESNGVHI--GSASQLVPRTV  847

Query  335  FERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                +A + V +RL  A   +Q +         +  VKSG  +  +L+P + ++ ++K  
Sbjct  848  GREMNASISVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLKQN  903

Query  164  FKAWKKDYKSRLQVVKATLKQL  99
            F +WKKD+ SR++  K  L +L
Sbjct  904  FDSWKKDFGSRIRETKVILNKL  925



>ref|XP_010327147.1| PREDICTED: myosin-2-like isoform X2 [Solanum lycopersicum]
Length=1202

 Score =   128 bits (322),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 112/350 (32%), Positives = 176/350 (50%), Gaps = 54/350 (15%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQ-FL  816
             QI++ ED ++  +Q  +E+ Q+CY G  AR  ++ELK   IVLQSFVRGE AR  Y+ FL
Sbjct  860   QIAVLEDVRKQVLQGTLEV-QKCYSGPHARRDFHELKGVVIVLQSFVRGEIARMQYKDFL  918

Query  815   VTRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP  636
              ++       QK+  ++     EQL A + +QS IR WL   + N+   S+  ++    P
Sbjct  919   ESK-------QKNANKEND---EQLVAALQIQSAIRCWLAHRQLNQLQKSKKLNQDRPKP  968

Query  635   -----ELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
                  E+KD   ++  SV+ DL+RRV V E  LE    ENA+LKE + Q + +  +YEA+
Sbjct  969   AKKTTEVKDLPAEILPSVVEDLERRVLVAETTLEEKEKENAALKEQVNQLESRWSDYEAR  1028

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAENG-----LSRTEPPS---------------  351
             M+ +E+ WQ Q+ S+Q SL +A +S GV  +      L  +  P                
Sbjct  1029  MRSMEEMWQKQMASLQASLVSAKKSLGVDNSASHPGKLEGSPSPCGYESEDTTTTMGTRT  1088

Query  350   -ERFIPFERS------------DAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDEP  213
                  P E +            + GL V N L     L ++N   + + I+ +KSG    
Sbjct  1089  PGGSTPIEYASNGVDFGGIREINGGLCVVNYLSREFELRKQNFDDEALAISQLKSGQ---  1145

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             L  +    D  +++ +F  WKKDYK+RL+  K+ + +L + +  K+   W
Sbjct  1146  LQSTSPAEDFRRLRHKFDEWKKDYKARLKETKSKVHKLGYSEAEKTRRNW  1195



>ref|XP_006661886.1| PREDICTED: myosin-1-like [Oryza brachyantha]
Length=1195

 Score =   128 bits (322),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 164/321 (51%), Gaps = 30/321 (9%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR +  E  RG + LQSF+RGENARK Y  LV
Sbjct  857   QIGKLEDTRNRTLH-GILRVQSCFRGHQARRHARERIRGVLALQSFIRGENARKMYSSLV  915

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRLNSRQML  642
              + RA   +Q+ +K   +RR  +    A + +QSGIRG L R    N  + + L   +  
Sbjct  916   RKHRAATVLQRSLKCWLARRYFINIRKASVVIQSGIRGCLVRRCAGNVDLLNVLREFES-  974

Query  641   NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
               E + + I ++ S L +LQRR+   EA +    +EN  L++ + Q++ +  EYE KM+ 
Sbjct  975   KKEAEGDQILIKASFLAELQRRILKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKA  1034

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE-----------------NGLSRTEPPSERFIPF  333
             +E+ WQ Q+ S+Q+SL  A +S  + E                 N +        R I  
Sbjct  1035  MEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWESNGNHIGSASQLVPRTIGR  1094

Query  332   ERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRF  162
             E  +A + V +RL  A   +Q +         +  VKSG  +  +L+P + ++ ++K  F
Sbjct  1095  EM-NASISVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLKQNF  1149

Query  161   KAWKKDYKSRLQVVKATLKQL  99
              +WKKD+ SR++  K  L +L
Sbjct  1150  DSWKKDFGSRIRETKVILNKL  1170



>gb|AAL31066.1|AC090120_12 putative myosin [Oryza sativa Japonica Group]
 gb|EEE51178.1| hypothetical protein OsJ_31968 [Oryza sativa Japonica Group]
Length=1200

 Score =   128 bits (321),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 167/322 (52%), Gaps = 32/322 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR +  E  RG + LQSF+RGENARK Y  L 
Sbjct  862   QIGKLEDTRNRTLH-GILRVQSCFRGHQARRHARERIRGVLALQSFIRGENARKMYSSLA  920

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRLNSRQML  642
              + RA + +Q+++K   +RR  +    A + +QSGIRG L R    N  + + L   +  
Sbjct  921   RKHRAAIILQRNLKCWLARRYFVNIRKASVVIQSGIRGCLVRRCAGNVDLLNVLREFES-  979

Query  641   NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
               E + + I ++ S L +LQRR+   EA +    +EN  L++ + Q++ +  EYE KM+ 
Sbjct  980   KKEAEGDQILIKASFLAELQRRILKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKA  1039

Query  461   LEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP---  336
             +E+ WQ Q+ S+Q+SL  A +S  + E               NG+      + + +P   
Sbjct  1040  MEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWESNGVHIGS--ASQLVPRTV  1097

Query  335   FERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                 +A + V +RL  A   +Q +         +  VKSG  +  +L+P + ++ ++K  
Sbjct  1098  GREMNASISVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLKQN  1153

Query  164   FKAWKKDYKSRLQVVKATLKQL  99
             F +WKKD+ SR++  K  L +L
Sbjct  1154  FDSWKKDFGSRIRETKVILNKL  1175



>gb|ABB47808.1| Myosin head family protein, expressed [Oryza sativa Japonica 
Group]
Length=995

 Score =   127 bits (320),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 101/322 (31%), Positives = 167/322 (52%), Gaps = 32/322 (10%)
 Frame = -3

Query  992  QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
            QI   ED +   +  G+  +Q C+ GHQAR +  E  RG + LQSF+RGENARK Y  L 
Sbjct  657  QIGKLEDTRNRTLH-GILRVQSCFRGHQARRHARERIRGVLALQSFIRGENARKMYSSLA  715

Query  812  TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRLNSRQML  642
             + RA + +Q+++K   +RR  +    A + +QSGIRG L R    N  + + L   +  
Sbjct  716  RKHRAAIILQRNLKCWLARRYFVNIRKASVVIQSGIRGCLVRRCAGNVDLLNVLREFES-  774

Query  641  NPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQC  462
              E + + I ++ S L +LQRR+   EA +    +EN  L++ + Q++ +  EYE KM+ 
Sbjct  775  KKEAEGDQILIKASFLAELQRRILKAEATVREKDEENEMLQQRLQQYENRWSEYEQKMKA  834

Query  461  LEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP---  336
            +E+ WQ Q+ S+Q+SL  A +S  + E               NG+      + + +P   
Sbjct  835  MEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWESNGVHIG--SASQLVPRTV  892

Query  335  FERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLR  165
                +A + V +RL  A   +Q +         +  VKSG  +  +L+P + ++ ++K  
Sbjct  893  GREMNASISVISRL--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLKQN  948

Query  164  FKAWKKDYKSRLQVVKATLKQL  99
            F +WKKD+ SR++  K  L +L
Sbjct  949  FDSWKKDFGSRIRETKVILNKL  970



>ref|XP_006406435.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
 gb|ESQ47888.1| hypothetical protein EUTSA_v10019925mg [Eutrema salsugineum]
Length=1205

 Score =   128 bits (321),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 108/338 (32%), Positives = 163/338 (48%), Gaps = 63/338 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + ED +   +  G+  +Q  + G+QAR    ELK G  VLQ+F+RGE  RK++  L 
Sbjct  866   QIGVLEDTRNRTLH-GILRVQSSFRGYQARRRLKELKMGISVLQTFIRGERIRKEFAELR  924

Query  812   TRLRAIVTIQKHMKEQQSRRLEQ--LAAVICLQSGIRGWLTR-----IEFNKKITSRLNS  654
              R RA  TIQ  +K + +R+  +    A + +Q+ IRGWL R     I + K   ++ N 
Sbjct  925   RRHRAAATIQSQVKSKIARQQYKGITDASVVIQTAIRGWLVRRCSGDIGWLKSEGTKTN-  983

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
                     +  ++ V+ +VL +LQRRV   EAAL    +EN  L++ + Q++ +  EYE 
Sbjct  984   --------EAGEVLVKATVLSELQRRVLKAEAALREKEEENDILQQRLQQYENRWSEYET  1035

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGV------------------------------A  384
             KM+ +E+ WQ Q+ S+Q+SL  A +S  V                              +
Sbjct  1036  KMKSMEEIWQKQMRSLQSSLSIAKKSLAVEDSARNSDASVNASDATDWDSSSNHFRSQTS  1095

Query  383   ENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEP  213
               G SR + P           AGL V  RL  A   +Q     G     +  VKSG  E 
Sbjct  1096  NGGGSRQQQPM---------SAGLSVIGRL--AEEFEQRAQVFGDDAKFLVEVKSGQVEA  1144

Query  212   LNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              NL+P + ++ ++K  F+ WKKDY  RL+  K  L +L
Sbjct  1145  -NLNP-DRELRRLKQMFETWKKDYGGRLRETKLILSKL  1180



>ref|XP_004510018.1| PREDICTED: unconventional myosin-Va-like [Cicer arietinum]
Length=1187

 Score =   127 bits (320),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 111/338 (33%), Positives = 174/338 (51%), Gaps = 60/338 (18%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED+++  +Q G   IQ+C+ GHQAR ++ EL+ G   LQSF+RGE  R+ +  L 
Sbjct  845   QIDALEDKRKQLLQ-GTIRIQKCFRGHQARSFFCELQNGVTTLQSFIRGEITRRKHGDLE  903

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE---------FNKKITSRL  660
                ++ +TI        S++LE++ A+I LQS IRGWL R +         +++    R 
Sbjct  904   ---KSSITIY-------SKKLEEIHAIILLQSVIRGWLVRRDCSHINKLRKYHENAKPRR  953

