BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21806_g1_i2 len=1052 path=[3093:0-185 898:186-237 2782:238-272
692:273-383 1096:384-420 457:421-592 629:593-616 653:617-635
672:636-684 121:685-755 192:756-1051]

Length=1052
                                                                      Score     E

ref|XP_006364434.1|  PREDICTED: putative methyltransferase DDB_G0...    398   2e-135   
ref|XP_011078957.1|  PREDICTED: putative methyltransferase DDB_G0...    395   7e-134   
ref|XP_009601898.1|  PREDICTED: putative methyltransferase DDB_G0...    394   2e-133   
gb|EYU20791.1|  hypothetical protein MIMGU_mgv1a012010mg                393   2e-133   
emb|CDP09510.1|  unnamed protein product                                391   1e-132   
ref|XP_004237334.1|  PREDICTED: putative methyltransferase DDB_G0...    390   6e-132   
ref|XP_009774440.1|  PREDICTED: putative methyltransferase DDB_G0...    387   6e-131   
ref|XP_011078956.1|  PREDICTED: putative methyltransferase DDB_G0...    384   5e-129   
ref|XP_002308901.1|  embryo-abundant family protein                     371   1e-124   Populus trichocarpa [western balsam poplar]
ref|XP_003632729.1|  PREDICTED: putative methyltransferase DDB_G0...    370   4e-124   
gb|EPS63915.1|  hypothetical protein M569_10867                         369   5e-124   
ref|XP_006492999.1|  PREDICTED: putative methyltransferase DDB_G0...    368   2e-123   
ref|XP_006442083.1|  hypothetical protein CICLE_v10021720mg             366   9e-123   
gb|ABK96242.1|  unknown                                                 364   5e-122   Populus trichocarpa x Populus deltoides
ref|XP_011027285.1|  PREDICTED: putative methyltransferase DDB_G0...    361   8e-121   
ref|XP_011000457.1|  PREDICTED: putative methyltransferase DDB_G0...    357   4e-119   
ref|XP_006491589.1|  PREDICTED: putative methyltransferase DDB_G0...    357   4e-119   
ref|XP_003632731.1|  PREDICTED: putative methyltransferase DDB_G0...    356   7e-119   
ref|XP_006442084.1|  hypothetical protein CICLE_v10024496mg             355   2e-118   
ref|XP_006442088.1|  hypothetical protein CICLE_v10021728mg             354   6e-118   
ref|XP_002531495.1|  S-adenosylmethionine-dependent methyltransfe...    354   7e-118   Ricinus communis
ref|XP_006491582.1|  PREDICTED: putative methyltransferase DDB_G0...    353   1e-117   
gb|KHG22088.1|  Putative methyltransferase                              352   4e-117   
ref|XP_006442090.1|  hypothetical protein CICLE_v10021734mg             351   1e-116   
ref|XP_009339574.1|  PREDICTED: putative methyltransferase DDB_G0...    348   1e-115   
ref|XP_009339575.1|  PREDICTED: putative methyltransferase DDB_G0...    348   1e-115   
ref|XP_010036343.1|  PREDICTED: putative methyltransferase DDB_G0...    347   2e-115   
emb|CBI30090.3|  unnamed protein product                                356   4e-115   
ref|XP_004293308.1|  PREDICTED: putative methyltransferase DDB_G0...    347   5e-115   
ref|XP_006421281.1|  hypothetical protein CICLE_v10005653mg             346   7e-115   
gb|KHN30375.1|  Putative methyltransferase                              346   8e-115   
gb|AFY98896.1|  S-adenosylmethionine-dependent methyltransferase        345   2e-114   
emb|CDP14219.1|  unnamed protein product                                343   6e-114   
ref|XP_007028540.1|  S-adenosyl-L-methionine-dependent methyltran...    343   6e-114   
ref|XP_007202465.1|  hypothetical protein PRUPE_ppa010137mg             343   8e-114   
ref|XP_008240724.1|  PREDICTED: putative methyltransferase DDB_G0...    342   3e-113   
ref|XP_008392394.1|  PREDICTED: putative methyltransferase DDB_G0...    339   4e-112   
ref|XP_010246243.1|  PREDICTED: putative methyltransferase DDB_G0...    337   4e-111   
emb|CDP09511.1|  unnamed protein product                                346   5e-111   
ref|XP_003632730.1|  PREDICTED: putative methyltransferase DDB_G0...    335   1e-110   
emb|CDP09514.1|  unnamed protein product                                335   2e-110   
ref|XP_004293307.1|  PREDICTED: putative methyltransferase DDB_G0...    334   4e-110   
ref|XP_010938137.1|  PREDICTED: putative methyltransferase DDB_G0...    333   7e-110   
ref|XP_007162109.1|  hypothetical protein PHAVU_001G124800g             333   8e-110   
ref|XP_010672977.1|  PREDICTED: putative methyltransferase DDB_G0...    333   9e-110   
ref|XP_006442086.1|  hypothetical protein CICLE_v10023900mg             332   3e-109   
ref|XP_010090906.1|  Putative methyltransferase                         331   7e-109   
emb|CDP14218.1|  unnamed protein product                                331   7e-109   
ref|XP_010543932.1|  PREDICTED: putative methyltransferase DDB_G0...    330   2e-108   
ref|XP_010090907.1|  Putative methyltransferase                         330   2e-108   
ref|XP_006421279.1|  hypothetical protein CICLE_v10006581mg             328   5e-108   
ref|XP_003625028.1|  Methyltransferase, putative                        327   2e-107   
ref|XP_006373713.1|  hypothetical protein POPTR_0016s03860g             325   5e-107   
gb|AFK45765.1|  unknown                                                 325   2e-106   
ref|XP_004169396.1|  PREDICTED: LOW QUALITY PROTEIN: putative met...    325   2e-106   
gb|KGN54522.1|  hypothetical protein Csa_4G354130                       324   2e-106   
ref|XP_004493415.1|  PREDICTED: putative methyltransferase DDB_G0...    323   7e-106   
ref|XP_003521139.1|  PREDICTED: LOW QUALITY PROTEIN: putative met...    324   8e-106   
ref|XP_007162108.1|  hypothetical protein PHAVU_001G124700g             322   1e-105   
ref|XP_009770993.1|  PREDICTED: putative methyltransferase DDB_G0...    320   3e-105   
gb|ACU19965.1|  unknown                                                 322   3e-105   Glycine max [soybeans]
ref|XP_006421282.1|  hypothetical protein CICLE_v10006978mg             321   3e-105   
gb|KEH23634.1|  S-adenosylmethionine-dependent methyltransferase        320   9e-105   
ref|XP_004493416.1|  PREDICTED: putative methyltransferase DDB_G0...    320   1e-104   
ref|XP_008455687.1|  PREDICTED: putative methyltransferase DDB_G0...    318   4e-104   
ref|XP_010036344.1|  PREDICTED: putative methyltransferase DDB_G0...    319   5e-104   
ref|XP_002455523.1|  hypothetical protein SORBIDRAFT_03g012620          318   5e-104   Sorghum bicolor [broomcorn]
ref|XP_010090908.1|  Putative methyltransferase                         318   5e-104   
ref|XP_004967532.1|  PREDICTED: putative methyltransferase DDB_G0...    318   6e-104   
ref|XP_009380624.1|  PREDICTED: putative methyltransferase DDB_G0...    318   8e-104   
gb|KCW47881.1|  hypothetical protein EUGRSUZ_K01627                     318   1e-103   
ref|XP_010672978.1|  PREDICTED: putative methyltransferase DDB_G0...    317   4e-103   
ref|XP_006387172.1|  hypothetical protein POPTR_1614s00200g             313   2e-102   
gb|EMT32692.1|  hypothetical protein F775_26316                         313   5e-102   
gb|KFK36988.1|  hypothetical protein AALP_AA4G197900                    312   2e-101   
dbj|BAJ98314.1|  predicted protein                                      311   5e-101   
gb|ACN25247.1|  unknown                                                 310   1e-100   Zea mays [maize]
emb|CDY14767.1|  BnaC04g47640D                                          310   1e-100   
gb|EAY89485.1|  hypothetical protein OsI_11014                          310   2e-100   Oryza sativa Indica Group [Indian rice]
ref|XP_007162114.1|  hypothetical protein PHAVU_001G125000g             310   2e-100   
ref|XP_003567596.1|  PREDICTED: putative methyltransferase DDB_G0...    308   8e-100   
ref|XP_009141988.1|  PREDICTED: putative methyltransferase DDB_G0...    307   1e-99    
ref|XP_006294798.1|  hypothetical protein CARUB_v10023848mg             306   2e-99    
ref|XP_006830346.1|  hypothetical protein AMTR_s00116p00046640          306   3e-99    
ref|NP_001151125.1|  embryonic abundant protein-like                    306   3e-99    Zea mays [maize]
ref|NP_181669.1|  S-adenosyl-L-methionine-dependent methyltransfe...    306   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142649.1|  PREDICTED: putative methyltransferase DDB_G0...    305   5e-99    
gb|AFK38407.1|  unknown                                                 305   7e-99    
emb|CDY06927.1|  BnaA04g23880D                                          305   8e-99    
ref|XP_002879928.1|  hypothetical protein ARALYDRAFT_903452             305   1e-98    
ref|XP_006411404.1|  hypothetical protein EUTSA_v10017081mg             303   4e-98    
ref|XP_010508723.1|  PREDICTED: putative methyltransferase DDB_G0...    303   6e-98    
gb|AFW90528.1|  embryo-abundant protein EMB                             303   7e-98    
ref|XP_010517625.1|  PREDICTED: putative methyltransferase DDB_G0...    302   2e-97    
ref|XP_010508722.1|  PREDICTED: putative methyltransferase DDB_G0...    301   5e-97    
gb|ACF74282.1|  embryo-abundant protein EMB                             298   1e-96    Arachis hypogaea [goober]
ref|XP_003625029.1|  Methyltransferase, putative                        300   1e-95    
ref|XP_010517624.1|  PREDICTED: putative methyltransferase DDB_G0...    294   3e-94    
gb|KEH23633.1|  S-adenosylmethionine-dependent methyltransferase        283   3e-90    
ref|XP_006421283.1|  hypothetical protein CICLE_v10005866mg             279   2e-89    
gb|KDO49184.1|  hypothetical protein CISIN_1g035840mg                   279   2e-89    
gb|AAM19356.1|AF369889_1  embryo-abundant protein EMB                   278   2e-88    Pisum sativum [garden pea]
gb|ADQ74922.1|  S-adenosylmethionine-dependent methyltransferase        266   4e-84    
ref|XP_006491618.1|  PREDICTED: putative methyltransferase DDB_G0...    266   4e-84    
ref|XP_009630235.1|  PREDICTED: putative methyltransferase DDB_G0...    267   8e-84    
gb|ABK22848.1|  unknown                                                 264   8e-83    Picea sitchensis
gb|KDO49181.1|  hypothetical protein CISIN_1g0379611mg                  262   1e-82    
ref|XP_008793339.1|  PREDICTED: putative methyltransferase DDB_G0...    261   2e-82    
gb|ABK25859.1|  unknown                                                 255   3e-79    Picea sitchensis
gb|ACE97886.1|  S-adenosylmethionine-dependent methyltransferase        243   1e-75    Populus tremula [European aspen]
gb|AAB01567.1|  embryo-abundant protein                                 246   1e-75    Picea glauca
gb|ACE97878.1|  S-adenosylmethionine-dependent methyltransferase        242   2e-75    Populus tremula [European aspen]
gb|ACE97895.1|  S-adenosylmethionine-dependent methyltransferase        241   5e-75    Populus tremula [European aspen]
gb|ACE97877.1|  S-adenosylmethionine-dependent methyltransferase        241   6e-75    Populus tremula [European aspen]
gb|ACE97880.1|  S-adenosylmethionine-dependent methyltransferase        241   6e-75    Populus tremula [European aspen]
emb|CDY71071.1|  BnaAnng35990D                                          234   4e-72    
gb|AFK34705.1|  unknown                                                 230   1e-70    
ref|XP_002967028.1|  hypothetical protein SELMODRAFT_86924              233   1e-70    
ref|XP_009353781.1|  PREDICTED: putative methyltransferase DDB_G0...    229   3e-69    
ref|XP_008347924.1|  PREDICTED: putative methyltransferase DDB_G0...    221   3e-66    
ref|XP_009355317.1|  PREDICTED: putative methyltransferase DDB_G0...    220   8e-66    
ref|XP_008361673.1|  PREDICTED: putative methyltransferase DDB_G0...    218   4e-65    
ref|XP_010674434.1|  PREDICTED: putative methyltransferase DDB_G0...    218   4e-65    
ref|XP_008218716.1|  PREDICTED: putative methyltransferase DDB_G0...    218   9e-65    
ref|XP_007226011.1|  hypothetical protein PRUPE_ppa010114mg             216   4e-64    
ref|XP_001755836.1|  predicted protein                                  215   6e-64    
ref|XP_010025773.1|  PREDICTED: putative methyltransferase DDB_G0...    214   2e-63    
ref|XP_002310527.1|  embryo-abundant family protein                     214   2e-63    Populus trichocarpa [western balsam poplar]
ref|XP_006645806.1|  PREDICTED: putative methyltransferase DDB_G0...    212   2e-63    
ref|XP_011022909.1|  PREDICTED: putative methyltransferase DDB_G0...    213   4e-63    
ref|XP_002960983.1|  hypothetical protein SELMODRAFT_74069              211   2e-62    
ref|XP_009357638.1|  PREDICTED: putative methyltransferase DDB_G0...    211   4e-62    
ref|XP_008392237.1|  PREDICTED: putative methyltransferase DDB_G0...    211   4e-62    
ref|XP_008378902.1|  PREDICTED: putative methyltransferase DDB_G0...    209   1e-61    
ref|XP_007048464.1|  S-adenosyl-L-methionine-dependent methyltran...    209   1e-61    
ref|XP_009355319.1|  PREDICTED: putative methyltransferase DDB_G0...    209   2e-61    
gb|EEE59267.1|  hypothetical protein OsJ_11290                          207   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007213119.1|  hypothetical protein PRUPE_ppa023887mg             208   4e-61    
gb|ABN07992.1|  embryo-abundant protein EMB, putative                   205   4e-61    Medicago truncatula
ref|XP_006380385.1|  hypothetical protein POPTR_0007s04400g             207   6e-61    
ref|XP_009344894.1|  PREDICTED: putative methyltransferase DDB_G0...    206   3e-60    
ref|XP_010027445.1|  PREDICTED: putative methyltransferase DDB_G0...    205   4e-60    
gb|ABK25958.1|  unknown                                                 205   5e-60    Picea sitchensis
ref|XP_006366473.1|  PREDICTED: putative methyltransferase DDB_G0...    205   5e-60    
ref|XP_011022910.1|  PREDICTED: putative methyltransferase DDB_G0...    204   2e-59    
ref|XP_008343524.1|  PREDICTED: putative methyltransferase DDB_G0...    203   2e-59    
ref|XP_009335928.1|  PREDICTED: putative methyltransferase DDB_G0...    202   6e-59    
ref|XP_002522831.1|  S-adenosylmethionine-dependent methyltransfe...    202   6e-59    Ricinus communis
gb|KDP31464.1|  hypothetical protein JCGZ_15344                         202   9e-59    
ref|XP_002306269.2|  hypothetical protein POPTR_0005s06850g             201   3e-58    Populus trichocarpa [western balsam poplar]
ref|XP_010526986.1|  PREDICTED: putative methyltransferase DDB_G0...    201   3e-58    
ref|XP_010270319.1|  PREDICTED: putative methyltransferase DDB_G0...    206   4e-58    
ref|XP_002274567.1|  PREDICTED: putative methyltransferase DDB_G0...    197   5e-57    Vitis vinifera
ref|XP_011022892.1|  PREDICTED: putative methyltransferase DDB_G0...    197   5e-57    
ref|XP_010106890.1|  Putative methyltransferase                         197   6e-57    
ref|XP_006465127.1|  PREDICTED: putative methyltransferase DDB_G0...    197   8e-57    
ref|XP_006380389.1|  hypothetical protein POPTR_0007s04550g             196   1e-56    
ref|XP_006442085.1|  hypothetical protein CICLE_v10024436mg             194   1e-56    
ref|XP_006382875.1|  hypothetical protein POPTR_0005s06730g             196   1e-56    
ref|XP_010027620.1|  PREDICTED: putative methyltransferase DDB_G0...    196   1e-56    
ref|XP_010929024.1|  PREDICTED: putative methyltransferase DDB_G0...    196   1e-56    
ref|XP_008370320.1|  PREDICTED: putative methyltransferase DDB_G0...    196   1e-56    
ref|XP_004299745.1|  PREDICTED: putative methyltransferase DDB_G0...    195   4e-56    
emb|CAN76825.1|  hypothetical protein VITISV_039111                     194   1e-55    Vitis vinifera
ref|XP_011031148.1|  PREDICTED: uncharacterized protein LOC105130372    193   3e-55    
ref|XP_002270565.1|  PREDICTED: putative methyltransferase DDB_G0...    192   8e-55    Vitis vinifera
ref|XP_011011392.1|  PREDICTED: uncharacterized protein LOC105115...    191   2e-54    
ref|XP_010031282.1|  PREDICTED: putative methyltransferase DDB_G0...    191   2e-54    
ref|XP_010031284.1|  PREDICTED: putative methyltransferase DDB_G0...    190   4e-54    
ref|XP_004298772.1|  PREDICTED: putative methyltransferase DDB_G0...    189   8e-54    
ref|XP_010911762.1|  PREDICTED: putative methyltransferase DDB_G0...    188   1e-53    
ref|XP_004298773.1|  PREDICTED: putative methyltransferase DDB_G0...    188   1e-53    
emb|CDX85742.1|  BnaA02g00710D                                          187   3e-53    
ref|XP_001757338.1|  predicted protein                                  185   3e-52    
ref|XP_010527089.1|  PREDICTED: putative methyltransferase DDB_G0...    187   3e-52    
ref|XP_010453118.1|  PREDICTED: putative methyltransferase DDB_G0...    185   4e-52    
ref|XP_002871442.1|  hypothetical protein ARALYDRAFT_487916             184   6e-52    
ref|XP_006289611.1|  hypothetical protein CARUB_v10003164mg             184   9e-52    
ref|XP_010929248.1|  PREDICTED: putative methyltransferase DDB_G0...    184   9e-52    
ref|XP_010527091.1|  PREDICTED: putative methyltransferase DDB_G0...    186   1e-51    
ref|XP_010911453.1|  PREDICTED: putative methyltransferase DDB_G0...    183   2e-51    
gb|KFK25364.1|  hypothetical protein AALP_AA8G103700                    183   2e-51    
ref|NP_196644.1|  methyltransferase                                     183   2e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006646053.1|  PREDICTED: putative methyltransferase DDB_G0...    183   2e-51    
ref|XP_006399580.1|  hypothetical protein EUTSA_v10014426mg             182   3e-51    
ref|XP_010491766.1|  PREDICTED: putative methyltransferase DDB_G0...    182   3e-51    
ref|XP_010929134.1|  PREDICTED: putative methyltransferase DDB_G0...    182   5e-51    
ref|XP_010031281.1|  PREDICTED: putative methyltransferase DDB_G0...    181   6e-51    
ref|XP_009125271.1|  PREDICTED: putative methyltransferase DDB_G0...    180   2e-50    
ref|XP_010547857.1|  PREDICTED: putative methyltransferase DDB_G0...    178   9e-50    
emb|CDY40123.1|  BnaC02g00070D                                          178   1e-49    
ref|NP_001131999.1|  hypothetical protein                               178   1e-49    Zea mays [maize]
emb|CDM83614.1|  unnamed protein product                                177   2e-49    
ref|XP_003569687.1|  PREDICTED: putative methyltransferase DDB_G0...    177   4e-49    
ref|XP_010427085.1|  PREDICTED: putative methyltransferase DDB_G0...    177   7e-49    
ref|XP_002456250.1|  hypothetical protein SORBIDRAFT_03g032930          176   8e-49    Sorghum bicolor [broomcorn]
ref|XP_010527066.1|  PREDICTED: uncharacterized protein LOC104804454    176   8e-49    
gb|KFK35320.1|  hypothetical protein AALP_AA5G269000                    176   1e-48    
emb|CDY69664.1|  BnaAnng31160D                                          176   2e-48    
ref|NP_001044071.1|  Os01g0716500                                       175   2e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009139261.1|  PREDICTED: uncharacterized protein LOC103863257    177   4e-48    
emb|CDX71759.1|  BnaC08g31150D                                          174   6e-48    
ref|XP_006403611.1|  hypothetical protein EUTSA_v10010557mg             175   6e-48    
ref|XP_006644622.1|  PREDICTED: putative methyltransferase DDB_G0...    174   6e-48    
gb|EKD73604.1|  hypothetical protein ACD_45C00253G0002                  173   9e-48    
dbj|BAK01848.1|  predicted protein                                      173   9e-48    
gb|EMT27832.1|  hypothetical protein F775_06435                         173   1e-47    
ref|XP_004135059.1|  PREDICTED: putative methyltransferase DDB_G0...    173   1e-47    
ref|XP_002878371.1|  hypothetical protein ARALYDRAFT_486597             173   1e-47    
ref|XP_010448882.1|  PREDICTED: putative methyltransferase DDB_G0...    173   1e-47    
ref|XP_010547882.1|  PREDICTED: putative methyltransferase DDB_G0...    173   1e-47    
ref|XP_006292735.1|  hypothetical protein CARUB_v10018982mg             174   2e-47    
ref|NP_001130612.1|  uncharacterized protein LOC100191711               172   3e-47    Zea mays [maize]
gb|ACF78902.1|  unknown                                                 172   3e-47    Zea mays [maize]
ref|XP_004969753.1|  PREDICTED: putative methyltransferase DDB_G0...    172   3e-47    
ref|XP_010434039.1|  PREDICTED: putative methyltransferase DDB_G0...    171   5e-47    
ref|NP_193984.1|  S-adenosyl-L-methionine-dependent methyltransfe...    171   6e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413651.1|  hypothetical protein EUTSA_v10026009mg             171   6e-47    
ref|XP_002877960.1|  hypothetical protein ARALYDRAFT_485812             172   7e-47    
ref|XP_008675410.1|  PREDICTED: putative methyltransferase DDB_G0...    171   8e-47    
ref|NP_191680.1|  S-adenosyl-L-methionine-dependent methyltransfe...    171   9e-47    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402507.1|  hypothetical protein EUTSA_v10006178mg             171   1e-46    
ref|NP_190983.1|  S-adenosyl-L-methionine-dependent methyltransfe...    172   1e-46    Arabidopsis thaliana [mouse-ear cress]
emb|CDY13187.1|  BnaC04g26480D                                          172   2e-46    
ref|XP_004159284.1|  PREDICTED: putative methyltransferase DDB_G0...    170   2e-46    
ref|XP_006392638.1|  hypothetical protein EUTSA_v10011654mg             170   2e-46    
ref|XP_010439329.1|  PREDICTED: putative methyltransferase DDB_G0...    169   3e-46    
ref|XP_006285991.1|  hypothetical protein CARUB_v10007518mg             169   3e-46    
gb|KFK34661.1|  hypothetical protein AALP_AA5G175100                    171   3e-46    
ref|XP_009116782.1|  PREDICTED: putative methyltransferase DDB_G0...    169   5e-46    
ref|XP_010527092.1|  PREDICTED: uncharacterized protein LOC104804474    169   7e-46    
ref|XP_004969040.1|  PREDICTED: putative methyltransferase DDB_G0...    169   9e-46    
gb|EAY75611.1|  hypothetical protein OsI_03515                          176   1e-45    Oryza sativa Indica Group [Indian rice]
emb|CDY48938.1|  BnaA09g38990D                                          168   1e-45    
ref|XP_010504207.1|  PREDICTED: uncharacterized protein LOC104781277    169   1e-45    
gb|ACI23521.1|  putative S-adenosylmethionine-dependent methyltra...    166   1e-45    Aegilops speltoides
gb|AAM65951.1|  embryonic abundant protein-like                         169   2e-45    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116103.1|  PREDICTED: uncharacterized protein LOC103841...    168   3e-45    
emb|CDX79160.1|  BnaA01g12270D                                          166   3e-45    
ref|XP_002455863.1|  hypothetical protein SORBIDRAFT_03g026460          166   3e-45    Sorghum bicolor [broomcorn]
ref|XP_006829945.1|  hypothetical protein AMTR_s00073p00188940          163   4e-45    
ref|XP_009135961.1|  PREDICTED: putative methyltransferase DDB_G0...    166   6e-45    
emb|CDX73502.1|  BnaC08g25010D                                          167   6e-45    
