BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21835_g3_i3 len=845 path=[1666:0-263 1930:264-287 7183:288-292
3726:293-844]

Length=845
                                                                      Score     E

sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    207   4e-62   Ipomoea batatas [batate]
gb|AFR60867.1|  sporamin B                                              206   5e-62   
gb|AFR60859.1|  sporamin B                                              206   7e-62   
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     206   8e-62   Ipomoea batatas [batate]
gb|AAA33390.1|  sporamin B                                              206   8e-62   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                              206   9e-62   
gb|AFR60865.1|  sporamin B                                              206   1e-61   
gb|ABB90968.1|  sporamin B precursor                                    204   5e-61   Ipomoea batatas [batate]
gb|AFR60862.1|  sporamin B                                              203   9e-61   
gb|AFR60864.1|  sporamin B                                              203   1e-60   
gb|ABB97547.1|  sporamin A precursor                                    203   1e-60   Ipomoea batatas [batate]
gb|AFR60863.1|  sporamin B                                              201   6e-60   
gb|AFR60860.1|  sporamin B                                              201   7e-60   
gb|AFR60855.1|  sporamin A                                              198   1e-58   
gb|ABG26236.1|  sporamin A                                              197   3e-58   Ipomoea trifida
gb|AAB52547.1|  sporamin precursor                                      196   5e-58   Ipomoea batatas [batate]
gb|ABG26232.1|  sporamin A                                              196   7e-58   Ipomoea trifida
gb|ABG26235.1|  sporamin A                                              196   8e-58   Ipomoea trifida
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    196   1e-57   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                              195   1e-57   Ipomoea trifida
gb|AAA33391.1|  sporamin A precursor                                    195   2e-57   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    194   3e-57   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                    194   4e-57   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                      194   4e-57   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                    194   4e-57   Ipomoea batatas [batate]
gb|ABG26224.1|  sporamin A                                              194   4e-57   Ipomoea leucantha
gb|AAL55800.1|AF289060_1  sporamin                                      194   5e-57   Ipomoea batatas [batate]
gb|ABB97549.1|  sporamin A precursor                                    193   6e-57   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                              193   8e-57   Ipomoea trifida
gb|ABG26238.1|  sporamin A                                              192   1e-56   Ipomoea trifida
gb|ABG26222.1|  sporamin A                                              191   7e-56   Ipomoea leucantha
gb|AFR60856.1|  sporamin A                                              191   8e-56   
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     190   9e-56   Ipomoea batatas [batate]
gb|AAA86670.1|  preprosporamin                                          190   1e-55   Ipomoea batatas [batate]
gb|ABG26227.1|  sporamin A                                              189   5e-55   Ipomoea leucantha
gb|AAD40288.1|  sporamin A precursor                                    188   6e-55   Ipomoea batatas [batate]
gb|ABB97542.1|  sporamin A precursor                                    188   6e-55   Ipomoea batatas [batate]
gb|ABG26229.1|  sporamin A                                              188   7e-55   Ipomoea trifida
gb|ABB97543.1|  sporamin A precursor                                    186   2e-54   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                186   5e-54   
gb|AAD05567.1|  sporamin A                                              185   2e-53   Ipomoea batatas [batate]
gb|AAB52549.1|  sporamin                                                127   1e-32   Ipomoea batatas [batate]
gb|AFR60853.1|  truncated sporamin                                      123   8e-31   
gb|AAB52550.1|  sporamin                                                110   7e-26   Ipomoea batatas [batate]
ref|XP_002265965.1|  PREDICTED: miraculin                             82.4    2e-15   Vitis vinifera
gb|AIT42186.1|  Kunitz-type inhibitor B                               82.4    2e-15   
sp|Q41484.1|SPI5_SOLTU  RecName: Full=Serine protease inhibitor 5...  79.7    2e-14   Solanum tuberosum [potatoes]
emb|CAN65022.1|  hypothetical protein VITISV_027379                   78.6    4e-14   Vitis vinifera
gb|ADD51186.1|  tumor-related protein                                 78.2    6e-14   Vitis cinerea var. helleri x Vitis riparia
ref|XP_011072079.1|  PREDICTED: miraculin                             77.8    7e-14   
gb|ABB72793.1|  Kunitz-type protease inhibitor-like protein           77.8    8e-14   Solanum tuberosum [potatoes]
ref|XP_004234308.1|  PREDICTED: serine protease inhibitor 5-like      77.0    1e-13   
emb|CAN81015.1|  hypothetical protein VITISV_025776                   76.6    2e-13   Vitis vinifera
emb|CBI35464.3|  unnamed protein product                              76.6    2e-13   
ref|XP_002266430.1|  PREDICTED: miraculin                             76.3    3e-13   Vitis vinifera
emb|CAN75396.1|  hypothetical protein VITISV_028636                   75.9    3e-13   Vitis vinifera
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              75.9    3e-13   
emb|CAN63617.1|  hypothetical protein VITISV_041430                   75.1    9e-13   Vitis vinifera
ref|XP_008238584.1|  PREDICTED: miraculin-like                        73.9    2e-12   
ref|XP_002270111.1|  PREDICTED: miraculin                             73.6    3e-12   Vitis vinifera
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           72.8    4e-12   
ref|XP_006372631.1|  trypsin protein inhibitor 3                      72.8    5e-12   
ref|XP_006351514.1|  PREDICTED: probable serine protease inhibito...  72.4    8e-12   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           72.0    9e-12   
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         71.6    1e-11   
gb|AIT42170.1|  Kunitz-type inhibitor B                               71.6    1e-11   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      71.2    2e-11   
ref|XP_009777240.1|  PREDICTED: miraculin-like                        71.2    2e-11   
gb|ABX76298.1|  sexual organ expressed protein                        71.6    2e-11   Nicotiana alata [flowering tobacco]
sp|Q41433.1|SPI6_SOLTU  RecName: Full=Probable serine protease in...  70.5    3e-11   Solanum tuberosum [potatoes]
gb|AFK36436.1|  unknown                                               70.5    4e-11   
gb|AAL60248.1|AF459083_1  putative Kunitz-type tuber invertase in...  69.7    5e-11   Solanum tuberosum [potatoes]
gb|AIT42206.1|  Kunitz-type inhibitor C                               70.1    5e-11   
ref|XP_004234331.1|  PREDICTED: miraculin                             69.7    6e-11   
gb|AAM10743.1|AF492359_1  putative kunitz-type proteinase inhibit...  68.9    1e-10   Solanum tuberosum [potatoes]
gb|AIT42176.1|  Kunitz-type inhibitor B                               68.9    1e-10   
gb|AAL60243.1|AF459078_1  putative Kunitz-type tuber invertase in...  68.9    1e-10   Solanum tuberosum [potatoes]
ref|XP_011046090.1|  PREDICTED: miraculin-like                        68.6    1e-10   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     68.6    2e-10   Theobroma microcarpum
sp|P58514.2|SPI1_SOLTU  RecName: Full=Serine protease inhibitor 1...  68.6    2e-10   Solanum tuberosum [potatoes]
gb|AIT42190.1|  Kunitz-type inhibitor B                               68.6    2e-10   
gb|AIT42196.1|  Kunitz-type inhibitor B                               68.6    2e-10   
gb|AIT42180.1|  Kunitz-type inhibitor B                               68.6    2e-10   
ref|NP_001275427.1|  Kunitz-type protease inhibitor precursor         68.2    2e-10   
gb|AIT42197.1|  Kunitz-type inhibitor B                               68.2    2e-10   
ref|XP_007036748.1|  21 kDa seed protein, putative                    68.2    3e-10   
gb|AIT42179.1|  Kunitz-type inhibitor B                               68.2    3e-10   
ref|XP_006353923.1|  PREDICTED: cysteine protease inhibitor 1-like    67.8    3e-10   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           67.8    3e-10   
ref|XP_007036750.1|  21 kDa seed protein                              67.8    3e-10   
gb|AAM21645.1|AF495584_1  putative Kunitz-type proteinase inhibitor   67.8    3e-10   Solanum tuberosum [potatoes]
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    68.2    3e-10   
gb|AIT42172.1|  Kunitz-type inhibitor B                               68.2    3e-10   
ref|XP_003534083.1|  PREDICTED: miraculin-like                        67.4    4e-10   
ref|XP_007036746.1|  21 kDa seed protein                              67.4    4e-10   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      67.4    4e-10   
gb|AIT42195.1|  Kunitz-type inhibitor B                               67.4    5e-10   
ref|XP_002305032.2|  trypsin protein inhibitor 3                      67.0    5e-10   Populus trichocarpa [western balsam poplar]
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               67.0    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           67.0    5e-10   
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           67.4    6e-10   
gb|AIT42191.1|  Kunitz-type inhibitor B                               67.0    6e-10   
ref|XP_008778295.1|  PREDICTED: miraculin                             66.2    6e-10   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        66.6    7e-10   
ref|XP_009588833.1|  PREDICTED: latex serine proteinase inhibitor...  66.6    7e-10   
gb|AAM10744.1|AF492769_1  putative kunitz-type proteinase inhibit...  67.0    7e-10   Solanum tuberosum [potatoes]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           66.6    7e-10   
gb|AAQ96377.1|  miraculin-like protein                                66.6    8e-10   Solanum palustre
dbj|BAA04150.1|  proteinase inhibitor                                 66.6    8e-10   Solanum tuberosum [potatoes]
gb|AIT42171.1|  Kunitz-type inhibitor B                               66.6    9e-10   
sp|P30941.2|SPI7_SOLTU  RecName: Full=Serine protease inhibitor 7...  66.6    9e-10   Solanum tuberosum [potatoes]
gb|AAZ08244.1|  putative Kunitz-type proteinase inhibitor PKI1        66.6    9e-10   Solanum tuberosum [potatoes]
gb|AAO23566.1|  serine protease inhibitor                             66.6    1e-09   Solanum tuberosum [potatoes]
ref|XP_011035401.1|  PREDICTED: miraculin-like                        66.2    1e-09   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        66.2    1e-09   
ref|XP_006353926.1|  PREDICTED: cysteine protease inhibitor 1-like    66.2    1e-09   
ref|XP_006495061.1|  PREDICTED: miraculin-like                        66.2    1e-09   
gb|AIT42188.1|  Kunitz-type inhibitor B                               66.2    1e-09   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           65.9    1e-09   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        66.2    1e-09   
ref|XP_010663911.1|  PREDICTED: miraculin-like                        65.9    1e-09   
emb|CDP19136.1|  unnamed protein product                              66.2    1e-09   
gb|AIT42208.1|  Kunitz-type inhibitor C                               66.2    1e-09   
gb|AIT42183.1|  Kunitz-type inhibitor B                               65.9    1e-09   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           65.9    1e-09   
emb|CAA43267.1|  sporamin                                             66.2    1e-09   Ipomoea batatas [batate]
gb|AAT06054.1|  putative Kunitz-type tuber invertase inhibitor        65.9    2e-09   Solanum tuberosum [potatoes]
gb|AIT42202.1|  Kunitz-type inhibitor C                               65.9    2e-09   
ref|XP_010101167.1|  hypothetical protein L484_005403                 65.5    2e-09   
gb|AAM21644.1|AF495583_1  putative Kunitz-type proteinase inhibitor   65.1    2e-09   Solanum tuberosum [potatoes]
sp|O24384.1|CPI8_SOLTU  RecName: Full=Cysteine protease inhibitor...  65.9    2e-09   Solanum tuberosum [potatoes]
gb|AIT42187.1|  Kunitz-type inhibitor B                               65.9    2e-09   
ref|XP_006362681.1|  PREDICTED: serine protease inhibitor 1-like      65.1    2e-09   
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  65.1    2e-09   
gb|AAM21643.1|AF495582_1  putative Kunitz-type proteinase inhibitor   65.5    2e-09   Solanum tuberosum [potatoes]
gb|AIT42193.1|  Kunitz-type inhibitor B                               65.5    2e-09   
ref|NP_001275101.1|  Kunitz-type protease inhibitor precursor         65.5    2e-09   
gb|AGF39574.1|  Kunitz-type protease inhibitor D                      65.5    2e-09   
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     65.5    2e-09   Theobroma bicolor
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  65.5    2e-09   Synsepalum dulcificum [miracle fruit]
gb|AAM10742.1|AF492358_1  putative kunitz-type proteinase inhibit...  65.1    3e-09   Solanum tuberosum [potatoes]
gb|AAL60244.1|AF459079_1  putative Kunitz-type tuber invertase in...  65.1    3e-09   Solanum tuberosum [potatoes]
gb|AIT42194.1|  Kunitz-type inhibitor B                               65.1    3e-09   
gb|AIT42203.1|  Kunitz-type inhibitor C                               65.1    3e-09   
prf||1802409A  albumin                                                65.1    3e-09
gb|AAL60242.1|AF459077_1  putative Kunitz-type tuber invertase in...  65.1    3e-09   Solanum tuberosum [potatoes]
gb|AAL60247.1|AF459082_1  putative Kunitz-type tuber invertase in...  64.3    3e-09   Solanum tuberosum [potatoes]
gb|AIT42205.1|  Kunitz-type inhibitor C                               65.1    3e-09   
ref|XP_007036743.1|  21 kDa seed protein                              65.1    3e-09   
ref|XP_006353928.1|  PREDICTED: putative Kunitz-type tuber invert...  65.1    3e-09   
gb|AAM21642.1|AF495581_1  putative Kunitz-type proteinase inhibitor   65.1    3e-09   Solanum tuberosum [potatoes]
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            64.3    4e-09   Populus balsamifera [balsam poplar]
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               65.1    4e-09   Nicotiana glutinosa
gb|ACS92518.1|  Kunitz-type protease inhibitor KPI-C6.1               64.3    4e-09   Populus trichocarpa x Populus nigra
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            63.9    4e-09   Populus balsamifera [balsam poplar]
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            63.9    5e-09   Populus balsamifera [balsam poplar]
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  64.3    5e-09   
ref|XP_009406658.1|  PREDICTED: miraculin-like                        64.3    5e-09   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           64.3    5e-09   
gb|ACS92499.1|  Kunitz-type protease inhibitor KPI-C6.2               64.3    5e-09   Populus trichocarpa x Populus nigra
pdb|3TC2|A  Chain A, Crystal Structure Of Potato Serine Protease ...  63.9    5e-09   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        64.3    6e-09   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     64.3    6e-09   Theobroma cacao [chocolate]
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            63.5    6e-09   Populus balsamifera [balsam poplar]
gb|AFZ77402.1|  Kunitz-type proteinase inhibitor PKI2                 63.9    8e-09   
ref|XP_009608866.1|  PREDICTED: miraculin-like                        63.9    8e-09   
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            63.2    8e-09   Populus balsamifera [balsam poplar]
sp|P20347.3|CPI1_SOLTU  RecName: Full=Cysteine protease inhibitor...  63.9    9e-09   Solanum tuberosum [potatoes]
emb|CAA45723.1|  aspartic proteinase inhibitor                        63.5    1e-08   Solanum tuberosum [potatoes]
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           63.5    1e-08   
gb|AIT42184.1|  Kunitz-type inhibitor B                               63.5    1e-08   
emb|CAA44005.1|  aspartic proteinase inhibitor homologue              63.2    1e-08   Solanum tuberosum [potatoes]
gb|ACS92512.1|  Kunitz-type protease inhibitor KPI-C7                 62.8    1e-08   Populus trichocarpa x Populus nigra
ref|XP_006360288.1|  PREDICTED: miraculin-like                        63.2    1e-08   
ref|XP_004137639.1|  PREDICTED: miraculin-like                        62.8    2e-08   
gb|ACO39957.1|  kunitz trypsin inhibitor 3                            62.4    2e-08   Populus balsamifera [balsam poplar]
gb|ACO40004.1|  kunitz trypsin inhibitor 3                            62.4    2e-08   Populus balsamifera [balsam poplar]
sp|Q43645.2|API4_SOLTU  RecName: Full=Aspartic protease inhibitor...  63.2    2e-08   Solanum tuberosum [potatoes]
gb|AIT42199.1|  Kunitz-type inhibitor B                               62.8    2e-08   
ref|XP_008437082.1|  PREDICTED: miraculin                             62.8    2e-08   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           62.4    2e-08   
gb|AIT42182.1|  Kunitz-type inhibitor B                               62.8    2e-08   
ref|XP_002266302.2|  PREDICTED: miraculin-like                        61.6    2e-08   Vitis vinifera
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            62.0    2e-08   Populus balsamifera [balsam poplar]
ref|XP_006360287.1|  PREDICTED: 21 kDa seed protein-like              62.4    2e-08   
gb|AIT42207.1|  Kunitz-type inhibitor C                               62.4    3e-08   
gb|AIT42204.1|  Kunitz-type inhibitor C                               62.4    3e-08   
gb|AIT42216.1|  Kunitz-type inhibitor D                               62.0    3e-08   
ref|XP_009588822.1|  PREDICTED: kunitz-type serine protease inhib...  62.0    3e-08   
gb|AAX47265.1|  Kunitz-type proteinase inhibitor group B3             61.6    3e-08   Solanum palustre
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            61.6    3e-08   Populus balsamifera [balsam poplar]
gb|ACO40070.1|  kunitz trypsin inhibitor 3                            61.6    3e-08   Populus balsamifera [balsam poplar]
ref|XP_009775241.1|  PREDICTED: latex serine proteinase inhibitor...  62.4    3e-08   
gb|ACO40038.1|  kunitz trypsin inhibitor 3                            61.6    3e-08   Populus balsamifera [balsam poplar]
ref|XP_004235413.1|  PREDICTED: aspartic protease inhibitor 1-like    62.0    4e-08   
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            61.2    4e-08   Populus balsamifera [balsam poplar]
gb|ACO39958.1|  kunitz trypsin inhibitor 3                            61.2    4e-08   Populus balsamifera [balsam poplar]
emb|CDP16462.1|  unnamed protein product                              62.0    4e-08   
gb|ACO40052.1|  kunitz trypsin inhibitor 3                            61.2    4e-08   Populus balsamifera [balsam poplar]
ref|XP_009627067.1|  PREDICTED: miraculin                             61.6    4e-08   
sp|Q00652.1|CPI9_SOLTU  RecName: Full=Cysteine protease inhibitor...  62.0    4e-08   Solanum tuberosum [potatoes]
gb|ACO39954.1|  kunitz trypsin inhibitor 3                            61.2    4e-08   Populus balsamifera [balsam poplar]
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            61.2    4e-08   Populus balsamifera [balsam poplar]
gb|ACO39943.1|  kunitz trypsin inhibitor 3                            61.2    4e-08   Populus balsamifera [balsam poplar]
gb|ACO39915.1|  kunitz trypsin inhibitor 3                            61.2    4e-08   Populus balsamifera [balsam poplar]
gb|ACO39920.1|  kunitz trypsin inhibitor 3                            61.2    4e-08   Populus balsamifera [balsam poplar]
ref|XP_002305033.1|  trypsin protein inhibitor 3                      61.6    4e-08   Populus trichocarpa [western balsam poplar]
dbj|BAC23033.1|  kunitz-type trypsin inhibitor                        61.6    5e-08   Solanum tuberosum [potatoes]
gb|AAU09272.1|  Kunitz-type proteinase inhibitor group B              61.2    5e-08   Solanum tuberosum [potatoes]
gb|ACO40063.1|  kunitz trypsin inhibitor 3                            61.2    5e-08   Populus balsamifera [balsam poplar]
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            61.2    5e-08   Populus balsamifera [balsam poplar]
ref|XP_006351546.1|  PREDICTED: miraculin-like                        61.6    5e-08   
gb|ACO40066.1|  kunitz trypsin inhibitor 3                            60.8    5e-08   Populus balsamifera [balsam poplar]
emb|CAC00536.1|  Cathepsin D Inhibitor                                61.6    6e-08   Solanum lycopersicum
ref|XP_011014541.1|  PREDICTED: wound-responsive protein GWIN3-like   60.8    7e-08   
gb|AIT42166.1|  Kunitz-type inhibitor A                               61.2    7e-08   
sp|P58515.1|SPI2_SOLTU  RecName: Full=Serine protease inhibitor 2...  60.5    8e-08   Solanum tuberosum [potatoes]
ref|XP_006387700.1|  hypothetical protein POPTR_0664s00220g           60.8    8e-08   
gb|AIT42164.1|  Kunitz-type inhibitor A                               61.2    8e-08   
ref|XP_006372633.1|  hypothetical protein POPTR_0017s03430g           60.8    9e-08   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      60.8    9e-08   
gb|AIT42159.1|  Kunitz-type inhibitor A                               60.8    9e-08   
ref|XP_004137534.1|  PREDICTED: miraculin-like                        60.8    9e-08   
gb|ACO39914.1|  kunitz trypsin inhibitor 3                            60.5    9e-08   Populus balsamifera [balsam poplar]
gb|ACO39916.1|  kunitz trypsin inhibitor 3                            60.5    9e-08   Populus balsamifera [balsam poplar]
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            60.5    9e-08   Populus balsamifera [balsam poplar]
gb|AAU04570.1|  Kunitz-type proteinase inhibitor                      60.5    1e-07   Solanum tuberosum [potatoes]
gb|ACO39913.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39924.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39990.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|ACO40041.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39926.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
ref|XP_006493432.1|  PREDICTED: miraculin-like                        62.0    1e-07   
gb|ACO39979.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39918.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
gb|AAL60245.1|AF459080_1  putative Kunitz-type tuber invertase in...  60.5    1e-07   Solanum tuberosum [potatoes]
gb|ACO39917.1|  kunitz trypsin inhibitor 3                            60.1    1e-07   Populus balsamifera [balsam poplar]
ref|NP_001274943.1|  Kunitz-type protease inhibitor precursor         60.5    1e-07   