Query  659   NSRQMLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKS  489
              SR  + PE+KD   E ++   S L +LQ+RV   EA +E+  +EN  L E + Q ++K 
Sbjct  954   KSRVQM-PEVKDLSKEMVQNLPSALAELQKRVYKAEAIVEQKEEENTELWEQLKQSERKR  1012

Query  488   QEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGL---SRTEPPSERFIPFERSDA  318
              EYE KM+ +E++WQ Q+ S+Q SL AA R+   +EN      R +  S R+  ++  DA
Sbjct  1013  IEYELKMKSMEETWQKQMASLQMSLVAA-RTSLASENSTVQPVRHDVVSPRY--YDSEDA  1069

Query  317   GLVVNNRLDFASPL-------------DQENGSHQNMITWVK-------SGHDE------  216
               + +      +P+              Q NG+   +   +K       + +DE      
Sbjct  1070  SSMGSRTTSGNTPMIKLSSSLSVSDVGRQANGTLTTVSNLMKEFEHRRQTFNDEVKALNE  1129

Query  215   --PLNLSPKNS--DVHKVKLRFKAWKKDYKSRLQVVKA  114
               P   +  NS  ++ K+K RF+ WKK YK RL+  KA
Sbjct  1130  IKPGQSADTNSADELRKLKQRFEGWKKQYKVRLREAKA  1167



>ref|XP_010536994.1| PREDICTED: myosin-2-like isoform X2 [Tarenaya hassleriana]
Length=1189

 Score =   127 bits (319),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 101/315 (32%), Positives = 157/315 (50%), Gaps = 50/315 (16%)
 Frame = -3

Query  932   QRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKEQQSRR  753
             Q+ + G  +R Y+ +L+ GA++LQS++RGEN+R+ Y  ++ R  ++           SR 
Sbjct  872   QKHFRGRWSRQYFRQLRNGAMLLQSYIRGENSRRKYD-VIYRAASV-----------SRA  919

Query  752   L-EQLAAVICLQSGIRGWLTRIEFNK------------KITSRLNSRQMLNPELKDEDIK  612
             + E++ A I LQS +RGWL R +FN             K   R N R   + +L  E ++
Sbjct  920   IAEEITAAIFLQSVVRGWLARNKFNSLQCKKQSHGEKTKPKRRSNRRISEDKDLLQEQVQ  979

Query  611   VQ--RSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQ  438
                  S + +LQRRV   EAAL +  +EN  L+  + QF+ K  +YEAKM+ +E++WQ Q
Sbjct  980   APPPTSAMAELQRRVQKAEAALVQKEEENTELRGQLRQFEAKWSDYEAKMKSVEEAWQKQ  1039

Query  437   LMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQENGS  258
             + S+Q SL AA+R      NG   T P +   +    S+  +         +P    NGS
Sbjct  1040  MASLQMSL-AAARKSLADNNGGHPTRPDTSISLFGYDSEDTVTSIGTPGICTPTKFTNGS  1098

Query  257   HQNMITWV------KSGHDE------PLNLSPKNS----------DVHKVKLRFKAWKKD  144
               ++          K   DE         + P+ S          ++ K+KLRF+ WKKD
Sbjct  1099  LNSVSNLAREFEQRKFSFDEDARSLVEAKMGPQLSISDGQHHPEEELKKLKLRFETWKKD  1158

Query  143   YKSRLQVVKATLKQL  99
             YK+RL+  KA L +L
Sbjct  1159  YKARLRETKARLHRL  1173



>ref|XP_001755337.1| predicted protein [Physcomitrella patens]
 gb|EDQ79817.1| predicted protein [Physcomitrella patens]
Length=1060

 Score =   127 bits (319),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 107/327 (33%), Positives = 162/327 (50%), Gaps = 35/327 (11%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +Q  + + Q  + G++ R  Y  L+   I +QS VRG  AR+ ++ L 
Sbjct  716   QIGHLEDVRLRTLQSVIRV-QALFRGYKDRCNYKHLRMTTIFVQSMVRGAIARRRFELLQ  774

Query  812   TRLRAIVTIQKHMKEQQ-SRRLEQLA-AVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK  + Q  SRR +     ++ LQS +R WL R +     + R  + + + 
Sbjct  775   ERHRAAVMIQKFARRQVVSRRYQSTKEKIVRLQSVVRMWLARKQL---FSQRREAEKKIA  831

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
              E K   IKV  S LL+LQRR  + E AL    ++NA L++ +L ++ +  EYEAKM  +
Sbjct  832   SEKKQATIKVAPSYLLELQRRAVMAEKALREKEEDNAVLRQRLLHYEARWMEYEAKMSSM  891

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAENGL---------------SRTEPP----------  354
             E+ WQ Q+ S+Q S+ AA +S    E+ L               + T  P          
Sbjct  892   EEMWQKQMSSLQLSIAAAKQSLATDEHPLQTPVKDDNDWDDAATNGTRSPDQFTNKYLVT  951

Query  353   -SERFIPFERSDAG-LVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVH  180
              SE   P    DA   VVN+ +       Q      + +  VKSG  E  +L+P++ ++ 
Sbjct  952   GSEYSTPRGDVDAARSVVNHLMREYDHRTQVFNDDVDFLVEVKSGLTEA-HLNPED-ELR  1009

Query  179   KVKLRFKAWKKDYKSRLQVVKATLKQL  99
             K+K+RF  WKKD+K RL+  K  L +L
Sbjct  1010  KLKVRFDTWKKDFKVRLRETKLVLNKL  1036



>dbj|BAJ99526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1257

 Score =   127 bits (319),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 108/352 (31%), Positives = 172/352 (49%), Gaps = 55/352 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q+++ E+ K      G   IQR + G   R  Y+ LK+GA  LQSFVRGE AR  + +L 
Sbjct  897   QVAVLENGKNRMFH-GALRIQRNFRGLHTRREYHTLKKGATALQSFVRGEKARFRFDYLF  955

Query  812   TRLRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA V IQK+ + + +  +  +QL  ++ LQS +RG L R +F  K        +++N
Sbjct  956   KRWRAAVLIQKYTRRRLAATMFTDQLKNIVVLQSVMRGCLARKKF--KCLQEEKESKVIN  1013

Query  638   PELKDE---------------DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQ  504
              ++K +                +  ++ V+ +LQ RV+  EA L    +ENA LK+ + Q
Sbjct  1014  IKVKRDVRNNISQAGLCHEMNGVYPRQPVVTELQGRVSEAEALLRDKEEENAMLKQQLEQ  1073

Query  503   FDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENGLSRTEPPSERFIP  336
             ++ K  EYEAKM+ +E++W+ QL S+Q SL AA +S    + V     + T P   ++  
Sbjct  1074  YENKWSEYEAKMKVMEEAWKKQLSSLQLSLVAAKKSLASDDMVIRAARTDTTPTHAQYDS  1133

Query  335   FERSDAG-------------------LVVNN---RLDFASPLDQEN-------GSHQNMI  243
              +    G                   +V  N   R++  + L +E              +
Sbjct  1134  EDTMSTGTHTPEGTELKFQNHNPEPRVVTGNSDRRINVVNHLAKEFEDRRQVFDDDAGFL  1193

Query  242   TWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCD  87
               VKSG     N++P + ++ K+K RF  WKKDYKSRL+  K  L+++   D
Sbjct  1194  VAVKSGQIGS-NMNP-DDELRKLKDRFATWKKDYKSRLKETKVNLQKVSSHD  1243



>ref|XP_004248278.1| PREDICTED: myosin-2-like isoform X1 [Solanum lycopersicum]
Length=1203

 Score =   126 bits (317),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 111/351 (32%), Positives = 175/351 (50%), Gaps = 55/351 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQ-FL  816
             QI++ ED ++  +Q  +E+ Q+CY G  AR  ++ELK   IVLQSFVRGE AR  Y+ FL
Sbjct  860   QIAVLEDVRKQVLQGTLEV-QKCYSGPHARRDFHELKGVVIVLQSFVRGEIARMQYKDFL  918

Query  815   VTRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNP  636
              ++       QK+  ++     EQL A + +QS IR WL   + N+   S+  ++    P
Sbjct  919   ESK-------QKNANKEND---EQLVAALQIQSAIRCWLAHRQLNQLQKSKKLNQDRPKP  968

Query  635   ELKDEDIK------VQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
               K  ++K      +  SV+ DL+RRV V E  LE    ENA+LKE + Q + +  +YEA
Sbjct  969   AKKTTEVKQDLPAEILPSVVEDLERRVLVAETTLEEKEKENAALKEQVNQLESRWSDYEA  1028

Query  473   KMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG-----LSRTEPPS--------------  351
             +M+ +E+ WQ Q+ S+Q SL +A +S GV  +      L  +  P               
Sbjct  1029  RMRSMEEMWQKQMASLQASLVSAKKSLGVDNSASHPGKLEGSPSPCGYESEDTTTTMGTR  1088

Query  350   --ERFIPFERS------------DAGLVVNNRLDFASPLDQENGSHQNM-ITWVKSGHDE  216
                   P E +            + GL V N L     L ++N   + + I+ +KSG   
Sbjct  1089  TPGGSTPIEYASNGVDFGGIREINGGLCVVNYLSREFELRKQNFDDEALAISQLKSGQ--  1146

Query  215   PLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
              L  +    D  +++ +F  WKKDYK+RL+  K+ + +L + +  K+   W
Sbjct  1147  -LQSTSPAEDFRRLRHKFDEWKKDYKARLKETKSKVHKLGYSEAEKTRRNW  1196



>gb|KFK29252.1| hypothetical protein AALP_AA7G109000 [Arabis alpina]
Length=1094

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 175/323 (54%), Gaps = 51/323 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + E+ +++ V + +  +Q+ + G+Q+R Y++ ++   +++QS++RGEN R++Y  +V
Sbjct  778   QIGVLEERRKI-VMRSILGLQKKFRGYQSREYFHNMRNATMIIQSYIRGENDRRNY--IV  834

