BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21835_g2_i1 len=762 path=[6098:0-316 1967:317-347 358:348-655
666:656-761]

Length=762
                                                                      Score     E

sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    189   1e-55   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                              189   1e-55   Ipomoea trifida
gb|AFR60862.1|  sporamin B                                              188   2e-55   
gb|ABB90968.1|  sporamin B precursor                                    188   3e-55   Ipomoea batatas [batate]
gb|ABG26232.1|  sporamin A                                              188   3e-55   Ipomoea trifida
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     187   4e-55   Ipomoea batatas [batate]
gb|AFR60859.1|  sporamin B                                              187   4e-55   
gb|AFR60863.1|  sporamin B                                              187   5e-55   
gb|AAL55800.1|AF289060_1  sporamin                                      187   6e-55   Ipomoea batatas [batate]
gb|ABB97543.1|  sporamin A precursor                                    187   6e-55   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                              187   6e-55   
gb|AAA33390.1|  sporamin B                                              187   6e-55   Ipomoea batatas [batate]
gb|AFR60867.1|  sporamin B                                              187   8e-55   
gb|AFR60865.1|  sporamin B                                              187   9e-55   
gb|ABB97545.1|  sporamin A precursor                                    187   9e-55   Ipomoea batatas [batate]
gb|ABG26235.1|  sporamin A                                              187   1e-54   Ipomoea trifida
gb|AAB52548.1|  sporamin precursor                                      186   1e-54   Ipomoea batatas [batate]
gb|ABG26230.1|  sporamin A                                              186   1e-54   Ipomoea trifida
gb|ABG26236.1|  sporamin A                                              186   2e-54   Ipomoea trifida
gb|ABB97549.1|  sporamin A precursor                                    186   2e-54   Ipomoea batatas [batate]
gb|AFR60860.1|  sporamin B                                              186   2e-54   
gb|AFR60855.1|  sporamin A                                              186   2e-54   
gb|AFR60864.1|  sporamin B                                              186   2e-54   
gb|AAA33391.1|  sporamin A precursor                                    186   2e-54   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    185   3e-54   Ipomoea batatas [batate]
gb|AFR60856.1|  sporamin A                                              185   4e-54   
gb|AAB52547.1|  sporamin precursor                                      185   6e-54   Ipomoea batatas [batate]
gb|ABB97544.1|  sporamin A precursor                                    185   6e-54   Ipomoea batatas [batate]
gb|ABG26238.1|  sporamin A                                              184   8e-54   Ipomoea trifida
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    184   2e-53   Ipomoea batatas [batate]
gb|ABB97547.1|  sporamin A precursor                                    183   3e-53   Ipomoea batatas [batate]
gb|ABG26222.1|  sporamin A                                              182   4e-53   Ipomoea leucantha
gb|ABG26224.1|  sporamin A                                              182   5e-53   Ipomoea leucantha
gb|AAA86670.1|  preprosporamin                                          180   4e-52   Ipomoea batatas [batate]
gb|ABG26227.1|  sporamin A                                              179   6e-52   Ipomoea leucantha
gb|ABG26229.1|  sporamin A                                              179   1e-51   Ipomoea trifida
gb|ABB97542.1|  sporamin A precursor                                    176   1e-50   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                176   2e-50   
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     175   3e-50   Ipomoea batatas [batate]
gb|AAD40288.1|  sporamin A precursor                                    172   7e-49   Ipomoea batatas [batate]
gb|AAD05567.1|  sporamin A                                              169   9e-48   Ipomoea batatas [batate]
gb|AAB52549.1|  sporamin                                                125   3e-32   Ipomoea batatas [batate]
gb|AFR60853.1|  truncated sporamin                                      108   1e-25   
gb|AAB52550.1|  sporamin                                                108   5e-25   Ipomoea batatas [batate]
emb|CAA43267.1|  sporamin                                             78.6    5e-14   Ipomoea batatas [batate]
emb|CAN81015.1|  hypothetical protein VITISV_025776                   74.3    7e-13   Vitis vinifera
emb|CAN75396.1|  hypothetical protein VITISV_028636                   73.6    2e-12   Vitis vinifera
emb|CBI35464.3|  unnamed protein product                              73.9    2e-12   
gb|ADD51186.1|  tumor-related protein                                 72.8    3e-12   Vitis cinerea var. helleri x Vitis riparia
emb|CAN65022.1|  hypothetical protein VITISV_027379                   72.8    3e-12   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                             72.0    5e-12   Vitis vinifera
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     72.4    6e-12   Theobroma bicolor
gb|ABX76297.1|  stigma expressed protein                              72.4    7e-12   Nicotiana alata [flowering tobacco]
ref|XP_002270111.1|  PREDICTED: miraculin                             70.9    1e-11   Vitis vinifera
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           70.5    2e-11   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   70.5    2e-11   
gb|AEK26936.1|  Kunitz-type trypsin inhibitor B3                      70.1    3e-11   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              69.7    4e-11   
ref|XP_002265965.1|  PREDICTED: miraculin                             69.3    4e-11   Vitis vinifera
gb|ADW95389.1|  Kunitz-type trypsin inhibitor                         69.3    4e-11   
ref|XP_006372631.1|  trypsin protein inhibitor 3                      68.9    7e-11   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           68.9    7e-11   
ref|XP_003534100.1|  PREDICTED: miraculin-like                        68.9    8e-11   
ref|XP_011046090.1|  PREDICTED: miraculin-like                        68.6    8e-11   
emb|CDP19138.1|  unnamed protein product                              68.6    9e-11   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        68.6    9e-11   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        68.6    1e-10   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     68.6    1e-10   Theobroma microcarpum
ref|XP_007036748.1|  21 kDa seed protein, putative                    68.6    1e-10   
ref|XP_007029361.1|  Kunitz family trypsin and protease inhibitor...  68.2    1e-10   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           68.2    1e-10   
gb|ADK62529.1|  miraculin-like protein                                67.4    2e-10   
ref|XP_004234331.1|  PREDICTED: miraculin                             67.4    3e-10   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           66.6    4e-10   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     66.6    6e-10   Theobroma cacao [chocolate]
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           66.2    6e-10   
ref|XP_011014541.1|  PREDICTED: wound-responsive protein GWIN3-like   66.2    7e-10   
gb|AAL85644.1|  trypsin inhibitor                                     65.1    7e-10   Theobroma subincanum
gb|ABK96508.1|  unknown                                               65.9    8e-10   Populus trichocarpa x Populus deltoides
ref|XP_007029360.1|  Kunitz family trypsin and protease inhibitor...  65.9    8e-10   
ref|XP_009792285.1|  PREDICTED: miraculin                             65.9    8e-10   
gb|AAC49969.1|  tumor-related protein                                 65.9    9e-10   Nicotiana tabacum [American tobacco]
gb|ADW95387.1|  Kunitz-type trypsin inhibitor                         65.9    9e-10   
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           65.9    9e-10   
emb|CDP21779.1|  unnamed protein product                              65.9    1e-09   
gb|ACS92504.1|  Kunitz-type protease inhibitor KPI-C2.1               65.5    1e-09   Populus trichocarpa x Populus deltoides
ref|XP_010918417.1|  PREDICTED: miraculin-like                        65.5    1e-09   
gb|AAF15901.1|AF208020_1  putative proteinase inhibitor               65.9    2e-09   Nicotiana glutinosa
gb|AAL85648.1|  trypsin inhibitor                                     64.3    2e-09   Theobroma obovatum
ref|XP_011035401.1|  PREDICTED: miraculin-like                        65.1    2e-09   
gb|KHM99732.1|  Miraculin                                             65.1    2e-09   
gb|ABK01288.1|  miraculin-like protein                                65.1    2e-09   Coffea arabica [arabica coffee]
gb|AAL85652.1|  trypsin inhibitor                                     63.9    2e-09   Theobroma mammosum
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           65.5    2e-09   
emb|CDP19136.1|  unnamed protein product                              65.1    2e-09   
gb|AAL85651.1|  trypsin inhibitor                                     63.9    2e-09   Theobroma mammosum
ref|XP_007036743.1|  21 kDa seed protein                              65.1    2e-09   
prf||1802409A  albumin                                                64.7    2e-09
ref|XP_006387700.1|  hypothetical protein POPTR_0664s00220g           64.3    3e-09   
gb|ACS92518.1|  Kunitz-type protease inhibitor KPI-C6.1               64.3    3e-09   Populus trichocarpa x Populus nigra
ref|XP_006495063.1|  PREDICTED: miraculin-like                        64.3    3e-09   
gb|ACS92499.1|  Kunitz-type protease inhibitor KPI-C6.2               64.3    3e-09   Populus trichocarpa x Populus nigra
gb|AAL85650.1|  trypsin inhibitor                                     63.5    3e-09   Theobroma mammosum
ref|XP_006353923.1|  PREDICTED: cysteine protease inhibitor 1-like    64.3    3e-09   
ref|XP_006353926.1|  PREDICTED: cysteine protease inhibitor 1-like    63.9    5e-09   
gb|AAQ96377.1|  miraculin-like protein                                63.5    6e-09   Solanum palustre
gb|ACV65034.1|  alpha-amylase inhibitor                               63.2    6e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           63.5    6e-09   
gb|ACO39958.1|  kunitz trypsin inhibitor 3                            62.8    7e-09   Populus balsamifera [balsam poplar]
ref|XP_009627067.1|  PREDICTED: miraculin                             63.2    7e-09   
ref|NP_001053363.1|  Os04g0526600                                     63.2    7e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ADL60120.1|  alpha-amylase inhibitor                               62.8    9e-09   
ref|XP_007036750.1|  21 kDa seed protein                              63.2    9e-09   
ref|XP_007036746.1|  21 kDa seed protein                              63.2    1e-08   
gb|ACO39920.1|  kunitz trypsin inhibitor 3                            62.4    1e-08   Populus balsamifera [balsam poplar]
gb|ACO39915.1|  kunitz trypsin inhibitor 3                            62.4    1e-08   Populus balsamifera [balsam poplar]
gb|ACO39954.1|  kunitz trypsin inhibitor 3                            62.4    1e-08   Populus balsamifera [balsam poplar]
ref|XP_008238584.1|  PREDICTED: miraculin-like                        62.8    1e-08   
gb|ACO39943.1|  kunitz trypsin inhibitor 3                            62.4    1e-08   Populus balsamifera [balsam poplar]
ref|XP_006371663.1|  hypothetical protein POPTR_0019s14550g           62.8    1e-08   
gb|ACS92509.1|  Kunitz-type protease inhibitor KPI-D2.3               62.8    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           62.8    1e-08   
gb|AEK26933.1|  Kunitz-type trypsin inhibitor B2                      62.8    1e-08   
gb|ADW95388.1|  Kunitz-type trypsin inhibitor                         62.4    1e-08   
ref|XP_002305032.2|  trypsin protein inhibitor 3                      62.8    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002266302.2|  PREDICTED: miraculin-like                        61.6    1e-08   Vitis vinifera
ref|XP_007211211.1|  hypothetical protein PRUPE_ppa011496mg           62.4    1e-08   
ref|XP_006493432.1|  PREDICTED: miraculin-like                        64.3    1e-08   
gb|AAL85645.1|  trypsin inhibitor                                     61.6    1e-08   Theobroma grandiflorum
gb|ACO40051.1|  kunitz trypsin inhibitor 3                            62.0    1e-08   Populus balsamifera [balsam poplar]
gb|AAQ84216.1|  Kunitz trypsin inhibitor 3                            62.4    1e-08   Populus trichocarpa x Populus deltoides
ref|XP_002305033.1|  trypsin protein inhibitor 3                      62.4    1e-08   Populus trichocarpa [western balsam poplar]
gb|ACS92511.1|  Kunitz-type protease inhibitor KPI-C1.2               62.4    2e-08   Populus trichocarpa [western balsam poplar]
gb|ACO40004.1|  kunitz trypsin inhibitor 3                            62.0    2e-08   Populus balsamifera [balsam poplar]
ref|XP_009401850.1|  PREDICTED: miraculin-like                        62.4    2e-08   
gb|ACS92492.1|  Kunitz-type protease inhibitor KPI-C1                 62.4    2e-08   Populus trichocarpa x Populus nigra
gb|ACO39957.1|  kunitz trypsin inhibitor 3                            62.0    2e-08   Populus balsamifera [balsam poplar]
ref|XP_007041757.1|  21 kDa seed protein, putative                    62.4    2e-08   
gb|ACO40070.1|  kunitz trypsin inhibitor 3                            61.6    2e-08   Populus balsamifera [balsam poplar]
ref|XP_011035402.1|  PREDICTED: 21 kDa seed protein-like              62.4    2e-08   
ref|XP_006493433.1|  PREDICTED: miraculin-like                        62.4    2e-08   
gb|AEK26926.1|  Kunitz-type trypsin inhibitor B1                      62.0    2e-08   
gb|ACS92512.1|  Kunitz-type protease inhibitor KPI-C7                 61.6    2e-08   Populus trichocarpa x Populus nigra
ref|XP_002326088.2|  hypothetical protein POPTR_0019s14540g           61.6    3e-08   Populus trichocarpa [western balsam poplar]
gb|ACO40066.1|  kunitz trypsin inhibitor 3                            61.2    3e-08   Populus balsamifera [balsam poplar]
gb|ACO39917.1|  kunitz trypsin inhibitor 3                            61.2    3e-08   Populus balsamifera [balsam poplar]
ref|XP_004235410.1|  PREDICTED: cysteine protease inhibitor 10-like   61.6    3e-08   
emb|CAI77768.1|  kunitz trypsin inhibitor                             61.6    3e-08   Populus tremula [European aspen]
gb|ACO39918.1|  kunitz trypsin inhibitor 3                            60.8    3e-08   Populus balsamifera [balsam poplar]
gb|AAL85643.1|  trypsin inhibitor                                     60.5    3e-08   Theobroma angustifolium
ref|XP_008778295.1|  PREDICTED: miraculin                             60.8    3e-08   
gb|ACO40052.1|  kunitz trypsin inhibitor 3                            60.8    4e-08   Populus balsamifera [balsam poplar]
gb|AAV41232.1|  putative 21 kDa trypsin inhibitor                     61.2    4e-08   Theobroma grandiflorum
gb|ACO40038.1|  kunitz trypsin inhibitor 3                            60.8    4e-08   Populus balsamifera [balsam poplar]
gb|ACS92496.1|  Kunitz-type protease inhibitor KPI-C2.2               61.2    4e-08   Populus trichocarpa x Populus deltoides
ref|XP_011035403.1|  PREDICTED: 21 kDa seed protein-like              61.2    4e-08   
ref|XP_006387699.1|  hypothetical protein POPTR_0664s00210g           61.2    5e-08   
ref|XP_006351546.1|  PREDICTED: miraculin-like                        60.8    5e-08   
ref|XP_010683194.1|  PREDICTED: miraculin-like                        60.8    5e-08   
emb|CDO98560.1|  unnamed protein product                              60.8    6e-08   
gb|ABX76298.1|  sexual organ expressed protein                        61.2    6e-08   Nicotiana alata [flowering tobacco]
gb|ACO39938.1|  kunitz trypsin inhibitor 3                            60.1    7e-08   Populus balsamifera [balsam poplar]
gb|ACO40007.1|  kunitz trypsin inhibitor 3                            60.1    7e-08   Populus balsamifera [balsam poplar]
gb|ACO40063.1|  kunitz trypsin inhibitor 3                            60.1    8e-08   Populus balsamifera [balsam poplar]
gb|AFL91231.1|  Kunitz-like protease inhibitor                        59.7    8e-08   
gb|ACO40008.1|  kunitz trypsin inhibitor 3                            60.1    8e-08   Populus balsamifera [balsam poplar]
gb|ACO39937.1|  kunitz trypsin inhibitor 3                            59.7    9e-08   Populus balsamifera [balsam poplar]
gb|ACO39986.1|  kunitz trypsin inhibitor 3                            59.7    9e-08   Populus balsamifera [balsam poplar]
gb|ACO39914.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|AIT42208.1|  Kunitz-type inhibitor C                               60.5    1e-07   
gb|ACS92503.1|  Kunitz-type protease inhibitor KPI-C4                 60.1    1e-07   Populus trichocarpa [western balsam poplar]
gb|AAL60243.1|AF459078_1  putative Kunitz-type tuber invertase in...  60.5    1e-07   Solanum tuberosum [potatoes]
gb|ACO39990.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39916.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|AAQ84217.1|  Kunitz trypsin inhibitor 4                            60.1    1e-07   Populus trichocarpa x Populus deltoides
gb|ACO40041.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|ACO40055.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
gb|ACO39926.1|  kunitz trypsin inhibitor 3                            59.7    1e-07   Populus balsamifera [balsam poplar]
emb|CAI77782.1|  kunitz trypsin inhibitor                             60.1    1e-07   Populus tremula [European aspen]
ref|XP_010663911.1|  PREDICTED: miraculin-like                        60.1    1e-07   
gb|ACO39913.1|  kunitz trypsin inhibitor 3                            59.3    1e-07   Populus balsamifera [balsam poplar]
gb|ABK96484.1|  unknown                                               59.7    1e-07   Populus trichocarpa x Populus deltoides
gb|ACO39979.1|  kunitz trypsin inhibitor 3                            59.3    1e-07   Populus balsamifera [balsam poplar]
emb|CAI77803.1|  kunitz trypsin inhibitor                             60.1    1e-07   Populus tremula [European aspen]
ref|XP_009608866.1|  PREDICTED: miraculin-like                        60.1    1e-07   
gb|ACO40053.1|  kunitz trypsin inhibitor 3                            59.3    1e-07   Populus balsamifera [balsam poplar]
emb|CAH59146.1|  kunitz trypsin inhibitor TI3                         59.7    1e-07   Populus tremula [European aspen]
gb|ACO39924.1|  kunitz trypsin inhibitor 3                            59.3    1e-07   Populus balsamifera [balsam poplar]
emb|CBI35471.3|  unnamed protein product                              61.6    2e-07   
emb|CAI77766.1|  kunitz trypsin inhibitor                             59.7    2e-07   Populus tremula [European aspen]
sp|Q00652.1|CPI9_SOLTU  RecName: Full=Cysteine protease inhibitor...  59.7    2e-07   Solanum tuberosum [potatoes]
dbj|BAC23033.1|  kunitz-type trypsin inhibitor                        59.7    2e-07   Solanum tuberosum [potatoes]
gb|ABK96560.1|  unknown                                               59.3    2e-07   Populus trichocarpa x Populus deltoides
gb|AFL91226.1|  Kunitz-like protease inhibitor                        58.5    2e-07   
ref|XP_003534083.1|  PREDICTED: miraculin-like                        59.3    2e-07   
gb|AAL85640.1|  trypsin inhibitor                                     58.2    3e-07   Herrania albiflora
emb|CAH59144.1|  kunitz trypsin inhibitor TI3                         58.9    3e-07   Populus tremula [European aspen]
emb|CAI77764.1|  kunitz trypsin inhibitor                             59.3    3e-07   Populus tremula [European aspen]
gb|AAL85653.1|  trypsin inhibitor                                     58.2    3e-07   Theobroma simiarum
ref|XP_010536414.1|  PREDICTED: miraculin-like                        58.9    3e-07   
gb|AIT42206.1|  Kunitz-type inhibitor C                               59.3    3e-07   
emb|CAI77765.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
gb|AAL60248.1|AF459083_1  putative Kunitz-type tuber invertase in...  58.9    3e-07   Solanum tuberosum [potatoes]
emb|CAI77774.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
emb|CDP20533.1|  unnamed protein product                              58.9    3e-07   
emb|CAI77777.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
emb|CAI77770.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
gb|AAL85642.1|  trypsin inhibitor                                     57.8    3e-07   Theobroma speciosum
gb|AIT42212.1|  Kunitz-type inhibitor C                               58.9    3e-07   
ref|NP_001274866.1|  Kunitz-type enzyme inhibitor P4E1 precursor      58.9    3e-07   
gb|AGW24883.1|  alpha-amylase inhibitor                               58.5    3e-07   
emb|CAI77772.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
emb|CAI77798.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             58.9    3e-07   Populus tremula [European aspen]
gb|AAB23101.1|  bifunctional subtilisin/alpha-amylase inhibitor, ...  58.2    3e-07   
gb|ACO39922.1|  kunitz trypsin inhibitor 3                            58.2    3e-07   Populus balsamifera [balsam poplar]
sp|P20347.3|CPI1_SOLTU  RecName: Full=Cysteine protease inhibitor...  58.9    4e-07   Solanum tuberosum [potatoes]
emb|CAH59147.1|  kunitz trypsin inhibitor TI3                         58.5    4e-07   Populus tremula [European aspen]
gb|ACO39944.1|  kunitz trypsin inhibitor 3                            58.2    4e-07   Populus balsamifera [balsam poplar]
gb|ACO39910.1|  kunitz trypsin inhibitor 3                            58.2    4e-07   Populus balsamifera [balsam poplar]
gb|ACO40086.1|  kunitz trypsin inhibitor 4                            58.2    4e-07   Populus balsamifera [balsam poplar]
gb|ACO39927.1|  kunitz trypsin inhibitor 3                            57.8    4e-07   Populus balsamifera [balsam poplar]
ref|XP_009406658.1|  PREDICTED: miraculin-like                        58.2    4e-07   
gb|ACO40133.1|  kunitz trypsin inhibitor 4                            57.8    5e-07   Populus balsamifera [balsam poplar]
gb|ACO39928.1|  kunitz trypsin inhibitor 3                            57.8    5e-07   Populus balsamifera [balsam poplar]
ref|XP_010101167.1|  hypothetical protein L484_005403                 58.2    5e-07   
gb|AIT42162.1|  Kunitz-type inhibitor A                               58.5    5e-07   
gb|AIT42159.1|  Kunitz-type inhibitor A                               58.5    5e-07   
emb|CDP18338.1|  unnamed protein product                              58.2    6e-07   
gb|AAK32691.1|AF349443_1  Kunitz trypsin inhibitor TI3                57.8    6e-07   Populus tremuloides
emb|CAI77783.1|  kunitz trypsin inhibitor                             58.2    6e-07   Populus tremula [European aspen]
ref|XP_009789071.1|  PREDICTED: cysteine protease inhibitor 8-like    58.5    6e-07   
ref|XP_011041831.1|  PREDICTED: wound-responsive protein GWIN3-like   57.8    7e-07   
emb|CAH59175.1|  kunitz trypsin inhibitor TI3                         57.8    7e-07   Populus tremula [European aspen]
gb|ABK96521.1|  unknown                                               57.8    7e-07   Populus trichocarpa x Populus deltoides
gb|AFL91232.1|  Kunitz-like protease inhibitor                        57.0    7e-07   
gb|AAL85661.1|  trypsin inhibitor                                     57.0    7e-07   Theobroma bicolor
gb|ACO40010.1|  kunitz trypsin inhibitor 3                            57.4    7e-07   Populus balsamifera [balsam poplar]
gb|ACO39929.1|  kunitz trypsin inhibitor 3                            57.4    8e-07   Populus balsamifera [balsam poplar]
gb|AFL91227.1|  Kunitz-like protease inhibitor                        57.0    8e-07   
emb|CAH59186.1|  kunitz trypsin inhibitor TI3                         57.8    8e-07   Populus tremula [European aspen]
gb|AFL91233.1|  Kunitz-like protease inhibitor                        57.0    8e-07   
gb|AAL85637.1|  trypsin inhibitor                                     56.6    8e-07   Herrania mariae
emb|CAH59178.1|  kunitz trypsin inhibitor TI3                         57.4    9e-07   Populus tremula [European aspen]
emb|CAH59158.1|  kunitz trypsin inhibitor TI3                         57.4    9e-07   Populus tremula [European aspen]
ref|XP_009777240.1|  PREDICTED: miraculin-like                        57.8    9e-07   
gb|AAM10493.1|  putative cysteine proteinase inhibitor precursor ...  57.8    9e-07   Solanum tuberosum [potatoes]
emb|CAH59184.1|  kunitz trypsin inhibitor TI3                         57.4    9e-07   Populus tremula [European aspen]
emb|CAH59150.1|  kunitz trypsin inhibitor TI3                         57.4    9e-07   Populus tremula [European aspen]
gb|AAM10492.1|  putative cysteine proteinase inhibitor precursor ...  57.8    1e-06   Solanum tuberosum [potatoes]
gb|ACO40015.1|  kunitz trypsin inhibitor 3                            57.0    1e-06   Populus balsamifera [balsam poplar]
ref|XP_006495061.1|  PREDICTED: miraculin-like                        57.4    1e-06   
gb|AIT42210.1|  Kunitz-type inhibitor C                               57.4    1e-06   
ref|XP_006653614.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  57.4    1e-06   
ref|XP_007210537.1|  hypothetical protein PRUPE_ppa011653mg           57.4    1e-06   
emb|CDP21543.1|  unnamed protein product                              57.4    1e-06   
ref|NP_001241106.1|  uncharacterized protein LOC100790688 precursor   57.4    1e-06   
emb|CAH59151.1|  kunitz trypsin inhibitor TI3                         57.0    1e-06   Populus tremula [European aspen]
gb|AHJ25677.1|  Kunitz-type trypsin inhibitor                         57.0    1e-06   
emb|CAI77769.1|  kunitz trypsin inhibitor                             57.0    1e-06   Populus tremula [European aspen]
emb|CAH59145.1|  kunitz trypsin inhibitor TI3                         57.0    1e-06   Populus tremula [European aspen]
emb|CAI77795.1|  kunitz trypsin inhibitor                             57.0    2e-06   Populus tremula [European aspen]
emb|CAH59168.1|  kunitz trypsin inhibitor TI3                         56.6    2e-06   Populus tremula [European aspen]
ref|XP_004234308.1|  PREDICTED: serine protease inhibitor 5-like      57.0    2e-06   
ref|NP_001274943.1|  Kunitz-type protease inhibitor precursor         57.0    2e-06   
gb|AAL85660.1|  trypsin inhibitor                                     55.8    2e-06   Theobroma sylvestre
emb|CAH59156.1|  kunitz trypsin inhibitor TI3                         56.6    2e-06   Populus tremula [European aspen]
gb|AAZ94195.1|  Kunitz-type protease inhibitor precursor              57.0    2e-06   Solanum tuberosum [potatoes]
gb|AAL85655.1|  trypsin inhibitor                                     55.8    2e-06   Theobroma bicolor
gb|AFL91230.1|  Kunitz-like protease inhibitor                        55.8    2e-06   
gb|AAL60247.1|AF459082_1  putative Kunitz-type tuber invertase in...  56.2    2e-06   Solanum tuberosum [potatoes]
gb|AIT42164.1|  Kunitz-type inhibitor A                               57.0    2e-06   
gb|AFL91229.1|  Kunitz-like protease inhibitor                        55.8    2e-06   
sp|P83594.1|IFXA_BAUUN  RecName: Full=Factor Xa inhibitor BuXI        55.8    2e-06   Bauhinia ungulata
emb|CAI77785.1|  kunitz trypsin inhibitor                             56.6    2e-06   Populus tremula [European aspen]
gb|AIT42157.1|  Kunitz-type inhibitor A                               56.6    2e-06   
emb|CAH59191.1|  kunitz trypsin inhibitor TI3                         56.2    2e-06   Populus tremula [European aspen]
ref|XP_006353928.1|  PREDICTED: putative Kunitz-type tuber invert...  56.6    3e-06   
gb|AAZ94192.1|  Kunitz-type protease inhibitor precursor              56.6    3e-06   
gb|ACO40082.1|  kunitz trypsin inhibitor 4                            55.8    3e-06   
gb|AAL60242.1|AF459077_1  putative Kunitz-type tuber invertase in...  56.2    3e-06   
gb|AIT42203.1|  Kunitz-type inhibitor C                               56.2    3e-06   
gb|AIT42161.1|  Kunitz-type inhibitor A                               56.2    3e-06   
emb|CAH59180.1|  kunitz trypsin inhibitor TI3                         55.8    3e-06   
gb|AAL60244.1|AF459079_1  putative Kunitz-type tuber invertase in...  56.2    3e-06   
gb|AIT42205.1|  Kunitz-type inhibitor C                               56.2    3e-06   
gb|AAT06054.1|  putative Kunitz-type tuber invertase inhibitor        56.2    3e-06   
ref|XP_006347376.1|  PREDICTED: miraculin-like                        55.8    3e-06   
emb|CAI77773.1|  kunitz trypsin inhibitor                             55.8    3e-06   
emb|CAI77786.1|  kunitz trypsin inhibitor                             55.8    4e-06   
gb|AIT42202.1|  Kunitz-type inhibitor C                               56.2    4e-06   
emb|CDO98555.1|  unnamed protein product                              55.8    4e-06   
gb|ACO40153.1|  kunitz trypsin inhibitor 4                            55.5    4e-06   
sp|O24384.1|CPI8_SOLTU  RecName: Full=Cysteine protease inhibitor...  55.8    4e-06   
emb|CAI77790.1|  kunitz trypsin inhibitor                             55.8    4e-06   
emb|CBJ94876.1|  kunitz trypsin inhibitor                             54.7    4e-06   
gb|ACO40073.1|  kunitz trypsin inhibitor 4                            55.1    4e-06   
ref|XP_008437082.1|  PREDICTED: miraculin                             55.5    4e-06   
emb|CDP21726.1|  unnamed protein product                              55.8    4e-06   
ref|XP_006441436.1|  hypothetical protein CICLE_v10023581mg           55.1    4e-06   
ref|XP_011041832.1|  PREDICTED: wound-responsive protein GWIN3-like   55.5    5e-06   
emb|CAC00536.1|  Cathepsin D Inhibitor                                55.8    5e-06   
gb|AAL85659.1|  trypsin inhibitor                                     54.7    5e-06   
gb|ACO39912.1|  kunitz trypsin inhibitor 3                            55.1    5e-06   
gb|ACO40016.1|  kunitz trypsin inhibitor 3                            55.1    5e-06   
emb|CBJ94885.1|  kunitz trypsin inhibitor                             54.3    5e-06   
gb|AFL91228.1|  Kunitz-like protease inhibitor                        55.1    5e-06   
emb|CAZ64525.1|  Kunitz trypsin inhibitor                             54.3    5e-06   
gb|ACO40144.1|  kunitz trypsin inhibitor 4                            55.1    5e-06   
sp|P16347.1|IAAS_WHEAT  RecName: Full=Endogenous alpha-amylase/su...  55.1    5e-06   
gb|ACO40077.1|  kunitz trypsin inhibitor 4                            55.1    5e-06   
gb|AIT42166.1|  Kunitz-type inhibitor A                               55.5    5e-06   
emb|CAN63617.1|  hypothetical protein VITISV_041430                   55.5    5e-06   
gb|ACO39911.1|  kunitz trypsin inhibitor 3                            55.1    5e-06   
gb|ACO39935.1|  kunitz trypsin inhibitor 3                            55.1    5e-06   
gb|ACO39965.1|  kunitz trypsin inhibitor 3                            54.7    6e-06   
gb|AGF39574.1|  Kunitz-type protease inhibitor D                      55.5    6e-06   
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   55.1    6e-06   
emb|CAI77800.1|  kunitz trypsin inhibitor                             55.5    6e-06   
gb|ACS92519.1|  Kunitz-type protease inhibitor KPI-D8                 55.5    6e-06   
gb|ACS92513.1|  Kunitz-type protease inhibitor KPI-A9                 55.1    6e-06   
ref|XP_004235413.1|  PREDICTED: aspartic protease inhibitor 1-like    55.5    6e-06   
emb|CAH59188.1|  kunitz trypsin inhibitor TI3                         55.1    6e-06   
ref|XP_006441460.1|  hypothetical protein CICLE_v10024584mg           54.3    7e-06   
ref|NP_001234142.1|  cathepsin D inhibitor protein precursor          55.5    7e-06   
emb|CAH59154.1|  kunitz trypsin inhibitor TI3                         55.1    7e-06   
ref|XP_004137639.1|  PREDICTED: miraculin-like                        55.1    7e-06   
emb|CAH59173.1|  kunitz trypsin inhibitor TI3                         55.1    8e-06   
dbj|BAA05474.1|  tumor-related protein                                53.5    8e-06   
gb|AAL85657.1|  trypsin inhibitor                                     53.9    8e-06   
gb|ACO40074.1|  kunitz trypsin inhibitor 4                            54.3    9e-06   
ref|XP_004241479.1|  PREDICTED: miraculin-like                        54.7    9e-06   
gb|ACO40119.1|  kunitz trypsin inhibitor 4                            54.3    1e-05   
ref|XP_011072079.1|  PREDICTED: miraculin                             54.7    1e-05   
gb|ACV41265.1|  alpha amylase inhibitor                               53.5    1e-05   
gb|ACO40100.1|  kunitz trypsin inhibitor 4                            53.9    1e-05   
gb|ACV41268.1|  alpha amylase inhibitor                               53.5    1e-05   
emb|CDO98557.1|  unnamed protein product                              54.3    1e-05   
gb|AIT42170.1|  Kunitz-type inhibitor B                               54.7    1e-05   
gb|AAB28594.1|  PCPI 8.3=cysteine proteinase inhibitor                53.9    1e-05   
gb|ACV41267.1|  alpha amylase inhibitor                               53.5    1e-05   
ref|XP_010037029.1|  PREDICTED: miraculin-like                        54.7    2e-05   
gb|ACV41269.1|  alpha amylase inhibitor                               52.8    2e-05   
gb|ACO40093.1|  kunitz trypsin inhibitor 4                            53.5    2e-05   
sp|O24385.1|CPI7_SOLTU  RecName: Full=Cysteine protease inhibitor...  53.5    2e-05   
gb|AIT42186.1|  Kunitz-type inhibitor B                               53.9    2e-05   
gb|AAZ08244.1|  putative Kunitz-type proteinase inhibitor PKI1        53.9    2e-05   
gb|AFR78144.1|  Isa                                                   53.5    2e-05   
gb|ACO40084.1|  kunitz trypsin inhibitor 4                            53.1    2e-05   
gb|AIT42190.1|  Kunitz-type inhibitor B                               53.9    2e-05   
dbj|BAA04148.1|  proteinase inhibitor                                 53.9    2e-05   
gb|AIT42185.1|  Kunitz-type inhibitor B                               53.9    2e-05   
ref|XP_003534079.1|  PREDICTED: miraculin-like                        53.5    2e-05   
emb|CDP20822.1|  unnamed protein product                              53.5    2e-05   
gb|ACO40145.1|  kunitz trypsin inhibitor 4                            53.1    2e-05   
gb|AIT42155.1|  Kunitz-type inhibitor A                               53.9    2e-05   
emb|CAH59163.1|  kunitz trypsin inhibitor TI3                         53.5    2e-05   
sp|Q41484.1|SPI5_SOLTU  RecName: Full=Serine protease inhibitor 5...  53.9    2e-05   
sp|Q41433.1|SPI6_SOLTU  RecName: Full=Probable serine protease in...  53.9    2e-05   
gb|AIT42209.1|  Kunitz-type inhibitor C                               53.9    2e-05   
ref|XP_006353929.1|  PREDICTED: LOW QUALITY PROTEIN: Kunitz-type ...  53.9    2e-05   
ref|XP_010042449.1|  PREDICTED: miraculin-like                        54.3    2e-05   
gb|AFK36436.1|  unknown                                               53.5    2e-05   
ref|XP_003534081.1|  PREDICTED: miraculin-like                        53.5    3e-05   
emb|CAJ21340.1|  kunitz trypsin inhibitor TI3                         53.1    3e-05   
gb|AIT42204.1|  Kunitz-type inhibitor C                               53.5    3e-05   
gb|ACS92500.1|  Kunitz-type protease inhibitor KPI-D9                 53.5    3e-05   
ref|XP_006351514.1|  PREDICTED: probable serine protease inhibito...  53.5    3e-05   
ref|XP_010041215.1|  PREDICTED: miraculin-like                        53.1    3e-05   
gb|ACO40104.1|  kunitz trypsin inhibitor 4                            52.8    3e-05   
ref|NP_001274816.1|  Kunitz-type enzyme inhibitor S9C11 precursor     53.5    3e-05   
gb|ACO40081.1|  kunitz trypsin inhibitor 4                            52.8    4e-05   
gb|ACO40021.1|  kunitz trypsin inhibitor 3                            52.4    4e-05   
gb|KHM99737.1|  Miraculin                                             53.1    4e-05   
emb|CAH59183.1|  kunitz trypsin inhibitor TI3                         52.8    4e-05   
gb|ACV41264.1|  alpha amylase inhibitor                               51.6    4e-05   
gb|ACO40154.1|  kunitz trypsin inhibitor 4                            52.4    5e-05   
gb|AFX67012.1|  aspartic protease inhibitor 5                         52.8    5e-05   
emb|CAH59152.1|  kunitz trypsin inhibitor TI3                         52.8    5e-05   
ref|NP_001275020.1|  aspartic protease inhibitor 7 precursor          52.8    5e-05   
gb|AAZ94185.1|  Kunitz-type protease inhibitor precursor              52.8    5e-05   
ref|XP_010683390.1|  PREDICTED: miraculin-like                        52.8    5e-05   
ref|XP_009615974.1|  PREDICTED: miraculin-like                        52.8    5e-05   
emb|CDO98552.1|  unnamed protein product                              52.4    5e-05   
gb|AAL60245.1|AF459080_1  putative Kunitz-type tuber invertase in...  52.8    5e-05   
gb|ABR17296.1|  unknown                                               52.8    5e-05   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            52.8    6e-05   
pdb|4J2K|A  Chain A, Crystal Structure Of A Plant Trypsin Inhibit...  52.0    6e-05   
emb|CDO98554.1|  unnamed protein product                              52.4    6e-05   
emb|CAH59176.1|  kunitz trypsin inhibitor TI3                         52.4    6e-05   
emb|CAH59182.1|  kunitz trypsin inhibitor TI3                         52.4    7e-05   
emb|CAH59148.1|  kunitz trypsin inhibitor TI3                         52.0    7e-05   
emb|CAI77767.1|  kunitz trypsin inhibitor                             52.4    7e-05   
emb|CAI77771.1|  kunitz trypsin inhibitor                             52.4    8e-05   
gb|ABB72793.1|  Kunitz-type protease inhibitor-like protein           52.4    8e-05   
ref|NP_001236241.1|  uncharacterized protein LOC100305754 precursor   52.0    8e-05   
sp|Q41480.2|API1_SOLTU  RecName: Full=Aspartic protease inhibitor...  52.4    8e-05   
gb|AFC88891.1|  Kunitz-type proteinase inhibitor group A1             51.6    8e-05   
emb|CAA44005.1|  aspartic proteinase inhibitor homologue              52.0    8e-05   
ref|XP_002315497.1|  hypothetical protein POPTR_0010s01170g           52.0    8e-05   
gb|KHM99741.1|  Miraculin                                             52.0    9e-05   
gb|AFM38167.1|  Kunitz-type protease inhibitor group A                51.6    9e-05   
pir||JC5562  trypsin inhibitor ETIb precursor - Erythrina variegata   52.0    9e-05
sp|Q43645.2|API4_SOLTU  RecName: Full=Aspartic protease inhibitor...  52.0    9e-05   
emb|CAJ21341.1|  kunitz trypsin inhibitor TI7                         51.6    9e-05   
emb|CAI77753.1|  kunitz trypsin inhibitor                             52.0    1e-04   
gb|ACV41272.1|  alpha amylase inhibitor                               50.8    1e-04   
sp|P58519.1|API5_SOLTU  RecName: Full=Aspartic protease inhibitor...  52.0    1e-04   
gb|ACV41266.1|  alpha amylase inhibitor                               50.8    1e-04   
gb|ACS12825.1|  Kunitz-type proteinase inhibitor A1                   51.2    1e-04   
gb|AIT42165.1|  Kunitz-type inhibitor A                               51.6    1e-04   
emb|CAI77747.1|  kunitz trypsin inhibitor                             51.6    1e-04   
ref|XP_003620175.1|  Pathogen-inducible trypsin-inhibitor-like pr...  51.6    1e-04   
sp|O24383.1|CPI10_SOLTU  RecName: Full=Cysteine protease inhibito...  51.2    1e-04   
emb|CAI77754.1|  kunitz trypsin inhibitor                             51.6    1e-04   
gb|ACR54295.1|  Kunitz-type proteinase inhibitor group A2             51.2    1e-04   
gb|AAM10741.1|AF492357_1  putative cysteine proteinase inhibitor ...  50.8    1e-04   
gb|ACS12830.1|  Kunitz-type proteinase inhibitor A6                   51.2    1e-04   
ref|XP_009601782.1|  PREDICTED: miraculin-like                        51.6    1e-04   
ref|XP_003620174.1|  Pathogen-inducible trypsin-inhibitor-like pr...  51.2    2e-04   
sp|Q03197.1|API10_SOLTU  RecName: Full=Aspartic protease inhibito...  51.2    2e-04   
ref|NP_001275465.1|  Kunitz-type protease inhibitor precursor         51.2    2e-04   
ref|XP_006362668.1|  PREDICTED: aspartic protease inhibitor 5-like    51.2    2e-04   
gb|AFL91234.1|  Kunitz-like protease inhibitor                        50.4    2e-04   
ref|XP_004515058.1|  PREDICTED: miraculin-like                        50.8    2e-04   
gb|AAM08398.1|AF490593_1  aspartic proteinase inhibitor precursor...  51.2    2e-04   
emb|CAH59169.1|  kunitz trypsin inhibitor TI3                         51.2    2e-04   
ref|XP_006387698.1|  hypothetical protein POPTR_0664s00200g           50.1    2e-04   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      51.2    2e-04   
ref|XP_003620187.1|  Miraculin                                        51.2    2e-04   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      51.2    2e-04   
emb|CAJ21342.1|  kunitz trypsin inhibitor TI                          50.8    2e-04   
gb|AIT42176.1|  Kunitz-type inhibitor B                               51.2    2e-04   
sp|P24924.2|ITRY_ACACO  RecName: Full=Trypsin inhibitor; Contains...  50.4    2e-04   
ref|XP_010693983.1|  PREDICTED: factor Xa inhibitor BuXI-like         50.8    2e-04   
gb|AAM10743.1|AF492359_1  putative kunitz-type proteinase inhibit...  51.2    2e-04   
gb|AAL60246.1|AF459081_1  putative Kunitz-type tuber invertase in...  50.4    2e-04   
gb|KHN19473.1|  Alpha-amylase/subtilisin inhibitor                    50.4    2e-04   
dbj|BAA04150.1|  proteinase inhibitor                                 50.8    2e-04   
gb|AAK32690.1|AF349442_1  Kunitz trypsin inhibitor TI2                50.8    2e-04   
emb|CAH59159.1|  kunitz trypsin inhibitor TI3                         50.4    3e-04   
emb|CAI77742.1|  kunitz trypsin inhibitor                             50.8    3e-04   
emb|CAI77757.1|  kunitz trypsin inhibitor                             50.8    3e-04   
emb|CAI77740.1|  kunitz trypsin inhibitor                             50.8    3e-04   
ref|XP_006347377.1|  PREDICTED: miraculin-like                        50.4    3e-04   
emb|CAI77737.1|  kunitz trypsin inhibitor                             50.4    3e-04   
gb|AAO23566.1|  serine protease inhibitor                             50.8    3e-04   
emb|CAI77752.1|  kunitz trypsin inhibitor                             50.4    3e-04   
ref|XP_010674666.1|  PREDICTED: kunitz-type trypsin inhibitor alp...  50.1    3e-04   
gb|AAM10490.1|  aspartic proteinase inhibitor precursor P7E9          50.1    3e-04   
gb|AAL85654.1|  trypsin inhibitor                                     49.3    3e-04   
ref|XP_010683213.1|  PREDICTED: trypsin inhibitor-like                50.8    3e-04   
emb|CDY11118.1|  BnaC06g23700D                                        50.1    3e-04   
emb|CAI77743.1|  kunitz trypsin inhibitor                             50.4    3e-04   
ref|XP_008437071.1|  PREDICTED: miraculin-like                        50.4    3e-04   
gb|AGF39575.1|  Kunitz-type protease inhibitor C                      49.7    4e-04   
emb|CAH59170.1|  kunitz trypsin inhibitor TI3                         50.1    4e-04   
emb|CAB94854.1|  inhibitor of yeast proteinase A                      49.7    4e-04   
ref|XP_008669134.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  50.4    4e-04   
ref|XP_010537532.1|  PREDICTED: miraculin                             50.1    4e-04   
gb|ACO40078.1|  kunitz trypsin inhibitor 4                            49.7    4e-04   
gb|ACS12828.1|  Kunitz-type proteinase inhibitor A4                   49.7    4e-04   
gb|AIT42160.1|  Kunitz-type inhibitor A                               50.1    4e-04   
gb|ABA81855.1|  kunitz-type protease inhibitor                        50.1    5e-04   
gb|KHM99743.1|  Miraculin                                             49.7    5e-04   
ref|XP_008226352.1|  PREDICTED: alpha-amylase/subtilisin inhibito...  50.1    5e-04   
gb|AIT42158.1|  Kunitz-type inhibitor A                               50.1    5e-04   
ref|XP_003603351.1|  Trypsin protein inhibitor                        49.7    5e-04   
gb|AIT42207.1|  Kunitz-type inhibitor C                               49.7    5e-04   
gb|AIT42175.1|  Kunitz-type inhibitor B                               50.1    5e-04   
gb|AIT42168.1|  Kunitz-type inhibitor B                               50.1    5e-04   
ref|XP_003534078.1|  PREDICTED: miraculin-like                        49.7    6e-04   
emb|CAI77750.1|  kunitz trypsin inhibitor                             49.7    6e-04   
gb|KHM99738.1|  Miraculin                                             49.3    6e-04   
gb|AAG12337.1|  cathepsin D inhibitor                                 49.3    6e-04   
ref|XP_009105993.1|  PREDICTED: latex serine proteinase inhibitor...  49.7    6e-04   
gb|AFK34345.1|  unknown                                               49.7    6e-04   
emb|CAH59181.1|  kunitz trypsin inhibitor TI3                         49.3    7e-04   
dbj|BAB85996.1|  trypsin inhibitor homolog                            49.3    7e-04   
gb|AIT42199.1|  Kunitz-type inhibitor B                               49.7    7e-04   
ref|XP_004237191.1|  PREDICTED: miraculin-like                        49.7    7e-04   
gb|AAM10744.1|AF492769_1  putative kunitz-type proteinase inhibit...  49.7    7e-04   
ref|NP_001237312.1|  uncharacterized protein LOC100527782 precursor   49.3    7e-04   
emb|CAJ21343.1|  kunitz trypsin inhibitor TI                          49.3    7e-04   
gb|AFM38166.1|  Kunitz-type protease inhibitor group A                48.9    7e-04   
ref|XP_006362681.1|  PREDICTED: serine protease inhibitor 1-like      48.9    7e-04   
ref|XP_011009407.1|  PREDICTED: wound-responsive protein GWIN3-li...  49.3    7e-04   
gb|AIT42182.1|  Kunitz-type inhibitor B                               49.7    8e-04   
ref|XP_010253746.1|  PREDICTED: 21 kDa seed protein-like              49.7    8e-04   
sp|P30941.2|SPI7_SOLTU  RecName: Full=Serine protease inhibitor 7...  49.3    8e-04   
emb|CAI77745.1|  kunitz trypsin inhibitor                             49.3    8e-04   
gb|ACS92495.1|  Kunitz-type protease inhibitor KPI-B7.2               49.3    8e-04   
gb|AAM21644.1|AF495583_1  putative Kunitz-type proteinase inhibitor   48.9    8e-04   
gb|AIT42196.1|  Kunitz-type inhibitor B                               49.3    8e-04   
emb|CDP22082.1|  unnamed protein product                              49.3    8e-04   
gb|AIT42183.1|  Kunitz-type inhibitor B                               49.3    8e-04   
gb|ACS92498.1|  Kunitz-type protease inhibitor KPI-B7.1               49.3    8e-04   
ref|XP_007041756.1|  21 kDa seed protein                              49.3    8e-04   
emb|CDP21540.1|  unnamed protein product                              49.3    8e-04   