ref|XP_006372632.1|  hypothetical protein POPTR_0017s03420g           60.5    1e-07   
gb|AAZ94195.1|  Kunitz-type protease inhibitor precursor              60.5    1e-07   Solanum tuberosum [potatoes]
gb|ACO40010.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|AAZ94192.1|  Kunitz-type protease inhibitor precursor              60.5    1e-07   Solanum tuberosum [potatoes]
sp|O24383.1|CPI10_SOLTU  RecName: Full=Cysteine protease inhibito...  60.1    1e-07   Solanum tuberosum [potatoes]
ref|XP_008437058.1|  PREDICTED: miraculin-like                        60.1    1e-07   
gb|AAX47263.1|  Kunitz-type proteinase inhibitor group B1             60.1    1e-07   Solanum palustre
gb|AIT42157.1|  Kunitz-type inhibitor A                               60.5    1e-07   
ref|NP_001274866.1|  Kunitz-type enzyme inhibitor P4E1 precursor      60.5    1e-07   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        60.1    1e-07   
gb|ACO40051.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
sp|Q03197.1|API10_SOLTU  RecName: Full=Aspartic protease inhibito...  60.5    2e-07   Solanum tuberosum [potatoes]
ref|XP_010539107.1|  PREDICTED: 21 kDa seed protein-like              60.5    2e-07   
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            59.7    2e-07   Populus balsamifera [balsam poplar]
emb|CDP21779.1|  unnamed protein product                              60.1    2e-07   
ref|XP_002326088.2|  hypothetical protein POPTR_0019s14540g           59.7    2e-07   Populus trichocarpa [western balsam poplar]
gb|ACS92492.1|  Kunitz-type protease inhibitor KPI-C1                 59.7    2e-07   Populus trichocarpa x Populus nigra
gb|ACO39910.1|  kunitz trypsin inhibitor 3                            59.3    2e-07   Populus balsamifera [balsam poplar]
ref|XP_010918417.1|  PREDICTED: miraculin-like                        59.7    2e-07   
gb|ACO39944.1|  kunitz trypsin inhibitor 3                            59.3    2e-07   Populus balsamifera [balsam poplar]
gb|KHN10912.1|  Kunitz-type trypsin inhibitor KTI1                    60.5    2e-07   
gb|KHN10907.1|  Kunitz-type trypsin inhibitor KTI1                    60.5    2e-07   
gb|ACO39922.1|  kunitz trypsin inhibitor 3                            59.3    2e-07   Populus balsamifera [balsam poplar]
ref|XP_006372654.1|  hypothetical protein POPTR_0017s03600g           59.7    2e-07   
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            59.3    2e-07   Populus balsamifera [balsam poplar]
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            59.3    2e-07   Populus balsamifera [balsam poplar]
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   59.7    2e-07   
gb|ACO39928.1|  kunitz trypsin inhibitor 3                            59.3    2e-07   Populus balsamifera [balsam poplar]
gb|ACO39938.1|  kunitz trypsin inhibitor 3                            58.9    3e-07   Populus balsamifera [balsam poplar]
gb|ACO39937.1|  kunitz trypsin inhibitor 3                            58.9    3e-07   Populus balsamifera [balsam poplar]
ref|XP_009615974.1|  PREDICTED: miraculin-like                        59.7    3e-07   
gb|ACO40007.1|  kunitz trypsin inhibitor 3                            58.9    3e-07   Populus balsamifera [balsam poplar]
gb|ACS49839.1|  trypsin inhibitor 26 kDa isoform                      60.1    3e-07   Glycine max [soybeans]
gb|AIT42162.1|  Kunitz-type inhibitor A                               59.7    3e-07   
gb|ACO40008.1|  kunitz trypsin inhibitor 3                            58.9    3e-07   Populus balsamifera [balsam poplar]
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   59.3    3e-07   
gb|ACO39986.1|  kunitz trypsin inhibitor 3                            58.9    3e-07   Populus balsamifera [balsam poplar]
ref|XP_010683193.1|  PREDICTED: miraculin-like                        59.3    3e-07   
gb|ACO40053.1|  kunitz trypsin inhibitor 3                            58.9    3e-07   Populus balsamifera [balsam poplar]
gb|ACO40055.1|  kunitz trypsin inhibitor 3                            58.5    3e-07   Populus balsamifera [balsam poplar]
gb|ACO39927.1|  kunitz trypsin inhibitor 3                            58.5    3e-07   Populus balsamifera [balsam poplar]
gb|ACS92503.1|  Kunitz-type protease inhibitor KPI-C4                 58.9    4e-07   
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            58.5    4e-07   
gb|ADW95388.1|  Kunitz-type trypsin inhibitor                         58.9    4e-07   
ref|XP_010042449.1|  PREDICTED: miraculin-like                        60.1    4e-07   
gb|AAL85645.1|  trypsin inhibitor                                     58.2    4e-07   
gb|ACS92511.1|  Kunitz-type protease inhibitor KPI-C1.2               58.9    4e-07   
ref|XP_007041757.1|  21 kDa seed protein, putative                    59.3    4e-07   
ref|XP_003551520.1|  PREDICTED: trypsin inhibitor A-like              58.9    4e-07   
sp|P58519.1|API5_SOLTU  RecName: Full=Aspartic protease inhibitor...  59.3    4e-07   
gb|AIT42185.1|  Kunitz-type inhibitor B                               59.3    4e-07   
emb|CAI77772.1|  kunitz trypsin inhibitor                             58.9    4e-07   
gb|ABA81855.1|  kunitz-type protease inhibitor                        58.9    4e-07   
gb|ACS92516.1|  Kunitz-type protease inhibitor KPI-D12                58.9    4e-07   
emb|CAI77803.1|  kunitz trypsin inhibitor                             58.9    5e-07   
ref|XP_010037029.1|  PREDICTED: miraculin-like                        59.7    5e-07   
gb|AAX47267.1|  Kunitz-type proteinase inhibitor group B5             58.5    5e-07   
gb|ACO39929.1|  kunitz trypsin inhibitor 3                            58.2    5e-07   
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            58.2    5e-07   
ref|XP_010536414.1|  PREDICTED: miraculin-like                        58.9    5e-07   
ref|XP_009401850.1|  PREDICTED: miraculin-like                        58.5    5e-07   
gb|AAU09271.1|  Kunitz-type proteinase inhibitor group B              58.2    6e-07   
emb|CBI35471.3|  unnamed protein product                              60.5    6e-07   
ref|XP_009793041.1|  PREDICTED: miraculin-like                        58.5    7e-07   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        58.5    7e-07   
ref|NP_001234142.1|  cathepsin D inhibitor protein precursor          58.5    7e-07   
gb|AGW21713.1|  proteinase inhibitor                                  57.0    7e-07   
gb|AAL85648.1|  trypsin inhibitor                                     57.4    7e-07   
gb|ACO40016.1|  kunitz trypsin inhibitor 3                            57.8    8e-07   
gb|AAX47264.1|  Kunitz-type proteinase inhibitor group B2             57.8    8e-07   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        58.2    8e-07   
gb|AIT42212.1|  Kunitz-type inhibitor C                               58.2    8e-07   
gb|AAL85644.1|  trypsin inhibitor                                     57.4    8e-07   
emb|CAI77798.1|  kunitz trypsin inhibitor                             58.2    8e-07   
gb|AFL91226.1|  Kunitz-like protease inhibitor                        57.4    9e-07   
gb|ABK96560.1|  unknown                                               57.8    9e-07   
gb|AAM10492.1|  putative cysteine proteinase inhibitor precursor ...  58.2    9e-07   
gb|AFL91231.1|  Kunitz-like protease inhibitor                        57.4    9e-07   
ref|XP_006347376.1|  PREDICTED: miraculin-like                        57.8    9e-07   
gb|AIT42209.1|  Kunitz-type inhibitor C                               58.2    1e-06   
gb|AIT42210.1|  Kunitz-type inhibitor C                               58.2    1e-06   
gb|ABK96484.1|  unknown                                               57.8    1e-06   
ref|XP_004235410.1|  PREDICTED: cysteine protease inhibitor 10-like   58.2    1e-06   
ref|XP_010041215.1|  PREDICTED: miraculin-like                        57.8    1e-06   
gb|AAB28594.1|  PCPI 8.3=cysteine proteinase inhibitor                57.4    1e-06   
gb|AIT42161.1|  Kunitz-type inhibitor A                               57.8    1e-06   
gb|AFC88888.1|  Kunitz-type proteinase inhibitor group A1             57.4    1e-06   
gb|AFK41478.1|  unknown                                               57.8    1e-06   
ref|NP_001275465.1|  Kunitz-type protease inhibitor precursor         57.8    1e-06   
gb|ACO39911.1|  kunitz trypsin inhibitor 3                            57.0    1e-06   
ref|XP_003620188.1|  Miraculin                                        57.8    1e-06   
emb|CAI77774.1|  kunitz trypsin inhibitor                             57.8    1e-06   
gb|ACO39935.1|  kunitz trypsin inhibitor 3                            57.0    1e-06   
emb|CAI77764.1|  kunitz trypsin inhibitor                             57.4    1e-06   
gb|ACO39965.1|  kunitz trypsin inhibitor 3                            57.0    1e-06   
gb|ACO39912.1|  kunitz trypsin inhibitor 3                            57.0    1e-06   
gb|ACO40015.1|  kunitz trypsin inhibitor 3                            57.0    1e-06   
emb|CAI77783.1|  kunitz trypsin inhibitor                             57.4    1e-06   
emb|CAI77775.1|  kunitz trypsin inhibitor                             57.4    1e-06   
gb|ABX76297.1|  stigma expressed protein                              57.8    1e-06   
emb|CAI77793.1|  kunitz trypsin inhibitor                             57.4    2e-06   
emb|CAI77782.1|  kunitz trypsin inhibitor                             57.4    2e-06   
emb|CAI77777.1|  kunitz trypsin inhibitor                             57.4    2e-06   
emb|CAI77765.1|  kunitz trypsin inhibitor                             57.4    2e-06   
ref|XP_006478228.1|  PREDICTED: uncharacterized protein LOC102606959  58.9    2e-06   
gb|AAZ94185.1|  Kunitz-type protease inhibitor precursor              57.4    2e-06   
emb|CAI77770.1|  kunitz trypsin inhibitor                             57.0    2e-06   
ref|XP_004235415.1|  PREDICTED: serine protease inhibitor 5-like      57.0    2e-06   
dbj|BAC55863.1|  mwti1b                                               56.6    2e-06   
gb|AFR78144.1|  Isa                                                   56.6    2e-06   
sp|Q41015.2|PIP21_PEA  RecName: Full=Kunitz-type trypsin inhibito...  57.0    2e-06   
gb|AAL60246.1|AF459081_1  putative Kunitz-type tuber invertase in...  56.6    2e-06   
ref|XP_010683192.1|  PREDICTED: miraculin-like                        57.0    2e-06   
gb|ACS12828.1|  Kunitz-type proteinase inhibitor A4                   56.6    2e-06   
gb|AIT42165.1|  Kunitz-type inhibitor A                               57.0    2e-06   
ref|XP_003532233.1|  PREDICTED: kunitz-type trypsin inhibitor KTI...  56.6    3e-06   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   56.6    3e-06   
gb|AAM08398.1|AF490593_1  aspartic proteinase inhibitor precursor...  56.6    3e-06   
dbj|BAA04148.1|  proteinase inhibitor                                 56.6    3e-06   
gb|ACL12055.1|  Kunitz trypsin inhibitor                              56.6    3e-06   
gb|AIT42175.1|  Kunitz-type inhibitor B                               56.6    3e-06   
ref|XP_009803614.1|  PREDICTED: miraculin-like                        56.6    3e-06   
gb|AAN04125.1|  Kunitz-type proteinase inhibitor precursor            56.2    3e-06   
ref|NP_001275020.1|  aspartic protease inhibitor 7 precursor          56.6    3e-06   
ref|XP_002888920.1|  hypothetical protein ARALYDRAFT_476458           56.6    3e-06   
pdb|1AVA|C  Chain C, Amy2BASI PROTEIN-Protein Complex From Barley...  55.8    3e-06   
gb|ACS12829.1|  Kunitz-type proteinase inhibitor A5                   56.2    3e-06   
emb|CAI77768.1|  kunitz trypsin inhibitor                             56.6    3e-06   
gb|AAM10493.1|  putative cysteine proteinase inhibitor precursor ...  56.2    4e-06   
pir||JC5562  trypsin inhibitor ETIb precursor - Erythrina variegata   56.2    4e-06
sp|P07596.2|IAAS_HORVU  RecName: Full=Alpha-amylase/subtilisin in...  56.2    4e-06   
gb|AAX47266.1|  Kunitz-type proteinase inhibitor group B4             55.8    4e-06   
emb|CAA78305.1|  bifunctional alpha-amylase/subtilisin inhibitor      55.8    4e-06   
ref|XP_006362668.1|  PREDICTED: aspartic protease inhibitor 5-like    56.2    4e-06   
gb|ACR54296.1|  Kunitz-type proteinase inhibitor group A3             55.8    4e-06   
sp|O82711.1|PIP22_PEA  RecName: Full=Kunitz-type trypsin inhibito...  56.2    4e-06   
prf||1210227A  amylase subtilisin inhibitor alpha                     55.5    5e-06
gb|AIT42155.1|  Kunitz-type inhibitor A                               56.2    5e-06   
sp|P68171.1|IDE3_ERYLA  RecName: Full=Trypsin inhibitor DE-3          55.5    5e-06   
sp|P09943.1|IDE3_ERYCA  RecName: Full=Trypsin inhibitor DE-3          55.1    5e-06   
gb|AAL85661.1|  trypsin inhibitor                                     55.1    5e-06   
emb|CAI77766.1|  kunitz trypsin inhibitor                             55.8    5e-06   
ref|XP_009782174.1|  PREDICTED: miraculin-like                        55.8    6e-06   
ref|XP_004237191.1|  PREDICTED: miraculin-like                        55.8    6e-06   
gb|ACR54294.1|  Kunitz-type proteinase inhibitor group A1             55.5    6e-06   
ref|XP_003532234.1|  PREDICTED: uncharacterized LOC100500599          55.5    6e-06   
emb|CDY19181.1|  BnaC05g13820D                                        55.5    6e-06   
gb|AFX67012.1|  aspartic protease inhibitor 5                         55.8    6e-06   
gb|ACU15724.1|  unknown                                               55.5    6e-06   
ref|XP_006441469.1|  hypothetical protein CICLE_v10024002mg           55.8    7e-06   
gb|ACU19069.1|  unknown                                               55.5    7e-06   
gb|AIT42160.1|  Kunitz-type inhibitor A                               55.8    7e-06   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 55.5    7e-06   
gb|ACO40021.1|  kunitz trypsin inhibitor 3                            55.1    7e-06   
gb|AFL91233.1|  Kunitz-like protease inhibitor                        54.7    7e-06   
emb|CAH59168.1|  kunitz trypsin inhibitor TI3                         55.5    7e-06   
sp|P81366.1|IDE3_ERYVA  RecName: Full=Trypsin inhibitor DE-3; Alt...  54.7    8e-06   
gb|ABK96508.1|  unknown                                               55.1    8e-06   
emb|CDY26209.1|  BnaA06g12080D                                        55.1    8e-06   
gb|AAM10490.1|  aspartic proteinase inhibitor precursor P7E9          54.7    8e-06   
gb|KHM99741.1|  Miraculin                                             55.1    8e-06   
gb|AFL91232.1|  Kunitz-like protease inhibitor                        54.7    9e-06   
ref|XP_009149240.1|  PREDICTED: miraculin                             55.1    9e-06   
gb|AFL91227.1|  Kunitz-like protease inhibitor                        54.7    9e-06   
gb|ABK01288.1|  miraculin-like protein                                55.1    9e-06   
ref|XP_006441467.1|  hypothetical protein CICLE_v10022124mg           55.5    9e-06   
gb|AAL85652.1|  trypsin inhibitor                                     54.3    1e-05   
gb|AFC88891.1|  Kunitz-type proteinase inhibitor group A1             54.7    1e-05   
gb|ACS12830.1|  Kunitz-type proteinase inhibitor A6                   54.7    1e-05   
ref|XP_006478132.1|  PREDICTED: 21 kDa seed protein-like              55.1    1e-05   
gb|AAL85651.1|  trypsin inhibitor                                     53.9    1e-05   
ref|XP_011046091.1|  PREDICTED: miraculin-like                        55.1    1e-05   
sp|Q41480.2|API1_SOLTU  RecName: Full=Aspartic protease inhibitor...  55.1    1e-05   
gb|AFR54471.1|  miraculin-like protein 2                              55.1    1e-05   
emb|CAB94854.1|  inhibitor of yeast proteinase A                      54.7    1e-05   
gb|AFK39112.1|  unknown                                               55.1    1e-05   
gb|AIT42167.1|  Kunitz-type inhibitor A/B                             54.7    1e-05   
gb|AGF39575.1|  Kunitz-type protease inhibitor C                      54.3    1e-05   
ref|XP_006347379.1|  PREDICTED: miraculin-like                        54.7    1e-05   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            55.1    1e-05   
ref|XP_006847953.1|  hypothetical protein AMTR_s00029p00141480        54.3    1e-05   
gb|KHM99735.1|  Miraculin                                             53.9    1e-05   
ref|XP_004299457.1|  PREDICTED: miraculin-like                        54.7    1e-05   
ref|XP_006477858.1|  PREDICTED: 21 kDa seed protein-like isoform X1   54.7    1e-05   
emb|CAI77785.1|  kunitz trypsin inhibitor                             54.7    2e-05   
ref|XP_003548289.1|  PREDICTED: miraculin-like                        54.3    2e-05   
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like              54.3    2e-05   
gb|AAT45474.1|  Kunitz proteinase inhibitor-1                         54.3    2e-05   
gb|AAL85643.1|  trypsin inhibitor                                     53.5    2e-05   
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         54.7    2e-05   
gb|AAL85650.1|  trypsin inhibitor                                     53.5    2e-05   
gb|AAL85637.1|  trypsin inhibitor                                     53.5    2e-05   
ref|XP_006347377.1|  PREDICTED: miraculin-like                        54.3    2e-05   
emb|CAA31578.1|  p340/p34021                                          54.7    2e-05   
gb|AEK26927.1|  Kunitz-type trypsin inhibitor B4                      54.3    2e-05   
emb|CAI77767.1|  kunitz trypsin inhibitor                             54.3    2e-05   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            53.5    2e-05   
ref|XP_003534081.1|  PREDICTED: miraculin-like                        54.3    2e-05   
emb|CAI77771.1|  kunitz trypsin inhibitor                             54.3    2e-05   
gb|KHN13525.1|  Trypsin inhibitor A                                   53.9    2e-05   
gb|AAL99261.1|  aspartic proteinase inhibitor P2B4                    53.5    2e-05   
gb|AIT42168.1|  Kunitz-type inhibitor B                               54.3    2e-05   
ref|NP_001236724.1|  uncharacterized protein LOC100527742 precursor   54.7    2e-05   
gb|KHM99743.1|  Miraculin                                             53.9    2e-05   
gb|ABG47463.1|  vegetative storage protein                            54.3    2e-05   
sp|P16347.1|IAAS_WHEAT  RecName: Full=Endogenous alpha-amylase/su...  53.5    2e-05   
gb|ACR54295.1|  Kunitz-type proteinase inhibitor group A2             53.5    2e-05   
ref|NP_001266050.1|  kunitz-type trypsin inhibitor-like 2 protein...  53.9    2e-05   
gb|KEH25327.1|  Kunitz type trypsin inhibitor / Alpha-fucosidase      55.1    2e-05   
emb|CAJ21342.1|  kunitz trypsin inhibitor TI                          53.9    2e-05   
emb|CAI77800.1|  kunitz trypsin inhibitor                             53.9    2e-05   
gb|AFM38167.1|  Kunitz-type protease inhibitor group A                53.5    2e-05   
sp|P32877.1|IT1B_PSOTE  RecName: Full=Trypsin inhibitor 1B; AltNa...  53.1    3e-05   
ref|XP_006477860.1|  PREDICTED: 21 kDa seed protein-like              53.9    3e-05   
gb|KDO40852.1|  hypothetical protein CISIN_1g046118mg                 53.9    3e-05   
sp|O24385.1|CPI7_SOLTU  RecName: Full=Cysteine protease inhibitor...  53.1    3e-05   
ref|XP_011041831.1|  PREDICTED: wound-responsive protein GWIN3-like   53.5    3e-05   
dbj|BAB63285.1|  Kunitz trypsin inhibitor                             53.5    3e-05   
ref|XP_008437071.1|  PREDICTED: miraculin-like                        53.5    4e-05   
gb|AIT42189.1|  Kunitz-type inhibitor B                               52.4    4e-05   
ref|XP_003620184.1|  Pathogen-inducible trypsin-inhibitor-like pr...  53.1    4e-05   
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     53.1    4e-05   
dbj|BAE79511.1|  miraculin-like protein 2                             53.5    4e-05   
gb|AAG12337.1|  cathepsin D inhibitor                                 52.8    4e-05   
sp|P16348.1|API11_SOLTU  RecName: Full=Aspartic protease inhibito...  52.8    4e-05   
gb|ACR54298.1|  Kunitz-type proteinase inhibitor group A5             52.8    4e-05   
emb|CDP20822.1|  unnamed protein product                              53.1    5e-05   
gb|KHM99737.1|  Miraculin                                             53.1    5e-05   
ref|XP_006441465.1|  hypothetical protein CICLE_v10022129mg           53.1    5e-05   
emb|CAH59184.1|  kunitz trypsin inhibitor TI3                         52.8    5e-05   
dbj|BAF95190.1|  Kunitz trypsin inhibitor                             53.1    5e-05   
ref|XP_003534079.1|  PREDICTED: miraculin-like                        52.8    5e-05   
emb|CAH59144.1|  kunitz trypsin inhibitor TI3                         52.8    5e-05   
gb|AAQ84216.1|  Kunitz trypsin inhibitor 3                            52.8    5e-05   
emb|CDO98552.1|  unnamed protein product                              52.8    5e-05   
gb|AAL85659.1|  trypsin inhibitor                                     52.0    5e-05   
ref|XP_010683195.1|  PREDICTED: miraculin-like                        53.1    6e-05   
dbj|BAF95193.1|  Kunitz trypsin inhibitor                             53.1    6e-05   
emb|CAH59188.1|  kunitz trypsin inhibitor TI3                         52.8    6e-05   
pdb|4J2K|A  Chain A, Crystal Structure Of A Plant Trypsin Inhibit...  52.4    6e-05   
ref|NP_001236355.1|  uncharacterized protein LOC100500579 precursor   52.8    6e-05   
sp|P81365.1|IT1B_ERYVA  RecName: Full=Trypsin inhibitor 1B; AltNa...  52.0    6e-05   
dbj|BAF95191.1|  Kunitz trypsin inhibitor                             52.8    7e-05   
ref|NP_001236001.1|  uncharacterized protein LOC100527176 precursor   52.8    7e-05   
ref|XP_006347378.1|  PREDICTED: miraculin-like                        52.4    7e-05   
gb|ACO40080.1|  kunitz trypsin inhibitor 4                            52.0    7e-05   
gb|AAK20289.1|AF314823_1  Kunitz trypsin inhibitor                    52.8    7e-05   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      52.8    7e-05   
ref|NP_001235651.1|  uncharacterized protein LOC100527408 precursor   52.8    7e-05   
emb|CDP18338.1|  unnamed protein product                              52.4    8e-05   
dbj|BAD04941.1|  Kunitz trypsin inhibitor                             52.4    8e-05   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      52.8    8e-05   
pdb|2IWT|B  Chain B, Thioredoxin H2 (Hvtrxh2) In A Mixed Disulfid...  52.0    8e-05   
ref|NP_001238220.1|  trypsin inhibitor subtype B precursor            52.4    8e-05   
ref|NP_001236752.1|  trypsin inhibitor subtype A precursor            52.4    8e-05   
gb|AEK31196.1|  miraculin-like protein 2                              51.6    8e-05   
dbj|BAD04942.1|  Kunitz trypsin inhibitor                             52.4    9e-05   
emb|CAH59175.1|  kunitz trypsin inhibitor TI3                         52.4    9e-05   
emb|CAH59186.1|  kunitz trypsin inhibitor TI3                         52.4    9e-05   
ref|XP_003534080.1|  PREDICTED: miraculin-like                        52.0    9e-05   
sp|P10821.1|IT1A_PSOTE  RecName: Full=Trypsin inhibitor 1A; AltNa...  51.6    9e-05   
gb|ACS92504.1|  Kunitz-type protease inhibitor KPI-C2.1               52.4    9e-05   