ref|XP_009793853.1|  PREDICTED: putative methyltransferase DDB_G0...    160   1e-44    
ref|XP_009103727.1|  PREDICTED: putative methyltransferase DDB_G0...    166   1e-44    
emb|CDY26104.1|  BnaC06g10920D                                          166   1e-44    
ref|XP_010527093.1|  PREDICTED: probable S-adenosylmethionine-dep...    166   2e-44    
dbj|BAB89030.1|  embryo-abundant protein EMB-like                       166   2e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010040143.1|  PREDICTED: putative methyltransferase DDB_G0...    166   2e-44    
ref|XP_010527081.1|  PREDICTED: uncharacterized protein LOC104804467    166   2e-44    
ref|XP_002867765.1|  hypothetical protein ARALYDRAFT_492618             162   8e-44    
gb|EAZ12517.1|  hypothetical protein OsJ_02414                          162   8e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002894505.1|  hypothetical protein ARALYDRAFT_892538             164   1e-43    
gb|AIC15767.1|  putative SAM-dependent methyltransferase                162   2e-43    
emb|CDX78213.1|  BnaA09g34080D                                          163   2e-43    
gb|EEC70987.1|  hypothetical protein OsI_02641                          163   2e-43    Oryza sativa Indica Group [Indian rice]
gb|KFK35582.1|  hypothetical protein AALP_AA4G009600                    163   2e-43    
emb|CDX82949.1|  BnaC01g13990D                                          162   3e-43    
ref|NP_564689.1|  S-adenosyl-L-methionine-dependent methyltransfe...    162   5e-43    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006392639.1|  hypothetical protein EUTSA_v10011654mg             162   6e-43    
ref|WP_018506843.1|  SAM-dependent methyltransferase                    160   6e-43    
ref|XP_006432140.1|  hypothetical protein CICLE_v10003789mg             157   2e-42    
ref|WP_022969735.1|  hypothetical protein                               158   3e-42    
gb|KFK28813.1|  hypothetical protein AALP_AA7G052200                    159   9e-42    
ref|XP_008446700.1|  PREDICTED: putative methyltransferase DDB_G0...    157   2e-41    
ref|WP_039725646.1|  hypothetical protein                               156   3e-41    
gb|AAM14022.1|  unknown protein                                         155   3e-41    Arabidopsis thaliana [mouse-ear cress]
gb|ACI23520.1|  putative S-adenosylmethionine-dependent methyltra...    153   7e-41    Triticum urartu
ref|XP_008226413.1|  PREDICTED: putative methyltransferase DDB_G0...    152   3e-40    
gb|KDO43672.1|  hypothetical protein CISIN_1g038491mg                   149   4e-40    
ref|WP_014782544.1|  methyltransferase                                  152   4e-40    
ref|NP_001185239.1|  S-adenosyl-L-methionine-dependent methyltran...    154   4e-40    
ref|WP_022653325.1|  hypothetical protein                               152   5e-40    
gb|AIF84973.1|  methylase involved in ubiquinone/menaquinone bios...    152   6e-40    
ref|XP_008226391.1|  PREDICTED: putative methyltransferase DDB_G0...    150   2e-39    
gb|EAY74744.1|  hypothetical protein OsI_02636                          151   2e-39    Oryza sativa Indica Group [Indian rice]
ref|XP_009802758.1|  PREDICTED: uncharacterized protein LOC104248235    147   3e-39    
ref|WP_028444583.1|  SAM-dependent methyltransferase                    150   4e-39    
ref|WP_035894854.1|  hypothetical protein                               150   5e-39    
emb|CEG56649.1|  Methylase involved in ubiquinone/menaquinone bio...    149   1e-38    
ref|WP_015329803.1|  hypothetical protein                               148   2e-38    
ref|WP_033109431.1|  SAM-dependent methyltransferase                    148   2e-38    
ref|WP_018477541.1|  hypothetical protein                               147   7e-38    
ref|WP_004766509.1|  methyltransferase domain protein                   146   8e-38    
ref|WP_034212329.1|  hypothetical protein                               147   8e-38    
ref|WP_002749583.1|  methyltransferase domain protein                   146   8e-38    
ref|WP_020762655.1|  methyltransferase domain protein                   146   1e-37    
ref|WP_010572367.1|  methyltransferase                                  146   1e-37    
ref|WP_004496647.1|  MULTISPECIES: methyltransferase                    146   1e-37    
ref|WP_013030333.1|  SAM-dependent methyltransferase                    146   1e-37    
ref|WP_012505004.1|  SAM-dependent methyltransferase                    146   1e-37    
ref|WP_004506541.1|  methyltransferase domain protein                   145   2e-37    
ref|WP_016759517.1|  methyltransferase                                  145   2e-37    
ref|WP_011244653.1|  hypothetical protein                               145   2e-37    
ref|WP_020779585.1|  methyltransferase domain protein                   145   2e-37    
ref|WP_017853692.1|  methyltransferase                                  145   2e-37    
ref|WP_004500893.1|  methyltransferase domain protein                   144   5e-37    
ref|WP_002063677.1|  hypothetical protein                               144   5e-37    
ref|WP_000367576.1|  methyltransferase                                  144   6e-37    
ref|WP_023574351.1|  methylase involved in ubiquinone/menaquinone...    144   6e-37    
ref|WP_028229005.1|  SAM-dependent methyltransferase                    144   6e-37    
ref|WP_011378169.1|  MULTISPECIES: hypothetical protein                 144   6e-37    
gb|KGE21420.1|  SAM-dependent methyltransferase                         144   6e-37    
ref|WP_000367570.1|  methyltransferase                                  144   7e-37    
ref|WP_000525829.1|  methyltransferase                                  144   7e-37    
ref|WP_033110401.1|  SAM-dependent methyltransferase                    144   7e-37    
ref|WP_002055080.1|  hypothetical protein                               144   7e-37    
ref|WP_002630093.1|  methyltransferase domain protein                   144   8e-37    
emb|CEG60643.1|  conserved protein of unknown function                  144   8e-37    
ref|WP_000367575.1|  hypothetical protein                               144   9e-37    
ref|WP_004449909.1|  methyltransferase domain protein                   144   1e-36    
ref|WP_033109787.1|  SAM-dependent methyltransferase                    143   1e-36    
ref|WP_000367573.1|  hypothetical protein                               143   1e-36    
dbj|BAP54736.1|  SAM (and some other nucleotide) binding motif          143   1e-36    
ref|WP_039477081.1|  SAM-dependent methyltransferase                    143   2e-36    
gb|KFN46711.1|  hypothetical protein N790_08340                         143   2e-36    
gb|EMJ55974.1|  methyltransferase domain protein                        143   2e-36    
ref|WP_016493163.1|  hypothetical protein                               143   2e-36    
ref|WP_033110045.1|  SAM-dependent methyltransferase                    143   2e-36    
ref|WP_012596001.1|  type 11 methyltransferase                          143   2e-36    
ref|WP_015784660.1|  type 11 methyltransferase                          143   2e-36    
ref|WP_004426209.1|  methyltransferase domain protein                   142   2e-36    
ref|WP_017733236.1|  hypothetical protein                               142   3e-36    
ref|WP_012373993.1|  SAM-dependent methyltransferase                    142   3e-36    
ref|WP_000367577.1|  hypothetical protein                               142   3e-36    
ref|WP_033108214.1|  SAM-dependent methyltransferase                    142   3e-36    
ref|WP_039141840.1|  hypothetical protein                               142   3e-36    
ref|WP_008552721.1|  SAM-dependent methyltransferase                    142   3e-36    
ref|WP_004756383.1|  methyltransferase                                  142   4e-36    
ref|WP_031442873.1|  hypothetical protein                               142   4e-36    
ref|WP_012473900.1|  SAM-dependent methyltransferase                    142   4e-36    
ref|WP_000367571.1|  methyltransferase                                  142   4e-36    
gb|EYU20579.1|  hypothetical protein MIMGU_mgv1a0119852mg               141   4e-36    
ref|WP_033108656.1|  SAM-dependent methyltransferase                    142   4e-36    
dbj|GAM11442.1|  putative methyltransferase                             142   5e-36    
ref|WP_004782383.1|  methyltransferase domain protein                   142   5e-36    
ref|WP_028372994.1|  hypothetical protein                               142   5e-36    
ref|WP_000367572.1|  hypothetical protein                               142   5e-36    
ref|WP_002158833.1|  hypothetical protein                               142   5e-36    
ref|WP_010576307.1|  methyltransferase                                  141   6e-36    
gb|EYU63067.1|  SAM-dependent methyltransferase                         141   6e-36    
ref|WP_004456795.1|  methyltransferase domain protein                   141   7e-36    
ref|WP_018694463.1|  hypothetical protein                               141   7e-36    
ref|WP_004451976.1|  methyltransferase domain protein                   141   9e-36    
gb|ABR17652.1|  unknown                                                 137   1e-35    
ref|WP_004440594.1|  methyltransferase domain protein                   141   1e-35    
ref|WP_041100099.1|  SAM-dependent methyltransferase                    140   1e-35    
ref|WP_035267554.1|  SAM-dependent methyltransferase                    140   2e-35    
ref|WP_037018133.1|  SAM-dependent methyltransferase                    140   2e-35    
ref|WP_003448322.1|  hypothetical protein                               140   2e-35    
ref|WP_014284061.1|  SAM-dependent methyltransferase                    140   2e-35    
ref|WP_004757699.1|  MULTISPECIES: methyltransferase                    140   3e-35    
ref|WP_004762735.1|  methyltransferase domain protein                   140   3e-35    
ref|WP_002435788.1|  SAM-dependent methyltransferase                    140   3e-35    
ref|WP_029765296.1|  SAM-dependent methyltransferase                    140   3e-35    
ref|WP_020772612.1|  methyltransferase domain protein                   139   4e-35    
ref|WP_010600537.1|  SAM-dependent methyltransferase                    139   4e-35    
ref|WP_026817090.1|  SAM-dependent methyltransferase                    139   4e-35    
gb|EMM93081.1|  methyltransferase domain protein                        139   5e-35    
gb|AIZ64377.1|  SAM-dependent methyltransferase                         139   5e-35    
ref|WP_002099646.1|  methyltransferase domain protein                   139   5e-35    
ref|WP_029132390.1|  hypothetical protein                               139   6e-35    
ref|WP_013767682.1|  type 11 methyltransferase                          139   7e-35    
ref|WP_004427723.1|  methyltransferase domain protein                   139   7e-35    
gb|AHE67527.1|  methylase involved in ubiquinone/menaquinone bios...    137   7e-35    
ref|WP_028627334.1|  SAM-dependent methyltransferase                    138   8e-35    
ref|WP_018973965.1|  hypothetical protein                               138   9e-35    
ref|WP_014682664.1|  SAM-dependent methyltransferase                    138   9e-35    
ref|WP_025141900.1|  SAM-dependent methyltransferase                    138   1e-34    
gb|AHG93058.1|  Methyltransferase type 11                               138   1e-34    
ref|WP_029277632.1|  SAM-dependent methyltransferase                    138   1e-34    
ref|WP_019306842.1|  hypothetical protein                               138   1e-34    
emb|CEE13906.1|  Ubiquinone/menaquinone biosynthesis C-methyltran...    138   1e-34    
ref|WP_029282157.1|  SAM-dependent methyltransferase                    137   1e-34    
ref|WP_022825940.1|  type 11 methyltransferase                          137   2e-34    
ref|WP_016168739.1|  hypothetical protein                               137   2e-34    
ref|WP_039053720.1|  SAM-dependent methyltransferase                    137   2e-34    
ref|WP_017213530.1|  MULTISPECIES: methyltransferase                    137   2e-34    
gb|EMO52393.1|  methyltransferase domain protein                        137   2e-34    
ref|WP_003288384.1|  SAM-dependent methyltransferase                    137   2e-34    
ref|WP_025608529.1|  SAM-dependent methyltransferase                    137   2e-34    
ref|WP_009779675.1|  SAM-dependent methyltransferase                    137   3e-34    
ref|WP_035416070.1|  hypothetical protein                               137   3e-34    
ref|WP_031221529.1|  SAM-dependent methyltransferase                    137   3e-34    
ref|WP_027886062.1|  SAM-dependent methyltransferase                    137   4e-34    
dbj|GAM09001.1|  putative methyltransferase                             137   4e-34    
emb|CDP14220.1|  unnamed protein product                                135   5e-34    
ref|XP_011011394.1|  PREDICTED: uncharacterized protein LOC105115...    136   5e-34    
ref|WP_017522796.1|  hypothetical protein                               136   5e-34    
gb|ESQ80290.1|  hypothetical protein ABENE_22405                        137   5e-34    
ref|WP_035673425.1|  SAM-dependent methyltransferase                    136   5e-34    
ref|WP_021701378.1|  putative methyltransferase                         136   5e-34    
ref|WP_023460150.1|  hypothetical protein                               136   5e-34    
ref|WP_009284176.1|  type 11 methyltransferase                          136   5e-34    
ref|WP_039109918.1|  SAM-dependent methyltransferase                    136   6e-34    
ref|WP_018229896.1|  SAM-dependent methyltransferase                    136   6e-34    
ref|WP_011709359.1|  SAM-dependent methyltransferase                    136   7e-34    
ref|WP_026992974.1|  SAM-dependent methyltransferase                    135   9e-34    
ref|WP_037023784.1|  SAM-dependent methyltransferase                    135   9e-34    
ref|WP_026705288.1|  SAM-dependent methyltransferase                    135   1e-33    
ref|WP_018077919.1|  hypothetical protein                               135   1e-33    
ref|WP_010121525.1|  SAM-dependent methyltransferase                    135   1e-33    
ref|WP_003010311.1|  methyltransferase domain protein                   135   2e-33    
ref|WP_026686116.1|  SAM-dependent methyltransferase                    135   2e-33    
ref|WP_020604130.1|  hypothetical protein                               135   2e-33    
ref|WP_002729385.1|  methyltransferase domain protein                   135   2e-33    
ref|WP_002153848.1|  methyltransferase domain protein                   134   2e-33    
ref|WP_028500270.1|  hypothetical protein                               135   2e-33    
ref|WP_018298490.1|  hypothetical protein                               135   2e-33    
ref|WP_014008655.1|  SAM-dependent methyltransferase                    135   3e-33    
ref|WP_009622698.1|  methyltransferase type 11                          134   3e-33    
ref|WP_035922057.1|  hypothetical protein                               134   3e-33    
ref|XP_008675411.1|  PREDICTED: putative methyltransferase DDB_G0...    133   3e-33    
ref|WP_011671302.1|  methyltransferase                                  134   4e-33    
gb|ACI23518.1|  putative S-adenosylmethionine-dependent methyltra...    132   4e-33    
ref|WP_012927669.1|  type 11 methyltransferase                          134   4e-33    
ref|XP_010467301.1|  PREDICTED: uncharacterized protein LOC104747367    131   5e-33    
ref|WP_002732159.1|  methyltransferase domain protein                   134   5e-33    
ref|WP_010112990.1|  SAM-dependent methyltransferase                    134   6e-33    
ref|WP_007652649.1|  SAM-dependent methyltransferase                    133   6e-33    
ref|WP_002756518.1|  MULTISPECIES: methyltransferase domain protein     133   6e-33    
ref|WP_020952745.1|  methyltransferase type 11                          133   9e-33    
ref|WP_018617734.1|  hypothetical protein                               133   1e-32    
gb|KES22405.1|  SAM-dependent methyltransferase                         133   1e-32    
ref|WP_011312681.1|  SAM-dependent methyltransferase                    133   1e-32    
gb|KGI79047.1|  SAM-dependent methyltransferase                         133   1e-32    
ref|WP_005018822.1|  MULTISPECIES: SAM-dependent methyltransferase      133   1e-32    
ref|WP_011672169.1|  methyltransferase                                  132   1e-32    
emb|CDF84514.1|  hypothetical protein PKB_3167                          132   2e-32    
ref|WP_018151652.1|  hypothetical protein                               132   2e-32    
ref|WP_015477650.1|  type 11 methyltransferase                          132   2e-32    
ref|WP_024763777.1|  SAM-dependent methyltransferase                    132   2e-32    
ref|WP_020442301.1|  hypothetical protein                               132   2e-32    
ref|WP_026987414.1|  SAM-dependent methyltransferase                    132   2e-32    
ref|WP_037043325.1|  SAM-dependent methyltransferase                    132   2e-32    
ref|WP_004825473.1|  hypothetical protein                               132   3e-32    
ref|WP_040201121.1|  SAM-dependent methyltransferase                    132   3e-32    
ref|WP_023448368.1|  hypothetical protein                               132   3e-32    
ref|WP_019987743.1|  hypothetical protein                               131   3e-32    
ref|WP_004336203.1|  type 11 methyltransferase                          131   3e-32    
ref|WP_005209288.1|  hypothetical protein                               131   4e-32    
gb|EFA74692.1|  methyltransferase type 11 domain-containing protein     132   4e-32    
emb|CEI53648.1|  SAM-dependent methyltransferases                       131   4e-32    
ref|WP_005034399.1|  SAM-dependent methyltransferase                    131   4e-32    
ref|WP_004155971.1|  SAM (and some other nucleotide) binding motif      131   4e-32    
ref|WP_005185640.1|  hypothetical protein                               131   4e-32    
ref|WP_014803028.1|  Methyltransferase type 11                          131   5e-32    
ref|WP_039606881.1|  SAM-dependent methyltransferase                    131   5e-32    
ref|WP_022729994.1|  SAM-dependent methyltransferase                    131   5e-32    
ref|WP_016921963.1|  hypothetical protein                               131   6e-32    
ref|WP_009584350.1|  methyltransferase domain protein                   131   6e-32    
ref|WP_017486931.1|  hypothetical protein                               131   6e-32    
ref|WP_039560274.1|  SAM-dependent methyltransferase                    131   6e-32    
ref|WP_014892813.1|  type 11 methyltransferase                          130   7e-32    
ref|WP_020212881.1|  hypothetical protein                               130   7e-32    
ref|WP_017519159.1|  SAM-dependent methyltransferase                    130   8e-32    
ref|WP_023580268.1|  methylase involved in ubiquinone/menaquinone...    130   8e-32    
ref|WP_005147432.1|  hypothetical protein                               130   8e-32    
ref|WP_038545306.1|  SAM-dependent methyltransferase                    130   9e-32    
ref|WP_002086481.1|  methyltransferase domain protein                   129   1e-31    
ref|WP_004816598.1|  hypothetical protein                               130   1e-31    
ref|WP_027590317.1|  SAM-dependent methyltransferase                    130   1e-31    
ref|WP_009556561.1|  methylase involved in ubiquinone/menaquinone...    130   1e-31    
ref|WP_005317574.1|  hypothetical protein                               130   1e-31    
ref|WP_004725351.1|  hypothetical protein                               130   1e-31    
ref|WP_035132554.1|  SAM-dependent methyltransferase                    130   1e-31    
dbj|BAP39020.1|  putative methyltransferase                             129   2e-31    
gb|KHF77285.1|  SAM-dependent methyltransferase                         129   2e-31    
ref|WP_008182965.1|  methylase involved in ubiquinone/menaquinone...    129   2e-31    
ref|WP_034616854.1|  SAM-dependent methyltransferase                    129   2e-31    
ref|WP_015029800.1|  SAM-dependent methyltransferase                    129   2e-31    
ref|WP_005260066.1|  hypothetical protein                               129   3e-31    
ref|WP_003303395.1|  SAM-dependent methyltransferase                    129   3e-31    
ref|WP_020595672.1|  hypothetical protein                               129   3e-31    
ref|WP_021445778.1|  hypothetical protein                               129   3e-31    
ref|WP_009194776.1|  ubiquinone/menaquinone biosynthesis methyltr...    129   3e-31    
ref|WP_021071579.1|  hypothetical protein                               128   4e-31    
gb|EMS45399.1|  hypothetical protein TRIUR3_18109                       126   4e-31    
ref|WP_038896794.1|  hypothetical protein                               128   4e-31    
ref|WP_005027564.1|  MULTISPECIES: SAM-dependent methyltransferase      129   4e-31    
ref|WP_033580999.1|  SAM-dependent methyltransferase                    129   4e-31    
ref|WP_004776128.1|  hypothetical protein                               128   5e-31    
ref|WP_038346250.1|  SAM-dependent methyltransferase                    128   6e-31    
gb|AFW83750.1|  hypothetical protein ZEAMMB73_337529                    127   6e-31    
gb|EFA74693.1|  putative SAM dependent methyltransferase                128   6e-31    
ref|WP_035382961.1|  SAM-dependent methyltransferase                    128   6e-31    
gb|AHF16461.1|  SAM-dependent methyltransferase                         128   7e-31    
ref|WP_007806875.1|  SAM-dependent methyltransferase                    128   7e-31    
ref|WP_032868523.1|  SAM-dependent methyltransferase                    127   7e-31    
ref|WP_018233266.1|  hypothetical protein                               128   8e-31    
ref|WP_004691550.1|  hypothetical protein                               127   8e-31    
ref|WP_032871569.1|  SAM-dependent methyltransferase                    127   8e-31    
ref|WP_023446126.1|  SAM-dependent methyltransferase                    128   8e-31    
ref|WP_014819278.1|  SAM-dependent methyltransferase                    128   9e-31    
gb|ACN25798.1|  unknown                                                 127   9e-31    
ref|WP_039646412.1|  SAM-dependent methyltransferase                    127   1e-30    
ref|WP_016162340.1|  hypothetical protein                               127   1e-30    
ref|WP_028666891.1|  SAM-dependent methyltransferase                    127   1e-30    
ref|WP_004657332.1|  hypothetical protein                               127   1e-30    
ref|WP_037314819.1|  SAM-dependent methyltransferase                    127   1e-30    