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 138/201 (69%), Gaps = 12/201 (6%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLE  586
            THS  NPIRL  A + A +S+ PV+D +GDE+R G  YY+++A     +W  G   L+L 
Sbjct  19   THSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYMVSA-----IWGAGGGGLRLV  72

Query  585  WLDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDR  415
             LD +S +C SDV++SR    +G PITITPA DP A+VV+PST+ +F+F + TNKLCV+ 
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNN  131

Query  414  LYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQI  238
            + W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYY  191

Query  237  DPLTRAIHLGLNDFPFVVVFK  175
            DPLTRA  L L++ PFV V K
Sbjct  192  DPLTRATRLALSNIPFVFVIK  212



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VVL ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIEV-EPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIEV + +LN Y+LTYC FG+ +CHN+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP ++VV+PSTF +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVMVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP ++VV+PSTF +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VVL ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L+D PFV V K
Sbjct  196  PMLRTTRLALSDSPFVFVIK  215



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP A+VV+PST+ +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP ++VV+PSTF +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITI PA DP ++VV+PSTF +F+F +PTNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITIRPA-DPESTVVMPSTFQTFRFSIPTNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   187 bits (476),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PL R   L L++ PFV V K
Sbjct  196  PLMRTTRLALSNSPFVFVIK  215



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   187 bits (474),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  2    HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  55

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  56   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  115

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  116  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  175

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  176  PMLRTTRLALSNSPFVFVIK  195



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP A+VV+PST+ +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   187 bits (475),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP ++VV+PSTF +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   187 bits (475),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP ++VV+PSTF +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVVVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   187 bits (474),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 138/201 (69%), Gaps = 12/201 (6%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLE  586
            THS  NPIRL  A + A +S+ PV+D +GDE+R G  YY+++A     +W  G   L+L 
Sbjct  19   THSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYMVSA-----IWGAGGGGLRLV  72

Query  585  WLDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDR  415
             LD +S +C SDV++SR    +G PITITPA DP ++VV+PST+ +F+F + TNKLCV+ 
Sbjct  73   RLDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTYQTFRFNIATNKLCVNN  131

Query  414  LYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQI  238
            + W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   
Sbjct  132  VNWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYY  191

Query  237  DPLTRAIHLGLNDFPFVVVFK  175
            DPLTRA  L L++ PFV V K
Sbjct  192  DPLTRATRLALSNTPFVFVIK  212



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   187 bits (474),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV+IS   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + + +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPS-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP +SV++ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMMRTTRLALSNSPFVFVIK  215



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VVL ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 137/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            H   NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HPRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VVL ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWRIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L+D PFV V K
Sbjct  196  PMLRTTRLALSDSPFVFVIK  215



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 137/200 (69%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            +S  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   YSKFNPIRLRPARETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G PITITPA DP ++VV+PSTF +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPITITPA-DPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             ++R   L L++ PFV V K
Sbjct  196  HMSRTTRLALSNSPFVFVIK  215