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   207 bits (526),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNPTHS FNPIRL  A +T     PVLD +GD +R GE Y++ S   GA  GG++L  LD
Sbjct  16   PNPTHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI ITPA +P ATVV+PST+Q+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 137/190 (72%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+VV+SR     GDPI ITPA +P +TVV+PSTFQ+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVVVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   206 bits (524),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 137/190 (72%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI ITPA +P +TVV+PSTFQ+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 137/190 (72%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI ITPA +P ATVV+PST+Q+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   206 bits (524),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 137/190 (72%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI ITPA +P +TVV+PSTFQ+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   206 bits (524),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 137/190 (72%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI ITPA +P ATVV+PST+Q+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   206 bits (523),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 138/190 (73%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNPTHS FNPIRL  A +T     PVLD +GD +R GE Y++ S   GA  GG++L  LD
Sbjct  16   PNPTHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI ITPA +P +TVV+PST+Q+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   204 bits (518),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 136/189 (72%), Gaps = 9/189 (5%)
 Frame = -1

Query  728  NPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDS  564
            NP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LDS
Sbjct  17   NPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDS  76

Query  563  AT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWR  390
            ++ +CAS+V++SR     GDPI ITPA +P +TVV+PSTFQ+F F +AT++LCV++V W 
Sbjct  77   SSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNWG  135

Query  389  IRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDESA  213
            I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D   
Sbjct  136  IKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLT  195

Query  212  GAARLALTE  186
             A RLAL+ 
Sbjct  196  RATRLALSN  204



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   203 bits (517),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 136/189 (72%), Gaps = 9/189 (5%)
 Frame = -1

Query  728  NPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDS  564
            NP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LDS
Sbjct  17   NPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDS  76

Query  563  AT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWR  390
            ++ +CAS+V++SR     GDPI ITPA +P +TVV+PSTFQ+F F +AT++LCV++V W 
Sbjct  77   SSNECASDVMVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNWG  135

Query  389  IRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDESA  213
            I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D   
Sbjct  136  IKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLT  195

Query  212  GAARLALTE  186
             A RLAL+ 
Sbjct  196  RATRLALSN  204



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDP  ITPA +P ATVV+PST+Q+F F +AT++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPTTITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIE V   LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   203 bits (516),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 132/190 (69%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   G   GG +LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEIRAGGNYYMVSAIWGVGGGGPRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   201 bits (511),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 9/190 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADDT-----PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRL  A +T     PVLD +GD +R GE Y+I S   GA  GG++L  LD
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  566  SAT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            S++ +CAS+V++SR     GDPI I PA +P +TVV+PSTFQ+F F + T++LCV++V W
Sbjct  76   SSSNECASDVIVSRSDFDNGDPITIRPA-DPESTVVMPSTFQTFRFSIPTNKLCVNNVNW  134

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D  
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  215  AGAARLALTE  186
              A RLAL+ 
Sbjct  195  TRATRLALSN  204



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   201 bits (511),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 136/189 (72%), Gaps = 9/189 (5%)
 Frame = -1

Query  728  NPTHSTFNPIRLPTA-----DDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDS  564
            NP +S FNPIRL  A      +TPVLD +GD +R GE Y+I S   GA  GG++L  LDS
Sbjct  17   NPAYSKFNPIRLRPARETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLDS  76

Query  563  AT-KCASNVVISRP-LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWR  390
            ++ +CAS+V++SR     GDPI ITPA +P +TVV+PSTFQ+F F +AT++LCV++V W 
Sbjct  77   SSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNVNWG  135

Query  389  IRYDQPSGQYFLSSGEFVSDISGQFKIEVAPE-LNAYKITYCPFGGHICYNVGRYFDESA  213
            I++D  SGQYF+ +GEFVSD S QFKIEV  + LNAYKI+YC FG   C+NVGRY+D   
Sbjct  136  IKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPLT  195

Query  212  GAARLALTE  186
             A RLAL+ 
Sbjct  196  RATRLALSN  204



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
            +   RLAL+ 
Sbjct  198  SRTTRLALSN  207



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   197 bits (500),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP H  FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHPRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVVL ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
            RI++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  RIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL++
Sbjct  198  LRTTRLALSD  207



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   196 bits (498),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVVL ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL++
Sbjct  198  LRTTRLALSD  207



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   196 bits (497),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPSSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P ++V++ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             IR+D  SGQYFL +GEFVSD S QFKIEV    LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  MRTTRLALSN  207



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCA++V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVVL ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   194 bits (494),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I+ D  SGQYFL +GEFVSD S QFKIE V   LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
                R+AL+ 
Sbjct  198  LRTTRIALSN  207



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V+IS   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   194 bits (493),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I+ D  SGQYFL +GEFVSD S QFKIE V   LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
                R+AL+ 
Sbjct  198  LRTTRIALSN  207



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   194 bits (492),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADD-----TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT  +     TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPPSSQTPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPAA-EPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPAA +P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   194 bits (492),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPL  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  MRTTRLALSN  207



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   193 bits (491),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   193 bits (491),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVVL ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEV-APELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   C+NVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 134/190 (71%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPAA-EPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L +GDPI ITPAA +P +TVV+  T+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITP+ A+P ++V++ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 132/189 (70%), Gaps = 8/189 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I+ D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDPM  197

Query  215  AGAARLALT  189
                RLAL+
Sbjct  198  LRTTRLALS  206



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   190 bits (483),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 126/189 (67%), Gaps = 8/189 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++     GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVYAILGACGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
                CAS+V++S   L  GD I ITPA  +P ATVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   LMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I+YD  SGQ  L +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDPM  197

Query  215  AGAARLALT  189
                RLAL+
Sbjct  198  LRTTRLALS  206



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 130/190 (68%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +A ++LCV +V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVKNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL  GEFVSD S QFKIEV    LN YK+TYC FG   CYN GR+ D  
Sbjct  138  GIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 131/190 (69%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPTADD-----TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT  +     TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPPPSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V +S   L  GDPI ITP+ A+P ++V++ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 126/189 (67%), Gaps = 8/189 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAILGACGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
                CAS+V++S   L  GD I ITPA  +P ATVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   LMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I+YD  S Q  L +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPM  197

Query  215  AGAARLALT  189
                RLA++
Sbjct  198  LRTTRLAIS  206



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   188 bits (478),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 133/190 (70%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++L  LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLGHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN+YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVGRFHDHM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   188 bits (478),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 132/190 (69%), Gaps = 8/190 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++L V++V W
Sbjct  78   MMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDES  216
             I++D  SGQYFL +GEFVSD S QFKIE V   LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  215  AGAARLALTE  186
                RLAL+ 
Sbjct  198  LRTTRLALSN  207



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 130/186 (70%), Gaps = 8/186 (4%)
 Frame = -1

Query  719  HSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK  555
            HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD  +K
Sbjct  2    HSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSK  61

Query  554  CASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRY  381
            CAS+V++S   L  GDPI ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W I++
Sbjct  62   CASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQH  121

Query  380  DQPSGQYFLSSGEFVSDISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDESAGAA  204
            D  SGQYFL +GEFVSD S QFKIE V   LN YK+TYC FG   CYNVGR+ D      
Sbjct  122  DSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTT  181

Query  203  RLALTE  186
            RLAL+ 
Sbjct  182  RLALSN  187



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   186 bits (472),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 130/189 (69%), Gaps = 8/189 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
              +KCAS+V++S   L  GDPI ITPA A+P ATVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I+YD  S Q  L +GEFVSD S QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPM  197

Query  215  AGAARLALT  189
                RLAL+
Sbjct  198  LRTTRLALS  206



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 125/189 (66%), Gaps = 8/189 (4%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSGFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYLVSAILGACGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
                CAS+V++S   L  GD I ITPA  +P ATVV+ ST+Q+F F +AT++LCV++V W
Sbjct  78   LMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSGQYFLSSGEFVSDISGQFKIEVA-PELNAYKITYCPFGGHICYNVGRYFDES  216
             I+YD  S Q  L +GE VSD + QFKIEV    LN YK+TYC FG   CYNVGR+ D  
Sbjct  138  GIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPM  197

Query  215  AGAARLALT  189
                RLAL+
Sbjct  198  LRTTRLALS  206



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -1

Query  506  IRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD  330
            I ITPA A+P +TVV+ ST+Q+F F +AT++LCV++V W I++D  SGQYFL +GEFVSD
Sbjct  1    ITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQHDSASGQYFLKAGEFVSD  60

Query  329  ISGQFKIE-VAPELNAYKITYCPFGGHICYNVGRYFDESAGAARLALTE  186
             S QFKIE V   LN YK+TYC FG   CYNVGR+ D      RLAL+ 
Sbjct  61   NSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSN  109



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score =   123 bits (309),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 93/129 (72%), Gaps = 7/129 (5%)
 Frame = -1

Query  731  PNPTHSTFNPIRLPT-----ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLD  567
            PNP HS FNPIRLPT     + +TPVLD +GD +R G  Y++ S   GA  GG++LA LD
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  566  SATKCASNVVIS-RPLTEGDPIRITPA-AEPNATVVLPSTFQSFAFFVATSRLCVSSVFW  393
            + +KCAS+V++S   L  GDPI ITPA A+P +TVVL ST+Q+F F +AT++LCV++V W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  392  RIRYDQPSG  366
             I++D  SG
Sbjct  138  GIQHDSASG  146



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score =   110 bits (276),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -1

Query  488  AEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFKI  309
              P +TVV+ ST+Q+F F +AT++LCV++V W I+YD  S Q  L +GEFVSD S QFKI
Sbjct  58   GRPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKI  117

Query  308  EVA-PELNAYKITYCPFGGHICYNVGRYFDESAGAARLALT  189
            EV    LN YK+TYC FG   CYNVGR+ D      RLAL+
Sbjct  118  EVVDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALS  158



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 96/189 (51%), Gaps = 24/189 (13%)
 Frame = -1

Query  710  FNPIRLPTADDT---PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNV  540
            FNP  LP A +    PVLD +G  LR G  Y+I    RG   GG+ +A + + T C  +V
Sbjct  18   FNP--LPGAAEAAPDPVLDIEGKQLRSGVDYYILPVIRGRG-GGLTVASVRNKT-CPLDV  73

Query  539  VISR-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQ  363
            V  +  ++ G P+  TP   P   V+  ST  +  F  AT  +C  S  W++ YD+ +GQ
Sbjct  74   VQDKLEVSHGLPLTFTPV-NPKQDVIRVSTDHNIKFSAAT--ICAQSTVWKLEYDESTGQ  130

Query  362  YFLSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             F+++G    +     +S  FKIE   +   YK+ +CP    F   IC +VG Y  +  G
Sbjct  131  RFITTGGVEGNPGRGTLSNWFKIEKYGD--DYKLVFCPTVCNFCKVICRDVGVYIQK--G  186

Query  209  AARLALTED  183
              RLALT D
Sbjct  187  YRRLALTTD  195



>gb|AIT42186.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=213

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 65/187 (35%), Positives = 87/187 (47%), Gaps = 11/187 (6%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L P  +Y I S GRGA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLPS-DATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGPHIFEDELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG--HICYNVGRYFDESAGAA  204
              G   L +G  +    S  FKI  + +L  Y + YCPF      C  VG       G  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPFSSDDQFCLKVGVV--HQNGKR  195

Query  203  RLALTED  183
            RLAL +D
Sbjct  196  RLALVKD  202



>sp|Q41484.1|SPI5_SOLTU RecName: Full=Serine protease inhibitor 5; AltName: Full=gCDI-B1; 
Flags: Precursor [Solanum tuberosum]
 dbj|BAA04152.1| proteinase inhibitor [Solanum tuberosum]
 gb|ABB72795.1| Kunitz-type protease inhibitor-like protein [Solanum tuberosum]
 gb|AIT42169.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=213

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 86/187 (46%), Gaps = 11/187 (6%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L P  +Y I S GRGA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLPS-DATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++T +LCVS   W++  YD 
Sbjct  79   GVFRFNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG--HICYNVGRYFDESAGAA  204
              G   L +G  +    S  FKI  + +L  Y + YCPF      C  VG       G  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPFSSDDQFCLKVGVV--HQNGKR  195

Query  203  RLALTED  183
            RLAL +D
Sbjct  196  RLALVKD  202



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 89/173 (51%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI-SRPLTEGDPIRI  498
            PVLDT+G  LR G  Y+I    RG   GG+ LA   + + C  +VV   + ++ G P+  
Sbjct  30   PVLDTEGKKLRSGVDYYILPVFRGRG-GGLTLASTGNES-CPLDVVQEQQEVSNGLPLTF  87

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ+F+++G    +    
Sbjct  88   TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQWFVTTGGVEGNPGRE  144

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE   +   YK+ +CP    F   +C ++G Y     G  RLAL++
Sbjct  145  TLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQN--GYRRLALSD  193



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 88/173 (51%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI-SRPLTEGDPIRI  498
            PVLDT+G  LR G  Y+I    RG   GG+ LA   + T C  +VV   + ++ G P+  
Sbjct  30   PVLDTEGKKLRSGVDYYILPVFRGRG-GGLTLASTGNET-CPLDVVQEQQEVSNGLPLTF  87

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +    
Sbjct  88   TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRE  144

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE   +   YK+ +CP    F   +C ++G Y     G  RLAL++
Sbjct  145  TLDNWFKIEKYDD--DYKLVFCPTVCDFCKPVCGDIGIYIQN--GYRRLALSD  193



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 65/186 (35%), Positives = 93/186 (50%), Gaps = 20/186 (11%)
 Frame = -1

Query  707  NPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR  528
            +P+     +  PVLDTD + +R G  Y+I    RG   GG+ LA   + T C  +VV  +
Sbjct  20   SPLSAAAEEPAPVLDTDRNLVRAGVDYYILPVIRGRG-GGLTLASTGNET-CPLDVVQEQ  77

Query  527  -PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFL  354
              +  G P+   P   P   VV  ST Q+  F  AT  +CV S  W++  YD  +G+YF+
Sbjct  78   LEVRNGLPLTFRP-VNPKKGVVRVSTDQNIKFSGAT--ICVQSTVWKLDNYDASTGKYFI  134

Query  353  SSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAAR  201
            ++G          IS  FKIE   +   YK+ +CP    +   IC +VG +  +  G  R
Sbjct  135  TTGGVEGKPGRETISNWFKIETYGD--DYKLVFCPTVCNYCKVICKDVGIFMQD--GKRR  190

Query  200  LALTED  183
            LALTED
Sbjct  191  LALTED  196



>gb|ABB72793.1| Kunitz-type protease inhibitor-like protein [Solanum tuberosum]
Length=213

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 85/187 (45%), Gaps = 11/187 (6%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L P  +Y I S GRGA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLPS-DATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++T +LC S   W++  YD 
Sbjct  79   GVFRFNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVKLCASYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG--HICYNVGRYFDESAGAA  204
              G   L +G  +    S  FKI  + +L  Y + YCPF      C  VG       G  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPFSSDDQFCLKVGVV--HQNGKR  195

Query  203  RLALTED  183
            RLAL +D
Sbjct  196  RLALVKD  202



>ref|XP_004234308.1| PREDICTED: serine protease inhibitor 5-like [Solanum lycopersicum]
Length=217

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 89/167 (53%), Gaps = 15/167 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLA-WLDSATKCAS  546
            T ++ N I LP+A +  VLDT+G+AL PG +Y I S GRGAA G V L    +S+  C +
Sbjct  21   TFTSQNLIDLPSATNKLVLDTNGNALDPGASYHIVSIGRGAAGGDVYLGPSPNSSAPCPN  80

Query  545  NVV-----ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-R  384
             V      + RP+  G P+R    ++ +   +  +   +  F +ATSRLCV    W+I  
Sbjct  81   GVFRYNSDVGRPI--GTPVRFITKSDHS---IFENQDVNIQFDIATSRLCVIYANWKIGD  135

Query  383  YDQPSGQYFLSSGEFVSD-ISGQFKIEVAPELNAYKITYCPFGGHIC  246
            YD   G   L +G  + +  S  FKI  A E ++Y + YCP G  +C
Sbjct  136  YDVSLGARLLETGGTLGEGDSSWFKIVKASE-SSYHLLYCP-GPFVC  180



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLDT+G  LR G  Y+I    RG   GG+ LA   +   C  +VV  +  ++ G P+  
Sbjct  30   PVLDTEGKQLRSGVDYYILPVIRGRG-GGLTLASTGNEN-CPLDVVQEQHEVSNGLPLTF  87

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +    
Sbjct  88   TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGXE  144

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE   +   YK+ +CP    F   +C ++G Y     G  RLAL++
Sbjct  145  TLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQN--GYRRLALSD  193



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI-SRPLTEGDPIRI  498
            PVLDT+G  LR G  Y+I    RG   GG+ LA   + T C  +VV   + ++ G P+  
Sbjct  52   PVLDTEGKKLRSGVDYYILPVFRGRG-GGLTLASTGNET-CPLDVVQEQQEVSNGLPLTF  109

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +    
Sbjct  110  TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRE  166

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE     + YK+ +CP    F   +C ++G Y        RLAL++
Sbjct  167  TLDNWFKIEKYE--DDYKLVFCPTVCDFCKPVCGDIGIYIQNE--YRRLALSD  215



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI-SRPLTEGDPIRI  498
            PVLDT+G  LR G  Y+I    RG   GG+ LA   + T C  +VV   + ++ G P+  
Sbjct  30   PVLDTEGKKLRSGVDYYILPVFRGRG-GGLTLASTGNET-CPLDVVQEQQEVSNGLPLTF  87

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +    
Sbjct  88   TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRE  144

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE     + YK+ +CP    F   +C ++G Y        RLAL++
Sbjct  145  TLDNWFKIEKYE--DDYKLVFCPTVCDFCKPVCGDIGIYIQNE--YRRLALSD  193



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 58/173 (34%), Positives = 87/173 (50%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI-SRPLTEGDPIRI  498
            PVLDT+G  LR G  Y+I    RG   GG+ LA   + T C  +VV   + ++ G P+  
Sbjct  30   PVLDTEGKKLRSGVDYYILPVFRGRG-GGLTLASTGNET-CPLDVVQEQQEVSNGLPLTF  87

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +    
Sbjct  88   TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRE  144

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE   +   YK+ +CP    F   +C ++G Y        RLAL++
Sbjct  145  TLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQNX--YRRLALSD  193



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 83/173 (48%), Gaps = 14/173 (8%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRIT  495
            PVLD  G  LR G  Y+I    RG   GG+ LA   + T   S V     L +G P+   
Sbjct  32   PVLDISGKELRAGVNYYILPVIRGRG-GGLSLASTGNNTCPLSVVQEQSELKKGLPLTFH  90

Query  494  PAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD-----  330
            P  +P   VV  ST  +  F  + S +CV S  WR+  D+ +G+YF+++G    +     
Sbjct  91   PV-DPKKGVVRLSTDHNIKF--SASTICVQSTVWRLDNDESTGKYFVNTGGVEGNPGSGS  147

Query  329  ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTED  183
            IS  FKIE A   + YK+ +CP    F   IC +VG    +      L LT+D
Sbjct  148  ISNWFKIE-AYGSSDYKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLTLTDD  199



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/181 (33%), Positives = 90/181 (50%), Gaps = 15/181 (8%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-  528
            P+    A D PVLDT+G  L+    Y+I S  R    GG+ LA   + T C  +VV  + 
Sbjct  21   PVAAEAAPD-PVLDTEGKKLQSEVDYYILSVIRRRGGGGLTLASTGNKT-CPLDVVQEQN  78

Query  527  PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSS  348
             ++ G  +  +P   P   V+  ST  +  F  AT  +CV S  W++ YD+ SGQ+F ++
Sbjct  79   EVSNGLTLMFSPV-NPKKGVIRVSTDHNIEFSAAT--ICVQSTVWKLEYDESSGQWFFTT  135

Query  347  GEFVSD-----ISGQFKIEVAPELN--AYKITYCPFGGHICYNVGRYFDESAGAARLALT  189
            G    +     +S QFKIE   + N   +  T C F   +C ++G Y  +  G   LAL+
Sbjct  136  GWVEGNLGRGTLSNQFKIEKYEDDNNLVFCPTVCDFCKPVCGDIGIYIQD--GYRHLALS  193

Query  188  E  186
            +
Sbjct  194  D  194



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 92/175 (53%), Gaps = 19/175 (11%)
 Frame = -1

Query  677  TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIR  501
            +PVLD  G+ L+ G  Y+I    RG   GG+ LA   + T C  +VV  +  ++ G  ++
Sbjct  32   SPVLDITGNKLQTGVNYYILPVIRGRG-GGLTLASTSNKTSCPLDVVQEQNEVSNGLSLK  90

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD--  330
             +P       VVL ST  +  F  + + +CV S  W++ ++D+ +GQ+F++SG    +  
Sbjct  91   FSPVNVTKG-VVLVSTDLNIKF--SATTICVQSTVWKLGKFDEQTGQWFVTSGGVEGNPG  147

Query  329  ---ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
                S  FKIE   +   YK+ +CP    F   IC +VG +F +  G  RLAL++
Sbjct  148  RQTTSNWFKIEKFGD--DYKLVFCPTVCNFCKVICRDVGIFFQD--GKRRLALSD  198



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 86/173 (50%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLDT+G  L  G  Y+I    RG   GG+ LA   +   C  +VV  +  ++ G P+  
Sbjct  30   PVLDTEGKQLWSGVDYYILPVIRGRG-GGLTLASTGNEN-CPLDVVQEQHEVSNGLPLTF  87

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
            TP   P   V+  ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +    
Sbjct  88   TPV-NPKKGVIRVSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGHE  144

Query  329  -ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +   FKIE   +   YK+ +CP    F   +C ++G Y     G  RLAL++
Sbjct  145  TLDNWFKIEKYED--DYKLVFCPTVCDFCKPVCGDIGIYIQN--GYRRLALSD  193



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 92/175 (53%), Gaps = 19/175 (11%)
 Frame = -1

Query  677  TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIR  501
            +PVLD  G+ L+ G  Y+I    RG   GG+ LA   + T C  +VV  +  ++ G P++
Sbjct  32   SPVLDITGNKLQTGVDYYILPVIRGRG-GGLTLASTSNKTSCPLDVVQEQNEVSNGLPLK  90

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD--  330
             +P       VV  ST  +  F  + + +CV S  W++ ++D+ +GQ+F++SG    +  
Sbjct  91   FSPVNVTKG-VVRVSTDLNIKF--SATTICVQSTVWKLGKFDEQTGQWFVTSGGVEGNPG  147

Query  329  ---ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
                S  FKIE   +   YK+ +CP    F   IC +VG +F +  G  RLAL++
Sbjct  148  RQTTSNWFKIEKFGD--DYKLVFCPTVCNFCKVICGDVGIFFQD--GKRRLALSD  198



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/174 (33%), Positives = 89/174 (51%), Gaps = 19/174 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD DG+ L  G  Y+I    RG   GG+ +A   + T C   VV  R  +++G P+  
Sbjct  27   PVLDIDGEKLVAGTEYYILPVFRGRG-GGITMA--SNKTSCPLAVVQDRLEVSKGLPLTF  83

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEFVSD---  330
            TPAA+    V+L ST  +  F   T+  C  S  W+I     S  Q+F+S+G    +   
Sbjct  84   TPAADDKKGVILVSTDLNIKFLAKTT--CPQSTVWKITKSSNSKVQWFVSTGGVEGNPGF  141

Query  329  --ISGQFKIEVAPELNAYKITYCPFG----GHICYNVGRYFDESAGAARLALTE  186
              ++  F+IE A +   YKI +CP      G +C ++G Y +++ G   L+L++
Sbjct  142  NTVTNWFQIEKADD--DYKIVFCPTKVCNCGVLCRDIGIYIEDN-GTRTLSLSD  192



>ref|XP_006351514.1| PREDICTED: probable serine protease inhibitor 6-like [Solanum 
tuberosum]
Length=221