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                 AIV+         S  +E+L A+I LQS +RGWL R    K + +R+  ++    E
Sbjct  835   VEKEAIVS---------SSIIEELDALIHLQSMVRGWLVR----KHLKNRMQQKKPSPNE  881

Query  632   ------------LKDEDI---KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFD  498
                         L+D+DI   +VQ  V+ DLQ RV   EAA+ +  DEN +L+E + +F+
Sbjct  882   KKKPRRKFRRRILEDKDIILEQVQPWVVADLQNRVLKVEAAIMQKEDENTNLQEELQRFE  941

Query  497   KKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFI---PFER  327
              +  E+E +M+ +E++ Q  + S+Q SL AA +   V +N +       E      P E 
Sbjct  942   VRWLEHETRMKLMEETLQKHMSSMQMSLAAACKIL-VPDNTVDDGNDSEETIFLATPTEE  1000

Query  326   SDAGL-VVNN-RLDFAS---PLDQENGSHQNMITWVKSGHDEPLNLSPK----NSDVHKV  174
              +  L VVNN  ++F       D++   H ++         EP ++S +      ++ K+
Sbjct  1001  LNGSLNVVNNISIEFNQRKVVFDEDVKCHVDVKL-------EPESVSIRKQHAGEELSKL  1053

Query  173   KLRFKAWKKDYKSRLQVVKATLK  105
             KLRF+ WKKDYK+RL+  KA L+
Sbjct  1054  KLRFEKWKKDYKARLRGTKARLR  1076



>gb|EMT12170.1| Myosin-J heavy chain [Aegilops tauschii]
Length=1293

 Score =   126 bits (316),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/310 (32%), Positives = 162/310 (52%), Gaps = 33/310 (11%)
 Frame = -3

Query  947   GVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKE  768
             GV  +Q C+ G+QAR + +E  RG + LQSF+R ENAR+ Y  L+ + RA   +QK+++ 
Sbjct  960   GVLRVQSCFRGYQARRHASERSRGVLALQSFIRAENARQSYSSLLRKHRAATLVQKNLRG  1019

Query  767   QQSRR--LEQLAAVICLQSGIRGWLT-RIEFNKKITSRLNSRQMLNPELKDED-IKVQRS  600
              ++RR  ++   A + +QSGIRG L  R   N  + + L  R+  + +  D D I ++ S
Sbjct  1020  WRARRYFIKIRKASVVIQSGIRGCLVRRCAGNVDLLNVL--REFESKKEADGDQILIKAS  1077

Query  599   VLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQT  420
              L +LQRR+   EA +    +EN  L + + Q++ +  EYE KM+ +E+ WQ Q+ S+Q+
Sbjct  1078  FLAELQRRILRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQS  1137

Query  419   SLGAASRSEGVAE--------------------NGLSRTEPPSERFIPFERSDAGLVVNN  300
             SL  A +S  + E                     G S  +  +   I     +A + V  
Sbjct  1138  SLSVAKKSLALDETPRMSDSSVEQSWESNGNHVGGGSSQQLAAAPRITGREMNASMSVIG  1197

Query  299   RLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRL  129
             RL  A  L+Q +         +  VKSG  +  +L+P + ++ ++K  F +WKKD+ SR+
Sbjct  1198  RL--AEELEQRSQVFADDAKFLVEVKSGQADA-SLNP-DVELRRLKQNFDSWKKDFGSRI  1253

Query  128   QVVKATLKQL  99
             +  K  L +L
Sbjct  1254  RETKVILNKL  1263



>gb|KFK29251.1| hypothetical protein AALP_AA7G109000 [Arabis alpina]
Length=1085

 Score =   125 bits (315),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 101/323 (31%), Positives = 175/323 (54%), Gaps = 51/323 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + E+ +++ V + +  +Q+ + G+Q+R Y++ ++   +++QS++RGEN R++Y  +V
Sbjct  769   QIGVLEERRKI-VMRSILGLQKKFRGYQSREYFHNMRNATMIIQSYIRGENDRRNY--IV  825

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                 AIV+         S  +E+L A+I LQS +RGWL R    K + +R+  ++    E
Sbjct  826   VEKEAIVS---------SSIIEELDALIHLQSMVRGWLVR----KHLKNRMQQKKPSPNE  872

Query  632   ------------LKDEDI---KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFD  498
                         L+D+DI   +VQ  V+ DLQ RV   EAA+ +  DEN +L+E + +F+
Sbjct  873   KKKPRRKFRRRILEDKDIILEQVQPWVVADLQNRVLKVEAAIMQKEDENTNLQEELQRFE  932

Query  497   KKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFI---PFER  327
              +  E+E +M+ +E++ Q  + S+Q SL AA +   V +N +       E      P E 
Sbjct  933   VRWLEHETRMKLMEETLQKHMSSMQMSLAAACKIL-VPDNTVDDGNDSEETIFLATPTEE  991

Query  326   SDAGL-VVNN-RLDFAS---PLDQENGSHQNMITWVKSGHDEPLNLSPK----NSDVHKV  174
              +  L VVNN  ++F       D++   H ++         EP ++S +      ++ K+
Sbjct  992   LNGSLNVVNNISIEFNQRKVVFDEDVKCHVDVKL-------EPESVSIRKQHAGEELSKL  1044

Query  173   KLRFKAWKKDYKSRLQVVKATLK  105
             KLRF+ WKKDYK+RL+  KA L+
Sbjct  1045  KLRFEKWKKDYKARLRGTKARLR  1067



>ref|XP_004982778.1| PREDICTED: myosin-J heavy chain-like isoform X2 [Setaria italica]
Length=1194

 Score =   125 bits (315),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 104/325 (32%), Positives = 165/325 (51%), Gaps = 38/325 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR++  E  RG + LQSF+RGENAR+ Y  L 
Sbjct  856   QIGKLEDTRNRTLH-GILRVQSCFRGHQARYHARERIRGVLDLQSFIRGENARQIYSSLS  914

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLA--AVICLQSGIRGWLTR-IEFNKKITSRL---NSR  651
              + RA + +Q+ ++   +RR       A + +QSGIRG L R    N  + + L    S+
Sbjct  915   RKHRAAIILQRSVRCWLARRYFTNIRRASVVIQSGIRGSLVRRCNGNIDLINVLREFESK  974

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
             Q    E + + I ++ SVL +LQRR+   EA +    +EN  L + + Q++ +  EYE K
Sbjct  975   Q----EAEGDQILIKASVLAELQRRILKAEATVREKDEENEMLHQRLQQYENRWLEYEQK  1030

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAE---------------NGLSRTEPPSERFIP  336
             M+ +E+ WQ Q+ S+Q+SL  A +S  + E               NG         + +P
Sbjct  1031  MKAMEEMWQKQMRSLQSSLSVAKKSLALDETPRMSDSSVDQSWEING--NHVGSGSQLVP  1088

Query  335   FERS---DAGLVVNNRLDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKV  174
                    +AGL V NRL      +Q +         I  VKSG  +  +L+P + ++ ++
Sbjct  1089  RTTGREMNAGLSVINRL--TEEFEQRSQVFADDATFIVEVKSGQADA-SLNP-DMELRRL  1144

Query  173   KLRFKAWKKDYKSRLQVVKATLKQL  99
             K  F +WKKD+  R++  K  L +L
Sbjct  1145  KQNFDSWKKDFGGRIRETKVILNKL  1169



>emb|CAB81387.1| myosin heavy chain-like protein [Arabidopsis thaliana]
Length=975

 Score =   125 bits (314),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 105/340 (31%), Positives = 171/340 (50%), Gaps = 61/340 (18%)
 Frame = -3

Query  989  ISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVT  810
            IS+ E+ K+  V +G+  +Q+ + G+Q R Y++ ++  A++LQS++RGENAR++Y  +V 
Sbjct  663  ISVLEERKKY-VLRGILGLQKQFRGYQTREYFHNMRNAAVILQSYIRGENARRNY--IVV  719

Query  809  RLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPEL  630
               AIV+         +   ++L A I LQ  +R WL R          LNS Q  N   
Sbjct  720  GESAIVS---------TAITKELDAAIHLQYMVRKWLAR--------KLLNSTQQKNKPR  762

Query  629  KDE--------------------DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYI  510
             ++                    D+ VQ  VL DLQ RV   EAA+ +  DEN +L+E +
Sbjct  763  NEKKKTRRKSTKRVSEDKVVFLPDVCVQPCVLADLQSRVLKVEAAIMQKEDENTALQEEL  822

Query  509  LQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR--------SEGV-AENGLSRTEP  357
             +F+++  E E +M+ +E +WQ  + S+Q SL AA +        S G  +E+ +S   P
Sbjct  823  QRFEERWLENETRMKSMEDTWQKHMSSMQMSLAAACKVLAPDKTASHGTDSEDTMSFGTP  882

Query  356  PSERFIPFERSDAGLVVNNRLDFASPLDQENG-SHQNMITWVKSGHDEPLNLSPKNSDVH  180
              E  +    SD    VNN    ++  DQ +   H++  + V+   D   N      ++ 
Sbjct  883  TKE--LKGSLSD----VNN---LSTEFDQRSVIIHEDPKSLVEVKSDSISNRKQHAEELR  933

Query  179  KVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
            ++K RF+ WKKDYK+RL+  KA ++   + D G+    WC
Sbjct  934  RLKSRFEKWKKDYKTRLRETKARVR--LNGDEGRHRNWWC  971



>ref|XP_003562871.1| PREDICTED: myosin-3 [Brachypodium distachyon]
Length=1251

 Score =   125 bits (314),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 109/336 (32%), Positives = 159/336 (47%), Gaps = 60/336 (18%)
 Frame = -3

Query  935   IQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKEQQSR  756
             IQ+ + G   R  Y+ LK+GA  LQSFVRGE  R  + +L  R RA V IQK+ + + + 
Sbjct  909   IQKNFRGMHTRQEYHRLKKGATTLQSFVRGEKTRFQFDYLFKRWRAAVVIQKYSRRRLAA  968