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 136/200 (68%), Gaps = 12/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRL  A + A +S+ PV+D +GDE+R G  YYI++A     +W  G   L+L  
Sbjct  20   HSKFNPIRLRPAHETA-SSETPVLDINGDEVRAGENYYIVSA-----IWGAGGGGLRLVR  73

Query  582  LDWAS-KCPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD +S +C SDV++SR    +G P TITPA DP A+VV+PST+ +F+F + TNKLCV+ +
Sbjct  74   LDSSSNECASDVIVSRSDFDNGDPTTITPA-DPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ FVKAGEFVS+ SNQFKIE V  +LN Y+++YC FGT +C N+G   D
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            PLTRA  L L++ PFV V K
Sbjct  193  PLTRATRLALSNTPFVFVIK  212



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   185 bits (470),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W + +   SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             + R   + L++ PFV V K
Sbjct  196  HMLRTTRIALSNSPFVFVIK  215



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W + +   SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L+ +PF  V K
Sbjct  196  PMLRTTRLALSYYPFFFVIK  215



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 137/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             + R   L L++ PFV V K
Sbjct  196  HMLRTTRLALSNSPFVFVIK  215



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 138/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W + +   SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             + R   + L++ PFV V K
Sbjct  196  HMLRTTRIALSNSPFVFVIK  215



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 137/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPAA-DPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + DG PITITPAA DP ++VV+  T+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC +DV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             + R   L L++ PFV V K
Sbjct  196  HMLRTTRLALSNSPFVFVIK  215



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   183 bits (464),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 136/200 (68%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTEL-KLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G    +L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEIRAGGNYYMVSA-----IWGVGGGGPRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             + R   L L++ PFV V K
Sbjct  196  HMLRTTRLALSNSPFVFVIK  215



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   182 bits (463),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 137/200 (69%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  +   +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPP-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITP+ ADP +SV++ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 136/200 (68%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  +   +S  PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPP-SSQTPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPAA-DPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPAA DP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   180 bits (456),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 134/200 (67%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F +  NKLCV  +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVKNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+K GEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N G   D
Sbjct  136  NWGIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/200 (49%), Positives = 135/200 (68%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  +    S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPP-PSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV +S   + +G PITITP+ ADP +SV++ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PFV V K
Sbjct  196  PMLRTTRLALSNSPFVFVIK  215



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 136/200 (68%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKL V+ +
Sbjct  76   LDMMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L++ PF  V +
Sbjct  196  PMLRTTRLALSNSPFAFVIR  215



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 132/200 (66%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G        
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLGH  75

Query  579  -DWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
             D  SKC SDV++S   + +G PITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     SG+ F+KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG  +C+N+G   D
Sbjct  136  NWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVGRFHD  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
             + R   L L++ PFV V K
Sbjct  196  HMLRTTRLALSNSPFVFVIK  215



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 134/200 (67%), Gaps = 11/200 (6%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  +   +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPP-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP A+VV+ ST+ +F+F + TNKLCV+ +
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQID  235
             W +     S +  +KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D
Sbjct  136  NWGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFND  195

Query  234  PLTRAIHLGLNDFPFVVVFK  175
            P+ R   L L+ +PF  V K
Sbjct  196  PMLRTTRLALSYYPFFFVIK  215



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 131/199 (66%), Gaps = 9/199 (5%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY++ A     +   G  L+L  L
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVYA----ILGACGGGLRLAHL  76

Query  579  DWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRLY  409
            D  + C SDV++S   + +G  ITITPA  DP A+VV+ ST+ +F+F + TNKLCV+ + 
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVN  136

Query  408  WEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQIDP  232
            W +     SG+  +KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   DP
Sbjct  137  WGIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDP  196

Query  231  LTRAIHLGLNDFPFVVVFK  175
            + R   L L+ +PF  V K
Sbjct  197  MLRTTRLALSYYPFFFVIK  215



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   172 bits (435),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 92/199 (46%), Positives = 131/199 (66%), Gaps = 9/199 (5%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +   G  L+L  L
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA----ILGACGGGLRLAHL  76

Query  579  DWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRLY  409
            D  + C SDV++S   + +G  ITITPA  DP A+VV+ ST+ +F+F + TNKLCV+ + 
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVN  136

Query  408  WEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQIDP  232
            W +     S +  +KAGEFVS+ SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   DP
Sbjct  137  WGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDP  196

Query  231  LTRAIHLGLNDFPFVVVFK  175
            + R   L ++ +PF  V K
Sbjct  197  MLRTTRLAISYYPFFFVIK  215



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 131/199 (66%), Gaps = 9/199 (5%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +   G  L+L  L
Sbjct  22   HSGFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYLVSA----ILGACGGGLRLAHL  76

Query  579  DWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRLY  409
            D  + C SDV++S   + +G  ITITPA  DP A+VV+ ST+ +F+F + TNKLCV+ + 
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVN  136

Query  408  WEMHESPNSGRVFVKAGEFVSNQSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQIDP  232
            W +     S +  +KAGE VS+++NQFKIE V+ +LN Y+LTYC FG+ +C+N+G   DP
Sbjct  137  WGIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDP  196

Query  231  LTRAIHLGLNDFPFVVVFK  175
            + R   L L+ +PF  V K
Sbjct  197  MLRTTRLALSYYPFFFVIK  215



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 84/117 (72%), Gaps = 2/117 (2%)
 Frame = -1

Query  519  ITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSN  343
            ITITPA ADP ++VV+ ST+ +F+F + TNKLCV+ + W +     SG+ F+KAGEFVS+
Sbjct  1    ITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQHDSASGQYFLKAGEFVSD  60

Query  342  QSNQFKIE-VEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPFVVVFK  175
             SNQFKIE V+ +LN Y+LTYC FG+ +C+N+G   D + R   L L++ PFV V K
Sbjct  61   NSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVIK  117



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 87/131 (66%), Gaps = 10/131 (8%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTE-LKLEW  583
            HS  NPIRLPT  + A +S+ PV+D +GDE+R GG YY+++A     +W  G   L+L  
Sbjct  22   HSRFNPIRLPTTHEPA-SSETPVLDINGDEVRAGGNYYMVSA-----IWGAGGGGLRLAH  75

Query  582  LDWASKCPSDVLIS--RMSDGTPITITPA-ADPNASVVLPSTFVSFKFELPTNKLCVDRL  412
            LD  SKC SDV++S   + +G PITITPA ADP ++VVL ST+ +F+F + TNKLCV+ +
Sbjct  76   LDTMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNV  135

Query  411  YWEMHESPNSG  379
             W +     SG
Sbjct  136  NWGIQHDSASG  146



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  495  PNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-  319
            P ++VV+ ST+ +F+F + TNKLCV+ + W +     S +  +KAGEFVS+ SNQFKIE 
Sbjct  60   PESTVVMASTYQTFRFNIATNKLCVNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEV  119

Query  318  VEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPFVVVFK  175
            V+ +LN Y+LTYC FG+ +C+N+G   DP+ R   L L+ +PF  V K
Sbjct  120  VDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSSYPFFFVIK  167



>emb|CAA43267.1| sporamin [Ipomoea batatas]
Length=236

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +1

Query  154  YTSLTSFLKHNNEGKIIETQMNSPREWVDLSAEVMASAGAERTISESVTVKARFH-FNLE  330
            YTS+   L    +G+I E+Q   P+  V  SA ++A  GAE T+SE V VK   H  NLE
Sbjct  31   YTSVG--LMTKTQGRIGESQTRGPQHGVMESANIVAFVGAELTVSEFVEVKVGIHQLNLE  88

Query  331  LVALV*HKLAGLHENSPGVWTLMHLPI*AIHTKFVCGKLEFEAHESRRQDH  483
            LVA+V HKLAG  E  PG   ++  P+  +H + V G +E E+   RR DH
Sbjct  89   LVAIVGHKLAGFQEILPGRAVVLDSPVHVVHAELVGGDVEPESLVRRRHDH  139



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 97/200 (49%), Gaps = 27/200 (14%)
 Frame = -1

Query  735  LPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPS  556
             P AA+   +S  PV+DT+G +LR G  YYI+  P+   +   G  L L        CP 
Sbjct  20   FPVAAE---SSPDPVLDTEGKQLRSGVDYYIL--PV---IRGRGGGLTLASTG-NENCPL  70

Query  555  DVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS  382
            DV+  +  +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++    +S
Sbjct  71   DVVQEQHEVSNGLPLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESS  127

Query  381  GRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPL  229
            G+ FV  G    N       N FKIE     + Y+L +CP    F    C ++G  I   
Sbjct  128  GQRFVTTGGVEGNPGXETLDNWFKIEKYE--DDYKLVFCPTVCDFCKPVCGDIGIYIQNG  185

Query  228  TRAIHLGLNDFPFVVVFKKA  169
             R   L L+D PF V+FKKA
Sbjct  186  YR--RLALSDVPFKVMFKKA  203



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 91/193 (47%), Gaps = 36/193 (19%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPI------DLYMWPPGTELKLEWLDWASKCPSDVLISR-  538
            PV+DT+G +LR G  YYI+  P+       L +   G E           CP DV+  + 
Sbjct  30   PVLDTEGKKLRSGVDYYIL--PVFRGRGGGLTLASTGNET----------CPLDVVQEQQ  77

Query  537  -MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKA  361
             +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++    +SG+ FV  
Sbjct  78   EVSNGLPLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTT  134

Query  360  GEFVSNQS-----NQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLG  208
            G    N       N FKI  E   + Y+L +CP    F    C ++G  I    R   L 
Sbjct  135  GGVEGNPGRETLDNWFKI--EKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNXYR--RLA  190

Query  207  LNDFPFVVVFKKA  169
            L+D PF V+FKKA
Sbjct  191  LSDVPFKVMFKKA  203



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 91/193 (47%), Gaps = 36/193 (19%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPI------DLYMWPPGTELKLEWLDWASKCPSDVLISR-  538
            PV+DT+G +LR G  YYI+  P+       L +   G E           CP DV+  + 
Sbjct  52   PVLDTEGKKLRSGVDYYIL--PVFRGRGGGLTLASTGNET----------CPLDVVQEQQ  99

Query  537  -MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKA  361
             +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++    +SG+ FV  
Sbjct  100  EVSNGLPLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTT  156

Query  360  GEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLG  208
            G    N       N FKI  E   + Y+L +CP    F    C ++G  I    R   L 
Sbjct  157  GGVEGNPGRETLDNWFKI--EKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEYR--RLA  212

Query  207  LNDFPFVVVFKKA  169
            L+D PF V+FKKA
Sbjct  213  LSDVPFKVMFKKA  225



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 91/193 (47%), Gaps = 36/193 (19%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPI------DLYMWPPGTELKLEWLDWASKCPSDVLISR-  538
            PV+DT+G +LR G  YYI+  P+       L +   G E           CP DV+  + 
Sbjct  30   PVLDTEGKKLRSGVDYYIL--PVFRGRGGGLTLASTGNE----------TCPLDVVQEQQ  77

Query  537  -MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKA  361
             +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++    +SG+ FV  
Sbjct  78   EVSNGLPLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTT  134

Query  360  GEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLG  208
            G    N       N FKIE     + Y+L +CP    F    C ++G  I    R   L 
Sbjct  135  GGVEGNPGRETLDNWFKIEKYD--DDYKLVFCPTVCDFCKPVCGDIGIYIQNGYR--RLA  190

Query  207  LNDFPFVVVFKKA  169
            L+D PF V+FKKA
Sbjct  191  LSDVPFKVMFKKA  203



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 91/187 (49%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR--MSDGT  523
            PV+DT+G +LR G  YYI+  P+       G  L L      S CP DV+  +  +S+G 
Sbjct  30   PVLDTEGKKLRSGVDYYIL--PV---FRGRGGGLTLASTGNES-CPLDVVQEQQEVSNGL  83

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSN  343
            P+T TP  +P   V+  ST  + KF   T  +CV    W++    +SG+ FV  G    N
Sbjct  84   PLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQWFVTTGGVEGN  140

Query  342  QS-----NQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
                   N FKI  E   + Y+L +CP    F    C ++G  I    R   L L+D PF
Sbjct  141  PGRETLDNWFKI--EKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNGYR--RLALSDVPF  196

Query  189  VVVFKKA  169
             V+FKKA
Sbjct  197  KVMFKKA  203



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 65/193 (34%), Positives = 90/193 (47%), Gaps = 36/193 (19%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPI------DLYMWPPGTELKLEWLDWASKCPSDVLISR-  538
            PV+DT+G +LR G  YYI+  P+       L +   G E           CP DV+  + 
Sbjct  30   PVLDTEGKKLRSGVDYYIL--PVFRGRGGGLTLASTGNET----------CPLDVVQEQQ  77

Query  537  -MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKA  361
             +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++    +SG+ FV  
Sbjct  78   EVSNGLPLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESSGQRFVTT  134

Query  360  GEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLG  208
            G    N       N FKI  E   + Y+L +CP    F    C ++G  I    R   L 
Sbjct  135  GGVEGNPGRETLDNWFKI--EKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNEYR--RLA  190

Query  207  LNDFPFVVVFKKA  169
            L+D PF V FKKA
Sbjct  191  LSDVPFKVKFKKA  203



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 92/197 (47%), Gaps = 20/197 (10%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ PV+DTDGDELR G  YY++++     +W  G             CP ++++ R
Sbjct  23   VANAANSPVLDTDGDELRTGVRYYVVSS-----IWGAGGGGLALGRATGQSCP-EIVVQR  76

Query  537  MSD---GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFV  367
             SD   GTP+ I   AD    VV  ST ++ +F    ++LC     W++    NS   + 
Sbjct  77   RSDLDNGTPV-IFSNADSKDGVVRLSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWW  135

Query  366  KAGEFVSNQ------SNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTR---AIH  214
               + V  Q      ++ FKIE    L GY+  +CP     C  L   I   +     I 
Sbjct  136  VTTDGVRGQPGPNTLTSWFKIERAGVL-GYKFRFCPSVCDSCKTLCSDIGRHSDDDGQIR  194

Query  213  LGLNDFPFVVVFKKASK  163
            L L+D  +  +FKKASK
Sbjct  195  LALSDNGWPWMFKKASK  211



>gb|ABX76297.1| stigma expressed protein [Nicotiana alata]
Length=243

 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 74/224 (33%), Positives = 107/224 (48%), Gaps = 33/224 (15%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVV----DTDGDELRPGGAYYIITAPIDLYMWPPGTEL  595
            + ++ NPI LPT  D    +D+PV+    DT+G  L+ G  Y+II+A      W  G  +
Sbjct  26   SFTSTNPIVLPTTTD--DDNDLPVLSEVLDTNGKPLQIGEEYHIISAS-----WRTGGGV  78

Query  594  KLEWLDWASKCPSDVLI--SRMSDGTPI---TITPAADPNASVVLPSTFVSFKFELPTNK  430
             L  L   +KCP+DV+       DG P+   T+ P   P +SVV  +  ++  F +PT K
Sbjct  79   YLTNLT-NTKCPNDVVQHWEGSKDGMPVKFFTMDPEVAP-SSVVRETNDINIMFSVPTTK  136

Query  429  LCVDRLYWEMH--ESPNSGRVFVKAGEFVS-----NQSNQFKIE-VEPSLNGYRLTY---  283
            LCV+   W++   +S   G  FV  G  +         + FKIE V  +   Y+L Y   
Sbjct  137  LCVNETVWKVGDPDSTEQGVRFVVTGGTLGYPGPITIKSWFKIEKVTKTAPFYKLRYCPD  196

Query  282  ---CPFGTSRCHNLGGQID-PLTRAIHLGLNDFPFVVVFKKASK  163
               CP     C ++G   D  +     L LND PF VVF+K  K
Sbjct  197  RYLCPMCYVGCSDVGLTADRDVVGDKRLVLNDQPFWVVFEKFQK  240



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 68/200 (34%), Positives = 96/200 (48%), Gaps = 27/200 (14%)
 Frame = -1

Query  735  LPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPS  556
             P AA+   +S  PV+DT+G +L  G  YYI+  P+   +   G  L L        CP 
Sbjct  20   FPVAAE---SSPDPVLDTEGKQLWSGVDYYIL--PV---IRGRGGGLTLASTG-NENCPL  70

Query  555  DVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS  382
            DV+  +  +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++    +S
Sbjct  71   DVVQEQHEVSNGLPLTFTP-VNPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYDESS  127

Query  381  GRVFVKAGEFVSNQS-----NQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPL  229
            G+ FV  G    N       N FKI  E   + Y+L +CP    F    C ++G  I   
Sbjct  128  GQRFVTTGGVEGNPGHETLDNWFKI--EKYEDDYKLVFCPTVCDFCKPVCGDIGIYIQNG  185

Query  228  TRAIHLGLNDFPFVVVFKKA  169
             R   L L+D PF V+FKKA
Sbjct  186  YR--RLALSDVPFKVMFKKA  203



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 91/203 (45%), Gaps = 31/203 (15%)
 Frame = -1

Query  744  PIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK  565
            P+R   +AD       PV+D  G +LR G  YYI+  P+       G  L L        
Sbjct  22   PVRGNASAD-------PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRSNNKT  69

Query  564  CPSDVLISRMS--DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHES  391
            CP DV+  + S  +G P+T +P  +P   VV  ST ++ KF+  T+  C     W++   
Sbjct  70   CPVDVVQEQHSFRNGLPVTFSP-VNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNF  126

Query  390  PNS-GRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQ  241
              + G+  V  G    N       N FKI  E     Y+L YCP    F    C ++G  
Sbjct  127  DAAIGQWLVTTGGVEGNPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIF  184

Query  240  IDPLTRAIHLGLNDFPFVVVFKK  172
            I+   R   L L+D PF VVFKK
Sbjct  185  INGGVR--RLALSDVPFKVVFKK  205



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 88/189 (47%), Gaps = 18/189 (10%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITA-PIDLYMWPP---GTELKLEWLDWASKCPSDVLISRMSD  529
            PV+DT G +LR    Y+II A P  +  +     G  L L+ +D    CP DV+I + ++
Sbjct  30   PVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSID--ESCPLDVIIEKANE  87

Query  528  GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEF  352
            G P+  +P  +    V+  ST ++  F     +       W + +   S G+ +V  G  
Sbjct  88   GLPLRFSP-VNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDASIGQTYVTTGGV  146

Query  351  VSNQS-----NQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLT---RAIHLGLNDF  196
            V N       N FKI+     + Y+L YCP     CH+L   I       R +HL L+D 
Sbjct  147  VGNPGEHTILNWFKIQKYE--DAYKLVYCPRVCPSCHHLCKDIGMFVDANRRMHLALSDD  204

Query  195  PFVVVFKKA  169
            PF + FK+A
Sbjct  205  PFKIKFKEA  213



>gb|AEK26936.1| Kunitz-type trypsin inhibitor B3 [Populus nigra]
Length=209

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 92/197 (47%), Gaps = 24/197 (12%)
 Frame = -1

Query  714  AITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRM  535
            +I +  PV+D DG++L  G  YYI+  P+       G    +      + CP  V+  R+
Sbjct  21   SIAAAEPVLDIDGEKLVAGTKYYIL--PV-----FRGRGGGITMASNKTSCPLAVVQDRL  73

Query  534  --SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVK  364
              S+G P+T TPAAD    V+L ST ++ KF   T   C     W++ +S NS  + FV 
Sbjct  74   EVSNGLPLTFTPAADDKKGVILVSTDLNIKFLAKTT--CPQSTVWKIIKSSNSKVQWFVS  131

Query  363  AGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI-----DPLTRAIH  214
             G    N      +N F+I  E + + Y+L +CP     C  L   I     D  TR + 
Sbjct  132  TGGVEGNPGFNTVTNWFQI--EKADDDYKLVFCPTKVCNCGVLCRDIGIYIEDNGTRTLS  189

Query  213  LGLNDFPFVVVFKKASK  163
            L     PF V FKKA K
Sbjct  190  LSDALQPFKVQFKKALK  206



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 64/189 (34%), Positives = 87/189 (46%), Gaps = 23/189 (12%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVL--ISRMSDGT  523
            PV+D  G ELR G  YYI+  P+   +   G  L L      + CP  V+   S +  G 
Sbjct  32   PVLDISGKELRAGVNYYIL--PV---IRGRGGGLSLASTG-NNTCPLSVVQEQSELKKGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSN  343
            P+T  P  DP   VV  ST  + KF   T  +CV    W +    ++G+ FV  G    N
Sbjct  86   PLTFHP-VDPKKGVVRLSTDHNIKFSAST--ICVQSTVWRLDNDESTGKYFVNTGGVEGN  142

Query  342  Q-----SNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLND--F  196
                  SN FKIE   S + Y+L +CP    F    C ++G  +    R + L L D   
Sbjct  143  PGSGSISNWFKIEAYGS-SDYKLLFCPTVCNFCKVICRDVGIVVQDGKRRLGLTLTDDVT  201

Query  195  PFVVVFKKA  169
            PF ++FKKA
Sbjct  202  PFPIMFKKA  210



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 96/200 (48%), Gaps = 26/200 (13%)
 Frame = -1

Query  735  LPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPS  556
            LP AA+ A     PV+D +G +LR G  YYI+  P+   +   G  L +  +   + CP 
Sbjct  21   LPGAAEAAPD---PVLDIEGKQLRSGVDYYIL--PV---IRGRGGGLTVASVRNKT-CPL  71

Query  555  DVLISRM--SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS  382
            DV+  ++  S G P+T TP  +P   V+  ST  + KF   T  +C     W++    ++
Sbjct  72   DVVQDKLEVSHGLPLTFTP-VNPKQDVIRVSTDHNIKFSAAT--ICAQSTVWKLEYDEST  128

Query  381  GRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPL  229
            G+ F+  G    N      SN FKI  E   + Y+L +CP    F    C ++G  I   
Sbjct  129  GQRFITTGGVEGNPGRGTLSNWFKI--EKYGDDYKLVFCPTVCNFCKVICRDVGVYIQKG  186

Query  228  TRAIHLGLNDFPFVVVFKKA  169
             R + L   D PF V+FKKA
Sbjct  187  YRRLAL-TTDAPFRVMFKKA  205



>gb|ADW95389.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=209

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 91/197 (46%), Gaps = 24/197 (12%)
 Frame = -1

Query  714  AITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRM  535
            +I +  PV+D DG++L  G  YYI+  P+       G    +      + CP  V+  R+
Sbjct  21   SIAAAEPVLDIDGEKLVAGTKYYIL--PV-----FRGRGGGITMASNKTSCPLAVVQDRL  73

Query  534  --SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVK  364
              S G P+T TPAAD    V+L ST ++ KF   T   C     W++ +S NS  + FV 
Sbjct  74   EVSKGLPLTFTPAADDKKGVILVSTDLNIKFLAKTT--CPQSTVWKIIKSSNSKVQWFVS  131

Query  363  AGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI-----DPLTRAIH  214
             G    N      +N F+I  E + + Y+L +CP     C  L   I     D  TR + 
Sbjct  132  TGGVEGNPGFNTVTNWFQI--EKADDDYKLVFCPTKVCNCGVLCRDIGIYIEDNGTRTLS  189

Query  213  LGLNDFPFVVVFKKASK  163
            L     PF V FKKA K
Sbjct  190  LSDALQPFKVQFKKALK  206



>ref|XP_006372631.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ERP50428.1| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=209

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 64/197 (32%), Positives = 91/197 (46%), Gaps = 24/197 (12%)
 Frame = -1

Query  714  AITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRM  535
            +I +  PV+D DG++L  G  YYI+  P+       G    +      + CP  V+  R+
Sbjct  21   SIAAAEPVLDIDGEKLVAGTEYYIL--PV-----FRGRGGGITMASNKTSCPLAVVQDRL  73

Query  534  --SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVK  364
              S G P+T TPAAD    V+L ST ++ KF   T   C     W++ +S NS  + FV 
Sbjct  74   EVSKGLPLTFTPAADDKKGVILVSTDLNIKFLAKTT--CPQSTVWKITKSSNSKVQWFVS  131

Query  363  AGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI-----DPLTRAIH  214
             G    N      +N F+I  E + + Y++ +CP     C  L   I     D  TR + 
Sbjct  132  TGGVEGNPGFNTVTNWFQI--EKADDDYKIVFCPTKVCNCGVLCRDIGIYIEDNGTRTLS  189

Query  213  LGLNDFPFVVVFKKASK  163
            L     PF V FKKA K
Sbjct  190  LSDALQPFKVQFKKALK  206



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 85/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRSNNKTCPVDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGNYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>ref|XP_003534100.1| PREDICTED: miraculin-like [Glycine max]
 gb|KHM99733.1| Miraculin [Glycine soja]
Length=216

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 89/197 (45%), Gaps = 33/197 (17%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWAS---KCPSDVLISRMSDGT  523
            V+DT G EL+PG +YY++ A            L  E L  AS    CP DV++ + S G 
Sbjct  30   VIDTSGTELQPGLSYYVVPAMRSFTRCGKFECLNAEGLSLASIGESCPLDVVVEQRSFGL  89

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRL---------YWEM-HESPNSGRV  373
            P++ +P  D N SVV  ST ++  F       C DR           W++ H   + G+ 
Sbjct  90   PLSFSP-LDTNESVVRVSTDLNIMF-------CTDRTSYSCAEYSPVWKLDHFDVSKGKW  141

Query  372  FVKAGEFVSNQS-----NQFKIEVEPSLNGYRLTY----CPFGTSRCHNLGGQIDPLTRA  220
            FV  G  + N S     N FKIE   S   YR+ Y    CP     C ++G  +D     
Sbjct  142  FVTTGGSMGNPSWETIRNWFKIEKCDS--AYRIVYCPSVCPSSKHMCKDVGVFVDE-NGY  198