>ref|XP_006364434.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Solanum 
tuberosum]
Length=264

 Score =   398 bits (1023),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 178/264 (67%), Positives = 226/264 (86%), Gaps = 1/264 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ +QYS+GRP+YPQ+LF+FIASKTP HDLVWDVGTG+GQAA SL + YK V+ 
Sbjct  1    MANLFIKQAQQYSKGRPSYPQELFNFIASKTPSHDLVWDVGTGSGQAAQSLAKLYKYVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  +PNVR++CT P M+ +E+E  +GAESSVDLVTIAQA+HWF LPTFY+
Sbjct  61   TDTSPKQLEFAAKVPNVRYICTSPKMSKSEIETKIGAESSVDLVTIAQAMHWFDLPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VKW+LKKP+GVIAAWCY  PE++SSVD+I+ ++YT++   +WE  RKLVD+KY+TIDFP
Sbjct  121  HVKWLLKKPNGVIAAWCYTTPEINSSVDAIFDKFYTSDTGPYWESPRKLVDEKYKTIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDGC+HNGP+EFK +K+M+L+SYF Y++S S YQTAK KGVE+LS D+++ FT AWN
Sbjct  181  FEAVDGCDHNGPFEFKIEKVMDLDSYFTYLKSWSAYQTAKEKGVELLSEDVIEKFTSAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGILD  144
            EDGK++K V  PIYLRIGKVG LD
Sbjct  241  EDGKSEKKVTHPIYLRIGKVGNLD  264



>ref|XP_011078957.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X2 
[Sesamum indicum]
Length=288

 Score =   395 bits (1016),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 186/285 (65%), Positives = 225/285 (79%), Gaps = 1/285 (0%)
 Frame = -1

Query  1004  MLKK*DFPCTSPRLWEKYTEELKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDL  825
             MLK  D         + Y +    MA LF+KQ KQYS GRP+YPQ+LF FIASKT  HDL
Sbjct  1     MLKLVDHHLIKTTQRQIYLKVRVNMAQLFIKQAKQYSVGRPSYPQELFHFIASKTLSHDL  60

Query  824   VWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVG  645
              WDVGTG+GQAA SL   YKNVV TDTSP QL+FA  LPN+R+ CTPP+M++AEL+ NVG
Sbjct  61    AWDVGTGSGQAAKSLANIYKNVVATDTSPKQLEFAAKLPNIRYQCTPPSMSMAELQDNVG  120

Query  644   AESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYT  465
             +ESS DLVTIAQA+HWF LPTFYQQVKWVLKKP+G+IAAWCY  PEV+ +VDS++ R+YT
Sbjct  121   SESSFDLVTIAQAMHWFDLPTFYQQVKWVLKKPNGIIAAWCYTVPEVNPTVDSLFNRFYT  180

Query  464   TNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGY  288
              +   +WE  R LVDQKY TI FPF+PVDG EHNGP+ F ++K+M+LESYF Y+RS S Y
Sbjct  181   IDAGPYWESPRALVDQKYETIHFPFEPVDGLEHNGPFRFSSEKVMDLESYFTYLRSWSAY  240

Query  287   QTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
             QTAK KGVE+L+ ++++DF RAWNEDGK +K V+FPIYLRIGKVG
Sbjct  241   QTAKEKGVELLTENVLEDFKRAWNEDGKFEKTVSFPIYLRIGKVG  285



>ref|XP_009601898.1| PREDICTED: putative methyltransferase DDB_G0268948 [Nicotiana 
tomentosiformis]
Length=264

 Score =   394 bits (1011),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 175/263 (67%), Positives = 225/263 (86%), Gaps = 1/263 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QYS+GRP+YP++LF+FIASKTP HDLVWDVGTG+GQAA SL + YKNV+ 
Sbjct  1    MAKLFIKQAQQYSKGRPSYPEELFNFIASKTPCHDLVWDVGTGSGQAAQSLAKLYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  +PNVR++CT P M+++E+E  +GAESS DLVT+AQA+HWF LPTFYQ
Sbjct  61   TDTSPKQLEFAAKVPNVRYICTSPKMSMSEIETKIGAESSADLVTVAQAMHWFDLPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKP+GVIAAWCY  PEV++SVD I++++YT +   +WE  RKLVD+KY+TIDFP
Sbjct  121  QVKWLLKKPNGVIAAWCYTVPEVNNSVDPIFEKFYTVDAGPYWESPRKLVDEKYKTIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV GC+HNGP++FK +K+M+L++YF Y++S S YQTAK KGVE+L+ D+V  F  AWN
Sbjct  181  FEPVIGCDHNGPFQFKIEKVMDLDAYFTYLKSWSAYQTAKEKGVELLTDDVVGKFRSAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGIL  147
            EDG++QK V+FPIYLRIGKVG L
Sbjct  241  EDGESQKTVSFPIYLRIGKVGNL  263



>gb|EYU20791.1| hypothetical protein MIMGU_mgv1a012010mg [Erythranthe guttata]
Length=264

 Score =   393 bits (1010),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 182/261 (70%), Positives = 212/261 (81%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF+KQ KQYSEGRP+YPQQLFDFIAS TP HDL WDVGTGTGQAA SL   YKNV+ 
Sbjct  1    MADLFIKQAKQYSEGRPSYPQQLFDFIASNTPSHDLAWDVGTGTGQAAKSLANYYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+ + CT   M+  EL   VG+ESS DLVTIAQA+HWF LPTFYQ
Sbjct  61   TDTSPKQLEFAAKLPNITYRCTSATMSADELREKVGSESSFDLVTIAQAMHWFDLPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVK VLKKPDGVIAAWCY  PEV+ SVDS++Q +Y      +WEP RKLV+QKY TIDFP
Sbjct  121  QVKCVLKKPDGVIAAWCYTTPEVNPSVDSLFQIFYNVGAGPYWEPARKLVEQKYETIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+P+DG EHNGP+ F ++K+M+LE YF Y+RS S YQTAK KGVE+L+  +V+DFTRAWN
Sbjct  181  FEPIDGLEHNGPFRFNSEKVMDLEGYFTYLRSWSAYQTAKEKGVELLTDSVVEDFTRAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG+ QKIV +P+YLRIGKVG
Sbjct  241  EDGQLQKIVTYPVYLRIGKVG  261



>emb|CDP09510.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   391 bits (1005),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 177/263 (67%), Positives = 216/263 (82%), Gaps = 1/263 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLFL Q KQYS  RP YP QLF+FIASKTP HDLVWDVGTG+GQAA +L + YKNV+ 
Sbjct  1    MADLFLNQAKQYSASRPRYPDQLFEFIASKTPSHDLVWDVGTGSGQAAAALAKIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FAP +PN+R+ CT P +++AELE N+ AES+VDLVTIAQALHWF  PTFYQ
Sbjct  61   TDTSPKQLEFAPKVPNIRYQCTSPKLSIAELEENIAAESTVDLVTIAQALHWFDFPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW LKKP+GVIAAWCY  PE++ S+D+++QR+Y  +   FWEP RKLVD KY TIDFP
Sbjct  121  QVKWALKKPNGVIAAWCYTVPEINPSLDAVFQRFYKVDSDPFWEPQRKLVDNKYETIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG +H GP++FKA+ +M+LE +F YIRS S YQTAK KGVE+L+  +V+DFT AWN
Sbjct  181  FEPVDGVDHTGPFQFKAENVMDLEGFFTYIRSWSSYQTAKQKGVELLNETVVKDFTSAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGIL  147
            EDG ++K+V  PI+LRIGKVG L
Sbjct  241  EDGISKKVVTSPIHLRIGKVGNL  263