Query  755   RL--EQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPELKD--EDIKVQR-----  603
              +  EQL  ++ LQS +RG L R  F K +     SR + N   +D  + I  +R     
Sbjct  969   TMFTEQLKDIVLLQSVMRGCLARRRF-KCLQEERESRVIQNKVKRDARKSISQERICHET  1027

Query  602   -------SVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQ  444
                     V+ +LQ RV   EA L+   +ENA LK+ + Q++ K  EYEAKM+ +E++W+
Sbjct  1028  NGEYAPQPVVTELQGRVLKAEALLQDKEEENAMLKQQLEQYENKWSEYEAKMKSMEEAWK  1087

Query  443   DQLMSIQTSLGAASR------------------------SEGVAENGLSRTEPPSERF--  342
              QL S+Q SL AA +                        SE     G    E    ++  
Sbjct  1088  KQLSSLQLSLVAAKKSLTSDDMATRAARTDTIPTHAQYDSEDTMSTGTHTPEAAELKYQN  1147

Query  341   ------IPFERSDAGLVVNNRL-----DFASPLDQENGSHQNMITWVKSGHDEPLNLSPK  195
                   +    SD  + V N L     D     D + G     +  VKSG     N++P 
Sbjct  1148  HNPEARVATGNSDRRINVVNHLAKEFEDRRQVFDDDAG----FLVAVKSGQIGS-NMNP-  1201

Query  194   NSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCD  87
             + ++ K+K RF  WKKDYKSRL+  K  L+++   D
Sbjct  1202  DDELRKLKDRFATWKKDYKSRLKETKVNLQKVGGHD  1237



>emb|CAA19731.1| myosin heavy chain-like protein [Arabidopsis thaliana]
Length=1126

 Score =   125 bits (314),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 105/340 (31%), Positives = 171/340 (50%), Gaps = 61/340 (18%)
 Frame = -3

Query  989   ISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVT  810
             IS+ E+ K+  V +G+  +Q+ + G+Q R Y++ ++  A++LQS++RGENAR++Y  +V 
Sbjct  814   ISVLEERKKY-VLRGILGLQKQFRGYQTREYFHNMRNAAVILQSYIRGENARRNY--IVV  870

Query  809   RLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPEL  630
                AIV+         +   ++L A I LQ  +R WL R          LNS Q  N   
Sbjct  871   GESAIVS---------TAITKELDAAIHLQYMVRKWLAR--------KLLNSTQQKNKPR  913

Query  629   KDE--------------------DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYI  510
              ++                    D+ VQ  VL DLQ RV   EAA+ +  DEN +L+E +
Sbjct  914   NEKKKTRRKSTKRVSEDKVVFLPDVCVQPCVLADLQSRVLKVEAAIMQKEDENTALQEEL  973

Query  509   LQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASR--------SEGV-AENGLSRTEP  357
              +F+++  E E +M+ +E +WQ  + S+Q SL AA +        S G  +E+ +S   P
Sbjct  974   QRFEERWLENETRMKSMEDTWQKHMSSMQMSLAAACKVLAPDKTASHGTDSEDTMSFGTP  1033

Query  356   PSERFIPFERSDAGLVVNNRLDFASPLDQENG-SHQNMITWVKSGHDEPLNLSPKNSDVH  180
               E  +    SD    VNN    ++  DQ +   H++  + V+   D   N      ++ 
Sbjct  1034  TKE--LKGSLSD----VNN---LSTEFDQRSVIIHEDPKSLVEVKSDSISNRKQHAEELR  1084

Query  179   KVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             ++K RF+ WKKDYK+RL+  KA ++   + D G+    WC
Sbjct  1085  RLKSRFEKWKKDYKTRLRETKARVR--LNGDEGRHRNWWC  1122



>ref|XP_002975651.1| hypothetical protein SELMODRAFT_103418 [Selaginella moellendorffii]
 gb|EFJ23280.1| hypothetical protein SELMODRAFT_103418 [Selaginella moellendorffii]
Length=1045

 Score =   125 bits (313),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 107/335 (32%), Positives = 163/335 (49%), Gaps = 47/335 (14%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI++ E EK+     G+   Q  Y G++AR Y+  L+R  ++ QS VRG  AR  ++ L 
Sbjct  715   QIAVLE-EKRTRTMNGIVGAQALYRGYRARLYFKRLRRSTVLWQSLVRGMQARAMFKKLK  773

Query  812   TRLRAIVTIQKHMKEQQSRR-----LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQ  648
              R RA + IQKH+K   +R      L +  A + +Q   +G + R E  +          
Sbjct  774   QRHRAAIFIQKHVKGILARASYKDLLRRHHATLTIQRHFKGLVARNELRR----------  823

Query  647   MLNPELKDEDIKVQRSV---LLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYE  477
                  LK  ++   R++   LL  ++R  V E A+     ENA++   + Q++++  EYE
Sbjct  824   -----LKRRNVAANRALAAELLAWKQRALVAEQAVWDKDVENAAMAHKLQQYEQRWSEYE  878

Query  476   AKMQCLEKSWQDQLMSIQTSLGAASRS----EGVAENGLSRTEPP---------------  354
             A+M  +E+ WQ Q+ S+Q SL AA RS    + V E+  S T  P               
Sbjct  879   ARMNAMEEVWQKQMTSLQQSLAAAKRSLTSEDPVPESATSVTPEPGFITASTTATSNQTS  938

Query  353   SERFIPFERS-DAG-LVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVH  180
             S+    F R  DAG  VV   +       Q      + +  VKSG  E  NLSP++ ++ 
Sbjct  939   SDNHSNFPRDFDAGKSVVGQLVKEYEHRTQVFNDDADFLVEVKSGQVEA-NLSPED-ELK  996

Query  179   KVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
             K+K RF  WKKD+K RL+  K  L++L H D  +S
Sbjct  997   KLKHRFDVWKKDFKGRLRETKVILQKLSHVDEERS  1031



>gb|EEC82270.1| hypothetical protein OsI_26483 [Oryza sativa Indica Group]
Length=1245

 Score =   125 bits (313),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 107/326 (33%), Positives = 155/326 (48%), Gaps = 50/326 (15%)
 Frame = -3

Query  935   IQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKEQ--Q  762
             IQ+ + G   R  Y  LK+GA+ LQSF+RGE AR  +  LV R +A V IQK+ + +   
Sbjct  907   IQKNFRGLCTRQEYQGLKKGAMTLQSFIRGEKARVHFDHLVKRWKASVLIQKYARRRIAA  966

Query  761   SRRLEQLAAVICLQSGIRGWLTRIEFN-------------KKITSRLNSRQMLNPELKDE  621
             +  ++QL  V+ LQS +RG L R ++              K I  R N  Q       + 
Sbjct  967   TMFIDQLKYVVLLQSVMRGCLARKKYKCLKEEKDSKASHRKVIHVRNNVSQARMYHETNG  1026

Query  620   DIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQD  441
             D   Q  V+ +LQ RV+  EAAL    +EN  LK+ + Q++KK  EYEAKM+ +E++W+ 
Sbjct  1027  DYPRQ-PVITELQGRVSKAEAALRDKEEENEILKQQLDQYEKKWSEYEAKMKSMEEAWKK  1085

Query  440   QLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSDAGLVVNNRLDF------  288
             QL S+Q SL AA +S   E VA         P       E +  G       +F      
Sbjct  1086  QLSSLQLSLVAAKKSLTAEDVASRAARTDAAPMHAHYDSEDTSTGTHTPEGTEFKYQNHN  1145

Query  287   -----ASPLDQENGSHQN------------------MITWVKSGHDEPLNLSPKNSDVHK  177
                  A+P      +  N                   +  VKSG     N++P + ++ K
Sbjct  1146  SEARVAAPNSDRRINAVNHLAKEFEDRRQVFEDDAGFLVAVKSGQVGS-NMNP-DDELRK  1203

Query  176   VKLRFKAWKKDYKSRLQVVKATLKQL  99
             +K RF  WKKDYKSRL+  K  L+++
Sbjct  1204  LKDRFATWKKDYKSRLKETKVNLQKV  1229



>gb|KHG19058.1| Myosin-2 heavy chain [Gossypium arboreum]
Length=1038

 Score =   124 bits (311),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 121/358 (34%), Positives = 177/358 (49%), Gaps = 68/358 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QIS  ED ++  V +GV  +Q+ + GH+AR  ++E  +GA +    V GEN R+ Y    
Sbjct  693   QISALEDRRK-QVLRGVIEVQKYFRGHRARRLFHEHNKGAKI----VCGENIRRKYAAES  747

Query  812   TRLRAIVTIQKHMKEQQSRRL-EQLAAVICLQSGIRGWLTRIEFN------KKITSRLNS  654
              R  A            S+ L EQL AVI LQS IRGWL R  FN      +     + S
Sbjct  748   NRCSAFA----------SQLLDEQLTAVIYLQSVIRGWLARRHFNNMHNLKQSNHGSVKS  797

Query  653   RQMLNP---ELKD----EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDK  495
             R+ +     E KD    + I+V  SV+ +LQRRV   E  L +   ENA+L+E + + + 
Sbjct  798   RRKIGRKIFEAKDMPHEQQIQVLPSVMAELQRRVLKAETNLRQKEQENATLREQLQKSEA  857

Query  494   KSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG---LSRTEPPSERFIPFE--  330
             +  +YEAKM+ +E+ WQ Q++S+QTSL AA +S   A+NG   L R +  S R    E  
Sbjct  858   RWLDYEAKMKSMEEMWQKQMVSLQTSLTAARKSL-AADNGAGQLGRADVLSPRCYDSEDN  916

Query  329   -----RSDAGLVVNNRLDFASPL-----DQENGS--------------HQNMITWVKSGH  222
                  R+  G   N  + F+  +      +ENGS               QN     KS  
Sbjct  917   VSMGSRTTGG---NTPVLFSGAMPDVVGGRENGSLNALGNLLKEFEQRKQNFDADAKSLI  973