Query  219  IHLGLNDFPFVVVFKKA  169
              L L+D PF V F+ A
Sbjct  199  RRLALSDVPFKVKFQLA  215



>ref|XP_011046090.1| PREDICTED: miraculin-like [Populus euphratica]
Length=209

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 91/197 (46%), Gaps = 24/197 (12%)
 Frame = -1

Query  714  AITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRM  535
            +I +  PV+D DG++L  G  YYI+  P+       G    +      + CP  V+  R+
Sbjct  21   SIAAAEPVLDIDGEKLVAGTKYYIL--PV-----FRGRGGGITMASNQTSCPLAVVQDRL  73

Query  534  --SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVK  364
              S G P+T TPAAD    V+L ST ++ KF   T   C     W++ +S NS  + FV 
Sbjct  74   EASKGLPLTFTPAADDKKGVILVSTDLNIKFLDKTT--CPHSTVWKIIKSSNSKVQWFVS  131

Query  363  AGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI-----DPLTRAIH  214
             G    N       N F+I  E + + Y+L +CP    +C  L   I     D  TR + 
Sbjct  132  TGGVEGNPGFNTVGNWFQI--EKADDDYKLVFCPTKVCKCGVLCRDIGIYIEDNGTRTLS  189

Query  213  LGLNDFPFVVVFKKASK  163
            L     PF V FKKA K
Sbjct  190  LSDALQPFKVQFKKALK  206



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 63/197 (32%), Positives = 92/197 (47%), Gaps = 32/197 (16%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIIT------APIDLYMWPPGTELKLEWLDWASKCPSDVLI--S  541
            PV+D +G+E+RPG  Y++++           Y   PG E+          CP  V+   S
Sbjct  26   PVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPGNEI----------CPLAVVQEPS  75

Query  540  RMSDGTPITITPAADPNASVVLPSTFVSFKF-ELPTNKLCVDRLYWEMHESPNSGRVF--  370
              + G P+T TP  +P   VV  ST ++ KF E P    C     W++H +    + F  
Sbjct  76   DRNRGHPVTFTP-VNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALEQHFVL  134

Query  369  ---VKAGEFVSNQSNQFKIEVEPSLNGYRLTYCPF-----GTSRCHNLGGQIDPLTRAIH  214
               V+       ++N FKIE   SL GY+L YCP        + C ++G   D   R   
Sbjct  135  TDGVEGNSGCETEANWFKIEAIGSL-GYKLVYCPAVCDSSSEAICKDVGIYYDD-DRTRR  192

Query  213  LGLNDFPFVVVFKKASK  163
            L L+D PF+VVF K S+
Sbjct  193  LALSDQPFLVVFIKKSE  209



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 85/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDISGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRSNNKTCPVDVVQEQHSFKNGF  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 85/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDISGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRSNNKTCPVDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWVVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 85/195 (44%), Gaps = 18/195 (9%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ PV+D DGDELR G  YY+++A                       CP  V+  R
Sbjct  23   VANAANSPVLDIDGDELRTGVQYYVVSALWGAGGGGLALGRAT-----GQSCPEIVVQRR  77

Query  537  --MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF--  370
              + DGTP+ I   AD    VV  ST ++ +F    ++LC     W++    NS   +  
Sbjct  78   SDLDDGTPV-IFSNADSKDGVVRVSTDINIEFVPIRDRLCTTSTVWKLDNYDNSAGKWWV  136

Query  369  ----VKAGEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTR---AIHL  211
                VK     S  S+ FKIE    + GY+  +CP     C  L   I   +     I L
Sbjct  137  TTDGVKGDPGASTMSSWFKIEPAGGI-GYKFRFCPSVCDSCTKLCSDIGKHSDDDGQIRL  195

Query  210  GLNDFPFVVVFKKAS  166
             L+D  +  +FKKAS
Sbjct  196  ALSDSGWPWIFKKAS  210



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/196 (30%), Positives = 90/196 (46%), Gaps = 19/196 (10%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ PV+DTDG+ELR G  YY+++A                       CP D+++ R
Sbjct  23   VANATNKPVLDTDGEELRTGVEYYVVSALWAAGGGGLALGRSRN-----QSCP-DIVVQR  76

Query  537  MSD---GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVF  370
             S+   G P+  +P   PN   +  ST +  +F    + LC+    W++ +   S G+ +
Sbjct  77   RSELDYGIPVIFSPVK-PNDVFIRVSTDLIIEFVPLRDSLCLTTAVWKLDDYDQSTGKWW  135

Query  369  VKAGEFVSNQS-----NQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL--TRAIHL  211
            V AG    +       N FKIE +  + GY+ TYCP     C  L   I        I L
Sbjct  136  VIAGRVAGDAGPHTFPNWFKIE-KNGVFGYKFTYCPSVCDSCTTLCSDIGRYEDNGQIRL  194

Query  210  GLNDFPFVVVFKKASK  163
            GL+D  +  VF KA++
Sbjct  195  GLSDQGWPFVFTKATR  210



>ref|XP_007029361.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
 gb|EOY09863.1| Kunitz family trypsin and protease inhibitor protein, putative 
[Theobroma cacao]
Length=198

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/191 (32%), Positives = 87/191 (46%), Gaps = 32/191 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYII----TAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRM--  535
            PV+D  G+ELR G  YYI+         L +   G E           CP DV+  ++  
Sbjct  25   PVLDISGEELRTGTDYYILPVIRGGGGGLTLASTGNE----------TCPLDVVQEQLEV  74

Query  534  SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGE  355
            S+G P+T +P  +    VV  ST ++ KF   T  +CV    W++     + ++ V  G 
Sbjct  75   SNGLPLTFSP-VNITKGVVRVSTDLNIKFSAAT--ICVQSTVWKLDNDEATQKMVVTTGG  131

Query  354  FVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLN  202
               N      SN FKIE     + Y+L +CP    F    C +LG  ID   R   L L+
Sbjct  132  VEGNPGIETLSNWFKIERYE--DDYKLVFCPGVCDFCRPVCGDLGVFIDAGIR--RLALS  187

Query  201  DFPFVVVFKKA  169
            D P  V+FK+A
Sbjct  188  DVPLKVMFKRA  198



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 85/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRGNNKTCPLDVVQEQHSFKNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDIP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>gb|ADK62529.1| miraculin-like protein [Nicotiana benthamiana]
Length=205

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/188 (34%), Positives = 91/188 (48%), Gaps = 26/188 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR---MSDGT  523
            VVD  G +LR G  YYI+  P+   +   G  L L+     S CP D ++     +++G 
Sbjct  31   VVDIAGKKLRTGIDYYIL--PV---VRGRGGGLTLDSTGNES-CPLDAVVQEQKEINNGF  84

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T TP  +P   V+  ST ++ KF   +  +CV    W++ +    +G+ F+  G    
Sbjct  85   PLTFTPV-NPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGNEG  141

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N      SN FKIE       Y+L YCP    F    C ++G  I   TR   L L+D P
Sbjct  142  NPGRETISNWFKIE--KFERDYKLVYCPTVCNFCKVICKDIGIFIQDGTR--RLALSDVP  197

Query  192  FVVVFKKA  169
            F V+FKKA
Sbjct  198  FKVMFKKA  205



>ref|XP_004234331.1| PREDICTED: miraculin [Solanum lycopersicum]
 gb|AAC63057.1| Lemir [Solanum lycopersicum]
Length=205

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 88/188 (47%), Gaps = 26/188 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLI---SRMSDGT  523
            VVD DG  LR G  YYI+  P+   +   G  L ++ +     CP D ++   + +  G 
Sbjct  31   VVDIDGKILRTGVDYYIL--PV---VRGRGGGLTMDSI-GDKMCPLDAVVQEHNEIDQGL  84

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGE---  355
            P+T TP  DP   V+  ST ++  F    N +CV    W++ +    +G+ F+  G    
Sbjct  85   PLTFTP-VDPKKGVIRESTDLNIIFS--ANSICVQTTQWKLDDFDETTGQYFITLGGDQG  141

Query  354  --FVSNQSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
               V   SN FKIE       Y+L YCP    F    C ++G  I    R   L L+D P
Sbjct  142  NPGVETISNWFKIEKYD--RDYKLLYCPTVCDFCKVICRDIGIFIQDGVR--RLALSDVP  197

Query  192  FVVVFKKA  169
            F V+FKKA
Sbjct  198  FKVMFKKA  205



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 84/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRGNNKTCPLDVVQEQHSFKNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ K +  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDINIKLDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDIP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>gb|AAV41231.1| putative 21 kDa trypsin inhibitor [Theobroma cacao]
Length=221

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 59/197 (30%), Positives = 93/197 (47%), Gaps = 20/197 (10%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ P++DTDGDEL+ G  YY++++ I            ++       CP  V+  R
Sbjct  23   VANAANSPLLDTDGDELQTGVQYYVLSS-ISGAGGGGLALEGVQ----VQSCPEIVVQRR  77

Query  537  --MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVK  364
              + +GTP+ I   AD    VV  ST V+ +F    ++LC     W +    NS   +  
Sbjct  78   SELDNGTPV-IFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWL  136

Query  363  AGEFVSNQS------NQFKIEVEPSLNGYRLTYCPFG----TSRCHNLGGQIDPLTRAIH  214
            A + V  ++      + FKIE    L GY+  +CP      T+ C ++G   D   + I 
Sbjct  137  ATDGVKGETGPNTLCSWFKIEKSGVL-GYKFRFCPSACDSCTTLCSDIGRHSDDDGQ-IR  194

Query  213  LGLNDFPFVVVFKKASK  163
            L  +D  +  +FKKASK
Sbjct  195  LAFSDNGWAWMFKKASK  211



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 85/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGQ---GGGLTLAGRSNNKTCPLDVVQEQHSLRNGF  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L +CP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>ref|XP_011014541.1| PREDICTED: wound-responsive protein GWIN3-like [Populus euphratica]
Length=203

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 82/182 (45%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            VVD  GDE+R GG Y+I  A  D  +      +          C SDV+ S MSDG P+ 
Sbjct  31   VVDVFGDEVRTGGRYFIAAASNDFAVSATSRII----------CNSDVVFSPMSDGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F   + ++      W++   P +    V  G       N
Sbjct  81   FSPVVESNDSVINEDSHLTVDFFAASCRMAGVSTMWKIEFRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  139  RFKITKYEGGNNLYQLSYCPISEPICE---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>gb|AAL85644.1| trypsin inhibitor [Theobroma subincanum]
Length=154

 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 77/161 (48%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YY+++A     +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYVMSA-----IWGAGGGGLALGRATDQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFV-  349
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS G+ +V  G    
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKG  113

Query  348  ----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                +  SN FKIE E   N Y+  +CP     C  L   I
Sbjct  114  EPGPNTLSNWFKIE-EAGGNVYKFRFCPSVCDSCATLCSDI  153



>gb|ABK96508.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92490.1| Kunitz-type protease inhibitor KPI-C5.1 [Populus trichocarpa 
x Populus deltoides]
Length=202

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 85/182 (47%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R GG Y I  A  D  +    T  ++        C SDV +S MS+G P+ 
Sbjct  31   VIDAFGDEVRTGGRYIIAAASNDFAV----TSSRI-------ICNSDVFLSPMSNGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E + N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGAHNLYQLSYCPISEPICE---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>ref|XP_007029360.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
 gb|EOY09862.1| Kunitz family trypsin and protease inhibitor protein [Theobroma 
cacao]
Length=195

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 65/188 (35%), Positives = 88/188 (47%), Gaps = 25/188 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRM--SDGT  523
            PV+D  G +LR G  YYI+  P+       G  L L      S CP DV+  ++  SDG 
Sbjct  21   PVLDISGKKLRTGTDYYIL--PV---FRGRGGGLTLASTGNES-CPLDVVQEQLEVSDGL  74

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRV-FVKAGEFVS  346
            P+T +P  +    VV  ST  + KF   T  +CV    W++    +S R  FV  G    
Sbjct  75   PVTFSP-VNIKKGVVRVSTDQNIKFSAAT--ICVQPTLWKLDSFDDSTRQWFVTTGGVEG  131

Query  345  NQS-----NQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKIE     + Y+L +CP    F    C ++G  ID   R   L L+D P
Sbjct  132  NPGRETIDNWFKIEKYE--DDYKLVFCPTVCDFCKVMCRDVGVFIDGGVR--RLALSDVP  187

Query  192  FVVVFKKA  169
            F V+FK+A
Sbjct  188  FKVMFKRA  195



>ref|XP_009792285.1| PREDICTED: miraculin [Nicotiana sylvestris]
Length=210

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 89/189 (47%), Gaps = 26/189 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR---MSDGT  523
            VVD  G +LR G  YYI+  P+   +   G  L L+     S CP D ++     + +G 
Sbjct  31   VVDIAGKKLRTGIDYYIL--PV---VRGRGGGLTLDSTGNES-CPLDAVVQEQQEIKNGL  84

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T TP  +P   V+  ST ++ KF   +  +CV    W++ +    +G+ F+  G    
Sbjct  85   PLTFTPV-NPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGNEG  141

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N      SN FKIE       Y+L YCP    F    C ++G  I    R   L L+D P
Sbjct  142  NPGRETISNWFKIE--KFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIR--RLALSDVP  197

Query  192  FVVVFKKAS  166
            F V+FKKA 
Sbjct  198  FKVMFKKAQ  206



>gb|AAC49969.1| tumor-related protein [Nicotiana tabacum]
Length=210

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 89/189 (47%), Gaps = 26/189 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR---MSDGT  523
            VVD  G +LR G  YYI+  P+   +   G  L L+     S CP D ++     + +G 
Sbjct  31   VVDIAGKKLRTGIDYYIL--PV---VRGRGGGLTLDSTGNES-CPLDAVVQEQQEIKNGL  84

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T TP  +P   V+  ST ++ KF   +  +CV    W++ +    +G+ F+  G    
Sbjct  85   PLTFTPV-NPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDETTGKYFITIGGNEG  141

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N      SN FKIE       Y+L YCP    F    C ++G  I    R   L L+D P
Sbjct  142  NPGRETISNWFKIE--KFERDYKLVYCPTVCNFCKVICKDVGIFIQDGIR--RLALSDVP  197

Query  192  FVVVFKKAS  166
            F V+FKKA 
Sbjct  198  FKVMFKKAQ  206



>gb|ADW95387.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|AEK26934.1| Kunitz-type trypsin inhibitor A7 [Populus nigra]
Length=207

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 81/176 (46%), Gaps = 12/176 (7%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D +G+E+ P   Y+I  A  D       T L +        C SDV++S MS+G P+T
Sbjct  34   VIDVNGNEVTPDARYFIGAASDD-----NTTTLAVSATSQI-ICNSDVILSSMSNGLPVT  87

Query  513  I-TPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQS  337
              +P  + N  V+   ++++  F+  T ++      W+M   P      V  G    N  
Sbjct  88   FSSPVGESNDGVIREDSYLNVNFDAATCRMAGVSTMWKMELRPTMRGFVVTTGGV--NGL  145

Query  336  NQFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAI-HLGLNDFPFVVVFK  175
            N+FKI + E   N Y+L+YCP     C      + PL   +  L  +  PF VVF+
Sbjct  146  NRFKITKYEGGNNSYQLSYCPISDPMCECSCACV-PLGNVVDRLAPSTIPFPVVFE  200



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 85/188 (45%), Gaps = 24/188 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRSNNKTCPLDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDINIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L +CP         C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFYGDYKLVFCPSVCNIFRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKKA  169
            F VVFKKA
Sbjct  199  FKVVFKKA  206



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 87/188 (46%), Gaps = 21/188 (11%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPI  517
            PV+DT+G+E+RPG  YY+ T      ++ PG  +          CP  V+ + +  G P+
Sbjct  26   PVLDTNGEEIRPGVEYYMGT------IFRPGGGVTYGKGPGNEICPLAVVQAWLQRGDPV  79

Query  516  TITPAADPNASVVLPSTFVSFKF-ELPTNKLCVDRLYWEMHESPNSGRVF-----VKAGE  355
            T TP  +P   VV  ST ++ KF E P    C     W++H +    + F     V+   
Sbjct  80   TFTP-VNPEEGVVRVSTDLNIKFAEPPIINFCRGSNVWKVHFNEALKQHFVLTDGVEGNS  138

Query  354  FVSNQSNQFKIEVEPSLNGYRLTYCPF-----GTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
                 +N FKIE   S   Y+  +CP        + C ++G  +D  TR + LG    P+
Sbjct  139  GCETTANWFKIEA-VSDRDYKFVFCPTVCDSSSEAICKDVGIYMDDGTRRLALGGQ--PY  195

Query  189  VVVFKKAS  166
             VVF K +
Sbjct  196  AVVFIKKN  203



>gb|ACS92504.1| Kunitz-type protease inhibitor KPI-C2.1 [Populus trichocarpa 
x Populus deltoides]
Length=207

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/176 (30%), Positives = 81/176 (46%), Gaps = 12/176 (7%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D +G+E+ P   Y+I  A  D       T L +        C SDV++S MS+G P+T
Sbjct  34   VIDVNGNEVTPDARYFIGAASDD-----NTTTLAVSATSQI-ICNSDVILSSMSNGLPVT  87

Query  513  I-TPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQS  337
              +P  + N  V+   ++++  F+  T ++      W+M   P      V  G    N  
Sbjct  88   FSSPVGESNDGVIREDSYLNVNFDAATCRMAGVSTMWKMELRPTMRGFVVTTGGV--NGL  145

Query  336  NQFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAI-HLGLNDFPFVVVFK  175
            N+FKI + E   N Y+L+YCP     C      + PL   +  L  +  PF VVF+
Sbjct  146  NRFKITKYEGGNNSYQLSYCPISDPMCECSCACV-PLGNVVDRLAPSTIPFPVVFE  200



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/188 (31%), Positives = 85/188 (45%), Gaps = 26/188 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVL--ISRMSD  529
            V+DTDG+ELR G  YYI           PG       L  AS+   CP DV   IS  ++
Sbjct  25   VLDTDGNELRRGVEYYIY----------PGITDVAGGLTLASRNHSCPLDVTLAISPTNN  74

Query  528  GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFV  349
            G P+T  P ADP    +  ST ++  F   T  +C+    W++     + R +V  G   
Sbjct  75   GLPVTFLP-ADPEEDTINTSTDLNIVFSAFT--ICLQSTAWKLDFDNTTRRFYVTTGGVT  131

Query  348  SN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTR--AIHLGL-NDFP  193
             N       N FKI+     +GY L +CP   + C  + G +  +     + LG+ +D P
Sbjct  132  GNPGRETLDNWFKIQSASGRSGYNLVFCPSVCNICRPVCGSLGVVREDGRLRLGISSDAP  191

Query  192  FVVVFKKA  169
              V F++A
Sbjct  192  LPVEFRRA  199



>gb|AAF15901.1|AF208020_1 putative proteinase inhibitor [Nicotiana glutinosa]
Length=241

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 101/218 (46%), Gaps = 23/218 (11%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVV----DTDGDELRPGGAYYIITAPIDLYMWPPGTEL  595
            + ++ NPI LPT  D      +PV+    D +G+ L+ G  Y+I++A     +W  G   
Sbjct  26   SFTSTNPIVLPTTTDDDKGFPVPVLPEVLDINGEPLQIGEKYHIVSA-----IWGAGGGG  80

Query  594  KLEWLDWASKCPSDVLISRMS--DGTPITITPAAD--PNASVVLPSTFVSFKFELPTNKL  427
                    ++CP+DV+    +     P+   P A   P  +VV  +  ++  F +PT++L
Sbjct  81   VYLTYVRNTRCPNDVVQHGRTPKKACPLNSLPLAPGPPPFNVVRETNNINIMFSVPTSRL  140

Query  426  CVDRLYWEMHESPNSGR--VFVKAGEFVSNQSNQ-----FKIE-VEPSLNGYRLTYCP--  277
            CV+   W++ +   + R   FV  G  + N   +     FKIE V  +   Y+L YCP  
Sbjct  141  CVNETVWKVGDPDLTARGTRFVVTGGTLGNPRPETINSWFKIEKVTKTAPFYKLRYCPDN  200

Query  276  FGTSRCHNLGGQIDPLTRAIHLGLNDFPFVVVFKKASK  163
            F    CH        LT    L L + PF+V+F+K  K
Sbjct  201  FLCPECHPDVCLDVGLTHERRLALTNQPFMVLFRKFQK  238



>gb|AAL85648.1| trypsin inhibitor [Theobroma obovatum]
 gb|AAL85649.1| trypsin inhibitor [Theobroma obovatum]
Length=154

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 76/161 (47%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YY+++      +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYVVSV-----IWGAGGGGLALGRATDQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFV-  349
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS G+ +V  G    
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKG  113

Query  348  ----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                +  SN FKIE E   N Y+  +CP     C  L   I
Sbjct  114  EPGPNTLSNWFKIE-EAGGNVYKFRFCPSVCDSCATLCSDI  153



>ref|XP_011035401.1| PREDICTED: miraculin-like [Populus euphratica]
Length=215

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 91/192 (47%), Gaps = 35/192 (18%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPI------DLYMWPPGTELKLEWLDWASKCPSDVLIS--R  538
            V+DTDG++LR G  YYI+  P+       L M   G E           CP DV+     
Sbjct  33   VLDTDGEKLRAGTEYYIL--PVFRGRGGGLTMASTGDE----------ACPLDVVQDPLE  80

Query  537  MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKA  361
            +S G P+T TP  +P   V+  ST ++ KF    + +CV    W++ +S NS  + FV  
Sbjct  81   ISKGLPLTFTP-VNPKKGVIRVSTDLNIKFS--ASSICVQSTVWKIQKSVNSEIQWFVTT  137

Query  360  GEFVSN-----QSNQFKIEVEPSLNGYRLTYCPF---GTSRCHNLGGQI-DPLTRAIHLG  208
            G    N      +N FKI  E + + Y+L +CP      + C ++G  I D   R + L 
Sbjct  138  GGVEGNPGIETITNWFKI--EKAGDDYKLVFCPTVCDCGALCRDIGIYIHDNGVRTLSLS  195

Query  207  LNDFPFVVVFKK  172
                PF+V FKK
Sbjct  196  DALQPFLVNFKK  207



>gb|KHM99732.1| Miraculin [Glycine soja]
Length=207

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (46%), Gaps = 18/186 (10%)
 Frame = -1

Query  687  DTDGDELRPGGAYYIITA-PIDLYMWPP---GTELKLEWLDWASKCPSDVLISRMSDGTP  520
            DT G +LR    Y+II A P  +  +     G  L L+ +D    CP DV+I + ++G P
Sbjct  27   DTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSID--ESCPLDVIIEKANEGLP  84

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVSN  343
            +  +P  +    V+  ST ++  F     +       W + +   S G+ +V  G  V N
Sbjct  85   LRFSP-VNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDASIGQTYVTTGGVVGN  143

Query  342  QS-----NQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLT---RAIHLGLNDFPFV  187
                   N FKI+     + Y+L YCP     CH+L   I       R +HL L+D PF 
Sbjct  144  PGEHTILNWFKIQKYE--DAYKLVYCPRVCPSCHHLCKDIGMFVDANRRMHLALSDDPFK  201

Query  186  VVFKKA  169
            + FK+A
Sbjct  202  IKFKEA  207



>gb|ABK01288.1| miraculin-like protein [Coffea arabica]
Length=214

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 87/194 (45%), Gaps = 30/194 (15%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIIT----APIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD  529
            PV+D +G+E+RPG  YYI T         Y   PG E+          CP  V  + +  
Sbjct  26   PVLDINGEEIRPGVEYYIGTTFRPGGGVTYGKGPGNEI----------CPLAVAQAWLQR  75

Query  528  GTPITITPAADPNASVVLPSTFVSFKF-ELPTNKLCVDRLYWEMHESPNSGRVF-----V  367
            G P+T TP  +P   VV  ST ++ KF E P  ++C     W++H +    + F     V
Sbjct  76   GLPVTFTP-VNPEEGVVRVSTDLNIKFAEPPVGRICSGSNVWKVHFNDLFEKHFVLTDGV  134

Query  366  KAGEFVSNQSNQFKIEVEPSLNGYRLTYCPF-----GTSRCHNLG-GQIDPLTRAIHLGL  205
            +        +N FKIE      GY+L +CP        + C  +G    D  TR + LG 
Sbjct  135  EGNSGCGTTANWFKIEAVGD-RGYKLVFCPTVCDSSSEAICKYVGIYHDDDGTRRLALGG  193

Query  204  NDFPFVVVFKKASK  163
               PFVV F K ++
Sbjct  194  Q--PFVVFFSKKNE  205



>gb|AAL85652.1| trypsin inhibitor [Theobroma mammosum]
Length=154

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 75/161 (47%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YYI++A     +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYIVSA-----IWGAGGGGLDLGRATNQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF------VKA  361
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS   +      VK 
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKG  113

Query  360  GEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                +  SN FKIE E   N Y+  +CP     C  L   I
Sbjct  114  VPGPNTLSNWFKIE-EAGGNIYKFRFCPSVCDSCATLCSDI  153



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 84/188 (45%), Gaps = 24/188 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  74   PVLDIAGKQLRTGSKYYIL--PV---TKGRGGGLTLAGRSNNKTCPLDVVQEQHSFKNGL  128

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++       G+  +  G    
Sbjct  129  PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEG  185

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  186  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  241