>ref|XP_004237334.1| PREDICTED: putative methyltransferase DDB_G0268948 [Solanum lycopersicum]
Length=264

 Score =   390 bits (1001),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 172/264 (65%), Positives = 226/264 (86%), Gaps = 1/264 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ +QYS+GRP+YPQ+LF+FIASKTP HDLVWDVGTG+GQAA SL + YKNV+ 
Sbjct  1    MANLFIKQAQQYSKGRPSYPQELFNFIASKTPSHDLVWDVGTGSGQAAQSLAKLYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  +PNV+++CT P ++ +E+E  +G+ESSVDLVTIAQA+HWF LPTFY+
Sbjct  61   TDTSPKQLEFAAKVPNVQYICTSPKLSKSEIETKIGSESSVDLVTIAQAMHWFDLPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VKW+LKKP+GVIA+WCY  P++++SVD+I+ ++YT++   +WE  RKLVD+KY TIDFP
Sbjct  121  HVKWLLKKPNGVIASWCYTTPKINNSVDAIFDKFYTSDAGPYWESPRKLVDEKYETIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ +DGC+HNGP+EFK +K+M+L+S F Y++S S YQTAK KGVE+LS D+V+ FT AWN
Sbjct  181  FEAIDGCDHNGPFEFKIEKVMDLDSCFTYLKSWSAYQTAKEKGVELLSEDVVEKFTSAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGILD  144
            EDGK++K V +PIYLRIGKVG LD
Sbjct  241  EDGKSEKKVIYPIYLRIGKVGNLD  264



>ref|XP_009774440.1| PREDICTED: putative methyltransferase DDB_G0268948 [Nicotiana 
sylvestris]
Length=263

 Score =   387 bits (994),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 173/263 (66%), Positives = 222/263 (84%), Gaps = 1/263 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QYS+GRP+YP++LF+FIASKTP HDLVWDVGTG+GQAA SL + YKNV+ 
Sbjct  1    MAKLFIKQAQQYSKGRPSYPEELFNFIASKTPCHDLVWDVGTGSGQAAQSLAKLYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDT P QL+FA  +PNV+++CT P M++AE+E  +GAESSVDLVT+AQA+HWF LPTFYQ
Sbjct  61   TDTRPKQLEFAVKVPNVQYICTSPKMSMAEIETKIGAESSVDLVTVAQAMHWFDLPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKP+GVIAAWCY  PEV++SVD I++++YT +   +WE  RKLVD+KY+T DFP
Sbjct  121  QVKWLLKKPNGVIAAWCYTVPEVNNSVDPIFEKFYTVDAGPYWESPRKLVDEKYKTSDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ + GC+HNGP+EFK +K+M+L SYF Y++S S YQTAK KGVE+L+ D+V+ FT  WN
Sbjct  181  FETISGCDHNGPFEFKIEKVMDLNSYFTYLKSWSAYQTAKEKGVELLTDDVVEKFTSVWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGIL  147
            EDG++QK V+FPIYLRI KVG L
Sbjct  241  EDGESQKPVSFPIYLRIDKVGNL  263



>ref|XP_011078956.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X1 
[Sesamum indicum]
Length=308

 Score =   384 bits (985),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 225/305 (74%), Gaps = 21/305 (7%)
 Frame = -1

Query  1004  MLKK*DFPCTSPRLWEKYTEELKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDL  825
             MLK  D         + Y +    MA LF+KQ KQYS GRP+YPQ+LF FIASKT  HDL
Sbjct  1     MLKLVDHHLIKTTQRQIYLKVRVNMAQLFIKQAKQYSVGRPSYPQELFHFIASKTLSHDL  60

Query  824   VWDVGTGTGQAAMS--------------------LGEKYKNVVGTDTSPNQLQFAPNLPN  705
              WDVGTG+GQAA S                    L   YKNVV TDTSP QL+FA  LPN
Sbjct  61    AWDVGTGSGQAAKSVPRLFLKYCSSNTKASLPDQLANIYKNVVATDTSPKQLEFAAKLPN  120

Query  704   VRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAW  525
             +R+ CTPP+M++AEL+ NVG+ESS DLVTIAQA+HWF LPTFYQQVKWVLKKP+G+IAAW
Sbjct  121   IRYQCTPPSMSMAELQDNVGSESSFDLVTIAQAMHWFDLPTFYQQVKWVLKKPNGIIAAW  180

Query  524   CYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYEFK  348
             CY  PEV+ +VDS++ R+YT +   +WE  R LVDQKY TI FPF+PVDG EHNGP+ F 
Sbjct  181   CYTVPEVNPTVDSLFNRFYTIDAGPYWESPRALVDQKYETIHFPFEPVDGLEHNGPFRFS  240

Query  347   AQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLR  168
             ++K+M+LESYF Y+RS S YQTAK KGVE+L+ ++++DF RAWNEDGK +K V+FPIYLR
Sbjct  241   SEKVMDLESYFTYLRSWSAYQTAKEKGVELLTENVLEDFKRAWNEDGKFEKTVSFPIYLR  300

Query  167   IGKVG  153
             IGKVG
Sbjct  301   IGKVG  305



>ref|XP_002308901.1| embryo-abundant family protein [Populus trichocarpa]
 gb|EEE92424.1| embryo-abundant family protein [Populus trichocarpa]
Length=263

 Score =   371 bits (952),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 170/261 (65%), Positives = 212/261 (81%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF++Q KQY+E RP+YPQ+LF+FIASKTP  DLVWDVGTG+GQAA SL   YKNV+G
Sbjct  1    MAELFVEQAKQYAETRPSYPQELFEFIASKTPSRDLVWDVGTGSGQAARSLAGIYKNVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNVR+  TPP M++ ELE  V  +SSVDLVTIAQA+HWF LP+FYQ
Sbjct  61   TDTSLKQLEFAPKLPNVRYQQTPPVMSMGELEQTVSTQSSVDLVTIAQAMHWFDLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFP
Sbjct  121  QVKWVLKKPHGVIAAWCYTIPEVNDSVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G ++ GP++F  +K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWN
Sbjct  181  FEPVEGTDNTGPFKFVTEKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG  QK+V FP++L+IGKVG
Sbjct  241  EDGHGQKVVKFPVHLKIGKVG  261



>ref|XP_003632729.1| PREDICTED: putative methyltransferase DDB_G0268948 [Vitis vinifera]
 emb|CBI30089.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   370 bits (949),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 167/260 (64%), Positives = 213/260 (82%), Gaps = 0/260 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF +Q KQYSE RP+YP +LF FIASKTP  DLVWDVGTG+GQAA+SL   YKNV+G
Sbjct  1    MAELFTEQAKQYSEARPSYPPELFQFIASKTPDRDLVWDVGTGSGQAAVSLAGIYKNVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            T+TS +QL+FA  LPN+R+  T P MT+A+L+A+V A+SSVDLVTIAQA+HWF LP FYQ
Sbjct  61   TETSQSQLEFAAKLPNIRYQYTSPVMTIADLQASVAAQSSVDLVTIAQAMHWFDLPKFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QV+WVLKKP GVIAAWCY  PEV+ SVD +++R+Y  ++ +W+  R LVD KYR+I+FPF
Sbjct  121  QVEWVLKKPHGVIAAWCYTVPEVNESVDLVFERFYADSKPYWDSARDLVDDKYRSIEFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
             PVDG +  GP+ FK +++M+LE+YF YIRS S YQTAK +GVE+L +D+++DF RAWN 
Sbjct  181  KPVDGEDDTGPFRFKTERIMDLEAYFTYIRSWSSYQTAKKEGVELLRNDVIEDFERAWNR  240

Query  212  DGKTQKIVAFPIYLRIGKVG  153
            DGK +K+V +PIYLRIGKVG
Sbjct  241  DGKGKKVVTYPIYLRIGKVG  260



>gb|EPS63915.1| hypothetical protein M569_10867 [Genlisea aurea]
Length=266

 Score =   369 bits (948),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 168/263 (64%), Positives = 207/263 (79%), Gaps = 1/263 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLFLKQ K+Y+EGRP YPQQLFDFIASKTP H L WDVGTG+GQAA SL + Y NVV 
Sbjct  1    MADLFLKQPKEYAEGRPAYPQQLFDFIASKTPSHHLAWDVGTGSGQAARSLADIYSNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSPNQL+ A  LPN+ + CTPP M+  EL  +VG+ESS D+VT+AQALHWF LPTFY+
Sbjct  61   TDTSPNQLEHAEKLPNIAYRCTPPKMSTPELRRDVGSESSFDVVTVAQALHWFDLPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            Q ++VLKKPDGV+AAWCY  PEVS  VDS+ +RYY+ + + +W+P R LVD+KY T+DFP
Sbjct  121  QARYVLKKPDGVVAAWCYTLPEVSPEVDSVLRRYYSEDTEPYWDPARSLVDRKYETVDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDGC+H GP+ F A+K M+LE Y  Y++S S YQTAK KGV +L  D+V+ F +AWN
Sbjct  181  FEAVDGCDHTGPFRFDAEKGMDLEGYLTYLKSWSAYQTAKEKGVCLLGGDVVRRFEKAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGIL  147
            + G  QK+  FP+YLRIGKVG L
Sbjct  241  DHGPPQKVATFPVYLRIGKVGSL  263



>ref|XP_006492999.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Citrus 
sinensis]
Length=265

 Score =   368 bits (944),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 168/262 (64%), Positives = 213/262 (81%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ KQY+E RP YP++LF FI SKT  HDL WDVGTG+GQAA SL   ++NV+G
Sbjct  1    MAELFIKQAKQYAETRPNYPEELFKFITSKTTNHDLAWDVGTGSGQAAASLSGIFENVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            T+TSP Q++FA  LPN+R+  T P M++AELE NV A+S+VDLVTIAQA+HWF LP FY 
Sbjct  61   TETSPKQIEFATKLPNIRYELTSPAMSIAELEQNVAAQSTVDLVTIAQAMHWFDLPQFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIA WCY  PEV+ SVD+++Q +YT +   FWEP RKLVD KY TIDFP
Sbjct  121  QVKWVLKKPNGVIATWCYTVPEVNVSVDAVFQPFYTVDSDPFWEPQRKLVDNKYMTIDFP  180

Query  395  FDPVDGCEHNGPYE-FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG +  GP++ F  +K M+LE YF+YIRS S YQTAK+KGVE+L+ +++++F RAW
Sbjct  181  FEPVDGADSTGPFDRFVIEKTMDLEGYFSYIRSWSAYQTAKDKGVELLTENVIENFRRAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            NEDG+++K+V FPIYLRIGKVG
Sbjct  241  NEDGQSRKVVRFPIYLRIGKVG  262



>ref|XP_006442083.1| hypothetical protein CICLE_v10021720mg [Citrus clementina]
 gb|ESR55323.1| hypothetical protein CICLE_v10021720mg [Citrus clementina]
 gb|KDO49185.1| hypothetical protein CISIN_1g024647mg [Citrus sinensis]
Length=265

 Score =   366 bits (940),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 167/262 (64%), Positives = 213/262 (81%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ KQY+E RP YP++LF FI SKT  H+L WDVGTG+GQAA SL   ++NV+G
Sbjct  1    MAELFIKQAKQYAETRPNYPEELFKFITSKTTNHELAWDVGTGSGQAAASLSGIFENVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            T+TSP Q++FA  LPN+R+  T P M++AELE NV A+S+VDLVTIAQA+HWF LP FY 
Sbjct  61   TETSPKQIEFATKLPNIRYELTSPAMSIAELEQNVAAQSTVDLVTIAQAMHWFDLPQFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIA WCY  PEV+ SVD+++Q +YT +   FWEP RKLVD KY TIDFP
Sbjct  121  QVKWVLKKPNGVIATWCYTVPEVNVSVDAVFQPFYTVDSDPFWEPQRKLVDNKYMTIDFP  180

Query  395  FDPVDGCEHNGPYE-FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG +  GP++ F  +K M+LE YF+YIRS S YQTAK+KGVE+L+ +++++F RAW
Sbjct  181  FEPVDGADSTGPFDRFVIEKTMDLEGYFSYIRSWSAYQTAKDKGVELLTENVIENFRRAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            NEDG+++K+V FPIYLRIGKVG
Sbjct  241  NEDGQSRKVVRFPIYLRIGKVG  262



>gb|ABK96242.1| unknown [Populus trichocarpa x Populus deltoides]
Length=263

 Score =   364 bits (935),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 209/261 (80%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF++Q KQY+E RP YPQ+LF+ IASKTP  DLVWDVGTG+GQAA SL   YKNV+G
Sbjct  1    MAELFVEQAKQYAETRPIYPQELFESIASKTPSRDLVWDVGTGSGQAARSLAGIYKNVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNV +  TPP M++ ELE  V  +SSVDLVTIAQA+HWF LP+FYQ
Sbjct  61   TDTSLKQLEFAPKLPNVNYQQTPPVMSMGELEQTVSTQSSVDLVTIAQAMHWFDLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFP
Sbjct  121  QVKWVLKKPHGVIAAWCYTIPEVNDSVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G ++ GP++F  +K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWN
Sbjct  181  FEPVEGTDNTGPFKFVTEKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG  QK+V FP++L+IGKVG
Sbjct  241  EDGHGQKVVKFPVHLKIGKVG  261



>ref|XP_011027285.1| PREDICTED: putative methyltransferase DDB_G0268948 [Populus euphratica]
Length=263

 Score =   361 bits (927),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 168/261 (64%), Positives = 208/261 (80%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF++Q KQY+E RP+YP++LF+FIASKTP  DLVWDVGTG+GQAA SL   YKNV+G
Sbjct  1    MAELFVEQAKQYAETRPSYPRELFEFIASKTPSRDLVWDVGTGSGQAARSLAGIYKNVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNVR+  TPP M++ ELE  V  +S VDLVTIAQA+HWF LP+FYQ
Sbjct  61   TDTSLKQLEFAPKLPNVRYQQTPPVMSMGELELIVSTQSGVDLVTIAQAMHWFDLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  PEV+ SVDS++  +Y+ +   +WE  RKLVD KY +IDFP
Sbjct  121  QVKWVLKKPHGVIAAWCYTIPEVNDSVDSVFNPFYSIDSDPYWELQRKLVDNKYMSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +  GP++F A K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWN
Sbjct  181  FEPVEGTDSTGPFKFIAVKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG  QK V FP++L+IGKVG
Sbjct  241  EDGHDQKAVKFPVHLKIGKVG  261



>ref|XP_011000457.1| PREDICTED: putative methyltransferase DDB_G0268948 [Populus euphratica]
Length=263

 Score =   357 bits (916),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/261 (63%), Positives = 204/261 (78%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+ Q KQY+E RP+YPQ+LF FIASKTP  DLVWDVGTG+GQAA SL   YK+V G
Sbjct  1    MAELFVNQAKQYAETRPSYPQELFQFIASKTPARDLVWDVGTGSGQAARSLAGIYKHVTG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNV +  TP  M+++ LE  V  +SSVDLVTIAQA+HWF L  FYQ
Sbjct  61   TDTSLQQLEFAPKLPNVSYHHTPSVMSMSGLERTVSTQSSVDLVTIAQAMHWFDLRAFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LK PDGVIAAWCY  PEV+ SVDS+   +Y+ +   +WEP  KL+D KY +IDFP
Sbjct  121  QVKWILKNPDGVIAAWCYTIPEVNDSVDSVLNPFYSIDSDPYWEPQLKLIDDKYMSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +H GP++F ++KLM+L+ YF Y+RSSS YQTAK KGVE+L  D+++ F RAWN
Sbjct  181  FEPVEGGDHTGPFKFVSEKLMDLDEYFTYLRSSSAYQTAKTKGVELLRDDMIESFKRAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG   K+V FP++LRIGKVG
Sbjct  241  EDGHDHKVVKFPVFLRIGKVG  261



>ref|XP_006491589.1| PREDICTED: putative methyltransferase DDB_G0268948-like isoform 
X1 [Citrus sinensis]
 ref|XP_006491590.1| PREDICTED: putative methyltransferase DDB_G0268948-like isoform 
X2 [Citrus sinensis]
Length=263

 Score =   357 bits (915),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 214/262 (82%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MAD+F+KQ KQY+E RP YP++LF FIASKTP+++LVWDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MADMFVKQAKQYAEARPNYPEELFKFIASKTPKNELVWDVGTGSGQAAASLAPIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA NLPN+R+  TPP M++ ELE NV  +SSVDLVTIA ALHWF LP FY+
Sbjct  61   TDTSPKQLEFAINLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIATALHWFDLPQFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIAAW Y +PE++ SVD++++ +++ + + F EP  KLV+ KY +IDFP
Sbjct  121  QVKWVLKKPNGVIAAWTYYWPEINESVDAVFKSFHSVDYEPFREPQHKLVENKYMSIDFP  180

Query  395  FDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG ++ GP+ +F  +KLM+L+ Y  +IRSSSGYQTAKN+GVE+L+ ++++ F  AW
Sbjct  181  FEPVDGVDNTGPFDQFVLEKLMDLDDYLTFIRSSSGYQTAKNRGVELLTDNMMEKFKVAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            N DG+++K+  FP+YLRIGKVG
Sbjct  241  NSDGQSKKVARFPVYLRIGKVG  262