Query  221   D-----EPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IW  63
             D     +  N++P + ++  ++LRF+ WKKDYK RL+  KA L +  H +  K+   W
Sbjct  974   DIRVPQQASNVNP-DDELRTLRLRFETWKKDYKLRLKAAKARLHKRGHPESDKARRKW  1030



>ref|XP_003574095.1| PREDICTED: myosin-1-like [Brachypodium distachyon]
Length=1190

 Score =   124 bits (310),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 96/309 (31%), Positives = 157/309 (51%), Gaps = 35/309 (11%)
 Frame = -3

Query  947   GVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKE  768
             GV  +Q C+ GHQAR +  E  RG + LQSF+RGEN R+ Y  L+ + RA   +Q++++ 
Sbjct  865   GVLRVQSCFRGHQARRHARERIRGVLALQSFIRGENERQSYSSLLRKHRAATVVQRNLRG  924

Query  767   QQSRR--LEQLAAVICLQSGIRGWLTR-IEFNKKITSRLNSRQMLNPELKDEDIKVQRSV  597
               +RR  ++   A + +QSGIRG L R    N  + + L   +    E + + I ++ S 
Sbjct  925   WLARRYFIKIRKASVVIQSGIRGCLVRRCAGNVDLLNVLREFES-KKEAEGDQILIKASF  983

Query  596   LLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQTS  417
             L +LQRR+   EA +    +EN  L + + Q++ +  EYE KM+ +E+ WQ Q+ S+Q+S
Sbjct  984   LAELQRRILRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSS  1043

Query  416   LGAASRSEGVAE--------------------NGLSRTEPPSERFIPFERSDAGLVVNNR  297
             L  A +S  + E                     G S+  P     I     +A + V  R
Sbjct  1044  LSVAKKSLALDETPRMSDSSVEQSWESNGNHVGGGSQLVPR----ITGREMNASISVIGR  1099

Query  296   LDFASPLDQEN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQ  126
             L  A   +Q +         +  VKSG  +  +L+P + ++ ++K  F +WKKD+ SR++
Sbjct  1100  L--AEEFEQRSQVFADDAKFLVEVKSGQADA-SLNP-DMELRRLKQNFDSWKKDFSSRIR  1155

Query  125   VVKATLKQL  99
               K  L +L
Sbjct  1156  ETKVILNKL  1164



>ref|XP_008797209.1| PREDICTED: LOW QUALITY PROTEIN: myosin-1-like [Phoenix dactylifera]
Length=1193

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 99/327 (30%), Positives = 170/327 (52%), Gaps = 38/327 (12%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR    E ++  + LQSF+RG+  R+ Y  L+
Sbjct  851   QIGALEDTRNRTLH-GILRVQSCFRGHQARRLVKERRKAIVTLQSFIRGKKTRQIYSGLL  909

Query  812   TRLRAIVTIQKHMKEQQSRR--LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN  639
              R RA + +Q+++K Q +R+  ++   A + +QS IRG L R          LN+ + L 
Sbjct  910   QRHRAAIVLQRYVKCQSARKSFIDVRNATVTIQSVIRGRLVRRCSGD--VGLLNTAKKLE  967

Query  638   PELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCL  459
                + ++++V+ S L +LQRR+   EAAL    +EN  L + + Q++ +  EYE KM+ +
Sbjct  968   GTKESDEVQVKASFLAELQRRILKAEAALRVKEEENDILHQRLQQYESRWLEYEQKMRSM  1027

Query  458   EKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSE-----------------------  348
             E+ WQ Q+ S+Q+SL  A +S   A++   R++   +                       
Sbjct  1028  EEVWQKQMRSLQSSLSIAKKSLA-ADDAARRSDASVDQSWDSNGNHIGTRGREGSHTRLG  1086

Query  347   -RFIPFERSDAGLVVNNRLDFASPLDQENGSHQNMITW---VKSGHDEPLNLSPKNSDVH  180
              R +  + S AGL   +RL  A   +Q +    + + +   VKSG  E  NL+P+  ++ 
Sbjct  1087  SRVLDRDMS-AGLGAISRL--AEEFEQRSQVFADDVKFLVEVKSGQAEA-NLNPEK-ELR  1141

Query  179   KVKLRFKAWKKDYKSRLQVVKATLKQL  99
             ++K  F++WKKD+  RL+  K+   +L
Sbjct  1142  RLKQNFESWKKDFSMRLRETKSIAHKL  1168



>ref|XP_002867507.1| hypothetical protein ARALYDRAFT_492062 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43766.1| hypothetical protein ARALYDRAFT_492062 [Arabidopsis lyrata subsp. 
lyrata]
Length=1155

 Score =   123 bits (309),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 105/341 (31%), Positives = 177/341 (52%), Gaps = 73/341 (21%)
 Frame = -3

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             +E++  V +G+  +Q+ + G+QAR  ++ ++  A++LQS++RGENAR++Y  +V +  AI
Sbjct  848   EERRKYVLRGILGLQKQFRGYQARECFHNMRNAAVILQSYIRGENARRNY--IVVKESAI  905

Query  794   VTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN----------------KKITSR  663
             V+         +   E+L A I LQ  +R WL R   N                +K T R
Sbjct  906   VS---------TAITEELDAAIHLQYMVRKWLARKHLNSMQQKKKPRNEKKQPRRKSTRR  956

Query  662   LN-SRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             ++  + +  P+L D        VL DLQ RV   EAA+ +  DEN +L+E + +F+++  
Sbjct  957   VSEDKVVFFPDLCDPP-----CVLADLQSRVQKVEAAIMQKEDENTALQEELQRFEERWL  1011

Query  485   EYEAKMQCLEKSWQDQLMSIQTSLGAASR--------SEG-VAENGLSRTEPPSERFIPF  333
             E EA+M+ +E++WQ  + S+Q SL AA +        S+G  +E+ +S   P  E     
Sbjct  1012  ENEARMKSMEETWQKHMSSMQMSLAAACKILAPDKTASQGNESEDTMSFGTPTKE----L  1067

Query  332   ERSDAGLVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNS----------DV  183
             +RS +   VNN    +   DQ     +++I      H++  +L   NS          ++
Sbjct  1068  KRSLSE--VNN---LSREFDQ-----RSVII-----HEDAKSLVEVNSQSSSRKQHAEEL  1112

Query  182   HKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
              ++KLRF+ WKKDYK+RL+  KA ++   + D G+    WC
Sbjct  1113  RRLKLRFEKWKKDYKARLRETKARIRS--NGDEGRHRNWWC  1151



>ref|XP_010448147.1| PREDICTED: myosin-4-like [Camelina sativa]
Length=1104

 Score =   122 bits (307),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 97/309 (31%), Positives = 157/309 (51%), Gaps = 34/309 (11%)
 Frame = -3

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             +E++  V  G+  +Q+ + G++ R YY+ +K  A++LQS++RGE+AR++Y  +V    AI
Sbjct  794   EERKKYVLCGILGLQKKFRGYKTREYYHNMKNAAVMLQSYIRGEHARRNY--IVVGGSAI  851

Query  794   VTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN------------KKITSRLNSR  651
             V             +E+L AVI LQ  +R WL R   N            K+   +L  R
Sbjct  852   VP---------PATIEELDAVIHLQYVVRKWLARKHLNSIKQKKKSCNEKKRPRRKLTRR  902

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
                + +L  +  +VQ     DLQ RV   EAA+ +  DEN +L+E + +F+++  E E K
Sbjct  903   NSKDKDLILQQFQVQPWAFADLQSRVQKVEAAIMQKEDENTALQEELQRFEERWLENETK  962

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAGLVVNNRLD  291
             M+ +E+ WQ  + S+Q SL AA +   +A N  +     SE  + F      L   + L 
Sbjct  963   MKSMEEIWQKHMSSMQVSLAAACKI--LASNKTASHGNDSEDTMSFGTPTKEL--KDSLS  1018

Query  290   FASPLDQENGSHQNMI-----TWVKSG--HDEPLNLSPKNSDVHKVKLRFKAWKKDYKSR  132
              A+ L  E+     +I     + V+ G   D   N +    ++ ++KLRF+ WKKDYK+R
Sbjct  1019  DANNLSTESDQRSVIINEDAKSLVEVGLEPDSSSNRTQHAEELRRLKLRFEKWKKDYKAR  1078

Query  131   LQVVKATLK  105
             L   K  L+
Sbjct  1079  LSETKTRLR  1087



>ref|XP_002978834.1| hypothetical protein SELMODRAFT_109322 [Selaginella moellendorffii]
 gb|EFJ20281.1| hypothetical protein SELMODRAFT_109322 [Selaginella moellendorffii]
Length=1052

 Score =   122 bits (306),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 161/332 (48%), Gaps = 34/332 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI++ E EK+     G+   Q  Y G++AR Y+  L+R  ++ QS VRG   R  ++ L 
Sbjct  715   QIAVLE-EKRTRTLNGIVGAQALYRGYRARLYFKRLRRSTVLWQSLVRGMQVRAMFKKLK  773

Query  812   TRLRAIVTIQKHMKEQQSRR-----LEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQ  648
              R RA + IQKH+K   SR      L +  A + +Q   +G + R E       RL  R 
Sbjct  774   QRHRAAIFIQKHVKGIFSRASYKDLLRRHHATLTIQRHFKGLVARNELR-----RLKRRN  828

Query  647   MLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
             +        + +   + LL  ++R  V E A+     ENA++   + Q++++  EYEA+M
Sbjct  829   VAAIVDSGHENRALAAELLAWKQRALVAEQAVWDKDVENAAMVHKLQQYEQRWSEYEARM  888

Query  467   QCLEKSWQDQLMSIQTSLGAASRS----EGVAENGLSRTEPP---------------SER  345
               +E+ WQ Q+ S+Q SL AA RS    + V E+  S T  P               S+ 
Sbjct  889   NAMEEVWQKQMTSLQQSLAAAKRSLTSEDPVPESATSVTPEPGFITASTTATSNQTSSDN  948