 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 87/168 (52%), Gaps = 13/168 (8%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLA-WLDSATKCAS  546
            T ++ NPI LPTA +  VLDT+G+AL    +Y I S GRGAA G V L    +S+  C++
Sbjct  21   TFTSQNPIDLPTATNKLVLDTNGNALDHRASYHIVSIGRGAAGGDVYLGPSPNSSAPCSN  80

Query  545  NVV-----ISRPLTEGDPIR-ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-  387
             V      + +P+  G P+R I  +     + +  +   +  F +ATSRLCV    W++ 
Sbjct  81   GVFRYNSDVGQPI--GTPVRFIIKSDYSTGSGIFENQDVNVQFDIATSRLCVIYANWKVG  138

Query  386  RYDQPSGQYFLSSGEFVSD-ISGQFKIEVAPELNAYKITYCPFGGHIC  246
             YD   G   L +G  +    S  FKI    E ++Y + YCP G  +C
Sbjct  139  DYDVSLGARLLETGGTLGQGDSSWFKIVKVSE-SSYNLLYCP-GPFVC  184



>ref|XP_007210537.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
 gb|EMJ11736.1| hypothetical protein PRUPE_ppa011653mg [Prunus persica]
Length=202

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 77/151 (51%), Gaps = 13/151 (9%)
 Frame = -1

Query  677  TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIR  501
            +PVLD  G  LR G  Y+I    RG   GG+ LA   + T C  +VV  +  ++ G P+ 
Sbjct  28   SPVLDITGKKLRTGTDYYILPVIRGRG-GGLTLASTSNTTSCPLDVVQEQHEVSNGLPLT  86

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD--  330
             +P   P   VV  ST  +  F  AT  +CV S  W++ ++D+ +GQ+F++SG    +  
Sbjct  87   FSP-VNPKKGVVRVSTDHNIKFSAAT--ICVQSTMWKLDKFDEQTGQWFVTSGGVEGNPG  143

Query  329  ---ISGQFKIEVAPELNAYKITYCPFGGHIC  246
                S  FKIE   E   YK+ +CP   + C
Sbjct  144  RQTTSNWFKIEKYDE--DYKLVFCPTVCNFC  172



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 89/174 (51%), Gaps = 19/174 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD DG+ L  G  Y+I    RG   GG+ +A   + T C   VV  R  +++G P+  
Sbjct  27   PVLDIDGEKLVAGTKYYILPVFRGRG-GGITMA--SNKTSCPLAVVQDRLEVSKGLPLTF  83

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWR-IRYDQPSGQYFLSSGEFVSD---  330
            TPAA+    V+L ST  +  F   T+  C  S  W+ I+      Q+F+S+G    +   
Sbjct  84   TPAADDKKGVILVSTDLNIKFLAKTT--CPQSTVWKIIKSSNSKVQWFVSTGGVEGNPGF  141

Query  329  --ISGQFKIEVAPELNAYKITYCPFG----GHICYNVGRYFDESAGAARLALTE  186
              ++  F+IE A +   YK+ +CP      G +C ++G Y +++ G   L+L++
Sbjct  142  NTVTNWFQIEKADD--DYKLVFCPTKVCNCGVLCRDIGIYIEDN-GTRTLSLSD  192



>gb|AIT42170.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYHIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQCIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVQSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 88/174 (51%), Gaps = 19/174 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD DG+ L  G  Y+I    RG   GG+ +A   + T C   VV  R  ++ G P+  
Sbjct  27   PVLDIDGEKLVAGTKYYILPVFRGRG-GGITMA--SNKTSCPLAVVQDRLEVSNGLPLTF  83

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWR-IRYDQPSGQYFLSSGEFVSD---  330
            TPAA+    V+L ST  +  F   T+  C  S  W+ I+      Q+F+S+G    +   
Sbjct  84   TPAADDKKGVILVSTDLNIKFLAKTT--CPQSTVWKIIKSSNSKVQWFVSTGGVEGNPGF  141

Query  329  --ISGQFKIEVAPELNAYKITYCPFG----GHICYNVGRYFDESAGAARLALTE  186
              ++  F+IE A +   YK+ +CP      G +C ++G Y +++ G   L+L++
Sbjct  142  NTVTNWFQIEKADD--DYKLVFCPTKVCNCGVLCRDIGIYIEDN-GTRTLSLSD  192



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 88/187 (47%), Gaps = 21/187 (11%)
 Frame = -1

Query  707  NPIRLPTA--DDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI  534
            NP  L +A    +PVLDT+GD +R G  YF+    RG   GG+  + +     C  +++ 
Sbjct  20   NPSELVSAGPSPSPVLDTNGDKIRAGSNYFVLPVIRGRG-GGLLPSNVKQNNSCPRDIIQ  78

Query  533  -SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQY  360
             S  + EG P+  TP  +P   V+  ST  +  FF  T  +C     W++  YD+   QY
Sbjct  79   NSNEVQEGLPVVFTP-VDPKKGVIRLSTDLNVRFFTPT--ICARETIWKLGTYDEKLKQY  135

Query  359  FLSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGA  207
            F+ +G    +     +S  FKIE       YK  +CP    F   IC +VG Y     G 
Sbjct  136  FIVTGGVEGNPGPLTVSNWFKIEKLG--TDYKFVFCPSVCTFCKVICKDVGIY--NKDGV  191

Query  206  ARLALTE  186
              LAL++
Sbjct  192  RFLALSD  198



>gb|ABX76298.1| sexual organ expressed protein [Nicotiana alata]
Length=242

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/200 (33%), Positives = 92/200 (46%), Gaps = 29/200 (15%)
 Frame = -1

Query  707  NPIRLPTADD----------TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSAT  558
            NPI LPT  D          + VLD +G+ L  GE Y I S  RGA  GGV L ++ + T
Sbjct  31   NPIVLPTTTDDDKGFPIPRFSEVLDINGEPLHVGEEYHIISAIRGAGGGGVYLTYVGN-T  89

Query  557  KCASNVVISRPLT-EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRY  381
            KC + V+     T  G P++          VV  +T  +  F VAT+RLCV+   W++  
Sbjct  90   KCPNGVLQHGTDTLPGMPVKFVTTHSRPFNVVRENTDINIMFSVATTRLCVNQTVWKVGD  149

Query  380  DQPS--GQYFLSSGEFVSD-----ISGQFKIE-VAPELNAYKITYCPFGGHI-------C  246
               +  G  F+ +G  + +     I+  FKIE V  +   YK+ YCP            C
Sbjct  150  PDLTARGTRFVVTGGTLGNPGPETINNWFKIEKVTKQAPFYKLRYCPDKLLCPECHPVDC  209

Query  245  YNVGRYFDESAGAARLALTE  186
             +VG    +  G  RLALT 
Sbjct  210  LDVG--VTDHFGRRRLALTN  227



>sp|Q41433.1|SPI6_SOLTU RecName: Full=Probable serine protease inhibitor 6; AltName: 
Full=AM66; Flags: Precursor [Solanum tuberosum]
 gb|AAC49602.1| Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=221

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYHIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVQSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AFK36436.1| unknown [Lotus japonicus]
Length=218

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 78/184 (42%), Gaps = 12/184 (7%)
 Frame = -1

Query  710  FNPIRLPTA----DDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASN  543
            F   +LPTA    D   VLD +GD++ PG  Y+I    RG   GGV+L     +    + 
Sbjct  15   FISTKLPTAFSPNDVEQVLDVNGDSIFPGGRYYIRPAIRGPPGGGVRLGKTGDSDCPVTA  74

Query  542  VVISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQ  363
            +     +  G P+R   AAE +  ++   T     F V     CV S  W +  D   G+
Sbjct  75   LQEYSEVKNGIPVRFRIAAEVSTGIIFTGTELDIEFTVKPH--CVESPKWIVFVDNEIGK  132

Query  362  YFLSSGEFVSD-----ISGQFKIEVAPELNAYKITYCPFGGHICYNVGRYFDESAGAARL  198
              +  G           SG F I+       YK+ +C  G   C ++GRY D   G  RL
Sbjct  133  ACVGIGGAKDHPGKQTFSGTFNIQKNSAGFGYKLVFCIKGSPTCLDIGRY-DNGEGGKRL  191

Query  197  ALTE  186
             LTE
Sbjct  192  NLTE  195



>gb|AAL60248.1|AF459083_1 putative Kunitz-type tuber invertase inhibitor precursor [Solanum 
tuberosum]
Length=207

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/184 (32%), Positives = 88/184 (48%), Gaps = 32/184 (17%)
 Frame = -1

Query  716  STFNPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA-  561
            S+ NPI LPT    DD  VL    D DG+ LR GE Y I +   G  +      +LD+  
Sbjct  20   SSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGGGA-----VYLDNIG  74

Query  560  -TKCASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSV  399
              +C + V+    I + L +G P+     +E +   VV   T     FFV TS+LCV   
Sbjct  75   NLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYGDVVRVMTGVYIKFFVKTSKLCVDET  134

Query  398  FWRIRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNV  237
             W++ ++Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+
Sbjct  135  VWKVNHEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNI  187

Query  236  GRYF  225
            GR F
Sbjct  188  GRNF  191



>gb|AIT42206.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 70.1 bits (170),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 64/198 (32%), Positives = 91/198 (46%), Gaps = 34/198 (17%)
 Frame = -1

Query  716  STFNPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA-  561
            S+ NPI LPT    DD  VL    D DG+ LR GE Y I +   G  +      +LD+  
Sbjct  24   SSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGGGA-----VYLDNIG  78

Query  560  -TKCASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSV  399
              +C + V+    I + L +G P+     +E +   VV   T     FFV TSRLCV   
Sbjct  79   NLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYRDVVRVMTGVYIKFFVKTSRLCVDET  138

Query  398  FWRIRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNV  237
             W++ ++Q      + +G  V + +  FKI+     V    N YK+ +CP   H+ C N+
Sbjct  139  VWKVNHEQ-----LVVTGGNVGNENDIFKIKKTDLVVRGMKNVYKLLHCP--SHLQCKNI  191

Query  236  GRYFDESAGAARLALTED  183
            G  F    G  RL    D
Sbjct  192  GSNFKN--GYPRLVTVHD  207



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 57/187 (30%), Positives = 88/187 (47%), Gaps = 18/187 (10%)
 Frame = -1

Query  713  TFNPIRLPTADDTP-VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVV  537
            +FN +    A+  P V+D DG  LR G  Y+I    RG   G    +  D      + V 
Sbjct  16   SFNSLLSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKMCPLDAVVQ  75

Query  536  ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIR-YDQPSGQY  360
                + +G P+  TP  +P   V+  ST  +  F  + + +CV +  W++  +D+ +GQY
Sbjct  76   EHNEIDQGLPLTFTPV-DPKKGVIRESTDLNIIF--SANSICVQTTQWKLDDFDETTGQY  132

Query  359  FLSSG-----EFVSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGA  207
            F++ G       V  IS  FKIE       YK+ YCP    F   IC ++G +  +  G 
Sbjct  133  FITLGGDQGNPGVETISNWFKIEKYDR--DYKLLYCPTVCDFCKVICRDIGIFIQD--GV  188

Query  206  ARLALTE  186
             RLAL++
Sbjct  189  RRLALSD  195



>gb|AAM10743.1|AF492359_1 putative kunitz-type proteinase inhibitor precursor P1H5 [Solanum 
tuberosum]
 gb|AIT42174.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS++CVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF----------GGHICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTTTMTLPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AIT42176.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS++CVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF----------GGHICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTTTMTLPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AAL60243.1|AF459078_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
 gb|AIT42201.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/198 (31%), Positives = 91/198 (46%), Gaps = 34/198 (17%)
 Frame = -1

Query  716  STFNPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA-  561
            S+ NPI LPT    DD  VL    D DG+ LR GE Y I +   G  +      +LD+  
Sbjct  24   SSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGGGA-----VYLDNIG  78

Query  560  -TKCASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSV  399
              +C + V+    I + L +G P+     +E +   VV   T     FFV TS+LCV   
Sbjct  79   NLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYGDVVRVMTGVYIKFFVKTSKLCVDET  138

Query  398  FWRIRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNV  237
             W++ ++Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+
Sbjct  139  VWKVNHEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNI  191

Query  236  GRYFDESAGAARLALTED  183
            G  F    G  RL    D
Sbjct  192  GSNFKN--GYPRLVTVHD  207



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 87/174 (50%), Gaps = 19/174 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD DG+ L  G  Y+I    RG   GG+ +A   + T C   VV  R   ++G P+  
Sbjct  27   PVLDIDGEKLVAGTKYYILPVFRGRG-GGITMA--SNQTSCPLAVVQDRLEASKGLPLTF  83

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWR-IRYDQPSGQYFLSSGEFVSD---  330
            TPAA+    V+L ST  +  F   T+  C  S  W+ I+      Q+F+S+G    +   
Sbjct  84   TPAADDKKGVILVSTDLNIKFLDKTT--CPHSTVWKIIKSSNSKVQWFVSTGGVEGNPGF  141

Query  329  --ISGQFKIEVAPELNAYKITYCPFG----GHICYNVGRYFDESAGAARLALTE  186
              +   F+IE A +   YK+ +CP      G +C ++G Y +++ G   L+L++
Sbjct  142  NTVGNWFQIEKADD--DYKLVFCPTKVCKCGVLCRDIGIYIEDN-GTRTLSLSD  192



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 92/182 (51%), Gaps = 15/182 (8%)
 Frame = -1

Query  698  RLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRP-L  522
            R+  A ++PVLD DGD LR G  Y++ S   GA  GG+ L    +   C   VV  R  L
Sbjct  22   RVANAANSPVLDIDGDELRTGVQYYVVSALWGAGGGGLALG-RATGQSCPEIVVQRRSDL  80

Query  521  TEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSG  345
             +G P+ I   A+    VV  ST  +  F     RLC +S  W++  YD  +G++++++ 
Sbjct  81   DDGTPV-IFSNADSKDGVVRVSTDINIEFVPIRDRLCTTSTVWKLDNYDNSAGKWWVTTD  139

Query  344  EFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLAL  192
                D     +S  FKIE A  +  YK  +CP        +C ++G++ D+  G  RLAL
Sbjct  140  GVKGDPGASTMSSWFKIEPAGGI-GYKFRFCPSVCDSCTKLCSDIGKHSDDD-GQIRLAL  197

Query  191  TE  186
            ++
Sbjct  198  SD  199



>sp|P58514.2|SPI1_SOLTU RecName: Full=Serine protease inhibitor 1; AltName: Full=PSPI-21; 
AltName: Full=PSPI-21-6.3; Contains: RecName: Full=Serine 
protease inhibitor 1 chain A; Contains: RecName: Full=Serine 
protease inhibitor 1 chain B; Flags: Precursor [Solanum 
tuberosum]
 gb|AAM21646.1|AF495585_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
 gb|AIT42178.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AIT42190.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYHIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVV--ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVQSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G   LAL +D
Sbjct  198  --HQNGKKSLALVKD  210



>gb|AIT42196.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=219

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/193 (33%), Positives = 83/193 (43%), Gaps = 17/193 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSENPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGPHIFEDELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF--------GGHICYNVGRYFD  222
              G   L +G  +    S  FKI V      Y + YCP             C  VG    
Sbjct  139  SLGTMLLETGGTIGQADSSWFKI-VKSSRFGYNLLYCPVTIICPSCPDDQFCSKVGVV--  195

Query  221  ESAGAARLALTED  183
               G  RLAL +D
Sbjct  196  HQNGKRRLALVKD  208



>gb|AIT42180.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFSISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|NP_001275427.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94199.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94200.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94201.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AIT42177.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDITGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AIT42197.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSHLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCSKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 88/182 (48%), Gaps = 18/182 (10%)
 Frame = -1

Query  695  LPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR--PL  522
            +  A + PVLDTDG+ LR G  Y++ S    A  GG+ L    S  +   ++V+ R   L
Sbjct  23   VANATNKPVLDTDGEELRTGVEYYVVSALWAAGGGGLALG--RSRNQSCPDIVVQRRSEL  80

Query  521  TEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSG  345
              G P+  +P  +PN   +  ST     F      LC+++  W++  YDQ +G++++ +G
Sbjct  81   DYGIPVIFSP-VKPNDVFIRVSTDLIIEFVPLRDSLCLTTAVWKLDDYDQSTGKWWVIAG  139

Query  344  EFVSDIS-----GQFKIEVAPELNAYKITYCPFGGH----ICYNVGRYFDESAGAARLAL  192
                D         FKIE    +  YK TYCP        +C ++GRY  E  G  RL L
Sbjct  140  RVAGDAGPHTFPNWFKIE-KNGVFGYKFTYCPSVCDSCTTLCSDIGRY--EDNGQIRLGL  196

Query  191  TE  186
            ++
Sbjct  197  SD  198



>gb|AIT42179.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=217

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSHLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +      F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELPHIQFAISTSKLCVSYTIWKVGNYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCSKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  HQN--GKRRLALVKD  210



>ref|XP_006353923.1| PREDICTED: cysteine protease inhibitor 1-like [Solanum tuberosum]
Length=222

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 87/191 (46%), Gaps = 25/191 (13%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGV-QLAWLDSATKC  552
            NPI LPT    DD  VL    D DGD LR GE Y I +   GA +  +  +  L      
Sbjct  29   NPIVLPTTSHDDDNLVLPEVYDQDGDPLRIGERYIINNPLIGAGAVYLYNIGNLQCPNAV  88

Query  551  ASNVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQ  375
              ++ I + L +G P+     +E +   VV   T     FFV T++LCV    W++  +Q
Sbjct  89   LQHMSIPQFLGKGTPVVFVRKSESDYGDVVRQMTAVYIKFFVKTTKLCVDQTVWKVDDEQ  148

Query  374  PSGQYFLSSGEFVSDISGQFKIE----VAP--ELNAYKITYCPFGGHI-CYNVGRYFDES  216
                  + +G  V + +  FKI     V P    N YK+ +CP   H+ C N+G  F   
Sbjct  149  -----LVVTGGKVGNENDIFKIRKIDLVTPGSSKNVYKLLHCP--SHLQCKNIGGNF--K  199

Query  215  AGAARLALTED  183
             G  RLA  +D
Sbjct  200  NGYPRLATVDD  210



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/186 (33%), Positives = 87/186 (47%), Gaps = 24/186 (13%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVIS  531
            P+R   + D PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  
Sbjct  22   PVRGNASPD-PVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCLLDVVQE  77

Query  530  R-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
            +     G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ 
Sbjct  78   QHSFRNGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWL  134

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            L++G    +     +   FKIE       YK+ YCP    F   +C +VG + +   G  
Sbjct  135  LTTGGVEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  203  RLALTE  186
            RLAL++
Sbjct  191  RLALSD  196



>ref|XP_007036750.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21251.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 15/178 (8%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDP  507
            AD++PVLD+DGD LR G  Y++ S   GA  GG+ L  + +   C   VV      +G P
Sbjct  26   ADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRV-TGQSCPEIVVQRGSDDDGLP  84

Query  506  IRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD  330
            + I   A+    VV  ST  +  F     RLC++S  W++  YD  +G++++++     D
Sbjct  85   V-IFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKGD  143

Query  329  -----ISGQFKIEVAPELNAYKITYCPFGG----HICYNVGRYFDESAGAARLALTED  183
                 ++  FKIE A  L  YK  +CP       H+C + GR+  +  G  RLAL+E+
Sbjct  144  PGHNTLTSWFKIENAGAL-GYKFRFCPSVCDSCIHLCNDFGRHGHD--GQVRLALSEN  198



>gb|AAM21645.1|AF495584_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
 gb|AIT42181.1| Kunitz-type inhibitor B [Solanum tuberosum]
 gb|AIT42192.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSEDQFCSKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  HQN--GKRRLALVKD  210



>ref|XP_009789071.1| PREDICTED: cysteine protease inhibitor 8-like [Nicotiana sylvestris]
Length=242

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 91/200 (46%), Gaps = 29/200 (15%)
 Frame = -1

Query  707  NPIRLPTADD----------TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSAT  558
            N I LPT  D          + VLD +G+ L  GE Y I S  RGA  GGV L ++ + T
Sbjct  31   NHIVLPTTTDDDKVFPIPGFSEVLDINGEPLHVGEEYHIISAIRGAGGGGVYLTYVGN-T  89

Query  557  KCASNVVIS-RPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRY  381
            KC + V+   R    G P++          VV  +T  +  F V+TSRLCV+   W++  
Sbjct  90   KCPNGVLQHGRDTRPGMPVKFVTTHSRPFNVVRENTDINIMFSVSTSRLCVNETVWKVGD  149

Query  380  DQPS--GQYFLSSGEFVSD-----ISGQFKIE-VAPELNAYKITYCPFGGHI-------C  246
               +  G  F+ +G  + +      +  FKIE V  +   YK+ YCP            C
Sbjct  150  PDLTTRGTRFVVTGGTLGNSRPETTNNWFKIEKVTKQAPFYKLRYCPDKFLCPECHPVDC  209

Query  245  YNVGRYFDESAGAARLALTE  186
             +VG    +  G  RLALT+
Sbjct  210  LDVG--VTDHFGYRRLALTK  227



>gb|AIT42172.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=245

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 93/193 (48%), Gaps = 30/193 (16%)
 Frame = -1

Query  695  LPTADDTP--VLDTDGDALRPGETYFI------TSTG---RGAASGGVQLAWLDSATKCA  549
            L  AD +P  V+DT G  LR G +Y+I      T  G   R    GG+ LA +  +  C 
Sbjct  20   LGVADASPEQVVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLASIGES--CP  77

Query  548  SNVVISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQP  372
             +VV+  P + G P++ +P  +P   VV  ST  +  F    +     S  W++  +D  
Sbjct  78   LDVVVV-PRSHGLPLQFSP-VDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDHFDVS  135

Query  371  SGQYFLSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP------FGGHICYNVGRYF  225
             G++F+S+G  + +     I   FKIE      AYKI YCP         H+C ++G + 
Sbjct  136  KGKWFVSTGGSMGNPSWETIRNWFKIEKCD--GAYKIVYCPSVFPSSSSKHMCKDIGVFV  193

Query  224  DESAGAARLALTE  186
            DE+ G  RLAL+ 
Sbjct  194  DEN-GFRRLALSN  205



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/178 (34%), Positives = 92/178 (52%), Gaps = 15/178 (8%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDP  507
            AD++PVLD+DGD LR G  Y++ S   GA  GG+ L  + +   C   VV      +G P
Sbjct  26   ADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRV-TGQSCPEIVVQRGSDDDGLP  84

Query  506  IRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD  330
            + I   A+    VV  ST  +  F     RLC++S  W++  YD  +G++++++     D
Sbjct  85   V-IFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDGVKGD  143

Query  329  -----ISGQFKIEVAPELNAYKITYCPFGG----HICYNVGRYFDESAGAARLALTED  183
                 ++  FKIE A  L  YK  +CP       H+C + GR+  +  G  RLAL+E+
Sbjct  144  PGHNTLTSWFKIEDAGAL-GYKFRFCPSVCDSCIHLCNDFGRHGHD--GQVRLALSEN  198



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 89/173 (51%), Gaps = 20/173 (12%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPL--TEGDPIRI  498
            VLDTDG+ LR G  Y+I    RG   GG+ +A     T C  +VV   PL  ++G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRG-GGLTMASTRDET-CPLDVV-QDPLEISKGLPLTF  89