Query  192  FVVVFKKA  169
            F +VFKK 
Sbjct  242  FKIVFKKV  249



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 92/195 (47%), Gaps = 34/195 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIIT------APIDLYMWPPGTELKLEWLDWASKCPSDVLISR-  538
            PVVD +G+E+RPG  YY+++           Y   PG E+          CP  V+ +R 
Sbjct  26   PVVDFNGEEIRPGVDYYVVSVFPGGRGSGVTYGKGPGNEI----------CPLAVVQARP  75

Query  537  -MSDGTPITITPAADPNASVVLPSTFVSFKF-ELPTNKLCVDRLYWEMHESPNSGRVF--  370
              + G P+T TP  +P  SVV  ST ++ KF E P    C     W++H +    + F  
Sbjct  76   DFNRGHPVTFTP-VNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFNEALKQHFVL  134

Query  369  ---VKAGEFVSNQSNQFKIEVEPSLNGYRLTYCPF-----GTSRCHNLGGQI-DPLTRAI  217
               V+       ++N FKIE+  ++ GY+  +CP        + C ++G    D  TR  
Sbjct  135  TDGVEGNSGCETEANWFKIELTGNV-GYKFVFCPAVCDSSSEAICKDVGIYYDDDGTR--  191

Query  216  HLGLNDFPFVVVFKK  172
             L L+D PFVV F K
Sbjct  192  RLALSDQPFVVFFIK  206



>gb|AAL85651.1| trypsin inhibitor [Theobroma mammosum]
Length=154

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 75/161 (47%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YYI++A     +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYIVSA-----IWGAGGGGLDLGRATNQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF------VKA  361
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS   +      VK 
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKG  113

Query  360  GEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                +  SN FKIE E   N Y+  +CP     C  L   I
Sbjct  114  VPGPNTLSNWFKIE-EAGGNIYKFRFCPSVCDSCTTLCSDI  153



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 91/198 (46%), Gaps = 22/198 (11%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ PV+DTDGDEL+ G  YY++++                       CP ++++ R
Sbjct  23   VANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRAT-----GQSCP-EIVVQR  76

Query  537  MSD---GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFV  367
             SD   GTP+ I   AD    VV  ST V+ +F    ++LC     W +    NS   + 
Sbjct  77   RSDLDNGTPV-IFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWW  135

Query  366  KAGEFVSNQ------SNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAI  217
               + V  +       + FKIE    L GY+  +CP      T+ C ++G   D   + I
Sbjct  136  VTTDGVKGEPGPNTLCSWFKIEKAGVL-GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQ-I  193

Query  216  HLGLNDFPFVVVFKKASK  163
             L L+D  +  +FKKASK
Sbjct  194  RLALSDNEWAWMFKKASK  211



>prf||1802409A albumin
Length=221

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/198 (30%), Positives = 91/198 (46%), Gaps = 22/198 (11%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ PV+DTDGDEL+ G  YY++++                       CP ++++ R
Sbjct  23   VANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGRAT-----GQSCP-EIVVQR  76

Query  537  MSD---GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFV  367
             SD   GTP+ I   AD    VV  ST V+ +F    ++LC     W +    NS   + 
Sbjct  77   RSDLDNGTPV-IFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWW  135

Query  366  KAGEFVSNQ------SNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAI  217
               + V  +       + FKIE    L GY+  +CP      T+ C ++G   D   + I
Sbjct  136  VTTDGVKGEPGPNTLCSWFKIEKAGVL-GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQ-I  193

Query  216  HLGLNDFPFVVVFKKASK  163
             L L+D  +  +FKKASK
Sbjct  194  RLALSDNEWAWMFKKASK  211



>ref|XP_006387700.1| hypothetical protein POPTR_0664s00220g [Populus trichocarpa]
 gb|ERP46614.1| hypothetical protein POPTR_0664s00220g [Populus trichocarpa]
Length=202

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 84/182 (46%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE---CSCVPLGQVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|ACS92518.1| Kunitz-type protease inhibitor KPI-C6.1 [Populus trichocarpa 
x Populus nigra]
Length=202

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (47%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  +L        C SDV+ S MSDG P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAV----TSSRL-------ICNSDVVFSPMSDGLPVM  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKCEGGNNLYQLSYCPISEPICE  164



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 84/187 (45%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRSNNKTCPLDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDTAFGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L +CP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
              VVFKK
Sbjct  199  LKVVFKK  205



>gb|ACS92499.1| Kunitz-type protease inhibitor KPI-C6.2 [Populus trichocarpa 
x Populus nigra]
 gb|AEK26935.1| Kunitz-type trypsin inhibitor A6 [Populus nigra]
Length=202

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 69/147 (47%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  +L        C SDV+ S MSDG P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAV----TSSRL-------ICNSDVVFSPMSDGLPVM  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|AAL85650.1| trypsin inhibitor [Theobroma mammosum]
Length=154

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 75/161 (47%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YY+++A     +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYVVSA-----IWGAGGGGLDLGRATNQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF------VKA  361
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS   +      VK 
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKG  113

Query  360  GEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                +  SN FKIE E   N Y+  +CP     C  L   I
Sbjct  114  VPGPNTLSNWFKIE-EAGGNIYKFRFCPSVCDSCTTLCSDI  153



>ref|XP_006353923.1| PREDICTED: cysteine protease inhibitor 1-like [Solanum tuberosum]
Length=222

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 88/191 (46%), Gaps = 34/191 (18%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + ++ NPI LPT +       +P V D DGD LR G   YII  P+     +Y++  G  
Sbjct  24   SFTSENPIVLPTTSHDDDNLVLPEVYDQDGDPLRIG-ERYIINNPLIGAGAVYLYNIGN-  81

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        +  GTP+     ++ +   VV   T V  KF + T
Sbjct  82   ---------LQCPNAVLQHMSIPQFLGKGTPVVFVRKSESDYGDVVRQMTAVYIKFFVKT  132

Query  435  NKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE----VEP--SLNGYRLTYCPF  274
             KLCVD+  W++ +        V  G  V N+++ FKI     V P  S N Y+L +CP 
Sbjct  133  TKLCVDQTVWKVDDEQ-----LVVTGGKVGNENDIFKIRKIDLVTPGSSKNVYKLLHCP-  186

Query  273  GTSRCHNLGGQ  241
               +C N+GG 
Sbjct  187  SHLQCKNIGGN  197



>ref|XP_006353926.1| PREDICTED: cysteine protease inhibitor 1-like [Solanum tuberosum]
Length=222

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 87/191 (46%), Gaps = 34/191 (18%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + ++ NPI LPT         +P V D DGD LR G   YII  P+     +Y++  G  
Sbjct  24   SFTSENPIVLPTTCHDDDNLVLPEVYDQDGDPLRIG-ERYIINNPLIGAGAVYLYNIGN-  81

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        +  GTP+     ++ +   VV   T V  KF + T
Sbjct  82   ---------LQCPNAVLQHMSIPQFLGKGTPVVFVRKSESDYGDVVRQMTAVYIKFFVKT  132

Query  435  NKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE----VEP--SLNGYRLTYCPF  274
             KLCVD+  W++ +        V  G  V N+++ FKI     V P  S N Y+L +CP 
Sbjct  133  TKLCVDQTVWKVDDEQ-----LVVTGGKVGNENDIFKIRKIDLVTPGSSKNVYKLLHCP-  186

Query  273  GTSRCHNLGGQ  241
               +C N+GG 
Sbjct  187  SHLQCKNIGGN  197



>gb|AAQ96377.1| miraculin-like protein [Solanum palustre]
Length=209

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 26/188 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLI---SRMSDGT  523
            VVD DG  LR G  YYI+  P+   +   G  L ++ +     CP D ++     +  G 
Sbjct  35   VVDIDGKILRTGVDYYIL--PV---VRGRGGGLTMDSIG-DKICPLDAVVQEHQEIDQGL  88

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T TP  +P   V+  ST ++  F    N +CV    W++ +    +G+ F+  G    
Sbjct  89   PLTFTP-VNPKKGVIRESTDLNIIFS--ANSICVQTTQWKLDDFDETTGQYFITLGGNQG  145

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N      SN FKI  E     Y+L YCP    F    C  +G  I    R   L L+D P
Sbjct  146  NPGRETISNWFKI--EKFDRDYKLLYCPTVCDFCKVICKEIGIFIQDGVR--RLALSDVP  201

Query  192  FVVVFKKA  169
            F V+FKKA
Sbjct  202  FKVMFKKA  209



>gb|ACV65034.1| alpha-amylase inhibitor [Oryza sativa Indica Group]
Length=179

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 84/187 (45%), Gaps = 29/187 (16%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD----  529
            PV DT+G EL   G+YY++ A        PG    L        CP  +L+++ +D    
Sbjct  5    PVYDTEGHELSADGSYYVLPA-------SPGHGGGLTMAPRVLPCP--LLVAQETDERRK  55

Query  528  GTPITITP---AADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAG  358
            G P+  TP   AA P    +  ST V  +F   T  +CV    W + + P +G   V  G
Sbjct  56   GFPVRFTPWGGAAAPEDRTIRVSTDVRIRFNAAT--ICVQSTEWHVGDEPLTGARRVVTG  113

Query  357  EFV----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
              +    S + N F+  VE    GY+L  C      C +LG   D   RA  LG +  P 
Sbjct  114  PLIGPSPSGRENAFR--VEKYGGGYKLVSC---RDSCQDLGVSRD-GARAW-LGASQPPH  166

Query  189  VVVFKKA  169
            VVVFKKA
Sbjct  167  VVVFKKA  173



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 83/187 (44%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDVAGKKLRAGSKYYIL--PVTKGQ---GGGLTLAGRSNNKTCPLDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST  + KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDFNIKFDAATS--CAQSTVWKLDNFDAALGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L +CP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
              VVFKK
Sbjct  199  LKVVFKK  205



>gb|ACO39958.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>ref|XP_009627067.1| PREDICTED: miraculin [Nicotiana tomentosiformis]
Length=205

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/188 (32%), Positives = 89/188 (47%), Gaps = 26/188 (14%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS---RMSDGT  523
            V+D  G +LR G  YYI+  P+   +   G  L L+     S CP D ++     + +G 
Sbjct  31   VIDIAGKKLRTGVDYYIL--PV---VRGRGGGLTLDSTGNES-CPLDAVVQEHHEIKNGL  84

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T TP  +P   V+  ST ++ KF   +  +CV    W++ +    +G+ F+  G    
Sbjct  85   PLTFTP-VNPKKGVIRESTDLNIKFSAAS--ICVQTTLWKLDDFDEATGKYFITIGGNEG  141

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N      SN FKI  +     Y+L YCP    F    C ++G  I   TR   L L+D P
Sbjct  142  NPGRETISNWFKI--DKFERDYKLVYCPTVCNFCKVICKDVGIFIQDGTR--RLALSDVP  197

Query  192  FVVVFKKA  169
            F V+FK A
Sbjct  198  FKVMFKNA  205



>ref|NP_001053363.1| Os04g0526600 [Oryza sativa Japonica Group]
 sp|P29421.2|IAAS_ORYSJ RecName: Full=Alpha-amylase/subtilisin inhibitor; AltName: Full=RASI; 
Flags: Precursor [Oryza sativa Japonica Group]
 pdb|2QN4|A Chain A, Structure And Function Study Of Rice Bifunctional Alpha- 
AmylaseSUBTILISIN INHIBITOR FROM ORYZA SATIVA
 pdb|2QN4|B Chain B, Structure And Function Study Of Rice Bifunctional Alpha- 
AmylaseSUBTILISIN INHIBITOR FROM ORYZA SATIVA
 dbj|BAB78730.1| bifunctional alpha-amylase/subtilisin inhibitor [Oryza sativa]
 gb|AAN86549.1| alpha-amylase/subtilisin inhibitor [Oryza sativa Japonica Group]
 gb|AAN86550.1| alpha-amylase/subtilisin inhibitor [Oryza sativa Japonica Group]
 emb|CAE05648.2| OSJNBa0038O10.14 [Oryza sativa Japonica Group]
 dbj|BAF15277.1| Os04g0526600 [Oryza sativa Japonica Group]
 emb|CAH67899.1| OSIGBa0115K01-H0319F09.5 [Oryza sativa Indica Group]
 dbj|BAG97809.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGI56255.1| alpha amylase inhibitor [Oryza sativa Indica Group]
 gb|AGW24882.1| alpha-amylase inhibitor [Oryza sativa Indica Group]
Length=200

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 84/187 (45%), Gaps = 29/187 (16%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD----  529
            PV DT+G EL   G+YY++ A        PG    L        CP  +L+++ +D    
Sbjct  26   PVYDTEGHELSADGSYYVLPA-------SPGHGGGLTMAPRVLPCP--LLVAQETDERRK  76

Query  528  GTPITITP---AADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAG  358
            G P+  TP   AA P    +  ST V  +F   T  +CV    W + + P +G   V  G
Sbjct  77   GFPVRFTPWGGAAAPEDRTIRVSTDVRIRFNAAT--ICVQSTEWHVGDEPLTGARRVVTG  134

Query  357  EFV----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
              +    S + N F+  VE    GY+L  C      C +LG   D   RA  LG +  P 
Sbjct  135  PLIGPSPSGRENAFR--VEKYGGGYKLVSC---RDSCQDLGVSRD-GARAW-LGASQPPH  187

Query  189  VVVFKKA  169
            VVVFKKA
Sbjct  188  VVVFKKA  194



>gb|ADL60120.1| alpha-amylase inhibitor [Oryza sativa Indica Group]
Length=179

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 84/187 (45%), Gaps = 29/187 (16%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD----  529
            PV DT+G EL   G+YY++ A        PG    L        CP  +L+++ +D    
Sbjct  5    PVHDTEGHELSADGSYYVLPA-------SPGHGGGLTMAPRVLPCP--LLVAQETDERRK  55

Query  528  GTPITITP---AADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAG  358
            G P+  TP   AA P    +  ST V  +F   T  +CV    W + + P +G   V  G
Sbjct  56   GFPVRFTPWGGAAAPEDRTIRVSTDVRIRFNAAT--ICVQSTEWHVGDEPLTGARRVVTG  113

Query  357  EFV----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
              +    S + N F+  VE    GY+L  C      C +LG   D   RA  LG +  P 
Sbjct  114  PLIGPSPSGRENAFR--VEKYGGGYKLVSC---RDSCQDLGVSRD-GARAW-LGASQPPH  166

Query  189  VVVFKKA  169
            VVVFKKA
Sbjct  167  VVVFKKA  173



>ref|XP_007036750.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21251.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 95/200 (48%), Gaps = 32/200 (16%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA   + PV+D+DGDELR G  YY+++A     +W  G             CP ++++ R
Sbjct  23   VARADESPVLDSDGDELRTGVEYYVVSA-----IWGAGGGGLALGRVTGQSCP-EIVVQR  76

Query  537  MS--DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVF-  370
             S  DG P+ I   AD    VV  ST V+ +F    ++LC+    W++ +  P++G+ + 
Sbjct  77   GSDDDGLPV-IFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWV  135

Query  369  ----VKAGEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRC---------HNLGGQIDPL  229
                VK     +  ++ FKIE   +L GY+  +CP     C         H   GQ+   
Sbjct  136  TTDGVKGDPGHNTLTSWFKIENAGAL-GYKFRFCPSVCDSCIHLCNDFGRHGHDGQV---  191

Query  228  TRAIHLGLNDFPFVVVFKKA  169
               + L  N +P+  +FKKA
Sbjct  192  --RLALSENGWPW--IFKKA  207



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 95/200 (48%), Gaps = 32/200 (16%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA   + PV+D+DGDELR G  YY+++A     +W  G             CP ++++ R
Sbjct  23   VARADESPVLDSDGDELRTGVEYYVVSA-----IWGAGGGGLALGRVTGQSCP-EIVVQR  76

Query  537  MS--DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVF-  370
             S  DG P+ I   AD    VV  ST V+ +F    ++LC+    W++ +  P++G+ + 
Sbjct  77   GSDDDGLPV-IFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWV  135

Query  369  ----VKAGEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRC---------HNLGGQIDPL  229
                VK     +  ++ FKIE   +L GY+  +CP     C         H   GQ+   
Sbjct  136  TTDGVKGDPGHNTLTSWFKIEDAGAL-GYKFRFCPSVCDSCIHLCNDFGRHGHDGQV---  191

Query  228  TRAIHLGLNDFPFVVVFKKA  169
               + L  N +P+  +FKKA
Sbjct  192  --RLALSENGWPW--IFKKA  207



>gb|ACO39920.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39925.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39936.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39939.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39962.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39982.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39985.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40005.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40046.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40047.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40069.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40072.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39915.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39932.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39960.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39968.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40024.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40040.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39954.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40035.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>ref|XP_008238584.1| PREDICTED: miraculin-like [Prunus mume]
Length=208

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/198 (32%), Positives = 95/198 (48%), Gaps = 27/198 (14%)
 Frame = -1

Query  726  AADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVL  547
            AAD A +   PV+D  G++L+ G  YYI+  P+   +   G  L L      + CP DV+
Sbjct  26   AADAAPS---PVLDITGNKLQTGVNYYIL--PV---IRGRGGGLTLASTSNKTSCPLDVV  77

Query  546  ISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGR  376
              +  +S+G  +  +P  +    VVL ST ++ KF   T  +CV    W++ +    +G+
Sbjct  78   QEQNEVSNGLSLKFSP-VNVTKGVVLVSTDLNIKFSATT--ICVQSTVWKLGKFDEQTGQ  134

Query  375  VFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTR  223
             FV +G    N      SN FKI  E   + Y+L +CP    F    C ++G       R
Sbjct  135  WFVTSGGVEGNPGRQTTSNWFKI--EKFGDDYKLVFCPTVCNFCKVICRDVGIFFQDGKR  192

Query  222  AIHLGLNDFPFVVVFKKA  169
               L L+D PF  +FKKA
Sbjct  193  --RLALSDVPFRAMFKKA  208



>gb|ACO39943.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39961.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>ref|XP_006371663.1| hypothetical protein POPTR_0019s14550g [Populus trichocarpa]
 gb|ERP49460.1| hypothetical protein POPTR_0019s14550g [Populus trichocarpa]
Length=207

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 80/176 (45%), Gaps = 12/176 (7%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D +G+E+ P   Y+I  A  D       T L +        C SDV +S MS+G P+T
Sbjct  34   VIDVNGNEVTPDARYFIGAASDD-----NTTTLAVSATSQI-ICNSDVTLSSMSNGLPVT  87

Query  513  I-TPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQS  337
              +P  + N  V+   ++++  F+  T ++      W+M   P      V  G    +  
Sbjct  88   FSSPVGESNDGVIREDSYLNVNFDAATCRMAGVSTMWKMELRPTMRGFVVTTGGV--DGL  145

Query  336  NQFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAI-HLGLNDFPFVVVFK  175
            N+FKI + E   N Y+L+YCP     C      + PL   +  L  +  PF VVF+
Sbjct  146  NRFKITKYEGGNNSYQLSYCPISDPMCECSCACV-PLGNVVDRLAPSTIPFPVVFE  200



>gb|ACS92509.1| Kunitz-type protease inhibitor KPI-D2.3 [Populus trichocarpa]
 gb|ACS92510.1| Kunitz-type protease inhibitor KPI-D2 [Populus trichocarpa x 
Populus deltoides]
Length=215

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 90/191 (47%), Gaps = 31/191 (16%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWAS----KCPSDVLIS--RMS  532
            V+DTDG++LR G  YYI+          P    +   L  AS     CP DV+     +S
Sbjct  33   VLDTDGEKLRAGTEYYIL----------PVFRGRGGGLTMASTRDETCPLDVVQDPLEIS  82

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T TP  +P   V+  ST ++ KF    + +CV    W++ +S NS  + FV  G 
Sbjct  83   KGLPLTFTP-VNPKKGVIRVSTDLNIKFS--ASSICVQSTVWKIQKSVNSEIQWFVTTGG  139

Query  354  FVSN-----QSNQFKIEVEPSLNGYRLTYCPF---GTSRCHNLGGQI-DPLTRAIHLGLN  202
               N      +N FKI  E + + Y+L +CP      + C ++G  I D   R + L   
Sbjct  140  VEGNPGIETITNWFKI--EKAGDDYKLVFCPTVCDCGALCRDVGIYIHDNGVRTLSLSDA  197

Query  201  DFPFVVVFKKA  169
              PF+V FKK 
Sbjct  198  LQPFLVNFKKV  208



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 81/187 (43%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+           G  L L        C  DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKG-----RGGGLTLAGRSNNKTCLLDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++       G+  +  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLLTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
            F VVFKK
Sbjct  199  FKVVFKK  205



>gb|AEK26933.1| Kunitz-type trypsin inhibitor B2 [Populus nigra]
Length=215

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/190 (33%), Positives = 90/190 (47%), Gaps = 31/190 (16%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWAS----KCPSDVLIS--RMS  532
            V+DTDG++LR G  YYI+          P    +   L  AS     CP DV+     +S
Sbjct  33   VLDTDGEKLRAGTEYYIL----------PVFRGRGGGLTMASTRDETCPLDVVQDPLEIS  82

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T TP  +P   V+  ST ++ KF    + +CV    W++ +S NS  + FV  G 
Sbjct  83   KGLPLTFTP-VNPKKGVIRVSTDLNIKFS--ASSICVQSTVWKIQKSVNSEIQWFVTTGG  139

Query  354  FVSN-----QSNQFKIEVEPSLNGYRLTYCPF---GTSRCHNLGGQI-DPLTRAIHLGLN  202
               N      +N FKI  E + + Y+L +CP      + C ++G  I D   R + L   
Sbjct  140  VEGNPGIETITNWFKI--EKADDDYKLVFCPTVCDCGALCRDVGIYIHDNGVRTLSLSDA  197

Query  201  DFPFVVVFKK  172
              PF+V FKK
Sbjct  198  LQPFLVNFKK  207



>gb|ADW95388.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=202

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 83/182 (46%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>ref|XP_002305032.2| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92483.1| Kunitz-type protease inhibitor KPI-D2.2 [Populus trichocarpa]
 gb|ADW95386.1| Kunitz-type trypsin inhibitor [Populus nigra]
 gb|EEE85543.2| trypsin protein inhibitor 3 [Populus trichocarpa]
Length=215

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/191 (32%), Positives = 90/191 (47%), Gaps = 31/191 (16%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWAS----KCPSDVLIS--RMS  532
            V+DTDG++LR G  YYI+          P    +   L  AS     CP DV+     +S
Sbjct  33   VLDTDGEKLRAGTEYYIL----------PVFRGRGGGLTMASTRDETCPLDVVQDPLEIS  82

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T TP  +P   V+  ST ++ KF    + +CV    W++ +S NS  + FV  G 
Sbjct  83   KGLPLTFTP-VNPKKGVIRVSTDLNIKFS--ASSICVQSTVWKIQKSVNSEIQWFVTTGG  139

Query  354  FVSN-----QSNQFKIEVEPSLNGYRLTYCPF---GTSRCHNLGGQI-DPLTRAIHLGLN  202
               N      +N FKI  E + + Y+L +CP      + C ++G  I D   R + L   
Sbjct  140  VEGNPGIETITNWFKI--EKAGDDYKLVFCPTVCDCGALCRDVGIYIHDNGVRTLSLSDA  197

Query  201  DFPFVVVFKKA  169
              PF+V FKK 
Sbjct  198  LQPFLVNFKKV  208



>ref|XP_002266302.2| PREDICTED: miraculin-like, partial [Vitis vinifera]
Length=162

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 18/143 (13%)
 Frame = -1

Query  564  CPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHES  391
            CP DV+  +  +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++   
Sbjct  27   CPLDVVQEQQEVSNGLPLTFTPV-NPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYD  83

Query  390  PNSGRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQI  238
             +SG+ FV  G    N       N FKIE     + Y+L +CP    F    C ++G  I
Sbjct  84   ESSGQRFVTTGGVEGNPGRETLDNWFKIE--KYEDDYKLVFCPTVCDFCKPVCGDIGIYI  141

Query  237  DPLTRAIHLGLNDFPFVVVFKKA  169
                R   L L+D PF V+FKKA
Sbjct  142  QNGYR--RLALSDVPFKVMFKKA  162



>ref|XP_007211211.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
 gb|EMJ12410.1| hypothetical protein PRUPE_ppa011496mg [Prunus persica]
Length=208

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 60/195 (31%), Positives = 94/195 (48%), Gaps = 23/195 (12%)
 Frame = -1

Query  726  AADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVL  547
            AAD A +   PV+D  G++L+ G  YYI+  P+   +   G  L L      + CP DV+
Sbjct  26   AADAAPS---PVLDITGNKLQTGVDYYIL--PV---IRGRGGGLTLASTSNKTSCPLDVV  77

Query  546  ISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGR  376
              +  +S+G P+  +P  +    VV  ST ++ KF   T  +CV    W++ +    +G+
Sbjct  78   QEQNEVSNGLPLKFSP-VNVTKGVVRVSTDLNIKFSATT--ICVQSTVWKLGKFDEQTGQ  134

Query  375  VFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTR--AI  217
             FV +G    N      SN FKI  E   + Y+L +CP   + C  + G +    +    
Sbjct  135  WFVTSGGVEGNPGRQTTSNWFKI--EKFGDDYKLVFCPTVCNFCKVICGDVGIFFQDGKR  192

Query  216  HLGLNDFPFVVVFKK  172
             L L+D PF  +FKK
Sbjct  193  RLALSDVPFRAMFKK  207



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 83/187 (44%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PVVD  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVVDIAGKQLRAGSKYYIL--PVTK---GRGGGLTLAGRSNNKTCPLDVVQEQHSFRNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++       G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAVLGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L +CP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFYGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
              VVFKK
Sbjct  199  LKVVFKK  205