Query  344   FIPFERS-DAG-LVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVK  171
                F R  DAG  VV   +       Q      + +  VKSG  E  NLSP++ ++ K+K
Sbjct  949   HSNFPRDFDAGKSVVGQLVKEYEHRTQVFNDDADFLVEVKSGQVEA-NLSPED-ELKKLK  1006

Query  170   LRFKAWKKDYKSRLQVVKATLKQLRHCDRGKS  75
              RF  WKKD+K RL+  K  L++L H D  +S
Sbjct  1007  HRFDVWKKDFKGRLRETKVILQKLSHVDEERS  1038



>gb|KDO74223.1| hypothetical protein CISIN_1g000931mg [Citrus sinensis]
Length=1095

 Score =   122 bits (305),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 110/204 (54%), Gaps = 21/204 (10%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             Q++  ED ++  +Q  + + Q+C+ G+QAR  + EL  G I LQSF RGEN R+ +  L 
Sbjct  871   QLAALEDRRKQVLQAIIRL-QKCFRGYQARSRFRELCNGVITLQSFARGENTRRRHASLG  929

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF-----------NKKITS  666
                 A+V            R EQL  +ICLQS IRGWL R +            N K+  
Sbjct  930   KSCSAVVP---------EIRDEQLREIICLQSAIRGWLVRKQLKMHKLKQSNPVNAKVKR  980

Query  665   RLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQ  486
             R   +     ++  E ++   + L +LQRRV   EA L +  +ENA+L+E + Q+D K  
Sbjct  981   RSGRKSSDMKDVPQEQVQALPTALAELQRRVLKAEATLGQKEEENAALREQLQQYDAKWL  1040

Query  485   EYEAKMQCLEKSWQDQLMSIQTSL  414
             EYEAKM+ +E+ WQ Q+ S+Q S 
Sbjct  1041  EYEAKMKSMEEMWQKQMASLQVSF  1064



>gb|EEE67412.1| hypothetical protein OsJ_24744 [Oryza sativa Japonica Group]
Length=1256

 Score =   121 bits (304),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 106/336 (32%), Positives = 157/336 (47%), Gaps = 59/336 (18%)
 Frame = -3

Query  935   IQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKEQ--Q  762
             IQ+ + G   R  Y  LK+GA+ LQSF+RGE AR  +  LV R +A V IQK+ + +   
Sbjct  907   IQKNFRGLCTRQEYQGLKKGAMTLQSFIRGEKARVHFDHLVKRWKASVLIQKYARRRIAA  966

Query  761   SRRLEQLAAVICLQSGIRGWLTRIEFN-------------KKITSRLNSRQMLNPELKDE  621
             +  ++QL  V+ LQS +RG L R ++              K I  R N  Q     +   
Sbjct  967   TMFIDQLKYVVLLQSVMRGCLARKKYKCLKEEKDSKASHRKVIHVRNNVSQARMYHVYPL  1026

Query  620   DIKV----------QRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
              I +          ++ V+ +LQ RV+  EAAL    +EN  LK+ + Q++KK  EYEAK
Sbjct  1027  TISIPWQETNGDYPRQPVITELQGRVSKAEAALRDKEEENEMLKQQLDQYEKKWSEYEAK  1086

Query  470   MQCLEKSWQDQLMSIQTSLGAASRS---EGVAENGLSRTEPPSERFIPFERSDAGLVVNN  300
             M+ +E++W+ QL S+Q SL AA +S   E VA         P       E +  G     
Sbjct  1087  MKSMEEAWKKQLSSLQLSLVAAKKSLTAEDVASRAARTDAAPMHAHYDSEDTSTGTHTPE  1146

Query  299   RLDF-----------ASPLDQENGSHQN------------------MITWVKSGHDEPLN  207
               +F           A+P      +  N                   +  VKSG     N
Sbjct  1147  GTEFKYQNHNSEARVAAPNSDRRINAVNHLAKEFEDRRQVFEDDAGFLVAVKSGQVGS-N  1205

Query  206   LSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             ++P + ++ K+K RF  WKKDYKSRL+  K  L+++
Sbjct  1206  MNP-DDELRKLKDRFATWKKDYKSRLKETKVNLQKV  1240



>ref|XP_010438625.1| PREDICTED: myosin-4-like [Camelina sativa]
Length=1099

 Score =   121 bits (304),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 95/309 (31%), Positives = 160/309 (52%), Gaps = 34/309 (11%)
 Frame = -3

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             +E++  V  G+  +Q+ + G++ R +Y+ +K  A++LQS++RGE+AR++Y  +V    AI
Sbjct  789   EERKKYVLCGILGLQKKFRGYKTREHYHNMKNAAVMLQSYIRGEHARRNY--IVVGGSAI  846

Query  794   VTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN------------KKITSRLNSR  651
             V+            +E+L AVI LQ  +R WL R   N            K+   +L  R
Sbjct  847   VS---------PATIEELDAVIHLQYVVRKWLARKHLNSMQQKKKSCNGKKRPRRKLTRR  897

Query  650   QMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAK  471
                +  L  E ++VQ     DLQ RV   EAA+ +  DEN +L++ + +F+++  E E K
Sbjct  898   DSKDKGLLLEQLQVQPLAFADLQTRVQKVEAAIMQKDDENTALQDELQRFEERWLENETK  957

Query  470   MQCLEKSWQDQLMSIQTSLGAASRSEGVAENGLSRTEPPSERFIPFERSDAGLVVNNRLD  291
             M+ +E++WQ  ++S++ SL AA +   +A N  +     SE  + F      L   + L 
Sbjct  958   MKSMEETWQKHMLSMEMSLAAACKI--LAPNKTASHGNDSEDTMSFGTPTKEL--KDSLS  1013

Query  290   FASPLDQENGSHQNMI-----TWVKSG--HDEPLNLSPKNSDVHKVKLRFKAWKKDYKSR  132
              A+ L  E+     +I     + V+ G   D   N +    ++ ++KLRF+ WKKDYK+R
Sbjct  1014  DANNLSTESDQRSVIINEDAKSLVEVGLEPDSSSNRTQHAEELRRLKLRFEKWKKDYKAR  1073

Query  131   LQVVKATLK  105
             L   K  L+
Sbjct  1074  LSETKTRLR  1082



>ref|XP_006283030.1| hypothetical protein CARUB_v10004022mg [Capsella rubella]
 gb|EOA15928.1| hypothetical protein CARUB_v10004022mg [Capsella rubella]
Length=1140

 Score =   121 bits (303),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 105/332 (32%), Positives = 158/332 (48%), Gaps = 52/332 (16%)
 Frame = -3

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             +E++  V  G+  +Q+ + G+Q R YY+ +   A + QS++RGENAR++Y  +V    AI
Sbjct  830   EERKKYVLCGILGLQKKFRGYQTREYYHNMMNAAKIFQSYIRGENARRNY--IVVERSAI  887

Query  794   VTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFN-----------KKITSRLNSRQ  648
             V+             E+  A I LQ  +R WL R   N           KKI  R    +
Sbjct  888   VS---------PAITEEFDAAIHLQYMVRKWLARKHLNNMQQKKKSCNEKKIPRR--KLR  936

Query  647   MLNPELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYE  477
             M + E KD   E  + Q   L DLQ RV   EAA+ +  DEN + +E + +F+++  E+E
Sbjct  937   MRDSEDKDPLLEQFQDQPWDLADLQSRVQKVEAAIMQKEDENTAFQEELQRFEERWLEHE  996

Query  476   AKMQCLEKSWQDQLMSIQTSLGAASR-------------SEGVAENGLSRTEPPSERFIP  336
              KM+ +E++WQ  + S+Q SL AA +             SE     G S  EP       
Sbjct  997   IKMKSMEETWQKHMSSMQMSLTAACKVLALNKTASPGNDSEDTMSFGTSTKEPKG-----  1051

Query  335   FERSDAGLVVNNRLDFASPLDQENGSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKA  156
                SDA   ++   D  S +  E+         V+ G +   N S    ++  +KLRF+ 
Sbjct  1052  -SWSDAN-NLSTEFDQRSVIINEDAKS---FVEVEFGPESISNRSQHAEELKTLKLRFEK  1106

Query  155   WKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             WKKDYK+RL   KATL+   +   G+    WC
Sbjct  1107  WKKDYKARLSETKATLR--LNGVEGRHRKWWC  1136



>tpg|DAA63129.1| TPA: hypothetical protein ZEAMMB73_109792 [Zea mays]
Length=1238

 Score =   120 bits (302),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 108/345 (31%), Positives = 173/345 (50%), Gaps = 54/345 (16%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++E  ++Q+ +  G   IQ  + G  +R  Y  LK+GA+ LQSF+RGE  R  +  LV R
Sbjct  881   ALENAKRQMLL--GTLHIQTQFRGLHSRRGYQRLKKGAMNLQSFIRGERTRIHFDNLVKR  938

Query  806   LRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEF----NKKITSRLNSRQM  645
              RA V IQKH + + +  +  +QL  VI LQS  RG+L R ++    N+K +   +S   
Sbjct  939   WRAAVLIQKHTRRRLAANMFNDQLNHVILLQSVTRGFLARRKYKCLQNEKESKASHSIVQ  998

Query  644   LNPELKDEDIKV---------QRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
              N    + + ++            V+ +LQ R+   EAAL    +EN  LK+ + Q+++K
Sbjct  999   GNTRKNNSESRICHEMNGHYPHEPVITELQGRITKAEAALRGKEEENVMLKQQLEQYERK  1058

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS--------------------EGVAENGL  372
               EYEAKM+C+E++W+ QL S+Q SL  A +S                    +  +E+ L
Sbjct  1059  WSEYEAKMKCMEEAWKRQLSSLQLSLVVAKKSLAADDAATRAARTDCTPTHAQYDSEDTL  1118