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF-----V  336
            TP   P   V+  ST  +  F  + S +CV S  W+I+    S  Q+F+++G       +
Sbjct  90   TP-VNPKKGVIRVSTDLNIKF--SASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGI  146

Query  335  SDISGQFKIEVAPELNAYKITYCPF---GGHICYNVGRYFDESAGAARLALTE  186
              I+  FKIE A +   YK+ +CP     G +C +VG Y  ++ G   L+L++
Sbjct  147  ETITNWFKIEKADD--DYKLVFCPTVCDCGALCRDVGIYIHDN-GVRTLSLSD  196



>gb|AIT42195.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=229

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDITGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVV--ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGNYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQANSSWFKIVKSSQL-GYNLLYCPVTNTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G   LAL +D
Sbjct  198  HQN--GKKHLALVKD  210



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 89/173 (51%), Gaps = 20/173 (12%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPL--TEGDPIRI  498
            VLDTDG+ LR G  Y+I    RG   GG+ +A     T C  +VV   PL  ++G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRG-GGLTMASTRDET-CPLDVV-QDPLEISKGLPLTF  89

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF-----V  336
            TP   P   V+  ST  +  F  + S +CV S  W+I+    S  Q+F+++G       +
Sbjct  90   TP-VNPKKGVIRVSTDLNIKF--SASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGI  146

Query  335  SDISGQFKIEVAPELNAYKITYCPF---GGHICYNVGRYFDESAGAARLALTE  186
              I+  FKIE A +   YK+ +CP     G +C +VG Y  ++ G   L+L++
Sbjct  147  ETITNWFKIEKAGD--DYKLVFCPTVCDCGALCRDVGIYIHDN-GVRTLSLSD  196



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 89/173 (51%), Gaps = 20/173 (12%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPL--TEGDPIRI  498
            VLDTDG+ LR G  Y+I    RG   GG+ +A     T C  +VV   PL  ++G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRG-GGLTMASTRDET-CPLDVV-QDPLEISKGLPLTF  89

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF-----V  336
            TP   P   V+  ST  +  F  + S +CV S  W+I+    S  Q+F+++G       +
Sbjct  90   TP-VNPKKGVIRVSTDLNIKF--SASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGI  146

Query  335  SDISGQFKIEVAPELNAYKITYCPF---GGHICYNVGRYFDESAGAARLALTE  186
              I+  FKIE A +   YK+ +CP     G +C +VG Y  ++ G   L+L++
Sbjct  147  ETITNWFKIEKAGD--DYKLVFCPTVCDCGALCRDVGIYIHDN-GVRTLSLSD  196



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 87/186 (47%), Gaps = 24/186 (13%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVIS  531
            P+R   + D PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  
Sbjct  22   PVRGNASPD-PVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPVDVVQE  77

Query  530  R-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
            +     G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ 
Sbjct  78   QHSFRNGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWL  134

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            +++G    +     +   FKIE       YK+ YCP    F   +C +VG + +   G  
Sbjct  135  VTTGGVEGNPGPRTMRNWFKIE--KFFGNYKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  203  RLALTE  186
            RLAL++
Sbjct  191  RLALSD  196



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 82/176 (47%), Gaps = 23/176 (13%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPI  504
            PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +     G P+
Sbjct  74   PVLDIAGKQLRTGSKYYILPVTKGRG---GGLTLAGRSNNKTCPLDVVQEQHSFKNGLPV  130

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD-  330
              +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ L++G    + 
Sbjct  131  TFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEGNP  187

Query  329  ----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
                +   FKIE       YK+ YCP    F   +C +VG + +   G  RLAL++
Sbjct  188  GPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALSD  239



>gb|AIT42191.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 85/195 (44%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P++   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVKFICSSSHFGQGIFENELLNIQFSISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 87/188 (46%), Gaps = 27/188 (14%)
 Frame = -1

Query  731  PNPTHSTFNPIRL-----------PTADDTPVLDTDGDALRPGETYFITSTGRGAASGGV  585
            PNPT ST   I L             A    VLD DG+ LR G  Y+I   G    +GG+
Sbjct  2    PNPTTSTMKLILLFSAFFLLSSLTTLAAAEVVLDRDGNELRRGVEYYIYP-GITDVAGGL  60

Query  584  QLAWLDSATKCASNVVISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVS  405
             LA  + +      + IS P + G P+   PA +P    +  ST  +  F   T  +CV 
Sbjct  61   TLASRNHSCPLDVTLAIS-PTSNGLPLTFLPA-DPEEDTINTSTDLNIVFSAVT--ICVQ  116

Query  404  SVFWRIRYDQPSGQYFLSSGEFVSD-----ISGQFKIEVAPELNAYKITYCPFGGHICY-  243
            S  W++ +D  +G++++++G    +     ++  FKIE   +  AYK+ +CP    IC  
Sbjct  117  STVWKLDFDDAAGRFYVTTGGVAGNPGRETLANWFKIE--NDRGAYKLVFCPTVCDICKP  174

Query  242  ---NVGRY  228
               N+G Y
Sbjct  175  VCGNLGVY  182



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (46%), Gaps = 23/181 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
             A   PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +    
Sbjct  26   NAQPDPVLDISGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPVDVVQEQHSFK  82

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ +++G 
Sbjct  83   NGFPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGG  139

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE       YK+ YCP    F   +C +VG + +   G  RLAL+
Sbjct  140  VEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALS  195

Query  188  E  186
            +
Sbjct  196  D  196



>ref|XP_009588833.1| PREDICTED: latex serine proteinase inhibitor-like [Nicotiana 
tomentosiformis]
Length=214

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 84/171 (49%), Gaps = 14/171 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL--DSATKCASNVVIS-RPLTEGDPIR  501
            V D  G  L     YFI S   GA  GGV+LA L       C ++VV S R   EG  + 
Sbjct  33   VKDLKGHPLDKNARYFIVSAFNGAGGGGVRLANLGGQEENTCLTSVVQSPRDTDEGIAVY  92

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVS---  333
              P  EP    ++ S   +  F++   + C +   W++  Y +P+  Y +S+G  ++   
Sbjct  93   FKP-KEPKHQQIVESASLNINFYLDYIK-CANLTVWKVDHYPKPAEHYTISTGAKLANPL  150

Query  332  DISGQFKIEVAPELNAYKITYCPFGGHI-CYNVGRYFDESAGAARLALTED  183
            D++  F+I+     ++YK+ +CP+G    C+NVG      +G  RL LTE+
Sbjct  151  DVNSWFQIKSLG--SSYKLVFCPYGETFTCHNVG--IVNESGYRRLVLTEN  197



>gb|AAM10744.1|AF492769_1 putative kunitz-type proteinase inhibitor S1C1 [Solanum tuberosum]
Length=221

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTNTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 87/186 (47%), Gaps = 24/186 (13%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVIS  531
            P+R   + D PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  
Sbjct  22   PVRGNASAD-PVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPVDVVQE  77

Query  530  R-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
            +     G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ 
Sbjct  78   QHSFRNGLPVTFSP-VNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAAIGQWL  134

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            +++G    +     +   FKIE       YK+ YCP    F   +C +VG + +   G  
Sbjct  135  VTTGGVEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  203  RLALTE  186
            RLAL++
Sbjct  191  RLALSD  196



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 86/182 (47%), Gaps = 19/182 (10%)
 Frame = -1

Query  695  LPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPL  522
            L +A ++P  V+D DG  LR G  Y+I    RG   G    +  D      + V   + +
Sbjct  25   LSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKICPLDAVVQEHQEI  84

Query  521  TEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIR-YDQPSGQYFLSSG  345
             +G P+  TP   P   V+  ST  +  F  + + +CV +  W++  +D+ +GQYF++ G
Sbjct  85   DQGLPLTFTPV-NPKKGVIRESTDLNIIF--SANSICVQTTQWKLDDFDETTGQYFITLG  141

Query  344  EFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLAL  192
                +     IS  FKIE       YK+ YCP    F   IC  +G +  +  G  RLAL
Sbjct  142  GNQGNPGRETISNWFKIEKFDR--DYKLLYCPTVCDFCKVICKEIGIFIQD--GVRRLAL  197

Query  191  TE  186
            ++
Sbjct  198  SD  199



>dbj|BAA04150.1| proteinase inhibitor [Solanum tuberosum]
Length=221

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMRCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AIT42171.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 80/194 (41%), Gaps = 17/194 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDISGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRYF  225
              G   L +G  +      +   V      Y + YCP               C  VG   
Sbjct  139  SLGTMLLETGGTIGQADSSWFKNVKSSQLGYHLLYCPVTNTMSCPFSSDDQFCLKVGVV-  197

Query  224  DESAGAARLALTED  183
                G  RLAL +D
Sbjct  198  -HPNGKRRLALVQD  210



>sp|P30941.2|SPI7_SOLTU RecName: Full=Serine protease inhibitor 7; AltName: Full=PIGEN1; 
Short=PIG; AltName: Full=STPIA; AltName: Full=STPIB; AltName: 
Full=pF4; AltName: Full=pKEN14-28; AltName: Allergen=Sola 
t 4; Flags: Precursor [Solanum tuberosum]
 dbj|BAA04149.1| proteinase inhibitor [Solanum tuberosum]
 gb|AIT42198.1| Kunitz-type inhibitor B [Solanum tuberosum]
 gb|AIT42200.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AAZ08244.1| putative Kunitz-type proteinase inhibitor PKI1 [Solanum tuberosum]
Length=221

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 74/158 (47%), Gaps = 7/158 (4%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDATCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS++CVS   W++  YD 
Sbjct  79   GVFRYNSDVGLSGTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCP  264
              G   L +G  +    S  FKI  + +   Y + YCP
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCP  175



>gb|AAO23566.1| serine protease inhibitor [Solanum tuberosum]
Length=221

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 79/194 (41%), Gaps = 17/194 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS++CVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDISGQFKIEVAPELNAYKITYCPF----------GGHICYNVGRYF  225
              G   L +G  +      +   V      Y + YCP               C   G   
Sbjct  139  SLGTMLLETGGTIGQADSSWLKIVKSSQFGYNLLYCPVTTTMTLPFSSDDQFCLKAGVV-  197

Query  224  DESAGAARLALTED  183
                G  RLAL +D
Sbjct  198  -HQNGKRRLALVKD  210



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 87/173 (50%), Gaps = 20/173 (12%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPL--TEGDPIRI  498
            VLDTDG+ LR G  Y+I    RG   G    +  D A  C  +VV   PL  ++G P+  
Sbjct  33   VLDTDGEKLRAGTEYYILPVFRGRGGGLTMASTGDEA--CPLDVV-QDPLEISKGLPLTF  89

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF-----V  336
            TP   P   V+  ST  +  F  + S +CV S  W+I+    S  Q+F+++G       +
Sbjct  90   TP-VNPKKGVIRVSTDLNIKF--SASSICVQSTVWKIQKSVNSEIQWFVTTGGVEGNPGI  146

Query  335  SDISGQFKIEVAPELNAYKITYCPF---GGHICYNVGRYFDESAGAARLALTE  186
              I+  FKIE A +   YK+ +CP     G +C ++G Y  ++ G   L+L++
Sbjct  147  ETITNWFKIEKAGD--DYKLVFCPTVCDCGALCRDIGIYIHDN-GVRTLSLSD  196



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (46%), Gaps = 23/181 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
             A   PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +    
Sbjct  26   NAQPDPVLDISGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPVDVVQEQHSFR  82

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ +++G 
Sbjct  83   NGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWVVTTGG  139

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE       YK+ YCP    F   +C +VG + +   G  RLAL+
Sbjct  140  VEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALS  195

Query  188  E  186
            +
Sbjct  196  D  196



>ref|XP_006353926.1| PREDICTED: cysteine protease inhibitor 1-like [Solanum tuberosum]
Length=222

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 86/191 (45%), Gaps = 25/191 (13%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGV-QLAWLDSATKC  552
            NPI LPT    DD  VL    D DGD LR GE Y I +   GA +  +  +  L      
Sbjct  29   NPIVLPTTCHDDDNLVLPEVYDQDGDPLRIGERYIINNPLIGAGAVYLYNIGNLQCPNAV  88

Query  551  ASNVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQ  375
              ++ I + L +G P+     +E +   VV   T     FFV T++LCV    W++  +Q
Sbjct  89   LQHMSIPQFLGKGTPVVFVRKSESDYGDVVRQMTAVYIKFFVKTTKLCVDQTVWKVDDEQ  148

Query  374  PSGQYFLSSGEFVSDISGQFKIE----VAP--ELNAYKITYCPFGGHI-CYNVGRYFDES  216
                  + +G  V + +  FKI     V P    N YK+ +CP   H+ C N+G  F   
Sbjct  149  -----LVVTGGKVGNENDIFKIRKIDLVTPGSSKNVYKLLHCP--SHLQCKNIGGNF--K  199

Query  215  AGAARLALTED  183
             G  RL   +D
Sbjct  200  NGYPRLVTVDD  210



>ref|XP_006495061.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 87/186 (47%), Gaps = 24/186 (13%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVIS  531
            P+R   + D PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  
Sbjct  22   PVRGNASPD-PVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPLDVVQE  77

Query  530  R-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
            +     G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ 
Sbjct  78   QHSFRNGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWL  134

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            +++G    +     +   FKIE       YK+ YCP    F   +C +VG + +   G  
Sbjct  135  VTTGGVEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  203  RLALTE  186
            RLAL++
Sbjct  191  RLALSD  196



>gb|AIT42188.1| Kunitz-type inhibitor B, partial [Solanum tuberosum]
Length=224

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  23   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  81

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  82   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  141

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  142  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  200

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  201  --HQNGKRRLALVKD  213



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 86/184 (47%), Gaps = 20/184 (11%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-  528
            P+R   + D PVLD  G  LR G  Y+I    +G   GG+ LA   +   C  +VV  + 
Sbjct  22   PVRGNASPD-PVLDIAGKQLRAGSKYYILPVTKGQG-GGLTLAGRSNNKTCPLDVVQEQH  79

Query  527  PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLS  351
             L  G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ ++
Sbjct  80   SLRNGFPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVT  136

Query  350  SGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARL  198
            +G    +     +   FKIE       YK+ +CP    F   +C +VG + +   G  RL
Sbjct  137  TGGVEGNPGPRTMRNWFKIE--KFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRL  192

Query  197  ALTE  186
            AL++
Sbjct  193  ALSD  196



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (46%), Gaps = 23/181 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
             A   PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +    
Sbjct  26   NAQPDPVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRRNNKTCPLDVVQEQHSFK  82

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ +++G 
Sbjct  83   NGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGG  139

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE       YK+ YCP    F   +C +VG + +   G  RLAL+
Sbjct  140  VEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALS  195

Query  188  E  186
            +
Sbjct  196  D  196



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 81/171 (47%), Gaps = 14/171 (8%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD +G  LR     +I    R    GG+ LA     T C  +VV  +  ++ G P+  
Sbjct  35   PVLDIEGKKLRSEVDCYILPVIRRRGGGGLTLASTGKET-CPLDVVQEQHEVSNGLPLMF  93

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD----  330
             P   P   V+  ST  +  F  AT  +C+ S  W++ YD+ SGQ F+++G    +    
Sbjct  94   IPV-NPKKGVIRVSTDHNIEFSAAT--ICIQSTVWKLEYDESSGQQFVTTGGVEGNPGRG  150

Query  329  -ISGQFKIEVAPELN--AYKITYCPFGGHICYNVGRYFDESAGAARLALTE  186
             +S  FKIE   + N   +  T C F   +C ++  Y  +  G  RLAL++
Sbjct  151  TLSNWFKIEKYEDDNNLVFCPTVCDFCKPVCGDIVIYIQD--GYRRLALSD  199



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 84/184 (46%), Gaps = 23/184 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRP-LTEG  513
            T    PV+D +G+ +RPG  Y++ S   G    GV          C   VV +RP    G
Sbjct  21   TEKPNPVVDFNGEEIRPGVDYYVVSVFPGGRGSGVTYGKGPGNEICPLAVVQARPDFNRG  80

Query  512  DPIRITPAAEPNATVVLPSTFQSFAF----FVATSRLCVSSVFWRIRYDQPSGQYFLSSG  345
             P+  TP   P  +VV  ST  +  F    F+     C  S  W++ +++   Q+F+ + 
Sbjct  81   HPVTFTP-VNPEESVVRVSTDLNIKFSEPPFI---NFCRGSNVWKVHFNEALKQHFVLT-  135

Query  344  EFVSDISG------QFKIEVAPELNAYKITYCPF-----GGHICYNVGRYFDESAGAARL  198
            + V   SG       FKIE+   +  YK  +CP         IC +VG Y+D+  G  RL
Sbjct  136  DGVEGNSGCETEANWFKIELTGNV-GYKFVFCPAVCDSSSEAICKDVGIYYDDD-GTRRL  193

Query  197  ALTE  186
            AL++
Sbjct  194  ALSD  197



>gb|AIT42208.1| Kunitz-type inhibitor C [Solanum tuberosum]
Length=222

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 87/191 (46%), Gaps = 25/191 (13%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGV-QLAWLDSATKC  552
            NPI LPT    DD  VL    D DG  LR GE Y I +   GA +  +  +  L      
Sbjct  29   NPIVLPTTCHDDDNLVLLEVYDQDGHPLRIGERYIIMNPLLGAGAVYLYNIGNLQCPNAV  88

Query  551  ASNVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQ  375
              ++ I + L +G P+     +E +   VV   T     FFV T++LCV    W++  +Q
Sbjct  89   LQHMSIPQFLGKGTPVVFVRKSESDYGDVVRVMTAVYIKFFVKTTKLCVDETVWKVNDEQ  148

Query  374  PSGQYFLSSGEFVSDISGQFKIE----VAP--ELNAYKITYCPFGGHI-CYNVGRYFDES  216
                  + +G  V + +  FKI+    V P    N YK+ +CP   H+ C N+G  F   
Sbjct  149  -----LVVTGGRVGNENDIFKIKKTDLVTPGGSKNVYKLLHCP--SHLGCKNIGGNFKN-  200

Query  215  AGAARLALTED  183
             G  RLA  +D
Sbjct  201  -GYPRLATVDD  210



>gb|AIT42183.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=219

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 83/193 (43%), Gaps = 17/193 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF--------GGHICYNVGRYFD  222
              G   L +G  +    S  FKI V      Y + YCP             C  VG    
Sbjct  139  SLGTMLLETGGTIGQADSSWFKI-VKSSRFGYNLLYCPVTIICPSCPDDQFCSKVGVV--  195

Query  221  ESAGAARLALTED  183
               G  RLAL +D
Sbjct  196  HQNGKRRLALVKD  208



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 83/181 (46%), Gaps = 23/181 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
             A   PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +    
Sbjct  26   NAQPDPVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRGNNKTCPLDVVQEQHSFK  82

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ +++G 
Sbjct  83   NGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGG  139

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE       YK+ YCP    F   +C +VG + +   G  RLAL+
Sbjct  140  VEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALS  195

Query  188  E  186
            +
Sbjct  196  D  196



>emb|CAA43267.1| sporamin [Ipomoea batatas]
Length=236

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  186  FSESQTRSPGRLVEVSSNVVAYVAAKRTISDFVSVKLR-RDFNLELAANVGDKLAGAQEV  362
              ESQTR P   V  S+N+VA+V A+ T+S+FV VK+     NLEL A VG KLAG QE+
Sbjct  44   IGESQTRGPQHGVMESANIVAFVGAELTVSEFVEVKVGIHQLNLELVAIVGHKLAGFQEI  103

Query  363  LPGWLVV  383
            LPG  VV
Sbjct  104  LPGRAVV  110



>gb|AAT06054.1| putative Kunitz-type tuber invertase inhibitor [Solanum tuberosum]
Length=221

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 89/195 (46%), Gaps = 34/195 (17%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TK  555
            NPI LPT    DD  VL    D DG+ LR GE Y I +   GA +      +LD+    +
Sbjct  29   NPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQ  83

Query  554  CASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWR  390
            C + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W+
Sbjct  84   CPNAVLQHMSIPQFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWK  143

Query  389  IRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRY  228
            +  +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  
Sbjct  144  VNNEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLECKNIGSN  196

Query  227  FDESAGAARLALTED  183
            F    G  RL    D
Sbjct  197  F--KNGYPRLVTVND  209



>gb|AIT42202.1| Kunitz-type inhibitor C [Solanum tuberosum]
Length=221

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 89/195 (46%), Gaps = 34/195 (17%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TK  555
            NPI LPT    DD  VL    D DG+ LR GE Y I +   GA +      +LD+    +
Sbjct  29   NPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQ  83

Query  554  CASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWR  390
            C + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W+
Sbjct  84   CPNAVLQHMSIPQFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWK  143

Query  389  IRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRY  228
            +  +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  
Sbjct  144  VNNEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLECKNIGSN  196

Query  227  FDESAGAARLALTED  183
            F    G  RL    D
Sbjct  197  F--KNGYPRLVTVND  209



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 18/174 (10%)
 Frame = -1

Query  677  TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRI  498
            + VLD  G  L+ G  Y+I    RG   GG++LA   + T     V     ++ G P+  
Sbjct  22   SAVLDLSGKKLQKGVDYYILPVIRGRG-GGLKLANARNKTSPLDVVQDQFEVSSGFPLTF  80

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD---  330
            +PA + N + V  ST  +  F  AT+  C  S  W++  +D+  GQ+F++SG    +   
Sbjct  81   SPANQ-NQSFVCLSTDLNIKFSAATT--CAQSTVWKLDSFDESLGQWFVTSGGVEGNPGR  137

Query  329  --ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
              IS  FKIE   +   YK+ +CP    F   +C +VG Y  +  G  RLAL++
Sbjct  138  QTISNWFKIEKYND--DYKLVFCPTVCNFCKVLCRDVGIYIKD--GIRRLALSD  187



>gb|AAM21644.1|AF495583_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=186

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 7/158 (4%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSHLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVV--ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCP  264
              G   L +G  +    S  FKI  + +L  Y + YCP
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCP  175



>sp|O24384.1|CPI8_SOLTU RecName: Full=Cysteine protease inhibitor 8; AltName: Full=PCPI-8; 
Short=Pcpi8; Flags: Precursor, partial [Solanum tuberosum]
 gb|AAB63250.1| cysteine proteinase inhibitor 8 precursor, partial [Solanum tuberosum]
Length=221

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 89/195 (46%), Gaps = 34/195 (17%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TK  555
            NPI LPT    DD  VL    D DG+ LR GE Y I +   GA +      +LD+    +
Sbjct  29   NPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQ  83

Query  554  CASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWR  390
            C + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W+
Sbjct  84   CPNAVLQHMSIPQFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWK  143

Query  389  IRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRY  228
            +  +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  
Sbjct  144  VNNEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLECKNIGST  196

Query  227  FDESAGAARLALTED  183
            F    G  RL    D
Sbjct  197  FKN--GYPRLVTVND  209



>gb|AIT42187.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 83/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   +       +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSFNHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|XP_006362681.1| PREDICTED: serine protease inhibitor 1-like [Solanum tuberosum]
Length=186

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 7/158 (4%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVV--ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCP  264
              G   L +G  +    S  FKI  + +L  Y + YCP
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCP  175



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/174 (32%), Positives = 86/174 (49%), Gaps = 20/174 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD  G  LR G  Y+I    RG   GG+ LA   + + C  +VV  +  +++G P+  
Sbjct  21   PVLDISGKKLRTGTDYYILPVFRGRG-GGLTLASTGNES-CPLDVVQEQLEVSDGLPVTF  78