>ref|XP_003632731.1| PREDICTED: putative methyltransferase DDB_G0268948 [Vitis vinifera]
Length=264

 Score =   356 bits (914),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 163/259 (63%), Positives = 197/259 (76%), Gaps = 0/259 (0%)
 Frame = -1

Query  929  ADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGT  750
            A L+  Q K+Y + RP+YP +LF FIASKTP HDL WD G G GQA +SL   YKNVV T
Sbjct  3    AKLYDTQAKEYRDIRPSYPPELFQFIASKTPIHDLAWDAGAGNGQATLSLAGIYKNVVAT  62

Query  749  DTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQ  570
            DTS NQL  AP+LPNVR+  T P MT AEL  NV  +SSVD+VT+AQALHWF +  F+QQ
Sbjct  63   DTSQNQLHLAPDLPNVRYQQTTPLMTEAELHHNVATQSSVDVVTVAQALHWFDISAFFQQ  122

Query  569  VKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFD  390
             KWVLKKP GVIAAWCY  PEV  SVDS++ RYY  ++ +W+P R ++D KYR+IDFPF 
Sbjct  123  AKWVLKKPQGVIAAWCYSAPEVDESVDSVFNRYYLESKPYWDPARNILDDKYRSIDFPFM  182

Query  389  PVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNED  210
            PVDG  H GP++FK +KL++L+ YFAY+RSSSGYQ  + KGVE+L SD+++DF RAWNED
Sbjct  183  PVDGEVHTGPFKFKTEKLLDLDDYFAYLRSSSGYQMPRKKGVELLRSDVIEDFERAWNED  242

Query  209  GKTQKIVAFPIYLRIGKVG  153
            G   KI  FPIYLRIGKVG
Sbjct  243  GNAHKIATFPIYLRIGKVG  261



>ref|XP_006442084.1| hypothetical protein CICLE_v10024496mg [Citrus clementina]
 gb|ESR55324.1| hypothetical protein CICLE_v10024496mg [Citrus clementina]
Length=264

 Score =   355 bits (911),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 212/263 (81%), Gaps = 3/263 (1%)
 Frame = -1

Query  932  MAD-LFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVV  756
            MAD LF+KQ KQY+E RP+YP +LF F+ASKTP HDLVWDVGTG+GQAA  L + YKNV+
Sbjct  1    MADQLFIKQAKQYAEVRPSYPAELFQFMASKTPDHDLVWDVGTGSGQAAKPLAKIYKNVI  60

Query  755  GTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
             TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVDLVTIA ALHWF LP FY
Sbjct  61   ATDTSPKQLEFAIKLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIAAALHWFDLPQFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDF  399
            +QVKWVLKKP+GVIAAW Y  PE++ SV ++++ + T + + FWEP RKLVD KY +IDF
Sbjct  121  KQVKWVLKKPNGVIAAWTYTMPEINESVGAVFKPFDTVDCEPFWEPQRKLVDNKYMSIDF  180

Query  398  PFDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            PF+PVDG ++ GP+ +F  +K+M+L++YF +IRS SGYQTAK+KGVE+L+ +++  F  A
Sbjct  181  PFEPVDGVDNTGPFDQFVLEKVMDLDNYFTFIRSCSGYQTAKDKGVELLTDNVMDKFKVA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKVG  153
            WNEDG++QK+  FPIYLRIGKVG
Sbjct  241  WNEDGQSQKVARFPIYLRIGKVG  263



>ref|XP_006442088.1| hypothetical protein CICLE_v10021728mg [Citrus clementina]
 gb|ESR55328.1| hypothetical protein CICLE_v10021728mg [Citrus clementina]
Length=263

 Score =   354 bits (908),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 211/262 (81%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MAD+F+KQ KQY+E RP YP++LF FIASKTP+H+L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MADMFVKQAKQYAEARPNYPEELFKFIASKTPKHELAWDVGTGSGQAAASLAPIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVDLVTIA ALHWF LP FY+
Sbjct  61   TDTSPKQLEFAIKLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIATALHWFDLPQFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIAAW Y +PE++ SVD++++ +++ + + F EP  KLV+ KY +IDFP
Sbjct  121  QVKWVLKKPNGVIAAWTYYWPEINESVDAVFKSFHSVDYEPFREPQHKLVENKYMSIDFP  180

Query  395  FDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG ++ GP+ +F  +KLM+L  Y  +IRSSSGYQTAKN+GVE+L+ ++++ F  AW
Sbjct  181  FEPVDGVDNTGPFDQFVLEKLMDLGDYLTFIRSSSGYQTAKNRGVELLTDNMMEKFKVAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            N DG+++K+  FP+YLRIGKVG
Sbjct  241  NSDGQSKKVARFPVYLRIGKVG  262



>ref|XP_002531495.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF30882.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=265

 Score =   354 bits (908),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 203/264 (77%), Gaps = 1/264 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ KQY+EGRP YPQ+LF FIASKTP   L WDVGTG+GQAA SL E YKNV+ 
Sbjct  1    MAELFIKQAKQYAEGRPNYPQELFQFIASKTPGKGLAWDVGTGSGQAAQSLAEIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNVR+  TPP + + E E  + +ESSVDLVTIAQA+HWF LP FYQ
Sbjct  61   TDTSMKQLEFAPKLPNVRYQRTPPVIPMNEFEQYISSESSVDLVTIAQAIHWFDLPAFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  PEV+ SVDS++  +YT +   FW  GRK VD KY  I FP
Sbjct  121  QVKWVLKKPHGVIAAWCYTVPEVNESVDSVFHPFYTIDSEPFWSSGRKWVDDKYTNIHFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +H GP+ F  +K+M L+ YF Y+RS S YQTAK +GV++L  ++ ++F  AWN
Sbjct  181  FEPVEGVDHTGPHRFVIEKVMSLDDYFTYLRSWSAYQTAKERGVDLLKDEVTKEFKNAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVGILD  144
            +DG+ +K+V FPIYLRIGKVG ++
Sbjct  241  KDGEDKKVVKFPIYLRIGKVGNME  264



>ref|XP_006491582.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Citrus 
sinensis]
Length=263

 Score =   353 bits (906),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 159/262 (61%), Positives = 212/262 (81%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MAD+F+KQ KQY+E RP YP++LF FIASKTP+++L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MADMFVKQAKQYAEARPNYPEELFKFIASKTPKNELAWDVGTGSGQAAASLAPIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVDLVTIA ALHWF LP FY+
Sbjct  61   TDTSPKQLEFAIKLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIATALHWFDLPQFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIAAW Y +PE++ SVD++++ +++ + + F EP  KLV+ KY +IDFP
Sbjct  121  QVKWVLKKPNGVIAAWTYYWPEINESVDAVFKSFHSVDYEPFREPQHKLVENKYMSIDFP  180

Query  395  FDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG ++ GP+ +F  +KLM+L+ Y  +IRSSSGYQTAKN+GVE+L+ ++++ F  AW
Sbjct  181  FEPVDGVDNTGPFDQFVLEKLMDLDDYLTFIRSSSGYQTAKNRGVELLTDNMMEKFKVAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            N DG+++K+  FP+YLRIGKVG
Sbjct  241  NSDGQSKKVARFPVYLRIGKVG  262



>gb|KHG22088.1| Putative methyltransferase [Gossypium arboreum]
Length=260

 Score =   352 bits (902),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/261 (64%), Positives = 203/261 (78%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ KQY++GRP+YP  LF FIASKTP+HDL WDVGTG+GQAA SL E Y NV+ 
Sbjct  1    MANLFIKQAKQYAQGRPSYPPHLFQFIASKTPQHDLAWDVGTGSGQAARSLAEIYNNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+  T P M+ AELE  VGAESSVDLVTIAQA+HWF LP FY+
Sbjct  61   TDTSPKQLEFATKLPNIRYQQTSPTMSSAELEQKVGAESSVDLVTIAQAMHWFDLPVFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVKWVLKKP G+IAAWCY  PEV+ S+D + +R+Y  +  +W+  R++VD KY+TIDFPF
Sbjct  121  QVKWVLKKPHGIIAAWCYTTPEVNDSMDQVLERFYKNS--YWDSPRQMVDDKYKTIDFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + VDG +  GP+EF+ ++ M LE YF Y+RS S YQ AK KGVE+LS  +V++F RAW E
Sbjct  179  EAVDGEDSTGPFEFENERWMGLEDYFTYLRSWSAYQKAKEKGVELLSEHVVEEFKRAWGE  238

Query  212  D-GKTQKIVAFPIYLRIGKVG  153
            D    QK V FPIYLRIGKVG
Sbjct  239  DENGGQKPVKFPIYLRIGKVG  259



>ref|XP_006442090.1| hypothetical protein CICLE_v10021734mg [Citrus clementina]
 gb|ESR55330.1| hypothetical protein CICLE_v10021734mg [Citrus clementina]
Length=263

 Score =   351 bits (900),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 159/261 (61%), Positives = 210/261 (80%), Gaps = 2/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MAD+F+KQ KQY+E RP YP++LF FIASKTP+H+L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MADMFVKQAKQYAEARPNYPEELFKFIASKTPKHELAWDVGTGSGQAAASLAPIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVDLVTIA ALHWF LP FY+
Sbjct  61   TDTSPKQLEFAIKLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIATALHWFDLPQFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIAAW Y +PE++ SVD++++ ++  + + F EP  KLV+ KY +IDFP
Sbjct  121  QVKWVLKKPNGVIAAWTYYWPEINESVDAVFKSFHFVDYEPFREPQPKLVENKYMSIDFP  180

Query  395  FDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG ++ GP+ +F  +KLM+L+ Y  +IRSSSGYQTAKN+GVE+L+ ++++ F  AW
Sbjct  181  FEPVDGVDNTGPFDQFVLEKLMDLDDYLTFIRSSSGYQTAKNRGVELLTDNMMEKFKVAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
            N DG+++K+  FP+YLRIGKV
Sbjct  241  NSDGQSKKVARFPLYLRIGKV  261



>ref|XP_009339574.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X1 
[Pyrus x bretschneideri]
Length=261

 Score =   348 bits (893),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/261 (62%), Positives = 209/261 (80%), Gaps = 2/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+DLF+KQ KQY+EGRP YP++LF++IASKTP HDL WDVGTG GQAA SL + +KNV+ 
Sbjct  1    MSDLFIKQSKQYAEGRPCYPKELFEYIASKTPCHDLAWDVGTGNGQAARSLPKIFKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPN+R+  TPP M++AE+E  +  +SSVDLVT+AQA+HWF LP FYQ
Sbjct  61   TDTSQKQLEFAPKLPNIRYEHTPPVMSIAEVEQKLTPKSSVDLVTVAQAIHWFDLPNFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVK VLKKP+GV+AAWCY  P V+S VD+++ R+YT +   +WEP RK+VD KY +IDFP
Sbjct  121  QVKHVLKKPNGVLAAWCYTVPRVNSIVDTVFDRFYTVDSDPYWEPPRKMVDDKYESIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG E+ GP+EF  ++LM+L+++F YIRS SGY TAK +GVE+LS  +++ F +AWN
Sbjct  181  FEPVDGEENTGPFEFVTEQLMDLDAFFTYIRSWSGYHTAKGRGVELLSDHVIEAFKQAWN  240

Query  215  EDG-KTQKIVAFPIYLRIGKV  156
            E G   QK V FP+YLRIGKV
Sbjct  241  EGGDHGQKPVKFPVYLRIGKV  261



>ref|XP_009339575.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X2 
[Pyrus x bretschneideri]
Length=261

 Score =   348 bits (892),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 209/261 (80%), Gaps = 2/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+DLF+KQ KQY+EGRP YP++LF++IASKTP HDL WDVGTG GQAA S+ + +KNV+ 
Sbjct  1    MSDLFIKQSKQYAEGRPCYPKELFEYIASKTPCHDLAWDVGTGNGQAARSVTKIFKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPN+R+  TPP M++AE+E  +  +SSVDLVT+AQA+HWF LP FYQ
Sbjct  61   TDTSQKQLEFAPKLPNIRYEHTPPVMSIAEVEQKLTPKSSVDLVTVAQAIHWFDLPNFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVK VLKKP+GV+AAWCY  P V+S VD+++ R+YT +   +WEP RK+VD KY +IDFP
Sbjct  121  QVKHVLKKPNGVLAAWCYTVPRVNSIVDTVFDRFYTVDSDPYWEPPRKMVDDKYESIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG E+ GP+EF  ++LM+L+++F YIRS SGY TAK +GVE+LS  +++ F +AWN
Sbjct  181  FEPVDGEENTGPFEFVTEQLMDLDAFFTYIRSWSGYHTAKGRGVELLSDHVIEAFKQAWN  240

Query  215  EDG-KTQKIVAFPIYLRIGKV  156
            E G   QK V FP+YLRIGKV
Sbjct  241  EGGDHGQKPVKFPVYLRIGKV  261



>ref|XP_010036343.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
 gb|KCW47880.1| hypothetical protein EUGRSUZ_K01626 [Eucalyptus grandis]
Length=263

 Score =   347 bits (891),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/261 (62%), Positives = 201/261 (77%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ +QY   RP+YP QLF FIASKTP  +L WD GTG+GQAA SL E Y NVV 
Sbjct  1    MAELFVKQAQQYVAARPSYPPQLFRFIASKTPARNLAWDAGTGSGQAAQSLAEIYGNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FAP LPNVR+  T P M++AEL+  V A SSVDLVT+AQALHWF LPTFY+
Sbjct  61   TDTSPKQLEFAPRLPNVRYELTSPVMSMAELDRKVSAASSVDLVTVAQALHWFDLPTFYR  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVK VLKKP GVIAAWCY  PEV   V+S+++R+Y+ + + +W+P RKLVD +YR IDFP
Sbjct  121  QVKHVLKKPHGVIAAWCYTIPEVDGPVNSVFRRFYSVDSNPYWDPARKLVDGEYRGIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G E  GP  F  ++ M +E +  YIRS SGYQTAK KGVE+LS D V+ F RAW 
Sbjct  181  FEPVEGMEDTGPVRFVTERTMGVEDFLTYIRSWSGYQTAKEKGVELLSGDTVERFRRAWA  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            +DG+ +K+V FP++L+IG+VG
Sbjct  241  DDGEDKKVVKFPVFLKIGRVG  261



>emb|CBI30090.3| unnamed protein product [Vitis vinifera]
Length=530

 Score =   356 bits (914),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 166/265 (63%), Positives = 201/265 (76%), Gaps = 1/265 (0%)
 Frame = -1

Query  944  ELKKMA-DLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKY  768
            E K+MA  L+  Q K+Y + RP+YP +LF FIASKTP HDL WD G G GQA +SL   Y
Sbjct  263  ERKEMAAKLYDTQAKEYRDIRPSYPPELFQFIASKTPIHDLAWDAGAGNGQATLSLAGIY  322

Query  767  KNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHL  588
            KNVV TDTS NQL  AP+LPNVR+  T P MT AEL  NV  +SSVD+VT+AQALHWF +
Sbjct  323  KNVVATDTSQNQLHLAPDLPNVRYQQTTPLMTEAELHHNVATQSSVDVVTVAQALHWFDI  382

Query  587  PTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRT  408
              F+QQ KWVLKKP GVIAAWCY  PEV  SVDS++ RYY  ++ +W+P R ++D KYR+
Sbjct  383  SAFFQQAKWVLKKPQGVIAAWCYSAPEVDESVDSVFNRYYLESKPYWDPARNILDDKYRS  442

Query  407  IDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            IDFPF PVDG  H GP++FK +KL++L+ YFAY+RSSSGYQ  + KGVE+L SD+++DF 
Sbjct  443  IDFPFMPVDGEVHTGPFKFKTEKLLDLDDYFAYLRSSSGYQMPRKKGVELLRSDVIEDFE  502

Query  227  RAWNEDGKTQKIVAFPIYLRIGKVG  153
            RAWNEDG   KI  FPIYLRIGKVG
Sbjct  503  RAWNEDGNAHKIATFPIYLRIGKVG  527


 Score =   337 bits (865),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 196/261 (75%), Gaps = 0/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M D + K   +YSE RP YP +LF FIASKTP  DL WDVG G GQAA SL   YKNVV 
Sbjct  1    MGDFYDKLANRYSEIRPNYPPELFQFIASKTPVRDLAWDVGAGNGQAARSLAGMYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL  AP LPNVR+  T P  T+A++E +V  +SSVDL+TIAQA+HWF LP FYQ
Sbjct  61   TDISQKQLDLAPKLPNVRYQQTSPVSTIADIEHDVAPQSSVDLITIAQAVHWFDLPKFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q KWVLKKP GVIAAWCY   E + SVDS++ R+Y   + +W+P R  +D +YR+I+FPF
Sbjct  121  QAKWVLKKPHGVIAAWCYTPAEFNQSVDSVFARFYIDAKPYWDPARYHLDDRYRSIEFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
             PV+G +H GP++FK ++ M+L+SYFAY+R+ SGYQTA+  GVE+L+S++++DF RAWNE
Sbjct  181  MPVEGEDHTGPFKFKTERQMDLDSYFAYLRTWSGYQTAQKNGVELLTSNVIEDFERAWNE  240

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
            DG  QKI  FPIYLRIGKVGI
Sbjct  241  DGGGQKIGVFPIYLRIGKVGI  261



>ref|XP_004293308.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Fragaria 
vesca subsp. vesca]
Length=264