Query  371   S---RT----EPPSERFIPFERSDAGLVVNNRLDFASPLDQENGSHQ-------NMITWV  234
             S   RT    E   +   P  +  AG   + R++  + L +E    +         +  V
Sbjct  1119  STGTRTPEVIESKHDNHNPEAKVSAG-NSDRRVNAVNHLAKEFEDRRQVFEDDAGFLVAV  1177

Query  233   KSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
             +SG     N++P + ++ K+K RF  WKKDYKSRL+  K  L ++
Sbjct  1178  RSGQIGS-NMNP-DEELRKLKDRFATWKKDYKSRLKETKVNLSKV  1220



>ref|XP_006279905.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
 gb|EOA12803.1| hypothetical protein CARUB_v10025758mg [Capsella rubella]
Length=1215

 Score =   120 bits (301),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 105/366 (29%), Positives = 174/366 (48%), Gaps = 74/366 (20%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI I ED ++  +Q G+  +Q+ +  H +R Y+  ++  A+VLQS+VRGE +R+ +    
Sbjct  864   QIGIFEDRRKKVLQ-GIVGLQKHFRCHLSRKYFQNMRAVALVLQSYVRGEISRRVFD---  919

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLNPE  633
                      + H         +++ AVI LQS +RGWL R  FN    S    +++LN  
Sbjct  920   ------TEAKIHADTVSEASTDEVTAVIHLQSAVRGWLARNRFN----SMQRQKELLNVT  969

Query  632   LK-----------DEDI-----KVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQF  501
              K           D+DI     +VQ + + DLQ+RV  +EAAL +  +EN +L++ + QF
Sbjct  970   TKSKKKAGRRISEDKDIPLEQFQVQPTTVSDLQKRVLKSEAALAQKEEENTALRDQLRQF  1029

Query  500   DKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGV---------------------A  384
             +++  EYE KM+ +E +WQ Q+ S+Q SL AA +S                        +
Sbjct  1030  EERWSEYEVKMKSMEDTWQKQMSSLQMSLAAARKSLATESITGQAGGRQDTSISPFGYDS  1089

Query  383   ENGLSRTEP----PSERFIPFERSDAGL-VVNNRLDFASPLDQENGSHQ-------NMIT  240
             E+ +S   P    P+ +F      +  +  +N  L+  + L +E    +         I 
Sbjct  1090  EDTMSTGTPGVRTPTTKFTNGNTPELRIRELNGSLNAVNHLAREFDQRRLNFDEDARAIV  1149

Query  239   WVKSGHDEPLNLSPKN-------SDVHKVKLRFKAWKKDYKSRLQVVKATLKQLRHCDRG  81
              VK G  +    +P          +  ++K RF+ WKKDYK+RL+  KA L ++   D+G
Sbjct  1150  EVKLGGPQA---TPNGQQQQHPEDEFRRLKQRFETWKKDYKARLRDTKARLHRV-DGDKG  1205

Query  80    KST*IW  63
             +    W
Sbjct  1206  RHRKWW  1211



>ref|XP_004982777.1| PREDICTED: myosin-J heavy chain-like isoform X1 [Setaria italica]
Length=1233

 Score =   120 bits (301),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 106/360 (29%), Positives = 167/360 (46%), Gaps = 69/360 (19%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI   ED +   +  G+  +Q C+ GHQAR++  E  RG + LQSF+RGENAR+ Y  L 
Sbjct  856   QIGKLEDTRNRTLH-GILRVQSCFRGHQARYHARERIRGVLDLQSFIRGENARQIYSSLS  914

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLA--AVICLQSGIRGWLTRI------------EFNKK  675
              + RA + +Q+ ++   +RR       A + +QSGIRG L R             EF  K
Sbjct  915   RKHRAAIILQRSVRCWLARRYFTNIRRASVVIQSGIRGSLVRRCNGNIDLINVLREFESK  974

Query  674   ---------------------------ITSRLNSRQMLNPELKDEDIKVQRSVLLDLQRR  576
                                        I + +N   +L  E + + I ++ SVL +LQRR
Sbjct  975   QVCKMGALYRAAGSHMLRTVASDPSDLIQNYMNFTLLLFQEAEGDQILIKASVLAELQRR  1034

Query  575   VAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS  396
             +   EA +    +EN  L + + Q++ +  EYE KM+ +E+ WQ Q+ S+Q+SL  A +S
Sbjct  1035  ILKAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKS  1094

Query  395   EGVAE---------------NGLSRTEPPSERFIPFERS---DAGLVVNNRLDFASPLDQ  270
               + E               NG         + +P       +AGL V NRL      +Q
Sbjct  1095  LALDETPRMSDSSVDQSWEING--NHVGSGSQLVPRTTGREMNAGLSVINRL--TEEFEQ  1150

Query  269   EN---GSHQNMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATLKQL  99
              +         I  VKSG  +  +L+P + ++ ++K  F +WKKD+  R++  K  L +L
Sbjct  1151  RSQVFADDATFIVEVKSGQADA-SLNP-DMELRRLKQNFDSWKKDFGGRIRETKVILNKL  1208



>ref|XP_009382696.1| PREDICTED: myosin-2-like [Musa acuminata subsp. malaccensis]
Length=471

 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 79/226 (35%), Positives = 126/226 (56%), Gaps = 31/226 (14%)
 Frame = -3

Query  986  SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             +E+D  Q +  +G+  +Q+ + G +A  YY +LK+GA VLQSFVRGE+ R +++ L  R
Sbjct  138  GMEDDRNQTS--QGIIWVQKSFRGFRACSYYQQLKKGATVLQSFVRGESTRHNFEVLKKR  195

Query  806  LRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEFN--KKI-----------  672
             RA + IQ+H++   +R +   Q   +I LQS IRG L R  F   KKI           
Sbjct  196  WRAAILIQQHLRRCFARTVFNNQRKDIIFLQSVIRGRLARNHFTALKKIEVLKSGHTYLK  255

Query  671  ---TSRLNSRQML-------NPEL----KDEDIKVQRSVLLDLQRRVAVTEAALERTRDE  534
                S ++  Q++       +PEL    + E  ++  SVL   Q +V   EAAL    +E
Sbjct  256  KREVSMVSHVQLIKGGSARDSPELVKDTESEHPQLDPSVLAQFQSQVCKAEAALRDKEEE  315

Query  533  NASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS  396
            NA LK+ + +++ +  EYE+KM+ +E++WQ QL+S+Q +   A +S
Sbjct  316  NAVLKQQLREYEMRWSEYESKMKSMERTWQKQLISLQMNFAGARKS  361



>ref|XP_003596488.1| Myosin-like protein [Medicago truncatula]
Length=1292

 Score =   119 bits (298),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 119/373 (32%), Positives = 184/373 (49%), Gaps = 80/373 (21%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQS---------------  858
             Q+   ED+++L +Q GV  +Q+   GHQAR +Y++LK G   LQS               
Sbjct  928   QVGALEDKRKLVLQ-GVLGVQKWVRGHQARSHYDKLKNGVTTLQSCNAWISILLYLYQKF  986

Query  857   FVRGENARKDYQFLVTRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTR-----  693
              VRGE AR+ Y  +V   ++ +TI        S  +E++ A+I LQS IRGWL R     
Sbjct  987   IVRGEIARRKYGVMV---KSSITIS-------SENIEEIEAIILLQSVIRGWLVRRHNSS  1036

Query  692   -IEF-----NKKITSRLNSRQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDEN  531
               +F     N K   R  S+   + +   +  +   S L +LQRRV   E+ +E+  +EN
Sbjct  1037  LCKFKIHPENGKTRRRSRSKMSDDKDASKDRSQNLPSALAELQRRVVKAESTIEQKEEEN  1096

Query  530   ASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRSEGVAENG---LSRTE  360
             A L+E + QF+K+  EYE +M+ +E+ WQ Q+ S+Q SL AA+RS   +EN     SR +
Sbjct  1097  AELREQLKQFEKRWIEYETRMKTMEEMWQRQMSSLQMSL-AAARSSLASENANGQPSRHD  1155

Query  359   PPSERFIPFERSDAGLV---------VNNRLDFASPLDQ------ENGSHQNMITWVK--  231
               S     ++  DA  +          +  L ++S L +       NGS  N++   +  
Sbjct  1156  VASPSPFCYDSEDATSMGSRTPRTPGCSTPLKYSSSLSEIKAMRDGNGSLGNLMKEFEQR  1215

Query  230   ----------------SGHDEPLNLSPKN-SDVHKVKLRFKAWKKDYKSRLQVVKATLKQ  102
                             +GH    +++P +  D+ K+K RF+ WKK+YK RL+  KA LK 
Sbjct  1216  SQTFDEDARALVEVRTTGH----SVNPNSIDDLRKLKHRFEGWKKEYKMRLKETKARLK-  1270

Query  101   LRHCDRGKST*IW  63
             LR+ +  KS   W
Sbjct  1271  LRNSEMEKSRRRW  1283



>ref|XP_004146844.1| PREDICTED: myosin-2 heavy chain-like [Cucumis sativus]
 ref|XP_004154813.1| PREDICTED: myosin-2 heavy chain-like [Cucumis sativus]
 gb|KGN59875.1| hypothetical protein Csa_3G851760 [Cucumis sativus]
Length=1202

 Score =   118 bits (295),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 104/345 (30%), Positives = 160/345 (46%), Gaps = 84/345 (24%)
 Frame = -3

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             DE++  V +G+  IQ+ + G  AR  +++LK+GA  LQSF+RGENAR+  +  V R   +
Sbjct  861   DERKKQVMQGILGIQKYFRGCHARGNFHDLKQGATTLQSFIRGENARR--RCTVKRFSFV  918

Query  794   V---TIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEF----------NKKITSRLNS  654
             V   ++ K + E Q        AVI LQS IRG L R             NKK  S+LN 
Sbjct  919   VYAFSVPKKVYEVQ--------AVIRLQSVIRGSLARKHLSMLDSKKFIENKK--SKLNK  968