>gb|AAL85645.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85646.1| trypsin inhibitor [Theobroma grandiflorum]
 gb|AAL85647.1| trypsin inhibitor [Theobroma grandiflorum]
Length=154

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 53/161 (33%), Positives = 75/161 (47%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YY+++A               +      KCP +++I R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYVLSALWGAGGGGLDLGRATD-----QKCP-EIVIQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFV-  349
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS G+ +V  G    
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTGGVKG  113

Query  348  ----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                +  SN FKIE E   N Y+  +CP     C  L   I
Sbjct  114  EPGPNTLSNWFKIE-EAGGNVYKFRFCPSVCDSCATLCSDI  153



>gb|ACO40051.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 66/147 (45%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +              +  C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTAT-----------SPICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>gb|AAQ84216.1| Kunitz trypsin inhibitor 3 [Populus trichocarpa x Populus deltoides]
Length=202

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 83/182 (46%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R GG Y I  A  D  +    T  ++        C SDV +S MS+G P+ 
Sbjct  31   VIDAFGDEVRTGGRYIIAAASNDFAV----TSSRI-------ICNSDVFLSPMSNGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFXITKYEGGNNLYQLSYCPISEPICE---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>ref|XP_002305033.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|EEE85544.1| trypsin protein inhibitor 3 [Populus trichocarpa]
 gb|ACS92484.1| Kunitz-type protease inhibitor KPI-D1.2 [Populus trichocarpa]
 gb|ADW95379.1| Kunitz-type trypsin inhibitor [Populus nigra]
Length=212

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 87/189 (46%), Gaps = 25/189 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGTEYIITSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDQLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  + FV  G    
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEG  137

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLND--F  196
            N      +N FKIE   +L GY+L +CP     C  L   I       R   L L+D   
Sbjct  138  NPGVHTLTNWFKIEKAGTL-GYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLS  196

Query  195  PFVVVFKKA  169
            PFVV+FKK 
Sbjct  197  PFVVLFKKV  205



>gb|ACS92511.1| Kunitz-type protease inhibitor KPI-C1.2 [Populus trichocarpa]
Length=202

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 83/182 (46%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|ACO40004.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>ref|XP_009401850.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=203

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/185 (32%), Positives = 85/185 (46%), Gaps = 19/185 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLI--SRMSDGTP  520
            V DTD   LRPG  YY++  P+ +     G  L     D    CP  V    S +SDG P
Sbjct  24   VRDTDRRSLRPGHEYYVL--PL-IRGHGGGLSLAARSND---TCPLAVAQESSEVSDGLP  77

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEF----  352
            +T +P  +P    V  ST ++  F   T  +CV    W + ++  +GR +V  G      
Sbjct  78   LTFSP-VNPKDKYVKMSTDLNVWFAAET--ICVQSTVWRLGDAEATGRRYVVTGGLKGDP  134

Query  351  -VSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH--LGLNDFPFVVV  181
             ++  SN FKIE     + Y+L +CP     C  + G +          LGL+D PF V+
Sbjct  135  GLATVSNWFKIE-RYGESDYKLVHCPSVCRFCKVVCGDVGVFVEGGKRWLGLSDEPFPVM  193

Query  180  FKKAS  166
            FK A+
Sbjct  194  FKNAA  198



>gb|ACS92492.1| Kunitz-type protease inhibitor KPI-C1 [Populus trichocarpa x 
Populus nigra]
 gb|ACS92493.1| Kunitz-type protease inhibitor KPI-C1.3 [Populus trichocarpa]
Length=202

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 83/182 (46%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|ACO39957.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>ref|XP_007041757.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOX97588.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/194 (29%), Positives = 79/194 (41%), Gaps = 17/194 (9%)
 Frame = -1

Query  714  AITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR-  538
            A   ++PV D +GDE+RPG  YY+++A     +W  G             CP DV   R 
Sbjct  21   ATDENVPVYDVNGDEVRPGVQYYVVSA-----IWGAGGGGLYLGQGRNKTCPYDVAQERS  75

Query  537  -MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVK  364
             +  G P+T +   D    V+  ST ++ KF  P    C     W++     S G  FV 
Sbjct  76   DLVRGIPVTFS-TVDTEGDVIHESTDLNIKFIRPQPTACSPSTVWKVDCYDESGGEWFVT  134

Query  363  AGEFVSNQ---SNQFKIEVEPSLNGYRLTYCPFGTSR-----CHNLGGQIDPLTRAIHLG  208
             G    +    S+ F+I   P    Y+L  CP          C  +G         I L 
Sbjct  135  TGGLEGDAQALSSLFRITAAPGGISYKLALCPSVCESCTKYLCSEIGRHSSGFDSLIRLV  194

Query  207  LNDFPFVVVFKKAS  166
            L+D  +  VF KAS
Sbjct  195  LSDNGWPFVFIKAS  208



>gb|ACO40070.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VMDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>ref|XP_011035402.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 86/188 (46%), Gaps = 25/188 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGAEYIISSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDLLRGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  + FV  G    
Sbjct  81   PVTFSPASSDD-DVIRVSTDLNIKFSI--EKACDHSSVWKIQKSSNSEVQWFVTTGGAEG  137

Query  345  NQS-----NQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLND--F  196
            N       N FKIE +  + GY+L +CP     C  L   I       R   L L+D   
Sbjct  138  NPGVDTLFNWFKIE-KAGILGYKLVFCPKDICHCGVLCRDIGIYFENNRGRILSLSDQLS  196

Query  195  PFVVVFKK  172
            PFVVVFKK
Sbjct  197  PFVVVFKK  204



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 83/187 (44%), Gaps = 24/187 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G +LR G  YYI+  P+       G  L L        CP DV+  + S  +G 
Sbjct  31   PVLDIAGKQLRAGSKYYIL--PVTKGR---GGGLTLAGRRNNKTCPLDVVQEQHSFKNGL  85

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+T +P  +P   VV  ST ++ KF+  T+  C     W++     + G+  V  G    
Sbjct  86   PVTFSP-VNPKKGVVRESTDLNIKFDAATS--CAQSTVWKLDNFDAAFGQWLVTTGGVEG  142

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
            N       N FKI  E     Y+L YCP    F    C ++G  I+   R   L L+D P
Sbjct  143  NPGPRTMRNWFKI--EKFFGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP  198

Query  192  FVVVFKK  172
            F VV  K
Sbjct  199  FKVVSSK  205



>gb|AEK26926.1| Kunitz-type trypsin inhibitor B1 [Populus nigra]
Length=212

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 60/189 (32%), Positives = 87/189 (46%), Gaps = 25/189 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGTEYIITSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDQLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  + FV  G    
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEG  137

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLND--F  196
            N      +N FKIE +  + GY+L +CP     C  L   I       R   L L+D   
Sbjct  138  NPGVHTLTNWFKIE-KAGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLS  196

Query  195  PFVVVFKKA  169
            PFVV+FKK 
Sbjct  197  PFVVLFKKV  205



>gb|ACS92512.1| Kunitz-type protease inhibitor KPI-C7 [Populus trichocarpa x 
Populus nigra]
Length=202

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 69/147 (47%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  G+E+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGNEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVM  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKCEGGNNLYQLSYCPISEPICE  164



>ref|XP_002326088.2| hypothetical protein POPTR_0019s14540g [Populus trichocarpa]
 gb|ACS92502.1| Kunitz-type protease inhibitor KPI-C1 [Populus trichocarpa x 
Populus deltoides]
 gb|EEF00470.2| hypothetical protein POPTR_0019s14540g [Populus trichocarpa]
Length=202

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 83/182 (46%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|ACO40066.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 65/147 (44%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV++S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVMLSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39917.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39950.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39966.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39972.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39974.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39975.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39980.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39988.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39998.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40018.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40044.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40048.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 66/147 (45%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +              +  C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTAT-----------SPICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>ref|XP_004235410.1| PREDICTED: cysteine protease inhibitor 10-like [Solanum lycopersicum]
Length=219

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 84/182 (46%), Gaps = 26/182 (14%)
 Frame = -1

Query  756  STRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
            S  NPI LPT+AD  I   +P V D D D +R G  Y I    I       G  + L+ +
Sbjct  28   SCENPIVLPTSADDNIV--LPEVYDQDDDPIRIGMTYIIKNPNIG------GGAVYLDNI  79

Query  579  DWASKCPSDVLI-----SRMSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDR  415
                KCP+ VL        M +GT +        +  VV   T V  KF + T  LCV+ 
Sbjct  80   GHL-KCPNAVLQHIPVPGLMGNGTAVMFVRDKSDDGEVVRVMTLVYIKFFVETTPLCVNE  138

Query  414  LYWEMHESPNSGRVFVKAGEFVSNQSNQFK-----IEVEPSLNGYRLTYCPFGTSRCHNL  250
              W++    N  ++ V  GE V N+++ FK     I++    N Y+L +CP    +C+ +
Sbjct  139  TVWKV----NDEQIVVTGGE-VGNENDIFKIMSTDIKIRDYKNVYKLLHCP-PYVKCNAI  192

Query  249  GG  244
            GG
Sbjct  193  GG  194



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 87/189 (46%), Gaps = 26/189 (14%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +    ++    G ++          CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGTEYIISS----IFWGAGGGDVSAT----NKTCPDDVIQYSLDLLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS--GRVFVKAGE--  355
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS   R+    GE  
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQRLVTTGGEEG  137

Query  354  --FVSNQSNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLND--  199
                   +N FKIE    + GY+L YCP         C ++G   +   R   L L+D  
Sbjct  138  NPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLSDKL  196

Query  198  FPFVVVFKK  172
             PF+V+FKK
Sbjct  197  SPFLVLFKK  205



>gb|ACO39918.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39973.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40036.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 66/147 (45%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +              +  C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTAT-----------SPICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|AAL85643.1| trypsin inhibitor [Theobroma angustifolium]
Length=154

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/161 (31%), Positives = 73/161 (45%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YY+++      +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYVVST-----IWGAGGGGLDLGRATNQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSN  343
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS   +    + V  
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKG  113

Query  342  Q------SNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
            +      SN FKIE E     Y+  +CP     C  L   I
Sbjct  114  EPGPNTLSNWFKIE-EAGGTLYKFRFCPSVCDSCATLCSDI  153



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 53/162 (33%), Positives = 72/162 (44%), Gaps = 25/162 (15%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDV--LISRMSD  529
            V+D DG+ELR G  YYI           PG       L  AS+   CP DV   IS  S+
Sbjct  33   VLDRDGNELRRGVEYYIY----------PGITDVAGGLTLASRNHSCPLDVTLAISPTSN  82

Query  528  GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFV  349
            G P+T  P ADP    +  ST ++  F   T  +CV    W++     +GR +V  G   
Sbjct  83   GLPLTFLP-ADPEEDTINTSTDLNIVFSAVT--ICVQSTVWKLDFDDAAGRFYVTTGGVA  139

Query  348  SN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
             N      +N FKIE +     Y+L +CP     C  + G +
Sbjct  140  GNPGRETLANWFKIENDRG--AYKLVFCPTVCDICKPVCGNL  179



>gb|ACO40052.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40054.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|AAV41232.1| putative 21 kDa trypsin inhibitor [Theobroma grandiflorum]
Length=206

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 82/169 (49%), Gaps = 17/169 (10%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR  538
            VA  ++ PV+DTDGD+L+ G  YY++++     +W  G             CP ++++ R
Sbjct  23   VANAANSPVLDTDGDDLQVGVQYYVVSS-----IWGAGGGGLDLGRAIGQSCP-EIVVQR  76

Query  537  MSD---GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVF  370
             SD   GTP+ I   AD    VV  ST ++ +F    ++LC     W++    NS G+ +
Sbjct  77   QSDLVLGTPV-IFSNADSKDGVVRVSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWW  135

Query  369  V-----KAGEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
            V     + G   S  +++FKIE    + GY+L  CP     C  L   I
Sbjct  136  VTTDGGEGGCGRSRLTSRFKIEKVGRI-GYKLRLCPSVCESCITLSSDI  183



>gb|ACO40038.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 68/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++    + W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSIMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACS92496.1| Kunitz-type protease inhibitor KPI-C2.2 [Populus trichocarpa 
x Populus deltoides]
Length=207

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/176 (29%), Positives = 80/176 (45%), Gaps = 12/176 (7%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D +G+E+     Y+I  A  D       T L +        C SDV++S MS+G P+T
Sbjct  34   VIDVNGNEVTADARYFIGAASDD-----NTTTLAVSATSRI-ICNSDVILSSMSNGLPVT  87

Query  513  I-TPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQS  337
              +P  + N  V+   ++++  F+  T ++      W+M   P      V  G    N  
Sbjct  88   FSSPVGESNDGVIREDSYLNVNFDAATCRMAGVSTMWKMELRPTMRGFVVTTGGV--NGL  145

Query  336  NQFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAI-HLGLNDFPFVVVFK  175
            N+FKI + E   N Y+L+YCP     C      + PL   +  L  +  PF VVF+
Sbjct  146  NRFKITKYEGGNNLYQLSYCPISDPMCECSCACV-PLGNVVDRLAPSTIPFPVVFE  200



>ref|XP_011035403.1| PREDICTED: 21 kDa seed protein-like [Populus euphratica]
Length=212

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 61/189 (32%), Positives = 86/189 (46%), Gaps = 25/189 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGAEYIISSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDLLRGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE---  355
            P+T +P A+    V+  ST ++ KF +   K C     W++ +S NS  + FV  G    
Sbjct  81   PVTFSP-ANYGDDVIRISTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEG  137

Query  354  --FVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLND--F  196
               V   +N FKIE +  + GY+L +CP     C  L   I       R   L L+D   
Sbjct  138  NPGVDTLTNWFKIE-KAGILGYKLVFCPKDICHCGVLCRDIGIYFENNRGRILSLSDQLS  196

Query  195  PFVVVFKKA  169
            PFVVVFKK 
Sbjct  197  PFVVVFKKV  205



>ref|XP_006387699.1| hypothetical protein POPTR_0664s00210g [Populus trichocarpa]
 gb|ERP46613.1| hypothetical protein POPTR_0664s00210g [Populus trichocarpa]
Length=204

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 81/180 (45%), Gaps = 12/180 (7%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D +G+E+     Y+I  A  D       T L +        C SDV++S MS+G P+T
Sbjct  34   VIDVNGNEVTADARYFIGAASDD-----NTTTLAVSATSQI-ICNSDVILSSMSNGLPVT  87

Query  513  I-TPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQS  337
              +P  + N  V+   ++++  F+  T ++      W+M   P      V  G    +  
Sbjct  88   FSSPVGESNDGVIREDSYLNVNFDAATCRMAGVSTMWKMELRPTMRGFVVTTGGV--DGL  145

Query  336  NQFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAI-HLGLNDFPFVVVFKKASK  163
            N+FKI + E   N Y+L+YCP     C      + PL   +  L  +  PF VVF+   +
Sbjct  146  NRFKITKYEGGNNSYQLSYCPISDPMCECSCACV-PLGNVVDRLAPSTIPFPVVFEPVCR  204



>ref|XP_006351546.1| PREDICTED: miraculin-like [Solanum tuberosum]
Length=205

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 85/186 (46%), Gaps = 22/186 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS---RMSDGT  523
            VVD DG  LR G  YYI+  P+   +   G  L ++ +     CP D ++     +  G 
Sbjct  31   VVDIDGKILRTGVDYYIL--PV---VRGRGGGLTMDSI-GDKICPLDAVVQEHHEIDQGL  84

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE-SPNSGRVFVKAGEFVS  346
            P+T TP  +P   V+  ST ++  F    N +CV    W++ +    +G+ F+  G    
Sbjct  85   PLTFTP-VNPKKGVIRESTDLNIIFS--ANSICVQTTQWKLDDFDETTGQYFITLGGTQG  141

Query  345  NQSNQFK---IEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFPFV  187
            N   +     I++E     Y+L YCP         C ++G  I    R   L L+D PF 
Sbjct  142  NPGRETVSNWIKIEKFDRDYKLLYCPTVCDICKVICKDIGIFIQDGVR--RLALSDAPFK  199

Query  186  VVFKKA  169
            V+FKKA
Sbjct  200  VMFKKA  205



>ref|XP_010683194.1| PREDICTED: miraculin-like [Beta vulgaris subsp. vulgaris]
Length=208

 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 91/193 (47%), Gaps = 22/193 (11%)
 Frame = -1

Query  708  TSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLI---SR  538
             ++I V+D +G  L+    YYI+  P+   +   G  L++   +    CP   +    S 
Sbjct  25   AANIAVLDINGRPLQARSNYYIL--PV---IRGRGGGLRMTPKNATQLCPLAYVAQEGSE  79

Query  537  MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAG  358
            +++G P+   P  +P    +  ST ++F F+  T  +CV    W +     +GR +V  G
Sbjct  80   LANGLPLKFYPV-NPKDKTISLSTDLNFVFDAAT--ICVQSTQWRLAFDEVTGRRYVGFG  136

Query  357  EFVSN-----QSNQFKIE-VEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLG  208
              + N      SN FKIE  E     Y++ +CP    F    C  +G  ++   R + LG
Sbjct  137  GEIGNPGGNTVSNWFKIEKAETGKYDYKIVFCPGVCNFCKVACGEIGVFVEKDGRRL-LG  195

Query  207  LNDFPFVVVFKKA  169
            +N+ P +V+FKKA
Sbjct  196  INNQPLLVMFKKA  208



>emb|CDO98560.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 81/188 (43%), Gaps = 20/188 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVL--ISRMSDGTP  520
            V   DG E+R    YYI   P +      G  L L  +   S CP  V+   + + DG P
Sbjct  34   VFGVDGKEVRTDLFYYI--RPANNRGKDRGGGLGLRSIGNDS-CPLVVIQETNELRDGLP  90

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVSN  343
            +T +PA  P  +VV  ST ++ +   P    C     W +  S  S GR FV  G  + N
Sbjct  91   LTFSPAVAPKDNVVRVSTDLNIQVAFPDT--CNQPTVWRVDVSDKSEGRKFVNLGGVIGN  148

Query  342  -----QSNQFKIE-VEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFP  193
                   N FKIE V    N Y+L YCP    +    C NLG       R   L L+  P
Sbjct  149  PGPETLGNWFKIEKVGDHGNKYKLVYCPTVCSYCKVNCKNLGIVYQNGLR--RLALSHRP  206

Query  192  FVVVFKKA  169
            F V+F +A
Sbjct  207  FKVIFTRA  214



>gb|ABX76298.1| sexual organ expressed protein [Nicotiana alata]
Length=242

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 97/218 (44%), Gaps = 26/218 (12%)
 Frame = -1

Query  756  STRNPIRLPTAADVAITSDIP----VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKL  589
            ++ NPI LPT  D      IP    V+D +G+ L  G  Y+II+A         G  + L
Sbjct  28   TSTNPIVLPTTTDDDKGFPIPRFSEVLDINGEPLHVGEEYHIISA----IRGAGGGGVYL  83

Query  588  EWLDWASKCPSDVLISRMSD--GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDR  415
             ++   +KCP+ VL        G P+          +VV  +T ++  F + T +LCV++
Sbjct  84   TYVG-NTKCPNGVLQHGTDTLPGMPVKFVTTHSRPFNVVRENTDINIMFSVATTRLCVNQ  142

Query  414  LYWEMHESPNSGR--VFVKAGEFVSNQ-----SNQFKIE-VEPSLNGYRLTYCP--FGTS  265
              W++ +   + R   FV  G  + N      +N FKIE V      Y+L YCP      
Sbjct  143  TVWKVGDPDLTARGTRFVVTGGTLGNPGPETINNWFKIEKVTKQAPFYKLRYCPDKLLCP  202

Query  264  RCHNLG----GQIDPLTRAIHLGLNDFPFVVVFKKASK  163
             CH +     G  D   R   L L + PF+V F+K  K
Sbjct  203  ECHPVDCLDVGVTDHFGRR-RLALTNQPFMVYFRKFQK  239



>gb|ACO39938.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO40007.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO40063.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 65/147 (44%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTSSPI-----------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +PA + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPAVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|AFL91231.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 59.7 bits (143),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 84/186 (45%), Gaps = 25/186 (13%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS--RMSDGTP  520
            V D DG+ +R G  YYI+  P+       G  + L      S CP DV+     + DG P
Sbjct  4    VRDIDGNLVRSGTEYYIL--PV---FRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLP  57

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPN----SGRVFVK--AG  358
            +T TP  DP   V+  ST ++  F    + +C+    W + E       SGR       G
Sbjct  58   LTFTPV-DPKKGVIRESTDLNIIFS--ASSICIQSNVWMLEEYEGQRIISGRGTAGNPGG  114

Query  357  EFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLNDFPFV  187
            E +SN    FKIE     NGY+L YCP     C  + G I  +     +  L ++D PF 
Sbjct  115  ETISNW---FKIE--KYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFK  169

Query  186  VVFKKA  169
            + F+KA
Sbjct  170  IKFRKA  175



>gb|ACO40008.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40025.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 60.1 bits (144),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>gb|ACO39937.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39941.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39956.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39963.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39995.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40006.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40012.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40017.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40027.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40030.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40031.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>gb|ACO39986.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVMFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSDLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39914.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39959.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40034.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|AIT42208.1| Kunitz-type inhibitor C [Solanum tuberosum]
Length=222

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 86/191 (45%), Gaps = 34/191 (18%)
 Frame = -1

Query  762  THSTRNPIRLPTAA-DVAITSDIPVVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + ++ NPI LPT   D      + V D DG  LR G   YII  P+     +Y++  G  
Sbjct  24   SFTSENPIVLPTTCHDDDNLVLLEVYDQDGHPLRIG-ERYIIMNPLLGAGAVYLYNIGN-  81

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        +  GTP+     ++ +   VV   T V  KF + T
Sbjct  82   ---------LQCPNAVLQHMSIPQFLGKGTPVVFVRKSESDYGDVVRVMTAVYIKFFVKT  132

Query  435  NKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE----VEP--SLNGYRLTYCPF  274
             KLCVD   W++++        V  G  V N+++ FKI+    V P  S N Y+L +CP 
Sbjct  133  TKLCVDETVWKVNDEQ-----LVVTGGRVGNENDIFKIKKTDLVTPGGSKNVYKLLHCPS  187

Query  273  GTSRCHNLGGQ  241
                C N+GG 
Sbjct  188  HLG-CKNIGGN  197



>gb|ACS92503.1| Kunitz-type protease inhibitor KPI-C4 [Populus trichocarpa]
Length=202

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 79/182 (43%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S MS G P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVFLSPMSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|AAL60243.1|AF459078_1 putative Kunitz-type tuber invertase inhibitor precursor, partial 
[Solanum tuberosum]
 gb|AIT42201.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 94/210 (45%), Gaps = 30/210 (14%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLE  586
            + S+ NPI LPT         +P V D DG+ LR G   YII  P+       G  + L+
Sbjct  22   SFSSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIG-ERYIIKNPL-----LGGGAVYLD  75

Query  585  WLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPTNKLC  424
             +    +CP+ VL        +  GTP+     ++ +   VV   T V  KF + T+KLC
Sbjct  76   NI-GNLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYGDVVRVMTGVYIKFFVKTSKLC  134

Query  423  VDRLYWEM-HESPNSGRVFVKAGEFVSNQSNQFKIE-----VEPSLNGYRLTYCPFGTSR  262
            VD   W++ HE        V  G  V N+++ FKI+     +    N Y+L +CP    +
Sbjct  135  VDETVWKVNHEQ------LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP-SHLQ  187

Query  261  CHNLGGQID---PLTRAIHLGLNDFPFVVV  181
            C N+G       P    +H   +  PFV +
Sbjct  188  CKNIGSNFKNGYPRLVTVHDDKDFIPFVFI  217



>gb|ACO39990.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39991.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39916.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40023.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40043.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|AAQ84217.1| Kunitz trypsin inhibitor 4 [Populus trichocarpa x Populus deltoides]
 gb|ACS92488.1| Kunitz-type protease inhibitor KPI-D10.2 [Populus trichocarpa 
x Populus deltoides]
Length=212

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 87/189 (46%), Gaps = 25/189 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVL--ISRMSDGT  523
            PV+D  G+EL+ G  Y I +    ++    G ++          CP DV+   S +  G 
Sbjct  29   PVLDIQGEELKAGTEYIIGS----IFFGAGGGDVSAT----NKTCPDDVIQYSSDLLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  + FV  G    
Sbjct  81   PVTFSPASSDD-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWFVTTGGEEG  137

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI-----DPLTRAIHLGLNDF  196
            N      +N FKIE +  + GY+L  CP G   C  L   I     +   R + L     
Sbjct  138  NPGIDTLTNWFKIE-KAGILGYKLVSCPEGICHCGVLCRDIGIYRENDGRRILSLSDKLS  196

Query  195  PFVVVFKKA  169
            PF+V+FKK 
Sbjct  197  PFLVLFKKV  205



>gb|ACO40041.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO40055.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40064.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 65/147 (44%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +              +  C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTAT-----------SPICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39926.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39946.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39967.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39976.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39989.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39996.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40050.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+VVFKK
Sbjct  194  DKLSPFLVVFKK  205



>ref|XP_010663911.1| PREDICTED: miraculin-like [Vitis vinifera]
Length=209

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 89/205 (43%), Gaps = 36/205 (18%)
 Frame = -1

Query  735  LPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---  565
             P AA+ A     PV+D +G +LR         + +D Y+ P         L  AS    
Sbjct  25   FPVAAEAAPD---PVLDIEGKKLR---------SEVDCYILPVIRRRGGGGLTLASTGKE  72