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD---  330
            +P       VV  ST Q+  F  AT  +CV    W++  +D  + Q+F+++G    +   
Sbjct  79   SPVNIKKG-VVRVSTDQNIKFSAAT--ICVQPTLWKLDSFDDSTRQWFVTTGGVEGNPGR  135

Query  329  --ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
              I   FKIE   +   YK+ +CP    F   +C +VG + D   G  RLAL++
Sbjct  136  ETIDNWFKIEKYED--DYKLVFCPTVCDFCKVMCRDVGVFID--GGVRRLALSD  185



>gb|AAM21643.1|AF495582_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=213

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/158 (34%), Positives = 75/158 (47%), Gaps = 7/158 (4%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVV--ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCP  264
              G   L +G  +    S  FKI  + +L  Y + YCP
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCP  175



>gb|AIT42193.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +      +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFEIELLNIQFSISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL ++
Sbjct  198  --HQNGKIRLALVKE  210



>ref|NP_001275101.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94187.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94197.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94198.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AIT42173.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=219

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/193 (32%), Positives = 84/193 (44%), Gaps = 17/193 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++T + CVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVKSCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFV-SDISGQFKIEVAPELNAYKITYCPF--------GGHICYNVGRYFD  222
              G   L +G  +  + S  FKI  + +L  Y + YCP             C  VG    
Sbjct  139  SLGTMLLETGGTIGQEDSSWFKIVKSSQL-GYNLLYCPATMICPFCSDDEFCLKVGVI--  195

Query  221  ESAGAARLALTED  183
               G  RLAL +D
Sbjct  196  HQNGKRRLALVKD  208



>gb|AGF39574.1| Kunitz-type protease inhibitor D, partial [Solanum tuberosum]
Length=219

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 89/193 (46%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +      +LD+    +C 
Sbjct  29   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  83

Query  548  SNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  84   NAVLQHMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  143

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F 
Sbjct  144  NEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLECKNIGSNFK  196

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  197  N--GYPRLVTVDD  207



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 93/182 (51%), Gaps = 15/182 (8%)
 Frame = -1

Query  695  LPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRP-LT  519
            +  A ++PVLDTDGD LR G  Y++ S+  GA  GG+ L    +   C   VV  R  L 
Sbjct  23   VANAANSPVLDTDGDELRTGVRYYVVSSIWGAGGGGLALG-RATGQSCPEIVVQRRSDLD  81

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+ I   A+    VV  ST  +  F     RLC +S  W++  YD  +G++++++  
Sbjct  82   NGTPV-IFSNADSKDGVVRLSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTDG  140

Query  341  FV-----SDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
                   + ++  FKIE A  L  YK  +CP        +C ++GR+ D+  G  RLAL+
Sbjct  141  VRGQPGPNTLTSWFKIERAGVL-GYKFRFCPSVCDSCKTLCSDIGRHSDDD-GQIRLALS  198

Query  188  ED  183
            ++
Sbjct  199  DN  200



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 80/175 (46%), Gaps = 14/175 (8%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSAT-KCASNVVISRPLTEGD-PIR  501
            PVLD DG+ LR G  Y+I    R    G    A   + T  C   VV +R   + D P+ 
Sbjct  35   PVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTPNGTFVCPPRVVQTRKEVDHDRPLA  94

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVSD--  330
              P   P   VV  ST  +  F         SS  WR+ +YD+ +GQYF++ G    +  
Sbjct  95   FFP-ENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPG  153

Query  329  ---ISGQFKIEVAPELNAYKITYCP-FGGHI---CYNVGRYFDESAGAARLALTE  186
               IS  FKIE       YK+ +CP   G     C +VG Y D+  G  RLAL++
Sbjct  154  PETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQK-GRRRLALSD  207



>gb|AAM10742.1|AF492358_1 putative kunitz-type proteinase inhibitor precursor P1D4 [Solanum 
tuberosum]
Length=212

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 74/168 (44%), Gaps = 6/168 (4%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I S GRGA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISIGRGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGPHIFEDELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGHICYNVG  234
              G   L +G  +    S  FKI  +  L    +         C  +G
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSHLVPLIVLSISSDDQFCLKIG  186



>gb|AAL60244.1|AF459079_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
Length=215

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 89/193 (46%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +      +LD+    +C 
Sbjct  25   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  79

Query  548  SNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  80   NAVLQHMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  139

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F 
Sbjct  140  DEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNIGSNF-  191

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  192  -KNGYPRLVTVDD  203



>gb|AIT42194.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 84/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+R   ++      +      +  F ++TS++CVS    ++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTICKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF----------GGHICYNVGRY  228
              G   L +G  +S   S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTISQADSSWFKIVKSSQF-GYNLLYCPVTTTMTLPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>gb|AIT42203.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=217

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 89/193 (46%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +      +LD+    +C 
Sbjct  27   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  81

Query  548  SNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  82   NAVLQHMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  141

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F 
Sbjct  142  DEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNIGSNF-  193

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  194  -KNGYPRLVTVDD  205



>prf||1802409A albumin
Length=221

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 92/182 (51%), Gaps = 15/182 (8%)
 Frame = -1

Query  695  LPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRP-LT  519
            +  A ++PVLDTDGD L+ G  Y++ S+  GA  GG+ L    +   C   VV  R  L 
Sbjct  23   VANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALG-RATGQSCPEIVVQRRSDLD  81

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+ I   A+    VV  ST  +  F     RLC +S  WR+  YD  +G++++++  
Sbjct  82   NGTPV-IFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDG  140

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE A  L  YK  +CP        +C ++GR+ D+  G  RLAL+
Sbjct  141  VKGEPGPNTLCSWFKIEKAGVL-GYKFRFCPSVCDSCTTLCSDIGRHSDDD-GQIRLALS  198

Query  188  ED  183
            ++
Sbjct  199  DN  200



>gb|AAL60242.1|AF459077_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
Length=217

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 89/193 (46%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +      +LD+    +C 
Sbjct  27   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  81

Query  548  SNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  82   NAVLQHMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  141

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F 
Sbjct  142  DEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNIGSNF-  193

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  194  -KNGYPRLVTVDD  205



>gb|AAL60247.1|AF459082_1 putative Kunitz-type tuber invertase inhibitor precursor [Solanum 
tuberosum]
Length=186

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 82/170 (48%), Gaps = 29/170 (17%)
 Frame = -1

Query  716  STFNPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA-  561
            S+ NPI LPT    DD  VL    D DG+ LR GE Y I +   G  +      +LD+  
Sbjct  20   SSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGGGA-----VYLDNIG  74

Query  560  -TKCASNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSV  399
              +C + V+    I + L +G P+     +E +   VV   T     FFV TS+LCV   
Sbjct  75   NLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYGDVVRVMTGVYIKFFVKTSKLCVDET  134

Query  398  FWRIRYDQPSGQYFLSSGEFVSDISGQFKIE----VAPEL-NAYKITYCP  264
             W++ ++Q      + +G  V + +  FKI+    V P + N YK+ +CP
Sbjct  135  VWKVNHEQ-----LVVTGGNVGNENDIFKIKKTDLVIPGMKNVYKLLHCP  179



>gb|AIT42205.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=217

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 89/193 (46%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +      +LD+    +C 
Sbjct  27   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  81

Query  548  SNVV----ISRPLTEGDPIRITPAAEP-NATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E  +  VV   T     FFV T++LCV    W++ 
Sbjct  82   NAVLQHMSIPQFLGKGTPVMFVRKSESYDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  141

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F 
Sbjct  142  DEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNIGSNFK  194

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  195  N--GYPRLVTVDD  205



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/182 (33%), Positives = 92/182 (51%), Gaps = 15/182 (8%)
 Frame = -1

Query  695  LPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRP-LT  519
            +  A ++PVLDTDGD L+ G  Y++ S+  GA  GG+ L    +   C   VV  R  L 
Sbjct  23   VANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALG-RATGQSCPEIVVQRRSDLD  81

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+ I   A+    VV  ST  +  F     RLC +S  WR+  YD  +G++++++  
Sbjct  82   NGTPV-IFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDG  140

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE A  L  YK  +CP        +C ++GR+ D+  G  RLAL+
Sbjct  141  VKGEPGPNTLCSWFKIEKAGVL-GYKFRFCPSVCDSCTTLCSDIGRHSDDD-GQIRLALS  198

Query  188  ED  183
            ++
Sbjct  199  DN  200



>ref|XP_006353928.1| PREDICTED: putative Kunitz-type tuber invertase inhibitor precursor 
[Solanum tuberosum]
Length=219

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 85/188 (45%), Gaps = 22/188 (12%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQ-LAWLDSATKCAS  546
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +  +  +  L        
Sbjct  29   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGAVYLNNIGNLQCPNAVLQ  88

Query  545  NVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPS  369
            ++ I + L +G P+     +E +   VV   T     FFV T++LCV    W++  +Q  
Sbjct  89   HMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNDEQ--  146

Query  368  GQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFDESAGA  207
                + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F    G 
Sbjct  147  ---LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNIGSNFKN--GY  199

Query  206  ARLALTED  183
             RL   +D
Sbjct  200  PRLVTVDD  207



>gb|AAM21642.1|AF495581_1 putative Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=229

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/158 (33%), Positives = 75/158 (47%), Gaps = 7/158 (4%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSHLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCP  264
              G   L +G  +    S  FKI  + +L  Y + YCP
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCP  175



>gb|ACO40086.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + CV S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSTDLNIKF--SIKKACVHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|AAF15901.1|AF208020_1 putative proteinase inhibitor [Nicotiana glutinosa]
Length=241

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 65/203 (32%), Positives = 91/203 (45%), Gaps = 34/203 (17%)
 Frame = -1

Query  707  NPIRLPTADDT----------PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSAT  558
            NPI LPT  D            VLD +G+ L+ GE Y I S   GA  GGV L ++ + T
Sbjct  31   NPIVLPTTTDDDKGFPVPVLPEVLDINGEPLQIGEKYHIVSAIWGAGGGGVYLTYVRN-T  89

Query  557  KCASNVVIS-RPLTEGDPIRITPAA--EPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI  387
            +C ++VV   R   +  P+   P A   P   VV  +   +  F V TSRLCV+   W++
Sbjct  90   RCPNDVVQHGRTPKKACPLNSLPLAPGPPPFNVVRETNNINIMFSVPTSRLCVNETVWKV  149

Query  386  RYDQPS--GQYFLSSGEFVSD-----ISGQFKIE-VAPELNAYKITYCP-------FGGH  252
                 +  G  F+ +G  + +     I+  FKIE V      YK+ YCP           
Sbjct  150  GDPDLTARGTRFVVTGGTLGNPRPETINSWFKIEKVTKTAPFYKLRYCPDNFLCPECHPD  209

Query  251  ICYNVGRYFDESAGAARLALTED  183
            +C +VG   +      RLALT  
Sbjct  210  VCLDVGLTHER-----RLALTNQ  227



>gb|ACS92518.1| Kunitz-type protease inhibitor KPI-C6.1 [Populus trichocarpa 
x Populus nigra]
Length=202

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDAFGDEVRTGDRYII-----GAASN--DFAVTSSRLICNSDVVFS-PMSDGLPVMFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKCEGGNNLYQLSYCPISEPIC  163



>gb|ACO40144.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40158.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F++   + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSTDLNIKFYI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGTL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|ACO40133.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + CV S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSDD-DVIRVSTDLNIKF--SIKKACVHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 86/173 (50%), Gaps = 19/173 (11%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIRI  498
            PVLD  G+ LR G  Y+I    RG   GG+ LA   + T C  +VV  +  ++ G P+  
Sbjct  25   PVLDISGEELRTGTDYYILPVIRGGG-GGLTLASTGNET-CPLDVVQEQLEVSNGLPLTF  82

Query  497  TPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEF-----VS  333
            +P       VV  ST  +  F  AT  +CV S  W++  D+ + +  +++G       + 
Sbjct  83   SPVNITKG-VVRVSTDLNIKFSAAT--ICVQSTVWKLDNDEATQKMVVTTGGVEGNPGIE  139

Query  332  DISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
             +S  FKIE   +   YK+ +CP    F   +C ++G + D  AG  RLAL++
Sbjct  140  TLSNWFKIERYED--DYKLVFCPGVCDFCRPVCGDLGVFID--AGIRRLALSD  188



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 90/187 (48%), Gaps = 20/187 (11%)
 Frame = -1

Query  713  TFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI  534
             F+ + LP + D PV DTDG+ L+ G  Y+I  T      GG+ L   + +  C  +V +
Sbjct  14   VFSALALPASADEPVRDTDGNVLQRGVDYYIRPTVTDIG-GGLTLEARNGS--CPLSVAL  70

Query  533  -SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYF  357
             S P   G P++ +P  + + TV L ST  +  F   T+  C+ S  W++  D+  G+Y+
Sbjct  71   ASLPADNGLPLQFSPEDDDDDTVEL-STDTNVIFSAFTT--CLQSTVWKLELDEGEGRYY  127

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            +  G    +     +S  FKIE       YK+ +CP    +   +C ++G Y  E  G  
Sbjct  128  VVIGGVAGNPGKETLSNWFKIESYQ--GVYKLVFCPTVCDYCRPVCGSLGVY--EQGGRQ  183

Query  203  RLALTED  183
             L + +D
Sbjct  184  WLGIRDD  190



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 85/184 (46%), Gaps = 20/184 (11%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-  528
            P+R   + D PVLD  G  LR G  Y+I    +G   GG+ LA   +   C  +VV  + 
Sbjct  22   PVRGNASPD-PVLDVAGKKLRAGSKYYILPVTKGQG-GGLTLAGRSNNKTCPLDVVQEQH  79

Query  527  PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLS  351
                G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ ++
Sbjct  80   SFRNGLPVTFSP-VNPKKGVVRESTDFNIKFDAATS--CAQSTVWKLDNFDAALGQWLVT  136

Query  350  SGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARL  198
            +G    +     +   FKIE       YK+ +CP    F   +C +VG + +   G  RL
Sbjct  137  TGGVEGNPGPRTMRNWFKIE--KFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRL  192

Query  197  ALTE  186
            AL++
Sbjct  193  ALSD  196



>gb|ACS92499.1| Kunitz-type protease inhibitor KPI-C6.2 [Populus trichocarpa 
x Populus nigra]
 gb|AEK26935.1| Kunitz-type trypsin inhibitor A6 [Populus nigra]
Length=202

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDAFGDEVRTGDRYII-----GAASN--DFAVTSSRLICNSDVVFS-PMSDGLPVMFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>pdb|3TC2|A Chain A, Crystal Structure Of Potato Serine Protease Inhibitor.
 pdb|3TC2|B Chain B, Crystal Structure Of Potato Serine Protease Inhibitor.
 pdb|3TC2|C Chain C, Crystal Structure Of Potato Serine Protease Inhibitor.
Length=187

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 76/177 (43%), Gaps = 12/177 (7%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCASNVVI--SRPLTE  516
            +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+ V    S     
Sbjct  3    SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS  62

Query  515  GDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF  339
            G P+R   ++      +      +  F ++TS++CVS   W++  YD   G   L +G  
Sbjct  63   GTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDASLGTMLLETGGT  122

Query  338  VSDI-SGQFKIEVAPELNAYKITYCPF----GGHICYNVGRYFDESAGAARLALTED  183
            +    S  FKI  + +   Y + YCP         C  VG       G  RLAL +D
Sbjct  123  IGQADSSWFKIVKSSQF-GYNLLYCPVTTSSDDQFCLKVGVV--HQNGKRRLALVKD  176



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 87/186 (47%), Gaps = 24/186 (13%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVIS  531
            P+R   + D PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  
Sbjct  22   PVRGNASPD-PVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPLDVVQE  77

Query  530  R-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
            +     G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ 
Sbjct  78   QHSFRNGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDTAFGQWL  134

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            +++G    +     +   FKIE       YK+ +CP    F   +C +VG + +   G  
Sbjct  135  VTTGGVEGNPGPRTMRNWFKIE--KFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVR  190

Query  203  RLALTE  186
            RLAL++
Sbjct  191  RLALSD  196



>gb|AAV41231.1| putative 21 kDa trypsin inhibitor [Theobroma cacao]
Length=221

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 91/182 (50%), Gaps = 15/182 (8%)
 Frame = -1

Query  695  LPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
            +  A ++P+LDTDGD L+ G  Y++ S+  GA  GG+ L  +     C   VV  R  L 
Sbjct  23   VANAANSPLLDTDGDELQTGVQYYVLSSISGAGGGGLALEGV-QVQSCPEIVVQRRSELD  81

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+ I   A+    VV  ST  +  F     RLC +S  WR+  YD  +G+++L++  
Sbjct  82   NGTPV-IFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWLATDG  140

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCPFGGH----ICYNVGRYFDESAGAARLALT  189
               +     +   FKIE +  L  YK  +CP        +C ++GR+ D+  G  RLA +
Sbjct  141  VKGETGPNTLCSWFKIEKSGVL-GYKFRFCPSACDSCTTLCSDIGRHSDDD-GQIRLAFS  198

Query  188  ED  183
            ++
Sbjct  199  DN  200



>gb|ACO40100.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGREYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F++   + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSTDLNIKFYI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|AFZ77402.1| Kunitz-type proteinase inhibitor PKI2 [Solanum tuberosum]
Length=221

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 83/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIVSTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  R AL +D
Sbjct  198  --HQNGKRRSALVKD  210



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 56/187 (30%), Positives = 88/187 (47%), Gaps = 21/187 (11%)
 Frame = -1

Query  707  NPIRLPTA--DDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI  534
            NP  L +A    +PVLDT+GD +R G  YF+    RG   GG+  + +     C  +++ 
Sbjct  20   NPSELLSAGPSPSPVLDTNGDKIRTGSNYFVLPVIRGRG-GGLFPSNVKQNNTCPRDIIQ  78

Query  533  -SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQY  360
             S  + +G P+  TP  +P   V+  S+  +  FF  T  +C     W++  +D+   QY
Sbjct  79   ESLDVQQGLPVVFTP-VDPKKGVIRLSSDLNVRFFTPT--ICARETIWKVGDFDEKLKQY  135

Query  359  FLSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGA  207
            F+ +G    +     +S  FKIE       YK  +CP    F   IC +VG +     G 
Sbjct  136  FVVTGGVEGNPGPQTVSNWFKIEKLG--TDYKFVFCPSVCSFCKVICKDVGIF--TKNGV  191

Query  206  ARLALTE  186
              LAL++
Sbjct  192  RFLALSD  198



>gb|ACO40074.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40083.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40091.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40101.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40108.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40117.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40123.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40138.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40148.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40155.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F++   + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSTDLNIKFYI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>sp|P20347.3|CPI1_SOLTU RecName: Full=Cysteine protease inhibitor 1; AltName: Full=P340; 
AltName: Full=P34021; AltName: Full=PCPI 8.3; Flags: Precursor 
[Solanum tuberosum]
Length=222

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 85/191 (45%), Gaps = 25/191 (13%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGV-QLAWLDSATKC  552
            NPI LPT    DD  VL    D DG+ LR GE Y I +   GA +  +  +  L      
Sbjct  29   NPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIINNPLLGAGAVYLYNIGNLQCPNAV  88

Query  551  ASNVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQ  375
              ++ I + L EG P+     +E +   VV   T     FFV T++LCV    W++  +Q
Sbjct  89   LQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVVYIKFFVKTTKLCVDQTVWKVNDEQ  148

Query  374  PSGQYFLSSGEFVSDISGQFKIE----VAP--ELNAYKITYCPFGGHI-CYNVGRYFDES  216
                  + +G  V + +  FKI     V P      YK+ +CP   H+ C N+G  F   
Sbjct  149  -----LVVTGGKVGNENDIFKIMKTDLVTPGGSKYVYKLLHCP--SHLGCKNIGGNFKN-  200

Query  215  AGAARLALTED  183
             G  RL   +D
Sbjct  201  -GYPRLVTVDD  210



>emb|CAA45723.1| aspartic proteinase inhibitor [Solanum tuberosum]
Length=217

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 84/195 (43%), Gaps = 23/195 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+R +   +     +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVRFSHFGQG----IFENELLNIQFAISTSKLCVSYTIWKVGDYDA  134

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  135  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV  193

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  194  --HQNGKRRLALVKD  206



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/181 (31%), Positives = 82/181 (45%), Gaps = 23/181 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
             A   PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +    
Sbjct  26   NAQPDPVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRGNNKTCPLDVVQEQHSFK  82

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+  +P   P   VV  ST  +     ATS  C  S  W++  +D   GQ+ +++G 
Sbjct  83   NGLPVTFSP-VNPKKGVVRESTDINIKLDAATS--CAQSTVWKLDNFDAAFGQWLVTTGG  139

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE       YK+ YCP    F   +C +VG + +   G  RLAL+
Sbjct  140  VEGNPGPRTMRNWFKIE--KFFGDYKLVYCPSVCNFCRGLCRDVGIFIN--GGVRRLALS  195

Query  188  E  186
            +
Sbjct  196  D  196



>gb|AIT42184.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=219

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 80/193 (41%), Gaps = 17/193 (9%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASN  543
            T ++ NPI LP +D TPVLD  G  L P  +Y I ST  GA  G V L    +     +N
Sbjct  20   TFTSENPINLP-SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNPDAPCAN  78

Query  542  VVI---SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             V    S     G P+    ++      +      +  F ++TS+LCVS   W++  YD 
Sbjct  79   GVFRYNSDVGPSGTPVIFIGSSSHFGPHIFEDELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF--------GGHICYNVGRYFD  222
              G   L +G  +    S  FKI V      Y + YCP             C  VG    
Sbjct  139  SLGTMLLETGGTIGQADSSWFKI-VKSSRFGYNLLYCPVTIICPSCPDDQFCSKVGVV--  195

Query  221  ESAGAARLALTED  183
               G  RLAL +D
Sbjct  196  HQNGKRRLALVKD  208



>emb|CAA44005.1| aspartic proteinase inhibitor homologue [Solanum tuberosum]
Length=216

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 81/197 (41%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+    P  VLDT+G  L P  +Y I S GRGA  G V L    +S   C
Sbjct  17   TFTSQNPINLPSESPVPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPC  76

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  77   PDGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVSYRNWKVGNL  132

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            +       L +G  +    S  FKI  + +   Y + YCP   H           C  VG
Sbjct  133  NAHLWTMLLETGGTIGQADSSYFKIVKSSKF-GYNLLYCPITRHFLCPFCRDDNFCAKVG  191

Query  233  RYFDESAGAARLALTED  183
               D   G  RLAL  +
Sbjct  192  --VDIQNGKRRLALVSE  206



>gb|ACS92512.1| Kunitz-type protease inhibitor KPI-C7 [Populus trichocarpa x 
Populus nigra]
Length=202

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  G+ +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGNEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVMFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKCEGGNNLYQLSYCPISEPIC  163



>ref|XP_006360288.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=212

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 80/171 (47%), Gaps = 15/171 (9%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL--DSATKCASNVVISRPLTE-GDPIR  501
            VLD DG  L     Y I         GGV LA L   S   C ++VV S+ +T+ G  + 
Sbjct  29   VLDIDGKPLNASRRYHILPAYNTMRDGGVSLANLGDQSQNTCPTSVVQSKDVTDNGIAVH  88