 Score =   347 bits (889),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/263 (64%), Positives = 208/263 (79%), Gaps = 3/263 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLFLKQ KQY+ GRP YP++LF FIASK P HDL WDVGTGTGQAA SL E YKNVV 
Sbjct  1    MADLFLKQSKQYAVGRPGYPEKLFQFIASKAPAHDLAWDVGTGTGQAARSLAEIYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGA-ESSVDLVTIAQALHWFHLPTFY  576
            TDTS  QL+ AP LPNVR+V T   +T+ E+E  V A +SSVDLVTIAQALHWF LP+FY
Sbjct  61   TDTSQTQLECAPKLPNVRYVHTSAVLTIPEIEQKVLAPKSSVDLVTIAQALHWFDLPSFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDF  399
            +QVKWVLKKP+GVIAAWCY  P ++++VD+++ R+Y+ + + +WEP RKLVD KY TIDF
Sbjct  121  EQVKWVLKKPNGVIAAWCYTLPRINNNVDTLFGRFYSIDVEPYWEPPRKLVDNKYSTIDF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+PV G    GP+EF A+ LM L+ +F Y+RS SGYQTAK+KGVE+L+ D+++ F +AW
Sbjct  181  PFEPVSGEGSTGPFEFAAETLMGLDDFFTYLRSWSGYQTAKDKGVELLNEDVMEQFKQAW  240

Query  218  NED-GKTQKIVAFPIYLRIGKVG  153
            N D G  QK+V + IYLRIG+VG
Sbjct  241  NVDGGDGQKVVNYTIYLRIGRVG  263



>ref|XP_006421281.1| hypothetical protein CICLE_v10005653mg [Citrus clementina]
 gb|ESR34521.1| hypothetical protein CICLE_v10005653mg [Citrus clementina]
Length=263

 Score =   346 bits (887),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 210/261 (80%), Gaps = 2/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MAD+F+KQ KQY+E RP YP++LF FIASKTP+H+L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MADMFVKQAKQYAEARPNYPEELFKFIASKTPKHELAWDVGTGSGQAAASLAPIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVDLVTIA ALHWF LP FY+
Sbjct  61   TDTSPKQLEFAIKLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIATALHWFDLPQFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIAAW Y +P+++  VD++++ +++ + + F EP  KLV+ KY +IDFP
Sbjct  121  QVKWVLKKPNGVIAAWTYYWPKINEFVDAVFKSFHSVDYEPFREPQPKLVENKYMSIDFP  180

Query  395  FDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG ++ GP+ +F  +KLM+L+ Y  +I+SSSGYQTAKN+GVE+L+ ++++ F  AW
Sbjct  181  FEPVDGVDNTGPFDQFVLEKLMDLDDYLTFIQSSSGYQTAKNRGVELLTDNMMEKFNVAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
            N DG+++K+  FP+YLRIGKV
Sbjct  241  NSDGQSKKVARFPLYLRIGKV  261



>gb|KHN30375.1| Putative methyltransferase [Glycine soja]
Length=261

 Score =   346 bits (887),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/261 (61%), Positives = 198/261 (76%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LFLKQ KQY++ RP+YP QLF FIASKTP H+L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MAKLFLKQAKQYADARPSYPPQLFQFIASKTPSHNLAWDVGTGSGQAAKSLAAIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M+ AELE  V ++ ++DLVTIAQALHWF  PTFY+
Sbjct  61   TDASDKQLEFAAKLPNVRYQHTPSTMSTAELEQMVASKGTIDLVTIAQALHWFDRPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP G+IAAWCY  P VS + D+++ ++Y+TN   +W+P RK VD  YR+IDFP
Sbjct  121  QVKWVLKKPHGIIAAWCYYLPRVSDAFDTVFDQFYSTNVSPYWDPARKWVDDNYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG +H GP+EF  + +M+L+ +  YIRS S YQTAK KGVE+L+ D+V+ F  AW 
Sbjct  181  FEPVDGADHTGPFEFVTETMMDLDDFLTYIRSWSAYQTAKEKGVELLAEDVVEKFKLAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            ED K  K+V FPIYLRIG+ G
Sbjct  241  EDAK--KVVKFPIYLRIGRTG  259



>gb|AFY98896.1| S-adenosylmethionine-dependent methyltransferase [Jatropha curcas]
 gb|KDP26233.1| hypothetical protein JCGZ_22479 [Jatropha curcas]
Length=263

 Score =   345 bits (884),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 199/261 (76%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ KQY+E RP+YP++LF FIASKTP  DL WDVGTG+GQA  SL E +KNV+ 
Sbjct  1    MAQLFIKQAKQYAEARPSYPKELFQFIASKTPIKDLAWDVGTGSGQAVHSLAEIFKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNVR+  TPP + + E E  +  ESSVDLVTIAQA+HWF LP FY 
Sbjct  61   TDTSSKQLEFAPKLPNVRYQQTPPTIPMEEFEQYISIESSVDLVTIAQAMHWFDLPKFYH  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  PEV+ S+DS+++ +Y  +   +WE GRK VD KY+ I FP
Sbjct  121  QVKWVLKKPHGVIAAWCYTVPEVNDSIDSVFKPFYAIDSEPYWEAGRKWVDDKYQNIYFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +  GP +F  +++M L+ +F Y+RS S YQTAK KGV++L +D+++ F  AWN
Sbjct  181  FEPVEGSDDTGPVKFVIERVMRLDDFFTYLRSWSAYQTAKEKGVDLLRNDVIEKFKNAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG  +K+V FP+YLRIGKVG
Sbjct  241  EDGSDEKVVKFPVYLRIGKVG  261



>emb|CDP14219.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   343 bits (881),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 198/261 (76%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLFL   +QYS  RP YPQ+LF FIASKTP HDL WDVGTG+GQAA+SL + +KNV+ 
Sbjct  1    MADLFLNHAEQYSVSRPNYPQELFHFIASKTPHHDLAWDVGTGSGQAALSLAKIFKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QLQ+AP LPNVR+  T P M+  ELE +V    +VDLVTI QA+HWF LPTF+Q
Sbjct  61   TDTSQKQLQYAPKLPNVRYRSTSPAMSAEELERDVAKPDTVDLVTIGQAIHWFDLPTFFQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVK VLK+P GVIAAWCY  P+V+  VD++++++Y  +   +W PGR LV  KY +++FP
Sbjct  121  QVKLVLKRPQGVIAAWCYTTPQVNDRVDAVFRQFYFVDSRPYWHPGRNLVFDKYESMEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F PVDG EH GP+EF  +KLM+L+ Y  Y +S S YQTA  KG+++LS D++++FT AWN
Sbjct  181  FLPVDGAEHTGPFEFITEKLMDLDHYLRYAKSGSAYQTALEKGIDLLSEDVIEEFTSAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG  +K V FP+YLRIGKVG
Sbjct  241  EDGSNKKSVKFPVYLRIGKVG  261



>ref|XP_007028540.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY09042.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=260

 Score =   343 bits (881),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/262 (63%), Positives = 197/262 (75%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M++LF+KQ K Y+  RP+Y  +LF FIASKTP HDL WDVGTG+GQAA SL E YK V+ 
Sbjct  1    MSNLFIKQAKHYAVARPSYAPELFQFIASKTPEHDLAWDVGTGSGQAAQSLAEIYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+ A  LPN+++  T P M+LAE+E  V A SSVDLVT+AQA+HWF LP FY+
Sbjct  61   TDTSPTQLELASKLPNIQYQHTSPVMSLAEVEQKVAAASSVDLVTVAQAIHWFDLPVFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVK VLKKP G+IAAWCY  PEV+  VD I QR+Y     +W+P RKLVD KY  IDFPF
Sbjct  121  QVKMVLKKPHGLIAAWCYTTPEVNDYVDKILQRFY--RNPYWDPQRKLVDHKYIGIDFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            +PVDG +  GP+EF  ++LM LE YF Y+RS S YQ AK KGVE+LS D+V+DF RAW E
Sbjct  179  EPVDGADSTGPFEFANERLMGLEDYFTYLRSWSAYQKAKEKGVELLSQDVVEDFKRAWKE  238

Query  212  DGKT-QKIVAFPIYLRIGKVGI  150
            DG   QK V FP+YLRIGKVG+
Sbjct  239  DGNNDQKRVNFPVYLRIGKVGL  260



>ref|XP_007202465.1| hypothetical protein PRUPE_ppa010137mg [Prunus persica]
 gb|EMJ03664.1| hypothetical protein PRUPE_ppa010137mg [Prunus persica]
Length=262

 Score =   343 bits (880),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 201/261 (77%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF+KQ KQY++ RP YP++LFD++ASKT  HDL WDVGTG GQAA SL   YKNV+ 
Sbjct  1    MADLFIKQSKQYAKARPDYPEELFDYVASKTNCHDLAWDVGTGNGQAAGSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPN+R+  TP  M++AE+E  +  +SS+DLV +AQALHWF LPTFYQ
Sbjct  61   TDTSQKQLEFAIKLPNIRYEHTPAVMSIAEVEQKLAPKSSIDLVIVAQALHWFDLPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
             V WVLKKP+GVIAAWCY  P V+++VD+++ R+YT +   +W+P RKLVD KYR+IDFP
Sbjct  121  GVNWVLKKPNGVIAAWCYTVPRVNNAVDTVFDRFYTVDVDPYWDPQRKLVDNKYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F PVDG E+ GP+EF  ++LM+L+ +F YIRS S YQTAK KGVE+LS D++  F  AWN
Sbjct  181  FAPVDGEENTGPFEFVTERLMDLDGFFTYIRSWSAYQTAKEKGVELLSDDVIAAFREAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            + G   K V FP+ LRIG+VG
Sbjct  241  DGGDGNKAVKFPVNLRIGRVG  261



>ref|XP_008240724.1| PREDICTED: putative methyltransferase DDB_G0268948 [Prunus mume]
Length=262

 Score =   342 bits (877),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/261 (61%), Positives = 200/261 (77%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF+KQ KQY++ RP YP++LFDFIASKT  HDL WDVGTG GQAA SL   YKNV+ 
Sbjct  1    MADLFIKQSKQYAKARPDYPEELFDFIASKTNCHDLAWDVGTGNGQAAGSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPN+R+  TP  +++AE+E  +  +SS+DLV +AQALHWF LPTFYQ
Sbjct  61   TDTSQKQLEFAIKLPNIRYEHTPAVLSIAEIEQKLAPKSSIDLVIVAQALHWFDLPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
             V WVLKKP+GVIAAWCY  P V++ VD+++ R+YT +   +W+P RKLVD KYR+IDFP
Sbjct  121  GVNWVLKKPNGVIAAWCYTVPRVNNVVDTVFDRFYTVDVDPYWDPQRKLVDNKYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F PVDG ++ GP+EF  ++LM+L+ +F YIRS S YQTAK KGVE+LS D++  F  AWN
Sbjct  181  FAPVDGEDNTGPFEFMTERLMDLDGFFTYIRSWSAYQTAKEKGVELLSDDVIAAFREAWN  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            + G   K V FP+ LRIG+VG
Sbjct  241  DGGDGNKAVKFPVNLRIGRVG  261



>ref|XP_008392394.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=265

 Score =   339 bits (869),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 205/261 (79%), Gaps = 2/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M++LF+KQ KQY+E RP YP++LF++IASKTP HDL WDVGTG+GQAA SL   +KNV+ 
Sbjct  1    MSELFIKQSKQYAETRPCYPEELFEYIASKTPCHDLAWDVGTGSGQAARSLAGIFKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+ AP LPN+ +  TPP M++AE+E  +  +SSVDLV +AQALHWF LP FYQ
Sbjct  61   TDTSQKQLELAPKLPNISYEHTPPVMSIAEVEQKLTPKSSVDLVIVAQALHWFDLPNFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVK VLKKP+GV+AAWCY  P V+S VD+++ R+YT +   +W+P RKLVD KY++I+FP
Sbjct  121  QVKHVLKKPNGVLAAWCYTVPRVNSIVDTVFDRFYTVDSDPYWDPARKLVDDKYKSIEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG E+ GP+EF  ++LM+L+ +F YIRS S YQTAK KGVE+LSS +++ F + WN
Sbjct  181  FEPVDGEENTGPFEFVTEQLMDLDGFFTYIRSWSAYQTAKEKGVELLSSHMIEAFKQTWN  240

Query  215  EDG-KTQKIVAFPIYLRIGKV  156
            E G   QK+V FP+ LRIGKV
Sbjct  241  EGGDHGQKVVKFPVNLRIGKV  261



>ref|XP_010246243.1| PREDICTED: putative methyltransferase DDB_G0268948 [Nelumbo nucifera]
Length=262

 Score =   337 bits (863),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 153/260 (59%), Positives = 196/260 (75%), Gaps = 0/260 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF  Q KQYSE RP+YP +LF FI+SKTP H+L WDVGTG+GQ+A SL   YKNVV 
Sbjct  1    MADLFNVQAKQYSETRPSYPPELFQFISSKTPSHNLAWDVGTGSGQSAKSLAGIYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL FA  LPN+R+  T P M++ E+E  V  ++SVD+VT+AQALHW  LP FYQ
Sbjct  61   TDTSQEQLAFASKLPNIRYQQTLPIMSIDEVEQQVARQASVDVVTVAQALHWIDLPNFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QV WVLK+P GVIA WCY  PEVS SVD ++ R Y  +  +W P RKLVD KY++I FPF
Sbjct  121  QVNWVLKRPHGVIAVWCYIEPEVSDSVDDVFWRVYRESGPYWAPARKLVDDKYQSIHFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            +PV+G +H GP++F++ + M L+ Y  YIRS S YQTA+  GVE+L  D+++DF RAW +
Sbjct  181  EPVEGTDHTGPFKFESNQSMNLDIYLTYIRSWSAYQTARKAGVELLREDVIEDFKRAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKVG  153
            DG+++K+V FP+YLR+GKVG
Sbjct  241  DGRSEKVVRFPVYLRMGKVG  260



>emb|CDP09511.1| unnamed protein product [Coffea canephora]
Length=535

 Score =   346 bits (887),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 202/263 (77%), Gaps = 2/263 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+L+ KQ KQYSE RPTYP++LF FIASKTP HDL WDVGTG+GQAA +L   YKNVV 
Sbjct  1    MAELYNKQAKQYSESRPTYPEELFQFIASKTPCHDLAWDVGTGSGQAARTLAGIYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+ CTPP M++AELE NV AESSVDLVT A A+HWF LPTFYQ
Sbjct  61   TDTSPKQLEFALKLPNIRYQCTPPKMSIAELEQNVSAESSVDLVTSAAAMHWFDLPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEV-SSSVDSIYQRYYTTNQHFWEP-GRKLVDQKYRTIDF  399
            QVKW+LKKPDGVIAAW Y   E+ ++S +++ Q  Y     + +P  R  V  +YRTIDF
Sbjct  121  QVKWILKKPDGVIAAWSYAKAEINAASANTLLQILYDNCDPYCDPRARYFVHDRYRTIDF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF PVDG EH GP+EFK ++LM+L+  F +I+S S YQTAK+ GVE+LS D+VQDFTRAW
Sbjct  181  PFQPVDGLEHTGPFEFKTERLMDLDDCFTFIKSWSPYQTAKDAGVELLSDDVVQDFTRAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVGI  150
            +ED   +K+  FPI L++GK  +
Sbjct  241  HEDANPKKVATFPISLKVGKTTV  263


 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 202/267 (76%), Gaps = 2/267 (1%)
 Frame = -1

Query  947  EELKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKY  768
            E   +MA+L+ KQ KQYSE RPTYP++LF FIAS+TP HDL WDVGTG+GQAA +L   Y
Sbjct  265  EGRSEMAELYDKQAKQYSESRPTYPEELFQFIASRTPCHDLAWDVGTGSGQAARTLAGIY  324

Query  767  KNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHL  588
            KNVV TDTSP QL+FA  LPN+R+ CTPP M++AELE NV AESSVDLVT A A+HWF L
Sbjct  325  KNVVATDTSPKQLEFALKLPNIRYQCTPPKMSIAELEQNVSAESSVDLVTSAAAMHWFDL  384

Query  587  PTFYQQVKWVLKKPDGVIAAWCYDFPEV-SSSVDSIYQRYYTTNQHFWEP-GRKLVDQKY  414
            PTFYQQVKW+LKKPDGVIAAW Y   E+ +S+ +++ Q+ Y     + +P  R  +  KY
Sbjct  385  PTFYQQVKWILKKPDGVIAAWSYAKAEINASAANALLQKLYDDRDPYCDPRARFFLHDKY  444

Query  413  RTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQD  234
            RTIDFPF PVDG +H GP+EFK + LM+L+  FA+I+S + YQ AK+ GVE+L  D VQ 
Sbjct  445  RTIDFPFQPVDGLDHTGPFEFKMEWLMDLDDCFAFIKSWAHYQAAKDTGVELLHDDFVQG  504

Query  233  FTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            FTRAW+EDG  +KI  F I LRIGKVG
Sbjct  505  FTRAWHEDGNPKKIATFRINLRIGKVG  531



>ref|XP_003632730.1| PREDICTED: putative methyltransferase DDB_G0268948 [Vitis vinifera]
Length=276

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 157/261 (60%), Positives = 196/261 (75%), Gaps = 0/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M D + K   +YSE RP YP +LF FIASKTP  DL WDVG G GQAA SL   YKNVV 
Sbjct  1    MGDFYDKLANRYSEIRPNYPPELFQFIASKTPVRDLAWDVGAGNGQAARSLAGMYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL  AP LPNVR+  T P  T+A++E +V  +SSVDL+TIAQA+HWF LP FYQ
Sbjct  61   TDISQKQLDLAPKLPNVRYQQTSPVSTIADIEHDVAPQSSVDLITIAQAVHWFDLPKFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q KWVLKKP GVIAAWCY   E + SVDS++ R+Y   + +W+P R  +D +YR+I+FPF
Sbjct  121  QAKWVLKKPHGVIAAWCYTPAEFNQSVDSVFARFYIDAKPYWDPARYHLDDRYRSIEFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
             PV+G +H GP++FK ++ M+L+SYFAY+R+ SGYQTA+  GVE+L+S++++DF RAWNE
Sbjct  181  MPVEGEDHTGPFKFKTERQMDLDSYFAYLRTWSGYQTAQKNGVELLTSNVIEDFERAWNE  240