Query  564  -CPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHE  394
             CP DV+  +  +S+G P+   P  +P   V+  ST  + +F   T  +C+    W++  
Sbjct  73   TCPLDVVQEQHEVSNGLPLMFIPV-NPKKGVIRVSTDHNIEFSAAT--ICIQSTVWKLEY  129

Query  393  SPNSGRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI---  238
              +SG+ FV  G    N      SN FKIE     N   L +CP     C  + G I   
Sbjct  130  DESSGQQFVTTGGVEGNPGRGTLSNWFKIEKYEDDN--NLVFCPTVCDFCKPVCGDIVIY  187

Query  237  --DPLTRAIHLGLNDFPFVVVFKKA  169
              D   R   L L+D PF V+FKKA
Sbjct  188  IQDGYRR---LALSDVPFKVMFKKA  209



>gb|ACO39913.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39919.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39923.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39930.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39931.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39949.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39964.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39971.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39977.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39978.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39984.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39992.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39993.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39997.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40033.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40042.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40045.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40049.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40056.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40057.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40059.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40060.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40061.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40065.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40067.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40068.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ABK96484.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92491.1| Kunitz-type protease inhibitor KPI-C5.3 [Populus trichocarpa 
x Populus deltoides]
Length=202

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 80/182 (44%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S MS+G P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAVTSSPI-----------ICNSDVFLSPMSNGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|ACO39979.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 87/190 (46%), Gaps = 26/190 (14%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +    ++    G ++          CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGTEYIISS----IFWGAGGGDVSAT----NKTCPDDVIQYSLDLLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G    
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  345  NQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLND--  199
            N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+D  
Sbjct  138  NPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLSDKL  196

Query  198  FPFVVVFKKA  169
             PF+VVFKK 
Sbjct  197  SPFLVVFKKV  206



>ref|XP_009608866.1| PREDICTED: miraculin-like [Nicotiana tomentosiformis]
Length=209

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 91/207 (44%), Gaps = 24/207 (12%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
             S  NP  L +A      S  PV+DT+GD++R G  Y+++       +   G  L    +
Sbjct  16   FSLANPSELLSAG----PSPSPVLDTNGDKIRTGSNYFVLPV-----IRGRGGGLFPSNV  66

Query  579  DWASKCPSDVLISRM--SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYW  406
               + CP D++   +    G P+  TP  DP   V+  S+ ++ +F  PT  +C     W
Sbjct  67   KQNNTCPRDIIQESLDVQQGLPVVFTP-VDPKKGVIRLSSDLNVRFFTPT--ICARETIW  123

Query  405  EMHE-SPNSGRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGG  244
            ++ +      + FV  G    N      SN FKIE   +   Y+  +CP   S C  +  
Sbjct  124  KVGDFDEKLKQYFVVTGGVEGNPGPQTVSNWFKIEKLGT--DYKFVFCPSVCSFCKVICK  181

Query  243  QIDPLTR--AIHLGLNDFPFVVVFKKA  169
             +   T+     L L+D PF V+FKK 
Sbjct  182  DVGIFTKNGVRFLALSDTPFRVMFKKT  208



>gb|ACO40053.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 65/147 (44%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +              +  C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTAT-----------SPICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>emb|CAH59146.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+DT GDE+R G  Y I  A  D  +      +          C SDV+ S MS G P+ 
Sbjct  31   VIDTFGDEVRAGYRYIIGAASNDFAITATSPII----------CNSDVVFSPMSTGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYEGGNNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>gb|ACO39924.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39942.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39948.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39955.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39969.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39999.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40001.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40003.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40058.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40062.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40071.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 67/147 (46%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK  164



>emb|CBI35471.3| unnamed protein product [Vitis vinifera]
Length=2095

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 70/143 (49%), Gaps = 18/143 (13%)
 Frame = -1

Query  564   CPSDVLISR--MSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHES  391
             CP DV+  +  +S+G P+T TP  +P   V+  ST  + KF   T  +CV    W++   
Sbjct  1960  CPLDVVQEQQEVSNGLPLTFTPV-NPKKGVIRVSTDHNIKFSAST--ICVQSTLWKLEYD  2016

Query  390   PNSGRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQI  238
              +SG+ FV  G    N       N FKIE     + Y+L +CP    F    C ++G  I
Sbjct  2017  ESSGQRFVTTGGVEGNPGRETLDNWFKIE--KYEDDYKLVFCPTVCDFCKPVCGDIGIYI  2074

Query  237   DPLTRAIHLGLNDFPFVVVFKKA  169
                 R   L L+D PF V+FKKA
Sbjct  2075  QNGYR--RLALSDVPFKVMFKKA  2095



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/192 (31%), Positives = 86/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQS-----NQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N       N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFINWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFET-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+VVFKK
Sbjct  194  DKLSPFLVVFKK  205



>sp|Q00652.1|CPI9_SOLTU RecName: Full=Cysteine protease inhibitor 9; AltName: Full=PKIX; 
AltName: Full=pT1; Flags: Precursor [Solanum tuberosum]
 emb|CAA40197.1| put. trypsin inhibitor [Solanum tuberosum]
Length=222

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 86/192 (45%), Gaps = 36/192 (19%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + S+ NPI LP+         +P V D DG  LR G   YII  P+     +Y++  G  
Sbjct  24   SFSSENPIVLPSTCHDDDNLVLPEVYDQDGHPLRIG-QRYIINNPLIGAGAVYLYNIGN-  81

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        + +GTP+     ++ +   VV   T V  KF + T
Sbjct  82   ---------LQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTGVYIKFFVKT  132

Query  435  NKLCVDRLYWEM-HESPNSGRVFVKAGEFVSNQSNQFKIEV------EPSLNGYRLTYCP  277
             KLCVD+  W++ HE        V  G  V N+++ FKI        E S   Y+L +CP
Sbjct  133  TKLCVDQTVWKVNHEG------LVVTGGQVGNENDIFKIRKTDLVTPEGSKFVYKLLHCP  186

Query  276  FGTSRCHNLGGQ  241
                +C N+GG 
Sbjct  187  -SHLQCKNIGGN  197



>dbj|BAC23033.1| kunitz-type trypsin inhibitor [Solanum tuberosum]
Length=220

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 86/192 (45%), Gaps = 36/192 (19%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + S+ NPI LP+         +P V D DG  LR G   YII  P+     +Y++  G  
Sbjct  22   SFSSENPIVLPSTCHDDDNLVLPEVYDQDGHPLRIG-QRYIINNPLIGAGAVYLYNIGN-  79

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        + +GTP+     ++ +   VV   T V  KF + T
Sbjct  80   ---------LQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTGVYIKFFVKT  130

Query  435  NKLCVDRLYWEM-HESPNSGRVFVKAGEFVSNQSNQFKIEV------EPSLNGYRLTYCP  277
             KLCVD+  W++ HE        V  G  V N+++ FKI        E S   Y+L +CP
Sbjct  131  TKLCVDQTVWKVNHEG------LVVTGGQVGNENDIFKIRKTDLVTPEGSKFVYKLLHCP  184

Query  276  FGTSRCHNLGGQ  241
                +C N+GG 
Sbjct  185  -SHLQCKNIGGN  195



>gb|ABK96560.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92494.1| Kunitz-type protease inhibitor KPI-C4 [Populus trichocarpa x 
Populus deltoides]
Length=202

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/182 (29%), Positives = 79/182 (43%), Gaps = 21/182 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C +DV +S MS G P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNADVFLSPMSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICK---CSCVPLGKVVNRLAPSTVPFPVVFVPSDRA  194

Query  168  SK  163
            SK
Sbjct  195  SK  196



>gb|AFL91226.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 84/186 (45%), Gaps = 25/186 (13%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS--RMSDGTP  520
            V D DG+ LR G  YYI+  P+       G  + L      S CP DV+     + +G P
Sbjct  4    VRDIDGNLLRSGTEYYIL--PV---FRGRGGGVTLAPTRNES-CPLDVVQEGFELDNGLP  57

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPN----SGRVFVK--AG  358
            +T TP  DP   V+  ST ++  F    + +C+    W + E       SGR       G
Sbjct  58   LTFTPV-DPKKGVIRESTDLNIIFS--ASSICIQSNVWMLEEYEGQRIISGRGTSGNPGG  114

Query  357  EFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLNDFPFV  187
            E +SN    FKIE     NGY+L YCP     C  + G I  +     +  L ++D PF 
Sbjct  115  ETISNW---FKIE--KYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFK  169

Query  186  VVFKKA  169
            + F+KA
Sbjct  170  IKFRKA  175



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 89/202 (44%), Gaps = 27/202 (13%)
 Frame = -1

Query  717  VAITSDIPVVDTDGDELRPGGAYYIITA-PI------DLYMWPPGTELKLEWLDWASKCP  559
            VA  S   VVDT G +LR G +YYI+ A P+      +  M   G  L          CP
Sbjct  22   VADASPEQVVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLA----SIGESCP  77

Query  558  SDVLISRMSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEM-HESPNS  382
             DV++   S G P+  +P  DP   VV  ST ++  F             W++ H   + 
Sbjct  78   LDVVVVPRSHGLPLQFSP-VDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLDHFDVSK  136

Query  381  GRVFVKAGEFVSNQS-----NQFKIEVEPSLNGYRLTYCP--FGTSR----CHNLGGQID  235
            G+ FV  G  + N S     N FKI  E     Y++ YCP  F +S     C ++G  +D
Sbjct  137  GKWFVSTGGSMGNPSWETIRNWFKI--EKCDGAYKIVYCPSVFPSSSSKHMCKDIGVFVD  194

Query  234  PLTRAIHLGLNDFPFVVVFKKA  169
                   L L++ PF V F++A
Sbjct  195  E-NGFRRLALSNVPFKVKFQRA  215



>gb|AAL85640.1| trypsin inhibitor [Herrania albiflora]
 gb|AAL85641.1| trypsin inhibitor [Herrania sp. 'Columbia']
Length=154

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 72/160 (45%), Gaps = 15/160 (9%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR--MSDGTP  520
            V+DTDGDEL+ G  YY+++A     +W  G             CP  V+  R  + DGTP
Sbjct  1    VLDTDGDELQTGVEYYVVSA-----IWGAGGGGLALGRASDQSCPEIVVQRRSDLDDGTP  55

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF------VKAG  358
            + I   AD    VV  ST ++ +F    ++LC     W++ +  NS   +      VK  
Sbjct  56   V-IFSNADSEDDVVRVSTDLNIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKGE  114

Query  357  EFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                  ++ FKIE   +L GY+  +CP     C  L   I
Sbjct  115  PGARTLTSWFKIESAGAL-GYKFRFCPSVCDSCAPLCSDI  153



>emb|CAH59144.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+DT GDE+R G  Y I  A  D  +      +          C SDV+ S MS+G P+ 
Sbjct  31   VIDTFGDEVRAGYRYIIGAASNDFAITATSPII----------CNSDVVFSPMSNGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I +     N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYGDGTNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>gb|AAL85653.1| trypsin inhibitor [Theobroma simiarum]
Length=154

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 74/161 (46%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YY++++     +W  G            KCP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYVVSS-----IWGAGGGGLALGRATDQKCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSN  343
            P+ I   AD    VV  ST ++ +F    ++LC     W++ +  NS   +    + V  
Sbjct  55   PV-IFSNADSEDDVVRVSTDINIEFVPIRDRLCSTSTVWKLDDYDNSAGKWWVTTDGVKG  113

Query  342  Q------SNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
            +      ++ FKIE E     Y+  +CP     C  L   I
Sbjct  114  EPGPNALTSWFKIE-EAGGTVYKFRFCPSVCDSCATLCSDI  153



>ref|XP_010536414.1| PREDICTED: miraculin-like [Tarenaya hassleriana]
Length=212

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 88/206 (43%), Gaps = 29/206 (14%)
 Frame = -1

Query  735  LPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPI------DLYMWPPGTELKLEWLDW  574
            L  A  +A  +   V D DGD LRPG  YY++  P+       L +   G+EL       
Sbjct  12   LAVAFLIAHATGTAVRDVDGDLLRPGVGYYVL--PVLRGHGGGLTLAGRGSEL-------  62

Query  573  ASKCPSDVLI--SRMSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEM  400
               CP D++   S + DG P+  +         V  S  ++ K ++    +C+   YW +
Sbjct  63   ---CPLDIVQENSEVDDGIPVKFS-GWTSRVGFVPESEDLNIKTDVAAT-ICIQSTYWWI  117

Query  399  HE-SPNSGRVFVKAGEFV---SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDP  232
             E      + FV  G  +     +S +   ++  S N Y+  +CP     C  + G +  
Sbjct  118  DEFDKQRKQWFVTTGNALRRSGKESLRSFFKIVKSRNDYKFVFCPRDCEFCRPICGDVGI  177

Query  231  LTRA---IHLGLNDFPFVVVFKKASK  163
                     L L+D PFVV+FKKA+K
Sbjct  178  FVDENGIRRLALSDQPFVVMFKKATK  203



>gb|AIT42206.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=219

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 94/210 (45%), Gaps = 30/210 (14%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLE  586
            + S+ NPI LPT         +P V D DG+ LR G   YII  P+       G  + L+
Sbjct  22   SFSSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIG-ERYIIKNPL-----LGGGAVYLD  75

Query  585  WLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPTNKLC  424
             +    +CP+ VL        +  GTP+     ++ +   VV   T V  KF + T++LC
Sbjct  76   NI-GNLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYRDVVRVMTGVYIKFFVKTSRLC  134

Query  423  VDRLYWEM-HESPNSGRVFVKAGEFVSNQSNQFKIE-----VEPSLNGYRLTYCPFGTSR  262
            VD   W++ HE        V  G  V N+++ FKI+     V    N Y+L +CP    +
Sbjct  135  VDETVWKVNHEQ------LVVTGGNVGNENDIFKIKKTDLVVRGMKNVYKLLHCP-SHLQ  187

Query  261  CHNLGGQID---PLTRAIHLGLNDFPFVVV  181
            C N+G       P    +H   +  PFV +
Sbjct  188  CKNIGSNFKNGYPRLVTVHDDKDFIPFVFI  217



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>gb|AAL60248.1|AF459083_1 putative Kunitz-type tuber invertase inhibitor precursor [Solanum 
tuberosum]
Length=207

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/183 (32%), Positives = 85/183 (46%), Gaps = 27/183 (15%)
 Frame = -1

Query  756  STRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
            S+ NPI LPT         +P V D DG+ LR G   YII  P+       G  + L+ +
Sbjct  20   SSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIG-ERYIIKNPL-----LGGGAVYLDNI  73

Query  579  DWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPTNKLCVD  418
                +CP+ VL        +  GTP+     ++ +   VV   T V  KF + T+KLCVD
Sbjct  74   -GNLQCPNAVLQHMSIPQFLGKGTPVMFVRKSESDYGDVVRVMTGVYIKFFVKTSKLCVD  132

Query  417  RLYWEM-HESPNSGRVFVKAGEFVSNQSNQFKIE-----VEPSLNGYRLTYCPFGTSRCH  256
               W++ HE        V  G  V N+++ FKI+     +    N Y+L +CP    +C 
Sbjct  133  ETVWKVNHEQ------LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCP-SHLQCK  185

Query  255  NLG  247
            N+G
Sbjct  186  NIG  188



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDHSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>emb|CDP20533.1| unnamed protein product [Coffea canephora]
Length=214

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/188 (32%), Positives = 83/188 (44%), Gaps = 19/188 (10%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVL--ISRMSDGT  523
            PV D  G  LR    YYI+ A  +++    G  L L  +   + CP+ V    S   +G 
Sbjct  34   PVRDVAGKMLRTDRHYYILPAA-NVFDKFRGGGLTLSGIG-KNTCPAAVFQETSEQKNGI  91

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPN-SGRVFVKAGEFVS  346
            P+   P  +P   VV  ST ++ KF  P  + C     W +      SG  FV  G  V 
Sbjct  92   PLAFLPV-NPKKGVVRVSTDLNIKFAYP--ETCGQSPVWSIDNYVYPSGDSFVNIGGVVG  148

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSR----CHNLGGQIDPLTRAIHLGLNDFP  193
            N      S+ FKIE +     Y+L YCP   S     C ++G +     R +HL   D+P
Sbjct  149  NPGPKTLSSWFKIE-KFGYQDYKLVYCPAVCSYCKVICKDVGIEYQNGKRRLHL-TTDYP  206

Query  192  FVVVFKKA  169
              VVFKKA
Sbjct  207  LRVVFKKA  214



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFET-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>gb|AAL85642.1| trypsin inhibitor [Theobroma speciosum]
Length=153

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/161 (29%), Positives = 78/161 (48%), Gaps = 20/161 (12%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGD+LR G  YY++++     +W  G             CP ++++ R+SD   GT
Sbjct  1    VLDTDGDDLRTGVQYYVVSS-----IWGAGGGGLALGRATGQSCP-EIVVQRLSDRDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSN  343
            P+  + AA  +  VV  ST ++ +F    ++LC     W++    NS   +    + V  
Sbjct  55   PVIFSNAASKDG-VVRVSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVTTDGVKG  113

Query  342  Q------SNQFKIEVEPSLNGYRLTYCPF---GTSRCHNLG  247
            +      ++ FKIE E    GY+  +CP     T+ C ++G
Sbjct  114  EPGPDTLTSWFKIE-EAGGIGYKFRFCPVCDSCTTLCSDIG  153



>gb|AIT42212.1| Kunitz-type inhibitor C, partial [Solanum tuberosum]
Length=221

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 94/214 (44%), Gaps = 37/214 (17%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + S+ NPI LPT         +P V D +G  LR G   YII  P+     +Y++  G  
Sbjct  23   SFSSENPIVLPTTCHDDDNLVLPEVYDQNGHPLRIG-ERYIIKNPLVGAGAVYLYNIGN-  80

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        + +GTP+     ++ +   VV   T V  KF + T
Sbjct  81   ---------LQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTGVYIKFFVKT  131

Query  435  NKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE----VEPSLNG--YRLTYCPF  274
             KLCVD+  W++++        V  G  V N+++ FKI     V P  +   Y+L +CP 
Sbjct  132  TKLCVDQTVWKVNDEG-----LVVTGGKVGNENDIFKIRKTDLVTPGGSKFVYKLLHCPS  186

Query  273  GTSRCHNLGGQID---PLTRAIHLGLNDFPFVVV  181
                C N+GG      P    +H   +  PFV +
Sbjct  187  HLG-CKNIGGNFKNGYPRLVTVHDDXDFLPFVFI  219



>ref|NP_001274866.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 gb|AAL99260.1| Kunitz-type enzyme inhibitor P4E1 precursor [Solanum tuberosum]
 dbj|BAC23032.1| cathepsin D inhibitor [Solanum tuberosum]
 gb|AIT42154.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 96/214 (45%), Gaps = 30/214 (14%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKL-E  586
            T +++NPI LPT      T   PV+DT+G+EL P  +Y II+     +    G ++ L +
Sbjct  21   TFTSQNPIDLPTDT----TPCTPVLDTNGNELNPNSSYRIIST----FWGALGGDVYLGK  72

Query  585  WLDWASKCPSDVLISRMSD----GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVD  418
              +  + CP D +    SD    GTP+   P +  N   +     ++ +F +PT KLCV 
Sbjct  73   SPNSDAPCP-DGVFRYNSDVGPRGTPVRFIPLSGAN---ICEDQLLNIQFNIPTPKLCVS  128

Query  417  RLYWEMHESPNSGRVFV--KAGEFVSNQSNQFKIEVEPSLNGYRLTYCPF---------G  271
               W++       R  +    G      S+ FKI V+ S  GY L YCP           
Sbjct  129  YTIWKVGNLNALLRTMLLETGGTIGQADSSYFKI-VKSSKIGYNLLYCPLTPIICPLCPD  187

Query  270  TSRCHNLGGQIDPLTRAIHLGLNDFPFVVVFKKA  169
               C  +G  I    R + L +N+ P  V+F++ 
Sbjct  188  DLFCAKVGVVIQNGKRRLAL-VNENPLDVLFQEV  220



>gb|AGW24883.1| alpha-amylase inhibitor [Oryza sativa Indica Group]
Length=200

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 83/187 (44%), Gaps = 29/187 (16%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD----  529
            PV DT+G EL   G+YY++ A        PG    L        CP  +L+++ +D    
Sbjct  26   PVYDTEGHELSADGSYYVLPA-------SPGHGGGLTMAPRVLPCP--LLVAQETDERRK  76

Query  528  GTPITITP---AADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAG  358
            G P+  TP   AA P    +  ST V  +F   T  +CV    W + + P +G   V  G
Sbjct  77   GFPVRFTPWGGAAAPEDRTIRVSTDVRIRFNAAT--ICVQSTEWHVGDEPLTGARRVVTG  134

Query  357  EFV----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
              +    S + N F+  VE    GY+L  C        +LG   D   RA  LG +  P 
Sbjct  135  PLIGPSPSGRENAFR--VEKYGGGYKLVSC---RDSRQDLGVSRD-GARAW-LGASQPPH  187

Query  189  VVVFKKA  169
            VVVFKKA
Sbjct  188  VVVFKKA  194



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 87/190 (46%), Gaps = 26/190 (14%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +    ++    G ++          CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGTEYIISS----IFWGAGGGDVSAT----NKTCPDDVIQYSLDLLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G    
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  345  NQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLND--  199
            N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+D  
Sbjct  138  NPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLSDKL  196

Query  198  FPFVVVFKKA  169
             PF+V+FKK 
Sbjct  197  SPFLVLFKKV  206



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 87/189 (46%), Gaps = 26/189 (14%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +    ++    G ++          CP DV+   +    G 
Sbjct  29   PVLDIQGEELKAGTEYIISS----IFWGAGGGDVSAT----NKTCPDDVIQYSLDLLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G    
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGGEEG  137

Query  345  NQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLND--  199
            N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+D  
Sbjct  138  NPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLSDKL  196

Query  198  FPFVVVFKK  172
             PF+V+FKK
Sbjct  197  SPFLVLFKK  205



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 87/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V+FKK
Sbjct  194  DKLSPFLVLFKK  205



>gb|AAB23101.1| bifunctional subtilisin/alpha-amylase inhibitor, RASI [Oryza 
sativa=rice, seeds, bran, Peptide, 176 aa]
Length=176

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/187 (33%), Positives = 83/187 (44%), Gaps = 29/187 (16%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD----  529
            PV DT+G EL   G+YY++ A        PG    L  +      P  +L+++ +D    
Sbjct  4    PVYDTEGHELSADGSYYVLPA-------SPGHGGGLT-MAPRRVIPCPLLVAQETDERRK  55

Query  528  GTPITITP---AADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAG  358
            G P+  TP   AA P    V  ST V  +F   T  LCV    W + + P +G   V  G
Sbjct  56   GFPVRFTPWGGAASPRTLRV--STDVRIRFNAAT--LCVQSTEWHVGDEPLTGARRVVTG  111

Query  357  EFV----SNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
              +    S + N F+  VE    GY+L  C      C +LG   D    A  +G +  P 
Sbjct  112  PLIGPSPSGRENAFR--VEKYGGGYKLVSC---RDSCQDLGVSRDGAG-AAWIGASQPPH  165

Query  189  VVVFKKA  169
            VVVFKKA
Sbjct  166  VVVFKKA  172



>gb|ACO39922.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/147 (29%), Positives = 63/147 (43%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S MS G P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVFLSPMSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>sp|P20347.3|CPI1_SOLTU RecName: Full=Cysteine protease inhibitor 1; AltName: Full=P340; 
AltName: Full=P34021; AltName: Full=PCPI 8.3; Flags: Precursor 
[Solanum tuberosum]
Length=222

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 87/191 (46%), Gaps = 34/191 (18%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + ++ NPI LPT         +P V D DG+ LR G   YII  P+     +Y++  G  
Sbjct  24   SFTSENPIVLPTTCHDDDNLVLPEVYDQDGNPLRIG-ERYIINNPLLGAGAVYLYNIGN-  81

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        + +GTP+     ++ +   VV   T V  KF + T
Sbjct  82   ---------LQCPNAVLQHMSIPQFLGEGTPVVFVRKSESDYGDVVRVMTVVYIKFFVKT  132

Query  435  NKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE----VEP--SLNGYRLTYCPF  274
             KLCVD+  W++++        V  G  V N+++ FKI     V P  S   Y+L +CP 
Sbjct  133  TKLCVDQTVWKVNDEQ-----LVVTGGKVGNENDIFKIMKTDLVTPGGSKYVYKLLHCPS  187

Query  273  GTSRCHNLGGQ  241
                C N+GG 
Sbjct  188  HLG-CKNIGGN  197



>emb|CAH59147.1| kunitz trypsin inhibitor TI3 [Populus tremula]
 emb|CAH59153.1| kunitz trypsin inhibitor TI3 [Populus tremula]
 emb|CAH59160.1| kunitz trypsin inhibitor TI3 [Populus tremula]
 emb|CAH59161.1| kunitz trypsin inhibitor TI3 [Populus tremula]
 emb|CAH59165.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE++ G  Y I  A  D  +      +          C SDV+ S MS+G P+ 
Sbjct  31   VIDAFGDEVKAGDRYIIGAASNDFAITATSPII----------CNSDVVFSPMSNGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYEGGNNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>gb|ACO39944.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39994.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40028.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 63/146 (43%), Gaps = 14/146 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S MS G P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVFLSPMSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRC  259
            +FKI + E   N Y+L+YCP     C
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO39910.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39947.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39952.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39953.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39970.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39981.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39987.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40009.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40019.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40026.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40029.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 63/146 (43%), Gaps = 14/146 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S MS G P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVFLSPMSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIEMRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRC  259
            +FKI + E   N Y+L+YCP     C
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPIC  163