Query  653   RQMLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEA  474
              + ++ E   E  +   + L +LQ+RV   EA +E+   ENA+L+E + QF+ +  EYEA
Sbjct  969   GRRVSEEKFQERAQSLPTSLTELQKRVVEAEATIEKKEGENAALREQVKQFESRRLEYEA  1028

Query  473   KMQCLEKSWQDQLMSIQ------------------------------------TSLGA--  408
             KM+ +E  WQ Q+ S+Q                                    TS+G+  
Sbjct  1029  KMKSMEDMWQKQMASLQMSLAAAKKTLAAENAAPPGRVDAGNSPPHYYDSEDMTSMGSRT  1088

Query  407   -----ASRSEGVAENGLSRTEPPSERFIPFERSDAGLVVNNRLDFASPLDQENGSHQNMI  243
                   +++ G++E G  R           E +   + VNN +                +
Sbjct  1089  PGGTTPTKASGISEGGTGR-----------EMNGTVVAVNNLVKEFEQRKTAFDDDAKAL  1137

Query  242   TWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
                KSG D     +  + +  K+K RF+AWKK+YK+RL+  KA +
Sbjct  1138  IEAKSGSD-----ANPDEEYRKIKARFEAWKKEYKARLRETKAKV  1177



>ref|XP_008454630.1| PREDICTED: myosin-2-like [Cucumis melo]
Length=1207

 Score =   115 bits (288),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 100/344 (29%), Positives = 168/344 (49%), Gaps = 77/344 (22%)
 Frame = -3

Query  974   DEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAI  795
             DE++  V +G+  IQ+ + G  AR  +++LK+GA  LQSF+RGENAR+  +  V R   +
Sbjct  861   DERKKQVMQGILGIQKYFRGCHARGNFHDLKQGATTLQSFIRGENARR--RCTVKRFSFV  918

Query  794   V---TIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIE--------FNKKITSRLNSRQ  648
             V   ++ K + E Q        A+I LQS IRG L R          F++   ++LN  +
Sbjct  919   VYAFSVPKKVYEVQ--------AIIRLQSVIRGSLARKHLSMRDSKRFHENKKTKLNKGR  970

Query  647   MLNPELKDEDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKM  468
              ++ E   E  +   + L +LQ++V   EA +E+  +ENA+L+E + QF+ +  EYEAKM
Sbjct  971   RVSEEEFQERAQSLPTSLTELQKKVVEAEATIEKKEEENAALREQVKQFESRRLEYEAKM  1030

Query  467   QCLEKSWQDQLMSIQ------------------------------------TSLGAAS--  402
             + +E  WQ Q+ S+Q                                    TS+G+ +  
Sbjct  1031  KSMEDMWQKQMASLQMSLAAAKKTLAAENAAPPGRVDACNSPPHYYDSEDTTSMGSRTPG  1090

Query  401   -----RSEGVAENGLSRTEPPSERFIPFERSDAGLVVNNRL-DFASPLDQENGSHQNMIT  240
                  ++ G++E G  R           E +   + VNN + +F       +   + +I 
Sbjct  1091  VTTPKKASGISEVGAGR-----------EMNGTLVAVNNLVKEFEQRRIAFDDDAKALIE  1139

Query  239   WVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQVVKATL  108
               KSG  +  + +  + +  K+K+RF+AWKK+YK+RL+  KA +
Sbjct  1140  -AKSGQTQMGSNANPDEEYRKIKVRFEAWKKEYKARLRETKAKV  1182



>gb|EMS67686.1| Myosin-J heavy chain [Triticum urartu]
Length=1240

 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 73/194 (38%), Positives = 113/194 (58%), Gaps = 6/194 (3%)
 Frame = -3

Query  947   GVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTRLRAIVTIQKHMKE  768
             GV  +Q C+ GHQAR + +E  RG + LQSF+R ENAR+ Y  L  + RA   +QK++K 
Sbjct  965   GVLRVQSCFRGHQARRHASERIRGVLALQSFIRAENARQSYSSLSKKHRAATLVQKNLKG  1024

Query  767   QQSRR--LEQLAAVICLQSGIRGWLT-RIEFNKKITSRLNSRQMLNPELKDED-IKVQRS  600
               +RR  ++   A + +QSGIRG L  R   N  + + L  R+  + +  D D I ++ S
Sbjct  1025  WLARRYFIKIRKASVVVQSGIRGCLVRRCAGNVDLLNVL--REFESKKEADGDQILIKAS  1082

Query  599   VLLDLQRRVAVTEAALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQT  420
              L +LQRR+   EA +    +EN  L + + Q++ +  EYE KM+ +E+ WQ Q+ S+Q+
Sbjct  1083  FLAELQRRILRAEATVREKDEENEMLHQRLQQYENRWLEYEQKMKAMEEMWQKQMRSLQS  1142

Query  419   SLGAASRSEGVAEN  378
             SL  A +S  + E 
Sbjct  1143  SLSVAKKSLALDET  1156



>ref|XP_008654108.1| PREDICTED: myosin-1-like [Zea mays]
Length=1261

 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 112/368 (30%), Positives = 175/368 (48%), Gaps = 77/368 (21%)
 Frame = -3

Query  986   SIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLVTR  807
             ++E  ++Q+ +  G   IQ  + G  +R  Y  LK+GA+ LQSF+RGE  R  +  LV R
Sbjct  881   ALENAKRQMLL--GTLHIQTQFRGLHSRRGYQRLKKGAMNLQSFIRGERTRIHFDNLVKR  938

Query  806   LRAIVTIQKHMKEQQSRRL--EQLAAVICLQSGIRGWLTRIEF----NKKIT--------  669
              RA V IQKH + + +  +  +QL  VI LQS  RG+L R ++    N+K +        
Sbjct  939   WRAAVLIQKHTRRRLAANMFNDQLNHVILLQSVTRGFLARRKYKCLQNEKESKASHSIVQ  998

Query  668   ---------SRLNSRQMLNPEL-------KDEDIKV--------QRSVLLDLQRRVAVTE  561
                      SR+     ++ E        K  DI             V+ +LQ R+   E
Sbjct  999   GNTRKNNSESRICHVSFISNEFAYAWLLTKFADISFIEMNGHYPHEPVITELQGRITKAE  1058

Query  560   AALERTRDENASLKEYILQFDKKSQEYEAKMQCLEKSWQDQLMSIQTSLGAASRS-----  396
             AAL    +EN  LK+ + Q+++K  EYEAKM+C+E++W+ QL S+Q SL  A +S     
Sbjct  1059  AALRGKEEENVMLKQQLEQYERKWSEYEAKMKCMEEAWKRQLSSLQLSLVVAKKSLAADD  1118

Query  395   ---------------EGVAENGLS---RT----EPPSERFIPFERSDAGLVVNNRLDFAS  282
                            +  +E+ LS   RT    E   +   P  +  AG   + R++  +
Sbjct  1119  AATRAARTDCTPTHAQYDSEDTLSTGTRTPEVIESKHDNHNPEAKVSAG-NSDRRVNAVN  1177

Query  281   PLDQENGSHQ-------NMITWVKSGHDEPLNLSPKNSDVHKVKLRFKAWKKDYKSRLQV  123
              L +E    +         +  V+SG     N++P + ++ K+K RF  WKKDYKSRL+ 
Sbjct  1178  HLAKEFEDRRQVFEDDAGFLVAVRSGQIGS-NMNP-DEELRKLKDRFATWKKDYKSRLKE  1235

Query  122   VKATLKQL  99
              K  L ++
Sbjct  1236  TKVNLSKV  1243



>ref|XP_009143365.1| PREDICTED: myosin-4 [Brassica rapa]
Length=1115

 Score =   110 bits (275),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/338 (29%), Positives = 171/338 (51%), Gaps = 54/338 (16%)
 Frame = -3

Query  992   QISIEEDEKQLAVQKGVEIIQRCYHGHQARHYYNELKRGAIVLQSFVRGENARKDYQFLV  813
             QI + E+ ++  +Q GV  +Q+   G+++R Y++ +K+ A++LQS++RGENAR++Y  + 
Sbjct  800   QIGLLEERREYVLQ-GVIGLQKHLRGYKSREYFHNMKKSALILQSYIRGENARRNY--IA  856

Query  812   TRLRAIVTIQKHMKEQQSRRLEQLAAVICLQSGIRGWLTRIEFNKKITSRLNSRQMLN--  639
              +  A V+         S   ++L AVI LQS +R W  R +    +  +  S       
Sbjct  857   MQTPATVS---------SEVTKELDAVIHLQSVVRRWFVRKQLKNSVELKKQSHNEKKKT  907

Query  638   --------PELKD---EDIKVQRSVLLDLQRRVAVTEAALERTRDENASLKEYILQFDKK  492
                      E+KD   E  +VQ   L DLQ RV   E A+ +  DEN +LKE + +F+++
Sbjct  908   RRKSRRKVSEVKDLPLEQFQVQPWDLADLQSRVQKVETAIMQKEDENTALKEELQRFEER  967

Query  491   SQEYEAKMQCLEKSWQDQLMSIQTSLGAA--------SRSEGV-AENGLSRTEPPSERFI  339
               ++E +M+ +E++WQ  + S+Q SL AA        + S G  +E+ +S   P  E   
Sbjct  968   WIKHETRMKSMEETWQKHISSMQMSLEAACNIMTPDKTASHGNDSEDTISPGTPTKEL--  1025

Query  338   PFERSDAGLVVNNRLDFASPLDQENGSH-QNMITWVKSGHDEPLNLSPK----NSDVHKV  174
                    G  +++  D    +DQ      +++   V+    E ++++ +      ++ ++
Sbjct  1026  ------KGGSLDDIKDIYVEVDQRRVVFDEDVKRHVEIDELEQVSIAIEKQHAEEELSRL  1079

Query  173   KLRFKAWKKDYKSRLQVVKATLKQLRHCDRGKST*IWC  60
             K RF+ WKKDYK+RL+  KA L+   H +       WC
Sbjct  1080  KSRFEKWKKDYKARLRGTKARLRLNGHRN-------WC  1110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3685527018540