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
            DG  QKI  FPIYLRIGKVGI
Sbjct  241  DGGGQKIGVFPIYLRIGKVGI  261



>emb|CDP09514.1| unnamed protein product [Coffea canephora]
Length=264

 Score =   335 bits (859),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/262 (60%), Positives = 199/262 (76%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+ F+KQ K+YS  RP YP++LF F+ASKTP HDLVWD GTG+GQAA SL   YKNVV 
Sbjct  1    MAERFVKQAKEYSASRPIYPEELFQFVASKTPCHDLVWDAGTGSGQAATSLARIYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+ A  LPN+++ CT P M++AEL+ ++ AESSVDLVTIA A+HWF LP+FYQ
Sbjct  61   TDTSPTQLEHAVKLPNIKYHCTSPKMSIAELKQSIAAESSVDLVTIATAIHWFDLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQR-YYTTNQHFWEPGRKLV-DQKYRTIDF  399
            QVK VLKKP+GVIAAW Y  P ++ ++D++  + YY     F  P  KL+ ++ YRTIDF
Sbjct  121  QVKCVLKKPNGVIAAWSYTLPRINKNLDTLLTKLYYVGAAPFGGPPPKLIMEENYRTIDF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+PVDG E+ GP E K +KL++L+ YF  I+S S YQ AK  GVE+L  DLV+DFT AW
Sbjct  181  PFEPVDGLENTGPLELKMEKLIDLDGYFTLIKSWSAYQAAKENGVELLGEDLVKDFTLAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            NEDGK +KI  +P+Y+RIGKVG
Sbjct  241  NEDGKQEKIATWPVYMRIGKVG  262



>ref|XP_004293307.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Fragaria 
vesca subsp. vesca]
Length=263

 Score =   334 bits (856),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 160/262 (61%), Positives = 201/262 (77%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY   RP YP++LF FIASK   HDL WDVGTG+GQAA  L E +KNVV 
Sbjct  1    MANLFLKQSKQYVVARPGYPEKLFQFIASKAAAHDLAWDVGTGSGQAARPLAEIFKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+ AP LPNVR+V TP  +T+ E+E  +  +SSVDLVTIAQALHWF LP+FY+
Sbjct  61   TDTSQKQLECAPKLPNVRYVHTPAVLTIPEIEQKLAPKSSVDLVTIAQALHWFDLPSFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP+GVIAAWCY  P V+++VD+++ R+Y+ + + +WEP RKLVD KY TIDFP
Sbjct  121  QVKWVLKKPNGVIAAWCYTVPRVNNTVDTVFDRFYSIDVEPYWEPPRKLVDNKYSTIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V G    GP+EF  + LM L+ +F YIRS S YQTAK+KGVE+L+ D+++ F +AWN
Sbjct  181  FELVSGEGSTGPFEFATEILMGLDDFFTYIRSWSAYQTAKDKGVELLNEDVMEQFKQAWN  240

Query  215  ED-GKTQKIVAFPIYLRIGKVG  153
             D G  QK+V +PI LRIG+VG
Sbjct  241  VDGGDGQKVVNYPINLRIGRVG  262



>ref|XP_010938137.1| PREDICTED: putative methyltransferase DDB_G0268948 [Elaeis guineensis]
Length=261

 Score =   333 bits (854),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 150/259 (58%), Positives = 192/259 (74%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF KQ K Y+E RP YPQ+LF FIASKTP HDL WDVGTG+GQAA+SL + Y NVV 
Sbjct  1    MAELFRKQAKNYAEARPNYPQELFQFIASKTPNHDLAWDVGTGSGQAAVSLAKIYNNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL FAP LPN+R+V TP  +++ +L+ +V A S+VDL+T+AQA+HWFHLPTFY 
Sbjct  61   TDTSREQLAFAPKLPNIRYVHTPATVSVPDLQRDVAAPSTVDLITVAQAIHWFHLPTFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q + +L+ P GV+AAWCY+ P V  +VDS+  R Y  ++ FW P R+ VD + R+IDFPF
Sbjct  121  QARRLLRGPHGVLAAWCYNLPRVDPAVDSVLSRLYAESRPFWAPQRRTVDDELRSIDFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPV+G  H GP+E   +K M+LE Y  YIRS S YQTA+ KGVE+LS  L  D  +AW  
Sbjct  181  DPVEGEGHTGPFECTEEKEMDLEMYLTYIRSWSAYQTAREKGVELLSDGLASDLEKAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            DGK  K+V +PI+L+IGK+
Sbjct  241  DGKAVKVVRYPIFLKIGKM  259



>ref|XP_007162109.1| hypothetical protein PHAVU_001G124800g [Phaseolus vulgaris]
 gb|ESW34103.1| hypothetical protein PHAVU_001G124800g [Phaseolus vulgaris]
Length=261

 Score =   333 bits (854),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/261 (59%), Positives = 196/261 (75%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF+KQ K+Y++ RP+YP QLF FIASKTP H L WDVGTG+GQAA SL   Y+ V+ 
Sbjct  1    MADLFVKQAKEYADARPSYPPQLFQFIASKTPSHSLAWDVGTGSGQAAKSLSVIYEKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  + NVR+  TPP M++AELE  V +E SVDLVTIAQ+LHWF +PTFYQ
Sbjct  61   TDASAKQLEFAVKICNVRYQHTPPIMSMAELEEMVASEGSVDLVTIAQSLHWFDMPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKP GVIAAWCY  P V   VD++   +Y++    +W+P RKLVD+ Y +IDFP
Sbjct  121  QVKWILKKPHGVIAAWCYYLPRVCDEVDTVLDEFYSSEVGPYWDPARKLVDKLYGSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +H GP+EF  + LM L+ +F YI+S S YQTAK KGVE+L+ ++VQ F  +W 
Sbjct  181  FEPVEGADHTGPFEFVTETLMNLDDFFTYIKSWSAYQTAKEKGVELLAEEVVQKFKLSWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            ED K  ++  FPIYLR+GKVG
Sbjct  241  EDAK--RVARFPIYLRMGKVG  259



>ref|XP_010672977.1| PREDICTED: putative methyltransferase DDB_G0268948 [Beta vulgaris 
subsp. vulgaris]
Length=268

 Score =   333 bits (854),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/265 (59%), Positives = 202/265 (76%), Gaps = 3/265 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ KQY+  RPTYP+QLF+FIASKTP H LVWDVGTG+GQA   L + YKNV+G
Sbjct  1    MAELFIKQAKQYAVVRPTYPKQLFEFIASKTPFHHLVWDVGTGSGQAIPPLAKMYKNVIG  60

Query  752  TDTSPNQLQFAPNLPNVRF-VCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
            TDTS  QL+FAP LPNV++   T P M++ EL+ NV ++S++DLVTIAQALHWF  P F+
Sbjct  61   TDTSQKQLEFAPKLPNVKYHHHTSPIMSIEELQQNVASQSTIDLVTIAQALHWFDHPQFF  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDF  399
             QVKW LKKP+G+IAAWCY  PEV+  VD+++  +Y  +   +WE  RK VD KY+ I F
Sbjct  121  DQVKWALKKPNGIIAAWCYTTPEVNEDVDAVFGLFYKVDSGPYWEEARKRVDNKYKDISF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ +DG +H GP+EFKA+K+M LE Y  YIRS S Y TAK KGVE+L+ ++V+ F  AW
Sbjct  181  PFEAIDGLDHTGPFEFKAEKVMNLEEYLMYIRSWSAYITAKEKGVELLTDEVVEKFKHAW  240

Query  218  N-EDGKTQKIVAFPIYLRIGKVGIL  147
            N   G+++K++ FPIYLRIGKVG L
Sbjct  241  NISGGESEKVMKFPIYLRIGKVGKL  265



>ref|XP_006442086.1| hypothetical protein CICLE_v10023900mg [Citrus clementina]
 gb|ESR55326.1| hypothetical protein CICLE_v10023900mg [Citrus clementina]
Length=262

 Score =   332 bits (850),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/262 (59%), Positives = 203/262 (77%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ K Y+  RP YP++LF  IASKTP+ +L WDVGTG+GQAA SL + Y++V+ 
Sbjct  1    MAELFIKQAKLYTVARPNYPKELFKLIASKTPKRNLAWDVGTGSGQAAASLAQIYQHVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPN+R+  T P M++ EL  NV  +SSVDLVTIA ALHWF LP FY+
Sbjct  61   TDTSPKQLKFAIKLPNIRYQLT-PTMSITELGQNVATQSSVDLVTIASALHWFDLPQFYK  119

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAW Y  PE++ SV ++++ + T + + FW P RKLVD+KY TIDFP
Sbjct  120  QVKWVLKKPSGVIAAWTYTMPEINESVGAVFKPFNTIDCNPFWAPQRKLVDKKYMTIDFP  179

Query  395  FDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+PVDG E+ GP+ +F  ++LM+L+ YF +IRS S YQ AK+KGVE+L+ ++++ F  AW
Sbjct  180  FEPVDGYENTGPFDQFVVERLMDLDDYFKFIRSCSAYQKAKDKGVELLTENVMEKFKAAW  239

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            NEDG++QKI  F +YLRIGKVG
Sbjct  240  NEDGQSQKIARFRVYLRIGKVG  261



>ref|XP_010090906.1| Putative methyltransferase [Morus notabilis]
 gb|EXB41194.1| Putative methyltransferase [Morus notabilis]
Length=267

 Score =   331 bits (848),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 159/263 (60%), Positives = 199/263 (76%), Gaps = 3/263 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY+E RP YP++LF+FIASKTP HDLVWDVGTG+GQAA SL   YK V+ 
Sbjct  1    MAELFLKQAKQYAEARPDYPKELFEFIASKTPCHDLVWDVGTGSGQAAQSLAGIYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QLQ AP L N+R+  TPP M++A++E  +  +SS+DLVTIAQALHWF L  FY 
Sbjct  61   TDTSLKQLQEAPKLANIRYEHTPPVMSIAQVEQKLTPKSSLDLVTIAQALHWFDLQNFYD  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYT-TNQHFWEPGRKLVDQKYRTIDFP  396
            QVKW LKKP+GV+AAWCY  P V++SVD I  R YT   + + +P RK VD +YR IDFP
Sbjct  121  QVKWALKKPNGVVAAWCYTLPRVNASVDKIMDRLYTICAEPYSDPLRKFVDDEYRGIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V+G    GP+EF  +K+M+LE +F YIRS S YQTAK+KGVE+L SD+V++F RAW 
Sbjct  181  FEAVEGACETGPFEFVIEKVMDLEGFFNYIRSWSAYQTAKDKGVELLGSDIVEEFKRAWE  240

Query  215  ED--GKTQKIVAFPIYLRIGKVG  153
             D  G  +K+V  P++LRIGKVG
Sbjct  241  NDEGGDCKKVVKCPLFLRIGKVG  263



>emb|CDP14218.1| unnamed protein product [Coffea canephora]
Length=270

 Score =   331 bits (849),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 194/262 (74%), Gaps = 1/262 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+LKQGK YS+ RP YP++LF FIASKTP HDLVWD GTG GQAA SL + YKNV+ 
Sbjct  1    MAYLYLKQGKNYSQSRPNYPEELFHFIASKTPHHDLVWDAGTGNGQAASSLAKIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+ A  LPNV++ CT P M+  ELE +V  +++VDLVT+ QA+HWF  P FYQ
Sbjct  61   TDTSQKQLELASRLPNVQYKCTSPTMSAEELERDVAKQATVDLVTVGQAIHWFDRPKFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QV+ VLKKP GVIAAWCY  P+V++ VD+++ ++Y  +   +W PGR L+  KY +I+FP
Sbjct  121  QVQLVLKKPQGVIAAWCYTTPQVNARVDAVFNKFYFVDSRPYWHPGRNLIYDKYESIEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F PV+G E+ GP+EF  +KLM L+   AY +S S Y+TA  KGV+++S D++++F  AW 
Sbjct  181  FFPVEGAENTGPFEFMTEKLMSLDELLAYAKSGSAYETALEKGVDLMSEDVIEEFRSAWA  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
            EDG  QK+  FPIYLRIGK G+
Sbjct  241  EDGNNQKVAKFPIYLRIGKAGM  262



>ref|XP_010543932.1| PREDICTED: putative methyltransferase DDB_G0268948 [Tarenaya 
hassleriana]
Length=264

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/261 (58%), Positives = 196/261 (75%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ  +Y+  RP YP +LF+FIASKTP HDL WDVGTG+GQA  SL   YKNVV 
Sbjct  1    MANLFIKQAGEYAAARPNYPTKLFEFIASKTPCHDLAWDVGTGSGQAVSSLARIYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP+QL+FAP LPN R+  TPP M+L+E+   V  ESS DLVT+AQALHWF LPTFY 
Sbjct  61   TDTSPSQLEFAPKLPNARYQLTPPVMSLSEIAGLVAPESSADLVTVAQALHWFDLPTFYG  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKP GV AAWCY  PEV+S+VD +++RYY+ +   +W+  R+LV+ +YR+I+FP
Sbjct  121  HVKHVLKKPHGVFAAWCYTNPEVNSAVDEVFRRYYSESLGPYWDKARRLVEDEYRSIEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG     P  F A++ M +E Y  Y+RSSS YQTA+ KG+E+L+ ++  +F  +W 
Sbjct  181  FEAVDGEVSTEPMRFAAEREMGMEEYMTYLRSSSAYQTAREKGLELLTPEMEAEFAGSWE  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG+ +K+V FPI+LRIGKVG
Sbjct  241  EDGEEKKVVRFPIFLRIGKVG  261



>ref|XP_010090907.1| Putative methyltransferase [Morus notabilis]
 gb|EXB41195.1| Putative methyltransferase [Morus notabilis]
Length=267

 Score =   330 bits (845),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 197/263 (75%), Gaps = 3/263 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY+E RP YP++LF+FIASKTP HDLVWDVGTG+GQAA SL   YK V+ 
Sbjct  1    MAELFLKQAKQYAENRPDYPKELFEFIASKTPCHDLVWDVGTGSGQAAQSLAGIYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QLQ AP L  +R+   PP M++A++E  +  +SS+DLVTIAQALHWF    FY 
Sbjct  61   TDTSPKQLQEAPKLTTIRYEHPPPVMSIAQVEQILTPKSSLDLVTIAQALHWFDFQNFYD  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW LKKP+GV+AAWCY  P V++SVD I  R YT     +W+P RK VD +YR IDFP
Sbjct  121  QVKWALKKPNGVVAAWCYTLPRVNASVDRIMDRLYTVCAGPYWDPLRKFVDDEYRGIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V+G    GP+EF  +K+M+LE +F YIRS S YQTAK+KGVE+L SD+V++F RAW 
Sbjct  181  FEAVEGACETGPFEFVIEKVMDLEGFFNYIRSWSAYQTAKDKGVELLGSDIVEEFKRAWE  240

Query  215  ED--GKTQKIVAFPIYLRIGKVG  153
             D  G  +K+V  P++LRIGKVG
Sbjct  241  NDEGGDCKKVVKCPLFLRIGKVG  263



>ref|XP_006421279.1| hypothetical protein CICLE_v10006581mg [Citrus clementina]
 gb|ESR34519.1| hypothetical protein CICLE_v10006581mg [Citrus clementina]
Length=254

 Score =   328 bits (841),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 158/263 (60%), Positives = 201/263 (76%), Gaps = 13/263 (5%)
 Frame = -1

Query  932  MAD-LFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVV  756
            MAD LF+KQ KQY+EGRP+YP +LF FIASKTP HDLVWDVGTG+GQAA  L + YKN  
Sbjct  1    MADQLFIKQAKQYTEGRPSYPAELFQFIASKTPDHDLVWDVGTGSGQAAKPLAKIYKN--  58

Query  755  GTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
                    L+FA  LPN+R+  TPP M + ELE NV  +SSVDLVTIA ALHWF LP FY
Sbjct  59   --------LEFAIKLPNIRYQLTPPTMYITELEQNVATQSSVDLVTIAAALHWFDLPQFY  110

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDF  399
            +QVKWVLKKP+GVIAAW Y  P ++ SV ++++ + T + + FWEP RKLVD KY +IDF
Sbjct  111  KQVKWVLKKPNGVIAAWTYTMPGINESVGAVFKPFDTVDCEPFWEPQRKLVDNKYMSIDF  170

Query  398  PFDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            PF+PVDG ++ GP+ +F  +K+M+L+ YF +IRS SGYQTAK+KGVE+L+ +++ +F  A
Sbjct  171  PFEPVDGVDNTGPFDQFVLEKVMDLDDYFTFIRSCSGYQTAKDKGVELLTDNVMDNFKVA  230

Query  221  WNEDGKTQKIVAFPIYLRIGKVG  153
            WNEDG++QK+  FPIYLRI K G
Sbjct  231  WNEDGQSQKVARFPIYLRIAKAG  253



>ref|XP_003625028.1| Methyltransferase, putative [Medicago truncatula]
 gb|ABN07990.1| SAM (and some other nucleotide) binding motif [Medicago truncatula]
 gb|ACJ84954.1| unknown [Medicago truncatula]
 gb|AES81246.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
 gb|AFK48419.1| unknown [Medicago truncatula]
Length=261