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI---RYDQP-SGQYFLSSGEFVS  333
              P  +    +V  S   +  F++     C + + W++   R D P +G    + GE V+
Sbjct  89   FMPKDQTYEHIVAYSPV-NIRFYLDNFNPCSNLMVWKVDHLREDVPLNGHTISTGGELVN  147

Query  332  --DISGQFKIEVAPELNAYKITYCPFGGHICYNVGRYFDESAGAARLALTE  186
              D+S  F+IE     N YK+ +CP     CY++GR+    +G  RL L+E
Sbjct  148  PIDVSRWFQIEPVAN-NKYKLVFCPRIK--CYDIGRF--RQSGYYRLGLSE  193



>ref|XP_004137639.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64219.1| hypothetical protein Csa_1G043220 [Cucumis sativus]
Length=205

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 89/185 (48%), Gaps = 21/185 (11%)
 Frame = -1

Query  701  IRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVV-IS  531
            +R   AD +P  VLDTDG  LR G+ Y+I S      SGG+ +  +    KC  N++  S
Sbjct  19   VRFCRADASPDAVLDTDGKKLRAGDQYYILSV-YSRNSGGLSIGGIYGYEKCPINILPES  77

Query  530  RPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFL  354
                 G P   +P   P   VV  ST  +   F A +R  +S+V W++ ++D+   QYF+
Sbjct  78   YDYLHGLPATFSP-INPKKGVVRVSTDLNIQ-FEANTRCGISTV-WKVGKFDEYLKQYFV  134

Query  353  SSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAAR  201
            + G    +     I   FK+E   +   YK+ YCP    +   +C +VG ++    G   
Sbjct  135  TMGGMKGNPGRETIENWFKVEKYGK--NYKLVYCPTVCKYCKVVCKDVGLFYKN--GRRV  190

Query  200  LALTE  186
            +AL +
Sbjct  191  IALND  195



>gb|ACO39957.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO40004.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>sp|Q43645.2|API4_SOLTU RecName: Full=Aspartic protease inhibitor 4; AltName: Full=API-13; 
Short=PI13; Flags: Precursor [Solanum tuberosum]
 gb|AIT42156.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 81/197 (41%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+    P  VLDT+G  L P  +Y I S GRGA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPVPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVSYRNWKVGNL  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            +       L +G  +    S  FKI  + +   Y + YCP   H           C  VG
Sbjct  137  NAHLWTMLLETGGTIGQADSSYFKIVKSSKF-GYNLLYCPITRHFLCPFCRDDNFCAKVG  195

Query  233  RYFDESAGAARLALTED  183
               D   G  RLAL  +
Sbjct  196  --VDIQNGKRRLALVSE  210



>gb|AIT42199.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 83/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP+ D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSKNPINLPS-DATPVLDVAGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+    ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVIFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +   Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQF-GYNLLYCPVTSTMSCPFSSDDQFCLXVGVV  197

Query  227  FDESAGAARLALTED  183
                 G  RLAL +D
Sbjct  198  --HQNGKRRLALVKD  210



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 84/174 (48%), Gaps = 19/174 (11%)
 Frame = -1

Query  701  IRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVV-IS  531
            +R   AD +P  VLDTDG  LR G+ Y+I S      SGG+ +  +    KC  N++  S
Sbjct  19   VRFCRADASPDAVLDTDGKKLRAGDQYYILSV-YSRNSGGLSIGGIYGYEKCPINILPES  77

Query  530  RPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFL  354
                +G P   +P   P   VV  ST  +   F A++R  +S+V W++ ++DQ   QYF+
Sbjct  78   YDYLDGLPATFSP-VNPKKGVVRVSTDLNIE-FEASTRCGISTV-WKVGKFDQYLKQYFV  134

Query  353  SSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDE  219
            + G    +     I   FK+E       YK  YCP    +   +C +VG ++  
Sbjct  135  TMGGTKGNPGRETIGNWFKVE--KHGKNYKFVYCPTVCKYCKVMCKDVGLFYKN  186



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 88/187 (47%), Gaps = 26/187 (14%)
 Frame = -1

Query  704  PIRLPTADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVIS  531
            P+R   + D PVLD  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  
Sbjct  22   PVRGNASPD-PVLDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPLDVVQE  77

Query  530  R-PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
            +     G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ 
Sbjct  78   QHSFRNGLPVTFSP-VNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAALGQWL  134

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP-----FGGHICYNVGRYFDESAGA  207
            +++G    +     +   FKIE       YK+ +CP     F G +C +VG + +   G 
Sbjct  135  VTTGGVEGNPGPRTMRNWFKIE--KFYGDYKLVFCPSVCNIFRG-LCRDVGIFIN--GGV  189

Query  206  ARLALTE  186
             RLAL++
Sbjct  190  RRLALSD  196



>gb|AIT42182.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=221

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 83/195 (43%), Gaps = 19/195 (10%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCAS  546
            T ++ NPI LP +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+
Sbjct  20   TFTSQNPINLP-SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCAN  78

Query  545  NVV--ISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQ  375
             +    S     G P+    ++      +  +   +  F ++TS+LCVS   W++  YD 
Sbjct  79   GIFRYNSDVGPSGTPVIFIGSSSHFGQGIFENELLNIQFSISTSKLCVSYTIWKVGDYDA  138

Query  374  PSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRY  228
              G   L +G  +    S  FKI  + +L  Y + YCP               C  VG  
Sbjct  139  SLGTMLLETGGTIGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCLKVGVV  197

Query  227  FDESAGAARLALTED  183
                 G   LAL +D
Sbjct  198  --HQNGKKTLALVKD  210



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 79/161 (49%), Gaps = 19/161 (12%)
 Frame = -1

Query  638  GETYFITSTGRGAASGGVQLAWLDSATKCASNVVI-SRPLTEGDPIRITPAAEPNATVVL  462
            G  Y+I    RG   GG+ LA   + T C  +VV   + ++ G P+  TP   P   V+ 
Sbjct  1    GVDYYILPVFRGRG-GGLTLASTGNET-CPLDVVQEQQEVSNGLPLTFTPV-NPKKGVIR  57

Query  461  PSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD-----ISGQFKIEVAP  297
             ST  +  F  + S +CV S  W++ YD+ SGQ F+++G    +     +   FKIE   
Sbjct  58   VSTDHNIKF--SASTICVQSTLWKLEYDESSGQRFVTTGGVEGNPGRETLDNWFKIEKYE  115

Query  296  ELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
            +   YK+ +CP    F   +C ++G Y     G  RLAL++
Sbjct  116  D--DYKLVFCPTVCDFCKPVCGDIGIYIQN--GYRRLALSD  152



>gb|ACO40082.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40094.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40118.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40124.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40128.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40146.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F +   + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGTL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>ref|XP_006360287.1| PREDICTED: 21 kDa seed protein-like [Solanum tuberosum]
Length=217

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/172 (31%), Positives = 88/172 (51%), Gaps = 14/172 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVVISR-PLTEGDPIR  501
            + D +G+ L     YFI S   GA  GGV+LA L +  +  C ++VV SR  L  G  + 
Sbjct  34   IRDIEGNPLNKNSRYFIVSAIWGAGGGGVRLANLGNQGQNDCPTSVVQSRNDLDNGVAVY  93

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQ-YFLSSGEFVSD-  330
            ITP  +P   ++   +  +  F++  S  C     W +  + +P+ Q Y +S+GE + D 
Sbjct  94   ITP-RDPKYDIISEMSTVNIKFYL-DSPTCSHFTMWMVDNFPKPTDQLYTISTGEQLIDS  151

Query  329  --ISGQFKIEVAPELNAYKITYCPFGGHI-CYNVGRYFDESAGAARLALTED  183
              ++ +F+I+ +   + YK+ +CP G    C NVG    +  G  RL LTE+
Sbjct  152  MNLNNRFQIK-SLGGSTYKLVFCPHGEKFTCQNVG--IADENGYNRLVLTEN  200



>gb|AIT42207.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=210

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 60/196 (31%), Positives = 87/196 (44%), Gaps = 36/196 (18%)
 Frame = -1

Query  707  NPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TK  555
            NPI LPT    DD  VL    D DG+ LR GE Y I +   GA +      +LD+    +
Sbjct  27   NPIVLPTTCHDDDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQ  81

Query  554  CASNVV----ISRPLTEGDPIRITPAAEPNAT---VVLPSTFQSFAFFVATSRLCVSSVF  396
            C + V+    I + L +G P+     +E  +    VV   T     FFV T+R CV    
Sbjct  82   CPNAVLQHMSIPQFLGKGTPVMFVRKSESESDYGDVVRLMTAVYIKFFVKTTRFCVKETV  141

Query  395  WRIRYDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVG  234
            W++  +Q      + +G  V + +  FKI      +    N YK+ +CP   H+ C N+G
Sbjct  142  WKVNDEQ-----LVVTGGNVGNENDIFKIMKTDLVIRGMKNVYKLLHCP--SHLQCKNIG  194

Query  233  RYFDESAGAARLALTE  186
              F    G  RL   +
Sbjct  195  SNF--KNGYPRLVTVD  208



>gb|AIT42204.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=217

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 88/193 (46%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ L  GE Y I +   GA +      +LD+    +C 
Sbjct  27   NPIVLPTTCHDNLVLPEVYDQDGNPLSIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  81

Query  548  SNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  82   NAVLQHMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  141

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F 
Sbjct  142  DEQ-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLQCKNIGSNF-  193

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  194  -KNGYPRLVTVDD  205



>gb|AIT42216.1| Kunitz-type inhibitor D, partial [Solanum tuberosum]
Length=203

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 90/181 (50%), Gaps = 14/181 (8%)
 Frame = -1

Query  698  RLPTADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVVISR-  528
             +P      + D +G+ L     YFI S   GA  GGV+LA L +  +  C ++VV SR 
Sbjct  11   NIPNQAFRTIRDIEGNPLNKNSRYFIVSAIWGAGGGGVRLANLGNQGQNDCPTSVVQSRN  70

Query  527  PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQ-YFL  354
             L  G  + ITP  +P   ++   +  +  F++  S  C   + W +  + +P  Q Y +
Sbjct  71   DLDNGIAVYITP-HDPKYDIISEMSTVNIKFYL-DSPTCSHFIMWMVDDFPKPVDQLYTI  128

Query  353  SSGEFV---SDISGQFKIEVAPELNAYKITYCPFGGHI-CYNVGRYFDESAGAARLALTE  186
            S+GE +    +++ +F+I+     + YK+ +CP+G    C NVG    +  G  RL LTE
Sbjct  129  STGEQLINSVNLNNRFQIKSLGG-STYKLVFCPYGEKFTCQNVG--IADENGYNRLVLTE  185

Query  185  D  183
            +
Sbjct  186  N  186



>ref|XP_009588822.1| PREDICTED: kunitz-type serine protease inhibitor DrTI-like [Nicotiana 
tomentosiformis]
Length=215

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 87/180 (48%), Gaps = 19/180 (11%)
 Frame = -1

Query  680  DTP------VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL--DSATKCASNVVISRP  525
            DTP      V DTDG  L+    YF+ S+  GA  GGV+LA +       C + VV SR 
Sbjct  24   DTPNQLLRAVHDTDGYPLQVNTRYFVFSSCWGAGGGGVRLANIGDQEENACPTAVVQSRS  83

Query  524  -LTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLS  351
             L +G  +   P  EP    ++ S+  +  F+  +++ C +   W++  Y  P     +S
Sbjct  84   DLDKGIAVYFKP-KEPKHQQIVESSSLNINFYFDSNK-CANLTVWKVDNYPIPRKYSTIS  141

Query  350  SGEFVS---DISGQFKIEVAPELNAYKITYCPFGGHI-CYNVGRYFDESAGAARLALTED  183
            +G  +    D++  F+I+     + YK+ +CP+G    C NVG    E  G  RL LTE+
Sbjct  142  TGAKLGNPLDVNSWFQIKPLGG-STYKLVFCPYGEEFTCQNVG--ITEENGYRRLVLTEN  198



>gb|AAX47265.1| Kunitz-type proteinase inhibitor group B3 [Solanum palustre]
Length=194

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 76/183 (42%), Gaps = 18/183 (10%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCASNVVI--SRPLTE  516
            +D TPVLD  G  L P  +Y I ST  GA  G V L    +S   CA+ V    S     
Sbjct  4    SDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS  63

Query  515  GDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF  339
            G P+R   ++      +      +  F ++TS++CVS   W++  YD   G   L +G  
Sbjct  64   GTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDASLGTMLLETGGT  123

Query  338  VSDI-SGQFKIEVAPELNAYKITYCPF----------GGHICYNVGRYFDESAGAARLAL  192
            +    S  FKI  + +   Y + YCP               C  VG       G  RLAL
Sbjct  124  IGQADSSWFKIVKSSQF-GYNLLYCPVTTTMTLPFSSDDQFCLKVGVV--HQNGKRRLAL  180

Query  191  TED  183
             +D
Sbjct  181  VKD  183



>gb|ACO40081.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  S   +  F++   + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSADLNIKFYI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|ACO40070.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VMDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>ref|XP_009775241.1| PREDICTED: latex serine proteinase inhibitor-like [Nicotiana 
sylvestris]
Length=224

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 84/171 (49%), Gaps = 14/171 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL--DSATKCASNVVIS-RPLTEGDPIR  501
            V D  G  L  G  YFI S   GA  GGV+LA L       C ++VV S R   +G  + 
Sbjct  35   VKDWKGHPLDKGARYFIVSAFNGAGGGGVRLANLGGQDENTCPTSVVQSPRDKDDGIAVY  94

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFVS---  333
              P  EP    ++ S   +  F++   + C +   W++  Y +P+  Y +S+G  ++   
Sbjct  95   FKP-KEPKHQEIVESAPLNINFYLDYYK-CANLTVWKVDHYPKPAEHYTISTGAKLANPL  152

Query  332  DISGQFKIEVAPELNAYKITYCPFGGHI-CYNVGRYFDESAGAARLALTED  183
            D++  F+I+     ++YK+ +CP+G    C NVG      +G  RL LT++
Sbjct  153  DVNSWFQIKSLG--SSYKLVFCPYGETFTCQNVG--IVSESGYRRLVLTDN  199



>gb|ACO40038.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S+ W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSIMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>ref|XP_004235413.1| PREDICTED: aspartic protease inhibitor 1-like [Solanum lycopersicum]
Length=221

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 81/190 (43%), Gaps = 22/190 (12%)
 Frame = -1

Query  707  NPIRLP--TADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVI  534
            NPI LP  +    PVLDT G  +    +Y I S   GA  G V L    ++     N V 
Sbjct  28   NPIELPNDSTSGKPVLDTSGKEVTSHSSYRIISAFWGALGGDVYLGESPNSDAPCPNGVF  87

Query  533  ---SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSG  366
               S     G P++  P +E  +     +   +  F + T RLCV    W++  Y++  G
Sbjct  88   RYNSDRGPRGTPVKFIPHSEGMSE----NKLFNIQFDIPTFRLCVKYTIWKVGDYNETLG  143

Query  365  QYFLSSGEFVSDISGQFKIEVAPELNAYKIT-------YCPF--GGHICYNVGRYFDESA  213
               L +G  +      +  ++ P    Y +        +CPF   G +C NVG  F +  
Sbjct  144  GVLLETGGSIGQRDSSY-FKIVPSKLGYNLVLCDPTPIFCPFCRKGQLCVNVGVVFQD--  200

Query  212  GAARLALTED  183
            G  RLALT+D
Sbjct  201  GRRRLALTKD  210



>gb|ACO40153.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSDD-DVIRVSTDLNIKF--SIKKACDHSSVWKIQKSSNSKVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|ACO39958.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEM-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/172 (31%), Positives = 76/172 (44%), Gaps = 18/172 (10%)
 Frame = -1

Query  677  TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEGDPIR  501
             PVLD DGD +R G  Y+I S+ RGA  GGV          C   VV  +  L  G P+ 
Sbjct  25   NPVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIGNESCPLPVVQEKLDLLRGHPVT  84

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSD---  330
             TP       V + +       F   + +C  S  W++ +D+  GQ+F+ +     +   
Sbjct  85   FTPVNSKEGVVRVSTDLN--IKFSKAAPVCNESNVWKLDFDEELGQHFILTNGVEGNPGC  142

Query  329  --ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLAL  192
              I   FKIE  P   +Y++ +CP        IC +VG + D      RLAL
Sbjct  143  GTIHNWFKIE-GPYHKSYRLVFCPTVCNICNVICKDVGVFSDR-----RLAL  188



>gb|ACO40052.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40054.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 57/186 (31%), Positives = 86/186 (46%), Gaps = 27/186 (15%)
 Frame = -1

Query  695  LPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCASNVVIS-  531
            L +A + P  V+D  G  LR G  Y+I    RG   G      LDS     C  + V+  
Sbjct  21   LSSAAEAPPAVIDIAGKKLRTGVDYYILPVVRGRGGG----LTLDSTGNESCPLDAVVQE  76

Query  530  -RPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYF  357
               +  G P+  TP   P   V+  ST  +  F  A+  +CV +  W++  +D+ +G+YF
Sbjct  77   HHEIKNGLPLTFTP-VNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDEATGKYF  133

Query  356  LSSGEFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAA  204
            ++ G    +     IS  FKI+       YK+ YCP    F   IC +VG +  +  G  
Sbjct  134  ITIGGNEGNPGRETISNWFKIDKFER--DYKLVYCPTVCNFCKVICKDVGIFIQD--GTR  189

Query  203  RLALTE  186
            RLAL++
Sbjct  190  RLALSD  195



>sp|Q00652.1|CPI9_SOLTU RecName: Full=Cysteine protease inhibitor 9; AltName: Full=PKIX; 
AltName: Full=pT1; Flags: Precursor [Solanum tuberosum]
 emb|CAA40197.1| put. trypsin inhibitor [Solanum tuberosum]
Length=222

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 88/194 (45%), Gaps = 25/194 (13%)
 Frame = -1

Query  716  STFNPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGV-QLAWLDSA  561
            S+ NPI LP+    DD  VL    D DG  LR G+ Y I +   GA +  +  +  L   
Sbjct  26   SSENPIVLPSTCHDDDNLVLPEVYDQDGHPLRIGQRYIINNPLIGAGAVYLYNIGNLQCP  85

Query  560  TKCASNVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
                 ++ I + L EG P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  86   NAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTGVYIKFFVKTTKLCVDQTVWKVN  145

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE----VAPELN--AYKITYCPFGGHI-CYNVGRYF  225
            ++       + +G  V + +  FKI     V PE +   YK+ +CP   H+ C N+G  F
Sbjct  146  HEG-----LVVTGGQVGNENDIFKIRKTDLVTPEGSKFVYKLLHCP--SHLQCKNIGGNF  198

Query  224  DESAGAARLALTED  183
                G  RL   +D
Sbjct  199  KN--GYPRLVTVDD  210



>gb|ACO39954.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40035.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO40073.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40075.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40076.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40079.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40085.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40087.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40088.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40089.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40092.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40095.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40096.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40097.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40098.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40099.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40102.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40103.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40107.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40109.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40111.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40112.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40113.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40114.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40121.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40122.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40125.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40126.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40129.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40131.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40134.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40135.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40136.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40137.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40147.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40152.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40160.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40162.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40164.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSED-DVIRVSTDLNIKF--SIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|ACO39943.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39961.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39915.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39932.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39960.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39968.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40024.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40040.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39920.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39925.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39936.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39939.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39962.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39982.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39985.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40005.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40046.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40047.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40069.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40072.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  29   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  82

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + C  S  W+I+    S  Q+F+++G      
Sbjct  83   TFSPASSED-DVIRVSTDLNIKF--SIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  140  GVHTLTNWFKIEKAGTL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  186



>dbj|BAC23033.1| kunitz-type trypsin inhibitor [Solanum tuberosum]
Length=220

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 59/194 (30%), Positives = 88/194 (45%), Gaps = 25/194 (13%)
 Frame = -1

Query  716  STFNPIRLPTA---DDTPVL----DTDGDALRPGETYFITSTGRGAASGGV-QLAWLDSA  561
            S+ NPI LP+    DD  VL    D DG  LR G+ Y I +   GA +  +  +  L   
Sbjct  24   SSENPIVLPSTCHDDDNLVLPEVYDQDGHPLRIGQRYIINNPLIGAGAVYLYNIGNLQCP  83

Query  560  TKCASNVVISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
                 ++ I + L EG P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  84   NAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTGVYIKFFVKTTKLCVDQTVWKVN  143

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE----VAPELN--AYKITYCPFGGHI-CYNVGRYF  225
            ++       + +G  V + +  FKI     V PE +   YK+ +CP   H+ C N+G  F
Sbjct  144  HEG-----LVVTGGQVGNENDIFKIRKTDLVTPEGSKFVYKLLHCP--SHLQCKNIGGNF  196

Query  224  DESAGAARLALTED  183
                G  RL   +D
Sbjct  197  KN--GYPRLVTVDD  208



>gb|AAU09272.1| Kunitz-type proteinase inhibitor group B [Solanum tuberosum]
Length=194

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/183 (31%), Positives = 77/183 (42%), Gaps = 18/183 (10%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCASNVVI--SRPLTE  516
            +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+ V    S     
Sbjct  4    SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS  63

Query  515  GDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF  339
            G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD   G   L +G  
Sbjct  64   GTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGT  123

Query  338  VSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRYFDESAGAARLAL  192
            +    S  FKI  + +L  Y + YCP               C  VG       G  RLAL
Sbjct  124  IGQADSSWFKIVKSSQL-GYNLLYCPVTSTMSCPFSSDDQFCLKVGVV--HQNGKRRLAL  180

Query  191  TED  183
             +D
Sbjct  181  VKD  183



>gb|ACO40063.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSPIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO40077.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40090.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40115.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40116.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40120.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40132.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40156.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSDD-DVIRVSTDLNIKF--SIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 84/182 (46%), Gaps = 19/182 (10%)
 Frame = -1

Query  695  LPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPL  522
            L +A ++P  V+D DG  LR G  Y+I    RG   G    +  D      + V     +
Sbjct  21   LSSAAESPPEVVDIDGKILRTGVDYYILPVVRGRGGGLTMDSIGDKICPLDAVVQEHHEI  80

Query  521  TEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIR-YDQPSGQYFLSSG  345
             +G P+  TP   P   V+  ST  +  F  + + +CV +  W++  +D+ +GQYF++ G
Sbjct  81   DQGLPLTFTPV-NPKKGVIRESTDLNIIF--SANSICVQTTQWKLDDFDETTGQYFITLG  137

Query  344  EFVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLAL  192
                +     +S   KIE       YK+ YCP        IC ++G +  +  G  RLAL
Sbjct  138  GTQGNPGRETVSNWIKIEKFDR--DYKLLYCPTVCDICKVICKDIGIFIQD--GVRRLAL  193

Query  191  TE  186
            ++
Sbjct  194  SD  195



>gb|ACO40066.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S+  C S+V++S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSSIICNSDVMLS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>emb|CAC00536.1| Cathepsin D Inhibitor [Solanum lycopersicum]
Length=220

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 80/197 (41%), Gaps = 34/197 (17%)
 Frame = -1

Query  707  NPIRLPTA--DDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLA--------WLDSAT  558
            NPI LP+A     PVLDT+G+ L P  +Y I ST  GA  G V L          LD   
Sbjct  26   NPIELPSASPKPNPVLDTNGNELNPNSSYRIISTFWGALGGDVYLGKSPRSSAPCLDGVF  85