>gb|ACO40086.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40141.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40149.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40150.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
 gb|ACO40151.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 74/157 (47%), Gaps = 20/157 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  14   PVLDIQGEELKAGTEYIITSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDQLQGL  65

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K CV    W++ +S NS  + FV  G    
Sbjct  66   PVTFSPASSED-DVIRVSTDLNIKFSI--KKACVHSSVWKIQKSSNSEVQWFVTTGGEEG  122

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNL  250
            N      +N FKIE +  + GY+L +CP     C  L
Sbjct  123  NPGVHTLTNWFKIE-KAGILGYKLVFCPEDICHCGVL  158



>gb|ACO39927.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39940.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39945.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO39983.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40000.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
 gb|ACO40032.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/147 (30%), Positives = 66/147 (45%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +    T  ++        C SDV+ S MSDG P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAV----TSSRI-------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLFYCPISEPICK  164



>ref|XP_009406658.1| PREDICTED: miraculin-like [Musa acuminata subsp. malaccensis]
Length=200

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 88/197 (45%), Gaps = 22/197 (11%)
 Frame = -1

Query  729  TAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDV  550
            +A  +  ++D PV DTDG+ L+ G  YYI     D+     G  L LE  +    CP  V
Sbjct  16   SALALPASADEPVRDTDGNVLQRGVDYYIRPTVTDI-----GGGLTLEARN--GSCPLSV  68

Query  549  LISRM--SDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGR  376
             ++ +   +G P+  +P  D + +V L ST  +  F   T   C+    W++      GR
Sbjct  69   ALASLPADNGLPLQFSPEDDDDDTVEL-STDTNVIFSAFTT--CLQSTVWKLELDEGEGR  125

Query  375  VFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-  214
             +V  G    N      SN FKIE    +  Y+L +CP     C  + G +    +    
Sbjct  126  YYVVIGGVAGNPGKETLSNWFKIESYQGV--YKLVFCPTVCDYCRPVCGSLGVYEQGGRQ  183

Query  213  -LGL-NDFPFVVVFKKA  169
             LG+ +D PF   FK+A
Sbjct  184  WLGIRDDTPFPFEFKRA  200



>gb|ACO40133.1| kunitz trypsin inhibitor 4 [Populus balsamifera]
Length=181

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 74/157 (47%), Gaps = 20/157 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G+EL+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  14   PVLDIQGEELKAGTEYIITSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDQLQGL  65

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K CV    W++ +S NS  + FV  G    
Sbjct  66   PVTFSPASSDD-DVIRVSTDLNIKFSI--KKACVHSSVWKIQKSSNSEVQWFVTTGGEEG  122

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNL  250
            N      +N FKIE +  + GY+L +CP     C  L
Sbjct  123  NPGVHTLTNWFKIE-KAGILGYKLVFCPEDICHCGVL  158



>gb|ACO39928.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 63/146 (43%), Gaps = 14/146 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S MS G P+ 
Sbjct  31   VIDAFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVFLSPMSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRC  259
            +FKI + E   N Y+L+YCP     C
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPIC  163



>ref|XP_010101167.1| hypothetical protein L484_005403 [Morus notabilis]
 gb|EXB87528.1| hypothetical protein L484_005403 [Morus notabilis]
Length=197

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/187 (33%), Positives = 89/187 (48%), Gaps = 25/187 (13%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISR--MSDGTP  520
            V+D  G +L+ G  YYI+  P+   +   G  LKL      +  P DV+  +  +S G P
Sbjct  24   VLDLSGKKLQKGVDYYIL--PV---IRGRGGGLKLANARNKTS-PLDVVQDQFEVSSGFP  77

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVSN  343
            +T +PA + N S V  ST ++ KF   T   C     W++     S G+ FV +G    N
Sbjct  78   LTFSPA-NQNQSFVCLSTDLNIKFSAATT--CAQSTVWKLDSFDESLGQWFVTSGGVEGN  134

Query  342  -----QSNQFKIEVEPSLNGYRLTYCP----FGTSRCHNLGGQIDPLTRAIHLGLNDFPF  190
                  SN FKIE     + Y+L +CP    F    C ++G  I    R   L L+D PF
Sbjct  135  PGRQTISNWFKIEKYN--DDYKLVFCPTVCNFCKVLCRDVGIYIKDGIR--RLALSDQPF  190

Query  189  VVVFKKA  169
            +V FK+A
Sbjct  191  IVGFKRA  197



>gb|AIT42162.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=221

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 97/215 (45%), Gaps = 31/215 (14%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKL-E  586
            T +++NPI LP+ + V      PV+DT+G +L P  +Y II+     +    G ++ L +
Sbjct  21   TFTSQNPINLPSESPVPK----PVLDTNGKKLNPNSSYRIIST----FWGALGGDVYLGK  72

Query  585  WLDWASKCPSDVLISRMSD----GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVD  418
              +  + CP D +    SD    GTP+   P +  N   +     ++ +F +PT KLCV 
Sbjct  73   SPNSDAPCP-DGVFRYNSDVGPSGTPVRFIPLSGAN---IFEDQLLNIQFNIPTVKLCVS  128

Query  417  RLYWEMHESPNSGRVFV--KAGEFVSNQSNQFKIEVEPSLNGYRLTYCPF----------  274
               W++       R  +    G      S+ FKI V+ S  GY L YCP           
Sbjct  129  YTIWKVGNINAHLRTMLLETGGTIGQADSSYFKI-VKSSKFGYNLLYCPLTRHFLCPFCR  187

Query  273  GTSRCHNLGGQIDPLTRAIHLGLNDFPFVVVFKKA  169
              + C  +G  I    R + L +N+ P  V+F++ 
Sbjct  188  DDNFCAKVGVVIQNGKRRLAL-VNENPLDVLFQEV  221



>gb|AIT42159.1| Kunitz-type inhibitor A [Solanum tuberosum]
Length=220

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 98/215 (46%), Gaps = 32/215 (15%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKL-E  586
            T +++NPI LP+ + V +    PV+DT+G +L P  +Y II+     +    G ++ L +
Sbjct  21   TFTSQNPINLPSESPVPM----PVLDTNGKKLNPNSSYRIIST----FWGALGGDVYLGK  72

Query  585  WLDWASKCPSDVLISRMSD----GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVD  418
              +  + CP D +    SD    GTP+   P     ++ +     ++ +F +PT KLCV 
Sbjct  73   SPNSDAPCP-DGVFRYNSDVGPSGTPVRFIPL----STNIFEDQLLNIQFNIPTVKLCVS  127

Query  417  RLYWEMHESPNSGRVFV--KAGEFVSNQSNQFKIEVEPSLNGYRLTYCPFGT--------  268
               W++       R  +    G      S+ FKI V+ S  GY L YCP           
Sbjct  128  YTIWKVGNLNAHLRTMLLETGGTIGQADSSYFKI-VKSSKLGYNLLYCPISRHFLCPFCR  186

Query  267  --SRCHNLGGQIDPLTRAIHLGLNDFPFVVVFKKA  169
              + C  +G  I    R + L +N+ P  V+F++ 
Sbjct  187  DDNFCAKVGVVIQNGKRRLAL-VNEXPLDVLFQEV  220



>emb|CDP18338.1| unnamed protein product [Coffea canephora]
Length=215

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 91/197 (46%), Gaps = 35/197 (18%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITA------PIDLYMWPPGTELKLEWLDWASKCPSDVL--IS  541
            PV+D +G+E+RPG  Y+I++A          Y   PG ++          CP  V+  +S
Sbjct  26   PVLDINGEEIRPGVEYHIVSAIFGGGGGGVTYGKGPGNQI----------CPLAVVQALS  75

Query  540  RMSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF---  370
             ++ G P++ TP  +P   VV  ST ++ KF  P    C     W++H +    + F   
Sbjct  76   DLNRGHPVSFTP-VNPEEGVVRVSTDLNIKFS-PFINFCRGSNVWKVHFNEALEQHFVLT  133

Query  369  --VKAGEFVSNQSNQFKIEVEPSLNGYRLTYCPF-----GTSRCHNLGGQI-DPLTRAIH  214
              V+       ++N FKIE       Y+L +CP        + C ++G    D  TR   
Sbjct  134  DGVEGNSGCETEANWFKIEGNYPF--YKLVFCPAVCDSSSEAICKDVGIYYDDDGTR--R  189

Query  213  LGLNDFPFVVVFKKASK  163
            L L+D PFVV F K ++
Sbjct  190  LALSDRPFVVFFSKKNE  206



>gb|AAK32691.1|AF349443_1 Kunitz trypsin inhibitor TI3 [Populus tremuloides]
Length=203

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 83/182 (46%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE++ G  Y I  A  D  +      +          C SDV+ S MSDG P+ 
Sbjct  31   VIDAFGDEVKAGDRYVIGAASNDFAITATSPII----------CNSDVVFSPMSDGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++ E   + R FV     V+   N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKI-ELRLTARGFVVTTGGVAGL-N  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYEGGTNQYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTVPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 86/192 (45%), Gaps = 32/192 (17%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASK---CPSDVLISRMS--  532
            PV+D  G+EL+ G  Y I +       W  G        D A+    CP DV+   +   
Sbjct  29   PVLDIQGEELKAGTEYIISS-----IFWGAGGG------DVAATNKTCPDDVIQYSLDLL  77

Query  531  DGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGE  355
             G P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  +  V  G 
Sbjct  78   QGLPVTFSPASSED-DVIRVSTDLNIKFSI--KKACDRSSVWKIQKSSNSEVQWLVTTGG  134

Query  354  FVSNQ-----SNQFKIEVEPSLNGYRLTYCPF----GTSRCHNLGGQIDPLTRAIHLGLN  202
               N      +N FKIE    + GY+L YCP         C ++G   +   R   L L+
Sbjct  135  EEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFES-NRGRILSLS  193

Query  201  D--FPFVVVFKK  172
            D   PF+V FKK
Sbjct  194  DKLSPFLVFFKK  205



>ref|XP_009789071.1| PREDICTED: cysteine protease inhibitor 8-like [Nicotiana sylvestris]
Length=242

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 95/221 (43%), Gaps = 32/221 (14%)
 Frame = -1

Query  756  STRNPIRLPTAADVAITSDIP----VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKL  589
            ++ N I LPT  D      IP    V+D +G+ L  G  Y+II+A         G  + L
Sbjct  28   TSTNHIVLPTTTDDDKVFPIPGFSEVLDINGEPLHVGEEYHIISA----IRGAGGGGVYL  83

Query  588  EWLDWASKCPSDVLISRMSD--GTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDR  415
             ++   +KCP+ VL        G P+          +VV  +T ++  F + T++LCV+ 
Sbjct  84   TYVG-NTKCPNGVLQHGRDTRPGMPVKFVTTHSRPFNVVRENTDINIMFSVSTSRLCVNE  142

Query  414  LYWEMHES--PNSGRVFVKAGEFVSNQ-----SNQFKIE-VEPSLNGYRLTYCP--FGTS  265
              W++ +      G  FV  G  + N      +N FKIE V      Y+L YCP  F   
Sbjct  143  TVWKVGDPDLTTRGTRFVVTGGTLGNSRPETTNNWFKIEKVTKQAPFYKLRYCPDKFLCP  202

Query  264  RCHNLGGQIDPLTRAI-------HLGLNDFPFVVVFKKASK  163
             CH     +D L   +        L L   PF+V F+K  K
Sbjct  203  ECH----PVDCLDVGVTDHFGYRRLALTKQPFMVFFRKFQK  239



>ref|XP_011041831.1| PREDICTED: wound-responsive protein GWIN3-like [Populus euphratica]
Length=203

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 84/182 (46%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+  G  Y I  A  D  +      +          C SDV+ S MS+G P+ 
Sbjct  31   VIDVFGDEVSTGDRYIIRAASNDFEVTATSPII----------CNSDVVFSPMSNGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++ E   + R FV     V+   N
Sbjct  81   FSPVVESNDSVIHEDSYLNVNFDAATCRMAGVSTMWKI-ELRLTARGFVVTTGGVAGL-N  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +FKI + E   N Y+L+YCP     C        PL + ++ L  +  PF VVF    +A
Sbjct  139  RFKITKYEGGNNLYQLSYCPISEPICE---CSCVPLGQVVNRLAPSTVPFPVVFVPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>emb|CAH59175.1| kunitz trypsin inhibitor TI3 [Populus tremula]
 emb|CAH59179.1| kunitz trypsin inhibitor TI3 [Populus tremula]
 emb|CAH59187.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+DT GDE+R G  Y I  A  D  +      +          C SDV+ S MS G P+ 
Sbjct  31   VIDTFGDEVRAGYRYIIGAASNDFAITATSPII----------CNSDVVFSPMSTGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I +     N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYGDGTNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>gb|ABK96521.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ACS92517.1| Kunitz-type protease inhibitor KPI-D11 [Populus trichocarpa x 
Populus deltoides]
Length=212

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 87/189 (46%), Gaps = 25/189 (13%)
 Frame = -1

Query  696  PVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMS--DGT  523
            PV+D  G++L+ G  Y I +A     +W  G     +       CP DV+   +    G 
Sbjct  29   PVLDIQGEQLKAGTEYIISSA-----IWGAGGG---DVSATNKTCPDDVIQYSLDLLQGL  80

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSG-RVFVKAGEFVS  346
            P+T +PA+  +  V+  ST ++ KF +   K C     W++ +S NS  + FV  G    
Sbjct  81   PVTFSPASSED-DVIRVSTDLNIKFSI--KKDCDHSSVWKIQKSSNSEVQWFVTTGGEEG  137

Query  345  N-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLND--F  196
            N      +N FKIE +  + GY+L +CP     C  L   I       R   L L+D   
Sbjct  138  NPGVHTITNWFKIE-KAGILGYKLVFCPEDICHCGVLCRDIGIYFENNRGRILSLSDKLS  196

Query  195  PFVVVFKKA  169
            PF+V+FKK 
Sbjct  197  PFLVLFKKV  205



>gb|AFL91232.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=172

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 83/186 (45%), Gaps = 25/186 (13%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS--RMSDGTP  520
            V D DG+ +  G  YYI+  P+       G  + L      S CP DV+     + DG P
Sbjct  1    VRDIDGNLVXXGXEYYIL--PV---FRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLP  54

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPN----SGRVFVK--AG  358
            +T TP  DP   V+  ST ++  F    + +C+    W + E       SGR       G
Sbjct  55   LTFTPV-DPKKGVIRESTDLNIIFS--ASSICIQSNVWMLEEYEGQRIISGRGTAGNPGG  111

Query  357  EFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLNDFPFV  187
            E +SN    FKIE     NGY+L YCP     C  + G I  +     +  L ++D PF 
Sbjct  112  ETISNW---FKIE--KYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFK  166

Query  186  VVFKKA  169
            + F+KA
Sbjct  167  IKFRKA  172



>gb|AAL85661.1| trypsin inhibitor [Theobroma bicolor]
Length=154

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 71/161 (44%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDG+ELR G  YY+++A                       CP D+++ R SD   G 
Sbjct  1    VLDTDGEELRTGVEYYVVSALWGAGGGGLAPGRSRN-----QSCP-DIVVQRRSDLDYGI  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNS-GRVFVKAGEFVS  346
            P+  +P   PN   +  ST ++ +F    + LC+    W++ +   S G+ +V AG    
Sbjct  55   PVIFSPVK-PNDIFIRVSTDLNIEFTPLRDSLCLTTAVWKLDDYDQSTGKWWVIAGGVAG  113

Query  345  NQS-----NQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
            +       N FKIE    L GY+  YCP     C  L   I
Sbjct  114  DAGPHTLPNWFKIEKNGVL-GYKFIYCPSVCDSCTTLCSDI  153



>gb|ACO40010.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 63/147 (43%), Gaps = 14/147 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE+R G  Y I  A  D  +                 C SDV +S  S G P+ 
Sbjct  31   VIDVFGDEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVFLSPTSHGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   ++++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSYLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCH  256
            +FKI + E   N Y+L+YCP     C 
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPICE  164



>gb|ACO39929.1| kunitz trypsin inhibitor 3 [Populus balsamifera]
Length=180

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/146 (29%), Positives = 63/146 (43%), Gaps = 14/146 (10%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  G E+R G  Y I  A  D  +                 C SDV+ S MSDG P+ 
Sbjct  31   VIDAFGHEVRTGDRYIIGAASNDFAVTSSSI-----------ICNSDVVFSPMSDGLPVI  79

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +P  + N SV+   + ++  F+  T ++      W++   P +    V  G       N
Sbjct  80   FSPVVESNDSVIHEDSNLNVDFDAATCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  137

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRC  259
            +FKI + E   N Y+L+YCP     C
Sbjct  138  RFKITKYEGGNNLYQLSYCPISEPIC  163



>gb|AFL91227.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 83/186 (45%), Gaps = 25/186 (13%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS--RMSDGTP  520
            V D DG+ +  G  YYI+  P+       G  + L      S CP DV+     + DG P
Sbjct  4    VRDXDGNLVXSGTEYYIL--PV---FRGRGGGVTLAPTRNES-CPLDVVQEGFELDDGLP  57

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPN----SGRVFVK--AG  358
            +T TP  DP   V+  ST ++  F    + +C+    W + E       SGR       G
Sbjct  58   LTFTPV-DPKKGVIRESTDLNIIFS--ASSICIQSNVWMLEEYEGQRIISGRGTAGNPGG  114

Query  357  EFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLNDFPFV  187
            E +SN    FKIE     NGY+L YCP     C  + G I  +     +  L ++D PF 
Sbjct  115  ETISNW---FKIE--KYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFK  169

Query  186  VVFKKA  169
            + F+KA
Sbjct  170  IKFRKA  175



>emb|CAH59186.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+DT GDE+R G  Y I  A  D  +      +          C SDV+ S MS G P+ 
Sbjct  31   VIDTFGDEVRAGYRYIIGAASNDFAITATSPII----------CNSDVVFSPMSTGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I +     N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYGDGTNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>gb|AFL91233.1| Kunitz-like protease inhibitor, partial [Helianthus annuus]
Length=175

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 83/186 (45%), Gaps = 25/186 (13%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLIS--RMSDGTP  520
            V D DG+ +  G  YYI+  P+       G  + L      S CP DV+     + DG P
Sbjct  4    VRDIDGNLVXSGTEYYIL--PV---FRGXGGGVTLAPTRNES-CPLDVVQEGFELDDGLP  57

Query  519  ITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPN----SGRVFVK--AG  358
            +T TP  DP   V+  ST ++  F    + +C+    W + E       SGR       G
Sbjct  58   LTFTPV-DPKKGVIRESTDLNIIFS--ASSICIQSNVWMLEEYEGQRIISGRGTAGNPGG  114

Query  357  EFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQIDPL---TRAIHLGLNDFPFV  187
            E +SN    FKIE     NGY+L YCP     C  + G I  +     +  L ++D PF 
Sbjct  115  ETISNW---FKIE--KYENGYKLVYCPTVCDLCRPVCGDIGVVFAENGSRRLAISDVPFK  169

Query  186  VVFKKA  169
            + F+KA
Sbjct  170  IKFRKA  175



>gb|AAL85637.1| trypsin inhibitor [Herrania mariae]
 gb|AAL85638.1| trypsin inhibitor [Herrania mariae]
 gb|AAL85639.1| trypsin inhibitor [Herrania mariae]
Length=154

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 74/161 (46%), Gaps = 17/161 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSD---GT  523
            V+DTDGDELR G  YYI+++     +W  G             CP ++++ R SD   GT
Sbjct  1    VLDTDGDELRTGVQYYIVSS-----IWGAGGGGVALGRTSGQSCP-EIVVQRRSDLDNGT  54

Query  522  PITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVF------VKA  361
            P+ I   AD    VV  ST ++ +F    ++LC     W++    +S   +      V+ 
Sbjct  55   PV-IFSNADSEDGVVRVSTDLNIEFVPIRDRLCTTSTVWKLDNYDHSAGKWWVTTDGVRG  113

Query  360  GEFVSNQSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGGQI  238
                S  ++ FKIE   ++ G+ L +CP     C  L   I
Sbjct  114  DPGASTLTSWFKIEHAGAI-GHTLKFCPSVCDSCTTLCSDI  153



>emb|CAH59178.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE++ G  Y I  A  D  +      +          C SDV+ S MS+G P+ 
Sbjct  31   VIDAFGDEVKAGDRYIIGAASNDFAITATSPII----------CNSDVVFSPMSNGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNEDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYEGGNNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>emb|CAH59158.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE++ G  Y I  A  D  +      +          C SDV+ S MS G P+ 
Sbjct  31   VIDAFGDEVKAGDRYIIGAASNDFAITATSPII----------CNSDVVFSPMSTGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYEGGNNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>ref|XP_009777240.1| PREDICTED: miraculin-like [Nicotiana sylvestris]
Length=209

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 91/207 (44%), Gaps = 24/207 (12%)
 Frame = -1

Query  759  HSTRNPIRLPTAADVAITSDIPVVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWL  580
             S  NP  L +A      S  PV+DT+GD++R G  Y+++       +   G  L    +
Sbjct  16   FSLANPSELVSAG----PSPSPVLDTNGDKIRAGSNYFVLPV-----IRGRGGGLLPSNV  66

Query  579  DWASKCPSDVLI--SRMSDGTPITITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYW  406
               + CP D++   + + +G P+  TP  DP   V+  ST ++ +F  PT  +C     W
Sbjct  67   KQNNSCPRDIIQNSNEVQEGLPVVFTP-VDPKKGVIRLSTDLNVRFFTPT--ICARETIW  123

Query  405  EMHESPNS-GRVFVKAGEFVSN-----QSNQFKIEVEPSLNGYRLTYCPFGTSRCHNLGG  244
            ++        + F+  G    N      SN FKIE   +   Y+  +CP   + C  +  
Sbjct  124  KLGTYDEKLKQYFIVTGGVEGNPGPLTVSNWFKIEKLGT--DYKFVFCPSVCTFCKVICK  181

Query  243  QIDPLTR--AIHLGLNDFPFVVVFKKA  169
             +    +     L L+D PF V+FK+ 
Sbjct  182  DVGIYNKDGVRFLALSDTPFRVMFKRT  208



>gb|AAM10493.1| putative cysteine proteinase inhibitor precursor P7G8 [Solanum 
tuberosum]
Length=209

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 55/190 (29%), Positives = 85/190 (45%), Gaps = 35/190 (18%)
 Frame = -1

Query  762  THSTRNPIRLPTAADVAITSDIP-VVDTDGDELRPGGAYYIITAPI----DLYMWPPGTE  598
            + ++ NPI LPT     +   +P V D DG+ LR G   YII  P+     +Y++  G  
Sbjct  27   SFTSENPIVLPTTCHDNLV--LPEVYDQDGEPLRIG-ERYIIKNPLLGGGAVYLYNIGN-  82

Query  597  LKLEWLDWASKCPSDVLISR-----MSDGTPITITPAADPN-ASVVLPSTFVSFKFELPT  436
                      +CP+ VL        +  GTP+     ++ +   VV   T V  KF   T
Sbjct  83   ---------LQCPNAVLQHMSIPQFLGKGTPVVFVRKSESDYGDVVRVMTGVYIKFFFKT  133

Query  435  NKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSNQFKIE-----VEPSLNGYRLTYCPFG  271
            +KLCVD   W++++        V  G  V N+++ FKI+     +    N Y+L +C   
Sbjct  134  SKLCVDETVWKVNDEE-----LVVTGGNVGNENDIFKIKKTDLVIRGMKNVYKLLHCRSH  188

Query  270  TSRCHNLGGQ  241
               C N+GG 
Sbjct  189  LG-CKNIGGN  197



>emb|CAH59184.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/182 (27%), Positives = 79/182 (43%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE++ G  Y I  A  D  +      +          C SDV+ S MS+G P+ 
Sbjct  31   VIDAFGDEVKAGDRYIIGAASNDFAITATSPTI----------CNSDVVFSPMSNGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIESRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I +     N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYGDGTNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



>emb|CAH59150.1| kunitz trypsin inhibitor TI3 [Populus tremula]
Length=203

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 50/182 (27%), Positives = 80/182 (44%), Gaps = 20/182 (11%)
 Frame = -1

Query  693  VVDTDGDELRPGGAYYIITAPIDLYMWPPGTELKLEWLDWASKCPSDVLISRMSDGTPIT  514
            V+D  GDE++ G  Y I  A  D  +      +          C SDV+ S MS+G P+ 
Sbjct  31   VIDAFGDEVKAGDRYIIGAASNDFAITATSPII----------CNSDVVFSPMSNGLPVI  80

Query  513  ITPAADPNASVVLPSTFVSFKFELPTNKLCVDRLYWEMHESPNSGRVFVKAGEFVSNQSN  334
             +   + N SV+   ++++  F+ P+ ++      W++   P +    V  G       N
Sbjct  81   FSKVVESNDSVINEDSYLNVDFDAPSCRMAGVSTMWKIELRPTARGFVVTTGGVAG--LN  138

Query  333  QFKI-EVEPSLNGYRLTYCPFGTSRCHNLGGQIDPLTRAIH-LGLNDFPFVVVF---KKA  169
            +F I + E   N Y+L+YCP     C        PL   ++ L  +  PF VVF    +A
Sbjct  139  RFTITKYEGGNNLYQLSYCPISEPICE---CSCVPLGNVVNRLAPSTIPFPVVFIPSDRA  195

Query  168  SK  163
            SK
Sbjct  196  SK  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1346324970506