Query  557  KCASNVVISRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
            +  S+V      T G P+R  P +      +      +  F +AT +LCVS   W+    
Sbjct  86   RYNSDVG-----TVGTPVRFIPLSGG----IFEDQLMNLQFNIATVKLCVSYTIWKAGNL  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPF----------GGHICYNVG  234
            +       L +G  +  + S  FKI  A     Y + YCP           G   C  VG
Sbjct  137  NAYYRAMLLETGGSIGQVDSSYFKIVKASTF-GYNLLYCPITRPVLCPFCRGDDFCAKVG  195

Query  233  RYFDESAGAARLALTED  183
                +  G  RLAL  +
Sbjct  196  VINQD--GRRRLALVNE  210



>ref|XP_011014541.1| PREDICTED: wound-responsive protein GWIN3-like [Populus euphratica]
Length=203

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 73/143 (51%), Gaps = 10/143 (7%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G  YFI +     A          S   C S+VV S P+++G P+  +P
Sbjct  31   VVDVFGDEVRTGGRYFIAAASNDFAVSAT------SRIICNSDVVFS-PMSDGLPVIFSP  83

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  FF A+ R+   S  W+I + +P+ + F+ +   V+ ++ +FK
Sbjct  84   VVESNDSVINEDSHLTVDFFAASCRMAGVSTMWKIEF-RPTARGFVVTTGGVAGLN-RFK  141

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  142  ITKYEGGNNLYQLSYCPISEPIC  164



>gb|AIT42166.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 79/197 (40%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP     P  VLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPRESPVPKPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSHVGPNGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNL  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            +       L +G  +    S  FKI  + +L  Y + YCP   H           C  VG
Sbjct  137  NAHLRTMLLETGGTIGQADSSYFKIVKSSKL-GYNLLYCPISRHFLCPFCRDDNFCAEVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL  +
Sbjct  196  VVIQN--GKRRLALVNE  210



>sp|P58515.1|SPI2_SOLTU RecName: Full=Serine protease inhibitor 2; AltName: Full=PSPI-21; 
AltName: Full=PSPI-21-5.2; Contains: RecName: Full=Serine 
protease inhibitor 2 chain A; Contains: RecName: Full=Serine 
protease inhibitor 2 chain B, partial [Solanum tuberosum]
Length=186

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 54/177 (31%), Positives = 76/177 (43%), Gaps = 12/177 (7%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCASNVVI--SRPLTE  516
            +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+ +    S     
Sbjct  3    SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPS  62

Query  515  GDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF  339
            G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD   G   L +G  
Sbjct  63   GTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGT  122

Query  338  VSDI-SGQFKIEVAPELNAYKITYCPFGG----HICYNVGRYFDESAGAARLALTED  183
            +    S  FKI  + +L  Y + YCP         C  VG       G  RLAL  +
Sbjct  123  IGQADSSWFKIVKSSQL-GYNLLYCPVTSSSDDQFCSKVGVVHQN--GKRRLALVNE  176



>ref|XP_006387700.1| hypothetical protein POPTR_0664s00220g [Populus trichocarpa]
 gb|ERP46614.1| hypothetical protein POPTR_0664s00220g [Populus trichocarpa]
Length=202

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 75/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|AIT42164.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 80/197 (41%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+    P  VLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPVPKPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPNGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNL  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            +       L +G  +    S  FKI  + +L  Y + YCP   H           C  VG
Sbjct  137  NAHLRTMLLETGGTIGQADSSYFKIVKSSKL-GYNLLYCPISRHFLCPFCRDDNFCAEVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL  +
Sbjct  196  VVIQN--GKRRLALVNE  210



>ref|XP_006372633.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
 gb|ERP50430.1| hypothetical protein POPTR_0017s03430g [Populus trichocarpa]
Length=206

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 86/179 (48%), Gaps = 19/179 (11%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEG  513
            TA   PVLD  G  LR G +Y+I    RG   GG+++A     T C  +VV  R   + G
Sbjct  26   TAAPEPVLDVTGKILRTGTSYYILPVIRGRG-GGLKMASTVRRT-CPLDVVQDRYEASNG  83

Query  512  DPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFV  336
             P++ TP       VV   T  +  F  A+  +C  S  W++  YD+ + Q+F+++    
Sbjct  84   LPLKFTPVNTKKG-VVRVHTDLNIRFSAAS--ICHQSTAWKLDNYDEWTKQWFVTTDGVE  140

Query  335  SD-----ISGQFKIEVAPELNAYKITYCP-FGGH---ICYNVGRYFDESAGAARLALTE  186
             +      +  FKIE   +   YK+ +CP    H   +C ++G Y D + G  RLALT 
Sbjct  141  GNPGPETTNNWFKIEKFED--KYKLVFCPTVCQHCKVMCKDIGIYVD-AKGVRRLALTN  196



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 82/168 (49%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  29   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  82

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  V+  ST  +  F  +  + C  S  W+I+    S  Q+F+++G      
Sbjct  83   TFSPASSED-DVIRVSTDLNIKF--SIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  139

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  140  GVHTLTNWFKIEKAGIL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  186



>gb|AIT42159.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 80/197 (41%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+    P  VLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPVPMPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNL  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            +       L +G  +    S  FKI  + +L  Y + YCP   H           C  VG
Sbjct  137  NAHLRTMLLETGGTIGQADSSYFKIVKSSKL-GYNLLYCPISRHFLCPFCRDDNFCAKVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL  +
Sbjct  196  VVIQN--GKRRLALVNE  210



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 85/185 (46%), Gaps = 22/185 (12%)
 Frame = -1

Query  701  IRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR  528
            IR  TAD +P  VLD DG  LR G  Y+I    RG   G         + KC  NVV  +
Sbjct  21   IRFSTADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGNL--QSEKCPLNVVQEQ  78

Query  527  -PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFL  354
              +  G P    P   P   VV  ST  +  F    S +CV+S  W++ ++D+ +GQ+ +
Sbjct  79   LEVMNGFPTTFHP-VNPKKGVVRVSTDLNVQF--EASTICVTSTVWKLDKFDESTGQWLV  135

Query  353  SSGEF-----VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAAR  201
            + G       V  +   FKIE       YK+ +CP    F   +C ++G +F    G   
Sbjct  136  TIGGSRGNPGVETVDNWFKIE--KHGKDYKLVFCPTVCNFCKVMCRDIGIFFKN--GERA  191

Query  200  LALTE  186
            LAL++
Sbjct  192  LALSD  196



>gb|ACO39914.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39959.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40034.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39916.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40023.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40043.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO40119.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40127.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40130.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40142.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40157.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 50/168 (30%), Positives = 79/168 (47%), Gaps = 23/168 (14%)
 Frame = -1

Query  674  PVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATK--CASNVV-ISRPLTEGDPI  504
            PVLD  G+ L+ G  Y ITS   GA  G V      SAT   C  +V+  S    +G P+
Sbjct  14   PVLDIQGEELKAGTEYIITSAIWGAGGGDV------SATNKTCPDDVIQYSLDQLQGLPV  67

Query  503  RITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSG-QYFLSSGEF----  339
              +PA+  +  + + +         +  + C  S  W+I+    S  Q+F+++G      
Sbjct  68   TFSPASSEDDVIRVSADLN---IKFSIKKACDHSSVWKIQKSSNSEVQWFVTTGGEEGNP  124

Query  338  -VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAG  210
             V  ++  FKIE A  L  YK+ +CP      G +C ++G YF+ + G
Sbjct  125  GVHTLTNWFKIEKAGTL-GYKLVFCPEDICHCGVLCRDIGIYFENNRG  171



>gb|AAU04570.1| Kunitz-type proteinase inhibitor [Solanum tuberosum]
Length=194

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 77/183 (42%), Gaps = 18/183 (10%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCASNVVI--SRPLTE  516
            +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+ +    S     
Sbjct  4    SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGIFRYNSDVGPS  63

Query  515  GDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF  339
            G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD   G   L +G  
Sbjct  64   GTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGT  123

Query  338  VSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRYFDESAGAARLAL  192
            +    S  FKI  + +L  Y + YCP               C  VG       G  RLAL
Sbjct  124  IGQADSSWFKIVKSSQL-GYNLLYCPVTSTMICPFSSDDQFCSKVGVV--HQNGKRRLAL  180

Query  191  TED  183
             +D
Sbjct  181  VKD  183



>gb|ACO39913.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39919.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39923.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39930.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39931.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39949.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39964.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39971.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39977.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39978.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39984.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39992.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39993.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39997.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40033.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40042.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40045.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40049.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40056.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40057.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40059.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40060.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40061.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40065.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40067.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40068.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39924.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39942.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39948.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39955.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39969.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39999.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40001.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40003.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40058.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40062.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40071.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39990.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39991.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO40041.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39926.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39946.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39967.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39976.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39989.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39996.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40050.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 56/181 (31%), Positives = 83/181 (46%), Gaps = 23/181 (13%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFI--TSTGRGAASGGVQLAWLDSATKCASNVVISR-PLT  519
             A   PV+D  G  LR G  Y+I   + GRG   GG+ LA   +   C  +VV  +    
Sbjct  26   NASPDPVVDIAGKQLRAGSKYYILPVTKGRG---GGLTLAGRSNNKTCPLDVVQEQHSFR  82

Query  518  EGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGE  342
             G P+  +P   P   VV  ST  +  F  ATS  C  S  W++  +D   GQ+ +++G 
Sbjct  83   NGLPVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLVTTGG  139

Query  341  FVSD-----ISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALT  189
               +     +   FKIE       YK+ +CP    F   +C +VG + +   G  RLAL+
Sbjct  140  VEGNPGPRTMRNWFKIE--KFYGDYKLVFCPSVCNFCRGLCRDVGIFIN--GGVRRLALS  195

Query  188  E  186
            +
Sbjct  196  D  196



>gb|ACO39979.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S   C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSRIICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39918.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39973.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40036.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   ++  C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTATSPICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|AAL60245.1|AF459080_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
Length=215

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/193 (31%), Positives = 87/193 (45%), Gaps = 32/193 (17%)
 Frame = -1

Query  707  NPIRLPT-ADDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCA  549
            NPI LPT   D  VL    D DG+ LR GE Y I +   GA +      +LD+    +C 
Sbjct  25   NPIVLPTTCHDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCP  79

Query  548  SNVV----ISRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIR  384
            + V+    I + L +G P+     +E +   VV   T     FFV T++LCV    W++ 
Sbjct  80   NAVLQHMSIPQFLGKGTPVMFVRKSESDDGDVVRLMTAVYIKFFVKTTKLCVDETVWKVN  139

Query  383  YDQPSGQYFLSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFD  222
             +Q      + +G  V + +  FKI      +    N YK+ +CP   H+   N+G  F 
Sbjct  140  DEQ-----LVVTGGNVGNENDIFKINKTDLVIRGMKNVYKLLHCP--SHLQLENIGSNF-  191

Query  221  ESAGAARLALTED  183
               G  RL   +D
Sbjct  192  -KNGYPRLVTVDD  203



>gb|ACO39917.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39950.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39966.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39972.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39974.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39975.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39980.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39988.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39998.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40018.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40044.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40048.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   ++  C S+VV S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTATSPICNSDVVFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
            A E N +V+   +  +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   AVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>ref|NP_001274943.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94179.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
 gb|AAZ94186.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
Length=220

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 79/197 (40%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADD--TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+      PVLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPLPKPVLDTNGKELNPNLSYRIISTYWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTPKLCVSYTIWKVGNI  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            + P     L +G  +    S  FKI  +     Y + YCP   H           C  VG
Sbjct  137  NAPLRTMLLETGGTIGQADSSYFKIVKSSNF-GYNLLYCPITRHFLCPFCRDDNFCAKVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL  +
Sbjct  196  VVIQN--GKRRLALVNE  210



>ref|XP_006372632.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
 gb|ERP50429.1| hypothetical protein POPTR_0017s03420g [Populus trichocarpa]
Length=206

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 86/179 (48%), Gaps = 19/179 (11%)
 Frame = -1

Query  689  TADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR-PLTEG  513
            TA   PVLD  G  LR G +Y+I    RG   GG+++A     T C  +VV  R   + G
Sbjct  26   TAAPEPVLDVTGKILRIGTSYYILPVIRGRG-GGLKMASTVRRT-CPLDVVQDRYEASNG  83

Query  512  DPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEFV  336
             P++ TP       VV   T  +  F  A+  +C  S  W++  YD+ + Q+F+++    
Sbjct  84   LPLKFTPVNTKKG-VVRVHTDLNIRFSAAS--ICHQSTAWKLDNYDEWTKQWFVTTDGVE  140

Query  335  SD-----ISGQFKIEVAPELNAYKITYCP-FGGH---ICYNVGRYFDESAGAARLALTE  186
             +      +  FKIE   +   YK+ +CP    H   +C ++G Y D + G  RLALT 
Sbjct  141  GNPGPETTNNWFKIEKFED--KYKLVFCPTVCQHCKVMCKDIGIYVD-AKGVRRLALTN  196



>gb|AAZ94195.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
Length=220

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 79/197 (40%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADD--TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+      PVLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPLPKPVLDTNGKELNPNLSYRIISTYWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTPKLCVSYTIWKVGNI  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            + P     L +G  +    S  FKI  +     Y + YCP   H           C  VG
Sbjct  137  NAPLRTMLLETGGTIGQADSSYFKIVKSSNF-GYNLLYCPITRHFLCPFCRDDNFCAKVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL  +
Sbjct  196  VVIQN--GKRRLALVNE  210



>gb|ACO40010.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   S+  C S+V +S P + G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTSSSIICNSDVFLS-PTSHGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>gb|AAZ94192.1| Kunitz-type protease inhibitor precursor [Solanum tuberosum]
Length=220

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 79/197 (40%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADD--TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+      PVLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPLPKPVLDTNGKELNPNLSYRIISTYWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTPKLCVSYTIWKVGNI  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            + P     L +G  +    S  FKI  +     Y + YCP   H           C  VG
Sbjct  137  NAPLRTMLLETGGTIGQADSSYFKIVKSSNF-GYNLLYCPITRHFLCPFCRDDYFCAKVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL  +
Sbjct  196  VVIQN--GKRRLALVNE  210



>sp|O24383.1|CPI10_SOLTU RecName: Full=Cysteine protease inhibitor 10; AltName: Full=PCPI-10; 
Short=Pcpi10; Flags: Precursor, partial [Solanum tuberosum]
 gb|AAB63099.1| cysteine proteinase inhibitor 10 precursor, partial [Solanum 
tuberosum]
Length=186

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/184 (30%), Positives = 83/184 (45%), Gaps = 31/184 (17%)
 Frame = -1

Query  683  DDTPVL----DTDGDALRPGETYFITSTGRGAASGGVQLAWLDSA--TKCASNVV----I  534
            DD  VL    D DG+ LR GE Y I +   GA +      +LD+    +C + V+    I
Sbjct  5    DDNLVLPEVYDQDGNPLRIGERYIIKNPLLGAGA-----VYLDNIGNLQCPNAVLQHMSI  59

Query  533  SRPLTEGDPIRITPAAEPN-ATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYF  357
             + L +G P+     +E +   VV   T     FFV T++LCV    W++  +Q      
Sbjct  60   PQFLGKGTPVVFIRKSESDYGDVVRLMTAVYIKFFVKTTKLCVDETVWKVNNEQ-----L  114

Query  356  LSSGEFVSDISGQFKIE-----VAPELNAYKITYCPFGGHI-CYNVGRYFDESAGAARLA  195
            + +G  V + +  FKI+     +    N YK+ +CP   H+ C N+G  F    G  RL 
Sbjct  115  VVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP--SHLECKNIGSNF--KNGYPRLV  170

Query  194  LTED  183
               D
Sbjct  171  TVND  174



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/185 (33%), Positives = 86/185 (46%), Gaps = 22/185 (12%)
 Frame = -1

Query  701  IRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISR  528
            +R  TAD +P  VLD DG  LR G  Y+I    RG   G      L S   C  NVV  +
Sbjct  20   LRFSTADASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGN-LQSEI-CPVNVVQEQ  77

Query  527  -PLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFL  354
              L  G P    P   P   VV  ST  +  F    S +CV+S  W++ ++D+ +GQ+F+
Sbjct  78   FELMNGFPTTFHP-VNPKKGVVRVSTDLNVQF--DASTICVTSTVWKLDKFDESTGQWFV  134

Query  353  SSGEF-----VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAAR  201
            + G       V  +   FKIE       YK+ +CP    F   +C ++G +F    G   
Sbjct  135  TIGGSRGNPGVETVDNWFKIE--KHGKDYKLVFCPTVCNFCKVMCRDIGIFFKN--GKRA  190

Query  200  LALTE  186
            LAL++
Sbjct  191  LALSD  195



>gb|AAX47263.1| Kunitz-type proteinase inhibitor group B1 [Solanum palustre]
Length=194

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 55/183 (30%), Positives = 76/183 (42%), Gaps = 18/183 (10%)
 Frame = -1

Query  686  ADDTPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKCASNVVI--SRPLTE  516
            +D TPVLD  G  L    +Y I ST  GA  G V L    +S   CA+ V    S     
Sbjct  4    SDATPVLDVTGKELDSRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPS  63

Query  515  GDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF  339
            G P+R   ++      +  +   +  F ++TS+LCVS   W++  YD   G   L +G  
Sbjct  64   GTPVRFIGSSSHFGQGIFENELLNIQFAISTSKLCVSYTIWKVGDYDASLGTMLLETGGT  123

Query  338  VSDI-SGQFKIEVAPELNAYKITYCPFGG----------HICYNVGRYFDESAGAARLAL  192
            +    S  FKI  + +   Y + YCP               C  VG       G  RLAL
Sbjct  124  IGQADSSWFKIVKSSQF-GYNLLYCPVTSTMNCPFSSDDQFCLKVGVV--HQNGKRRLAL  180

Query  191  TED  183
             +D
Sbjct  181  VKD  183



>gb|AIT42157.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 80/197 (41%), Gaps = 24/197 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADDTP--VLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LP+    P  VLDT+G  L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPINLPSESPVPKPVLDTNGKKLNPNSSYRIISTFWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P     +T +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPNGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNL  136

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGH----------ICYNVG  234
            +       L +G  +    S  FKI  + +L  Y + YCP   H           C  VG
Sbjct  137  NAHLRTMLLETGGTIGQADSSYFKIVKSSKL-GYNLLYCPISRHFLCPFCRDDNFCAEVG  195

Query  233  RYFDESAGAARLALTED  183
                   G  RLAL + 
Sbjct  196  VVIQN--GKRRLALGQQ  210



>ref|NP_001274866.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 gb|AAL99260.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 dbj|BAC23032.1| cathepsin D inhibitor [Solanum tuberosum]
 gb|AIT42154.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 74/166 (45%), Gaps = 11/166 (7%)
 Frame = -1

Query  722  THSTFNPIRLPTADD--TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ NPI LPT     TPVLDT+G+ L P  +Y I ST  GA  G V L    +S   C
Sbjct  21   TFTSQNPIDLPTDTTPCTPVLDTNGNELNPNSSYRIISTFWGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RY  381
               V    S     G P+R  P +  N   +      +  F + T +LCVS   W++   
Sbjct  81   PDGVFRYNSDVGPRGTPVRFIPLSGAN---ICEDQLLNIQFNIPTPKLCVSYTIWKVGNL  137

Query  380  DQPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGHIC  246
            +       L +G  +    S  FKI  + ++  Y + YCP    IC
Sbjct  138  NALLRTMLLETGGTIGQADSSYFKIVKSSKI-GYNLLYCPLTPIIC  182



>ref|XP_004241479.1| PREDICTED: miraculin-like [Solanum lycopersicum]
Length=200

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/175 (29%), Positives = 80/175 (46%), Gaps = 17/175 (10%)
 Frame = -1

Query  677  TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVV-ISRPLTEGDPIR  501
            +PVLD +GD ++ G  YFI    RG   GG+    + +   C  +++       EG P+ 
Sbjct  21   SPVLDVNGDEVQAGPNYFILPVIRGRGGGGLSPFNVKNNNTCPRDIIQWDDEEQEGLPVV  80

Query  500  ITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRI-RYDQPSGQYFLSSGEF-----  339
             T   +   +VV  ST  +  F+  T  +C     W++  YD    +YF+ +G       
Sbjct  81   FT-RIDAKKSVVRVSTDVNVRFYTPT--ICARETIWKLGDYDDKLKKYFVVTGGVEGNPG  137

Query  338  VSDISGQFKIEVAPELNAYKITYCP----FGGHICYNVGRYFDESAGAARLALTE  186
            +  +   FKIE     + YK+ YCP    F   IC +VG  F  + G   LAL++
Sbjct  138  LKTVGNWFKIERFG--SGYKLVYCPSVCKFCKVICKDVG-IFITNDGVRLLALSD  189



>gb|ACO40051.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/143 (31%), Positives = 76/143 (53%), Gaps = 11/143 (8%)
 Frame = -1

Query  671  VLDTDGDALRPGETYFITSTGRGAASGGVQLAWLDSATKCASNVVISRPLTEGDPIRITP  492
            V+D  GD +R G+ Y I     GAAS     A   ++  C S+V+ S P+++G P+  +P
Sbjct  31   VIDVFGDEVRTGDRYII-----GAASN--DFAVTATSPICNSDVMFS-PMSDGLPVIFSP  82

Query  491  AAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYDQPSGQYFLSSGEFVSDISGQFK  312
              E N +V+   ++ +  F  AT R+   S  W+I   +P+ + F+ +   V+ ++ +FK
Sbjct  83   VVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEL-RPTARGFVVTTGGVAGLN-RFK  140

Query  311  I-EVAPELNAYKITYCPFGGHIC  246
            I +     N Y+++YCP    IC
Sbjct  141  ITKYEGGNNLYQLSYCPISEPIC  163



>sp|Q03197.1|API10_SOLTU RecName: Full=Aspartic protease inhibitor 10; AltName: Full=Wound-induced 
aspartate proteinase CDI inhibitor; Flags: Precursor 
[Solanum tuberosum]
 emb|CAA48036.1| cathepsin D inhibitor [Solanum tuberosum]
Length=219

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 79/196 (40%), Gaps = 23/196 (12%)
 Frame = -1

Query  722  THSTFNPIRLPTADD--TPVLDTDGDALRPGETYFITSTGRGAASGGVQLAWL-DSATKC  552
            T ++ N I LP+      PVLDT+G  L P  +Y I S GRGA  G V L    +S   C
Sbjct  21   TFTSQNLIDLPSESPLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPC  80

Query  551  ASNVVI--SRPLTEGDPIRITPAAEPNATVVLPSTFQSFAFFVATSRLCVSSVFWRIRYD  378
               V    S     G P+R  P +      +      +  F + T RLCVS   W++  +
Sbjct  81   PDGVFRYNSDVGPSGTPVRFIPLSGG----IFEDQLLNIQFNIPTVRLCVSYTIWKVGIN  136

Query  377  QPSGQYFLSSGEFVSDI-SGQFKIEVAPELNAYKITYCPFGGHI----------CYNVGR  231
                   L +G  +    S  FKI V   +  Y + YCP    I          C  VG 
Sbjct  137  AYLRTMLLETGGTIGQADSSYFKI-VKSSILGYNLLYCPITRPILCPFCRDDDFCAKVGV  195

Query  230  YFDESAGAARLALTED  183
               +  G  RLAL  +
Sbjct  196  VIQK--GKRRLALVNE  209



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1678336246910