 Score =   327 bits (839),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 190/261 (73%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+ QGK+Y++ RP+YP QLF FIASKTP H+LVWDV TG+GQAA SL   YKNV+ 
Sbjct  1    MAELFVNQGKEYADARPSYPPQLFQFIASKTPSHNLVWDVATGSGQAAKSLAALYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNV++  TP  M++ ELE  V  + ++DLVTIAQ LHWF LP FYQ
Sbjct  61   TDVSEQQLEFATKLPNVQYKHTPSTMSIPELEQIVTPQGTIDLVTIAQGLHWFDLPNFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIY-QRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  P +S  VD+++ Q YYT +Q +W+  RKLV++ YR+IDFP
Sbjct  121  QVKWVLKKPHGVIAAWCYFLPRISDEVDTVFDQFYYTDSQPYWDSARKLVEKNYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F  VDG +H GP+EF  +  M  +    YI+S S YQTAK KGVE+L  D+V+ F  AW 
Sbjct  181  FQAVDGVDHTGPFEFVTETFMSFDGLLTYIKSWSAYQTAKKKGVELLGEDVVEKFKLAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG   K   FP+YLRIG+VG
Sbjct  241  EDG--HKTAKFPVYLRIGRVG  259



>ref|XP_006373713.1| hypothetical protein POPTR_0016s03860g [Populus trichocarpa]
 gb|ERP51510.1| hypothetical protein POPTR_0016s03860g [Populus trichocarpa]
Length=246

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/261 (59%), Positives = 191/261 (73%), Gaps = 18/261 (7%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+ Q KQY+E RP+YPQ+LF FIASKTP HDLVWDVGTG+GQAA SL   YK+V G
Sbjct  1    MAELFVNQAKQYAETRPSYPQELFQFIASKTPAHDLVWDVGTGSGQAARSLAGIYKHVTG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNV +  TP  M+++ LE  V  +SSVDLVT+AQA+HWF L  FYQ
Sbjct  61   TDTSLKQLEFAPKLPNVSYHHTPSVMSMSGLEQTVSTQSSVDLVTVAQAMHWFDLHAFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKP+GVIAAWCY  PEV+ SVDS+   +Y+ +   +WEP  KL+D KY +IDFP
Sbjct  121  QVKWILKKPNGVIAAWCYTVPEVNDSVDSVLNPFYSIDSDPYWEPQLKLIDDKYMSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +H GP                  +S S YQTAK KGVE+L  D+++ F RAWN
Sbjct  181  FEPVEGADHTGPS-----------------KSWSAYQTAKTKGVELLRDDMIESFKRAWN  223

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG  +K+V FP+YLRIGKVG
Sbjct  224  EDGHDEKVVKFPVYLRIGKVG  244



>gb|AFK45765.1| unknown [Lotus japonicus]
Length=261

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/260 (57%), Positives = 193/260 (74%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M++LF+KQ KQY+  RP+YP QLF FIASKTP H+L WDV TG+GQAA SL E Y+NV+ 
Sbjct  1    MSNLFVKQAKQYAGARPSYPPQLFQFIASKTPSHNLAWDVATGSGQAAKSLAELYQNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M++AE+E  V  + ++DLVTIAQ LHWF LP FY 
Sbjct  61   TDASEKQLEFATKLPNVRYQHTPSTMSIAEVEQKVAPQGTIDLVTIAQGLHWFDLPNFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QV WVLKKP GVIAAW Y+ P +S +VDS+  ++Y ++ + +W+  R+LV+  YRTIDFP
Sbjct  121  QVNWVLKKPHGVIAAWSYNLPRLSDAVDSVLDQFYGSDTKPYWDQARRLVENNYRTIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG +H GP+EF  + +M+ + +  YI+S S YQTAK KGVE+L  D+V+ F  AW 
Sbjct  181  FEPVDGADHTGPFEFVTETVMDFDDFLTYIKSWSVYQTAKEKGVELLGEDVVEKFKLAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKV  156
            EDG  QK+  +PIYLRIGKV
Sbjct  241  EDG--QKVAKYPIYLRIGKV  258



>ref|XP_004169396.1| PREDICTED: LOW QUALITY PROTEIN: putative methyltransferase DDB_G0268948-like 
[Cucumis sativus]
Length=263

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 198/262 (76%), Gaps = 4/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ K Y+EGRP+YP +LF++IAS TP HDLVWDVGTGTGQAA SL   Y  V+ 
Sbjct  1    MAKLFIKQAKNYAEGRPSYPSKLFEYIASTTPAHDLVWDVGTGTGQAAQSLAAHYTTVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPNV +  TP  M++ E+E  V    SVDLVT+AQALHWF+LP+FYQ
Sbjct  61   TDTSPKQLEFATKLPNVHYHHTPSTMSIEEVEKMVAPPGSVDLVTVAQALHWFNLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
             V+WVLKKP GVIAAWCY  PEV++ +D++ +R Y T+   +WE  R+LVD++Y+TI+FP
Sbjct  121  NVRWVLKKPHGVIAAWCYSLPEVNNGIDTVLRRIYKTDFGPYWEAPRRLVDEEYKTIEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG E     EF A+K ME E Y  Y+RS S YQTAK+ G+E+LS+++V++   AWN
Sbjct  181  FEAVDGEE--PITEFAAEKEMEFEEYLIYLRSWSSYQTAKDLGIELLSNEVVEELESAWN  238

Query  215  EDG-KTQKIVAFPIYLRIGKVG  153
            EDG K +K+  FPI+L+IG+VG
Sbjct  239  EDGVKGKKVAKFPIHLKIGRVG  260



>gb|KGN54522.1| hypothetical protein Csa_4G354130 [Cucumis sativus]
Length=263

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/262 (58%), Positives = 198/262 (76%), Gaps = 4/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ K Y+EGRP+YP +LF++IAS TP HDLVWDVGTGTGQAA SL   Y  V+ 
Sbjct  1    MAKLFIKQAKNYAEGRPSYPTKLFEYIASTTPAHDLVWDVGTGTGQAAQSLAAHYTTVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPNV +  TP  M++ E+E  V    SVDLVT+AQALHWF+LP+FYQ
Sbjct  61   TDTSPKQLEFATKLPNVHYHHTPSTMSIEEVEKMVAPPGSVDLVTVAQALHWFNLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
             V+WVLKKP GVIAAWCY  PEV++ +D++ +R Y T+   +WE  R+LVD++Y+TI+FP
Sbjct  121  NVRWVLKKPHGVIAAWCYSLPEVNNGIDTVLRRIYKTDFGPYWEAPRRLVDEEYKTIEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG E     EF A+K ME E Y  Y+RS S YQTAK+ G+E+LS+++V++   AWN
Sbjct  181  FEAVDGEEPIT--EFAAEKEMEFEEYLIYLRSWSSYQTAKDLGIELLSNEVVEELESAWN  238

Query  215  EDG-KTQKIVAFPIYLRIGKVG  153
            EDG K +K+  FPI+L+IG+VG
Sbjct  239  EDGVKGKKVAKFPIHLKIGRVG  260



>ref|XP_004493415.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Cicer 
arietinum]
Length=261

 Score =   323 bits (828),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/261 (59%), Positives = 188/261 (72%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+ Q KQY++ RP+YP QLF FIASKTP H+LVWDV TG+GQAA SL   YKNV+ 
Sbjct  1    MAELFVNQAKQYADSRPSYPLQLFQFIASKTPSHNLVWDVATGSGQAAKSLATLYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M+  ELE  V  E ++DLVTIAQALHWF L TFY+
Sbjct  61   TDVSEKQLEFATKLPNVRYQHTPSTMSKIELEQLVTPEGTIDLVTIAQALHWFDLSTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIY-QRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP G+IAAWCY+ P +S+ VD +  Q Y   ++ +W+  RKLVD+ YR+IDFP
Sbjct  121  QVKWVLKKPHGIIAAWCYNLPRISNEVDIVLDQLYSVISKPYWDSARKLVDENYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG +H GP+EF  +  M  +    YIRS S YQTAK KGVE+L  D+V+ F  AW 
Sbjct  181  FEAVDGVDHTGPFEFVTETNMTFDGLLTYIRSWSAYQTAKEKGVELLGDDVVEKFKFAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            ED   +K   FPIYLRIG+VG
Sbjct  241  ED--VRKTAKFPIYLRIGRVG  259



>ref|XP_003521139.1| PREDICTED: LOW QUALITY PROTEIN: putative methyltransferase DDB_G0268948-like 
[Glycine max]
Length=286

 Score =   324 bits (830),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 185/244 (76%), Gaps = 1/244 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LFLKQ KQY++ RP+YP QLF FIASKTP H+L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MAKLFLKQAKQYADARPSYPPQLFQFIASKTPSHNLAWDVGTGSGQAAKSLAAIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M+ AELE  V ++ ++DLVTIAQALHWF  PTFY+
Sbjct  61   TDASDKQLEFAAKLPNVRYQHTPSTMSTAELEQMVASKGTIDLVTIAQALHWFDRPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP G+IAAWCY  P VS + D+++ ++Y+TN   +W+P RK VD  YR+IDFP
Sbjct  121  QVKWVLKKPHGIIAAWCYYLPRVSDAFDTVFDQFYSTNVSPYWDPARKWVDDNYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG +H GP+EF  + +M+L+ +  YIRS S YQTAK KGVE+L+ D+V+ F  AW 
Sbjct  181  FEPVDGADHTGPFEFVTETMMDLDDFLTYIRSWSAYQTAKEKGVELLAEDVVEKFKLAWG  240

Query  215  EDGK  204
            ED K
Sbjct  241  EDAK  244



>ref|XP_007162108.1| hypothetical protein PHAVU_001G124700g [Phaseolus vulgaris]
 gb|ESW34102.1| hypothetical protein PHAVU_001G124700g [Phaseolus vulgaris]
Length=263

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/261 (58%), Positives = 192/261 (74%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF+KQ K+Y++ RP+YP QLF FIASKTP H+L WDVGTG+GQAA SL   Y+ V+ 
Sbjct  1    MADLFVKQAKEYADARPSYPPQLFQFIASKTPSHNLAWDVGTGSGQAAKSLSVIYEKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  + NVR+  TPP M++AELE  V +E SVDLVT+AQ+LHWF +PT Y+
Sbjct  61   TDASAKQLEFAVKICNVRYQHTPPIMSMAELEEMVASEGSVDLVTMAQSLHWFDMPTLYR  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP GVIAAWCY  P V   VD++   +Y++    +W P  KL+ + YR IDFP
Sbjct  121  QVKWVLKKPHGVIAAWCYYLPRVCDEVDTVLDEFYSSEVGPYWNPAGKLIHKLYRRIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G +H GP+EF  + LM L+  F YI+S S YQTAK KGVE+L  D+VQ F  +W 
Sbjct  181  FEPVEGADHTGPFEFVTETLMNLDDLFTYIKSWSAYQTAKGKGVELLGEDVVQKFKFSWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDGK  ++V FPI LR+GKVG
Sbjct  241  EDGK--RVVRFPIDLRMGKVG  259



>ref|XP_009770993.1| PREDICTED: putative methyltransferase DDB_G0268948, partial [Nicotiana 
sylvestris]
Length=218

 Score =   320 bits (820),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 143/218 (66%), Positives = 182/218 (83%), Gaps = 1/218 (0%)
 Frame = -1

Query  797  QAAMSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVT  618
            QAA SL + YKNV+ TDTSP QL+FA  +PNV+++CT P M++AE+E  +G ESSVDLVT
Sbjct  1    QAAQSLAKLYKNVIATDTSPKQLEFAVKVPNVQYICTSPKMSMAEIETKIGTESSVDLVT  60

Query  617  IAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEP  441
            IAQA+HWF LPTFYQQVKW+LKKP+GVIAAWCY  PEV++SVD I++++YT +   +WE 
Sbjct  61   IAQAMHWFDLPTFYQQVKWLLKKPNGVIAAWCYTVPEVNNSVDPIFEKFYTVDAGPYWES  120

Query  440  GRKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVE  261
             RKLVD+KY+TIDFPF+PV GC+HNGP+EFK +K+M+L SYF Y++S S YQTAK KGVE
Sbjct  121  PRKLVDEKYKTIDFPFEPVSGCDHNGPFEFKIEKVMDLNSYFTYLKSWSAYQTAKEKGVE  180

Query  260  ILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVGIL  147
            +L+ D+V+ FT  WNED ++QK V+FPIYLRIGKVG L
Sbjct  181  LLTDDVVEKFTSVWNEDAESQKTVSFPIYLRIGKVGNL  218



>gb|ACU19965.1| unknown [Glycine max]
Length=286

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 147/244 (60%), Positives = 184/244 (75%), Gaps = 1/244 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LFLKQ KQY++ RP+YP QLF FIASKTP H+L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MAKLFLKQAKQYADARPSYPPQLFQFIASKTPSHNLAWDVGTGSGQAAKSLAAIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M+ AELE  V ++ ++DLVTIAQALHWF  PTFY+
Sbjct  61   TDASDKQLEFAAKLPNVRYQHTPSTMSTAELEQMVASKGTIDLVTIAQALHWFDRPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKWVLKKP G+IAAWCY  P VS + D+++ ++Y+TN   +W+P RK VD  YR+IDFP
Sbjct  121  QVKWVLKKPHGIIAAWCYYLPRVSDAFDTVFDQFYSTNVSPYWDPARKWVDDNYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG +H GP+EF  + +M+L+ +  YIRS S YQTAK KGVE+L+ D+V+ F   W 
Sbjct  181  FEPVDGADHTGPFEFVTETMMDLDDFLTYIRSWSAYQTAKEKGVELLAEDVVEKFKLVWG  240

Query  215  EDGK  204
            ED K
Sbjct  241  EDAK  244



>ref|XP_006421282.1| hypothetical protein CICLE_v10006978mg, partial [Citrus clementina]
 gb|ESR34522.1| hypothetical protein CICLE_v10006978mg, partial [Citrus clementina]
Length=249

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/255 (60%), Positives = 196/255 (77%), Gaps = 10/255 (4%)
 Frame = -1

Query  908  GKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEK-YKNVVGTDTSPNQ  732
             KQY+EGRP+YP +LF FIASKTP HDLVWDVGTG+GQAA  +  K YKNV+ TDTSP Q
Sbjct  1    SKQYTEGRPSYPAELFQFIASKTPDHDLVWDVGTGSGQAAKPVSAKIYKNVIATDTSPKQ  60

Query  731  LQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLK  552
            L+FA  LPN+R+  TPP M++ ELE NV  +SSV       ALHWF LP FY+QVKWVLK
Sbjct  61   LEFAIKLPNIRYQLTPPTMSITELEQNVATQSSV-------ALHWFDLPQFYKQVKWVLK  113

Query  551  KPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFPFDPVDGC  375
            KP+GVIAAW Y  P ++ SV ++++ + T + + FWEP RKLVD KY +IDFPF+PVDG 
Sbjct  114  KPNGVIAAWTYTMPGINESVGAVFKPFDTVDCEPFWEPQRKLVDNKYMSIDFPFEPVDGV  173

Query  374  EHNGPYE-FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQ  198
            ++ GP++ F  +K+M+L+ YF +IRS SGYQTAK+KGVE+L+ +++ +F  AWNEDG++Q
Sbjct  174  DNTGPFDQFVLEKVMDLDDYFTFIRSCSGYQTAKDKGVELLTDNVMDNFKVAWNEDGQSQ  233

Query  197  KIVAFPIYLRIGKVG  153
            K+  FPIYLRI K G
Sbjct  234  KVARFPIYLRIAKAG  248



>gb|KEH23634.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=261

 Score =   320 bits (820),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 194/260 (75%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+ F KQGK+Y++ RP+YP QLF FIASKTP HDL WDV TGTGQAA SL   YKNV+ 
Sbjct  1    MAEHFAKQGKEYADSRPSYPPQLFQFIASKTPSHDLAWDVATGTGQAAKSLSTLYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M++ ELE  V  + ++DLVTIAQALHW  L TFY+
Sbjct  61   TDASEKQLEFATKLPNVRYQHTPSTMSMTELEQMVSPQGTIDLVTIAQALHWLDLSTFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QV WVLKKP+GV+A WCY  P V+ +V +++ + Y+ + + +W+  R+L++  YR IDFP
Sbjct  121  QVNWVLKKPNGVLAIWCYTSPRVNDAVGALHDKLYSFDAKPYWDSRRELLEDNYRNIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            FDPV+G +H GP+EF+A+ +M+L+ +  YIRS S YQ++KNKGVE+L+ D+++ F  AW 
Sbjct  181  FDPVEGVDHTGPFEFEAETVMDLDDFLNYIRSRSAYQSSKNKGVELLTDDVIEKFKLAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKV  156
            EDGK  KI  F +YLRIG+V
Sbjct  241  EDGK--KIAKFQVYLRIGRV  258



>ref|XP_004493416.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Cicer 
arietinum]
Length=257

 Score =   320 bits (819),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 184/259 (71%), Gaps = 3/259 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+ Q K+Y+  RP+YP +LF FIASKTP H+L WD  TG+GQAA SL   YKNV+ 
Sbjct  1    MAELFVNQAKEYANARPSYPNKLFRFIASKTPSHNLAWDAATGSGQAAKSLASMYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M+++ELE  V  E ++DLVTIAQALHWF LPTFY+
Sbjct  61   TDVSKKQLEFAIKLPNVRYQHTPSIMSMSELEEIVAPEGTMDLVTIAQALHWFDLPTFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKP GV AAWCY+ P V   VD+I  + Y+TN   F +P  + +D  YR+IDFP
Sbjct  121  QVKWILKKPHGVFAAWCYNLPRVCDEVDTILDKLYSTNASSFSDPLIRFIDSNYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG +H GP+EF  + LM+L  Y  YIRS S YQTA  KGVE+L  D++Q F  AW 
Sbjct  181  FEAVDGADHTGPFEFVKENLMDLNDYLTYIRSWSAYQTAIEKGVELLGDDVLQKFNLAWG  240

Query  215  EDGKTQKIVAFPIYLRIGK  159
            ED    K+  FPIYLRIGK
Sbjct  241  ED--VHKVAKFPIYLRIGK  257



>ref|XP_008455687.1| PREDICTED: putative methyltransferase DDB_G0268948 [Cucumis melo]
Length=263

 Score =   318 bits (816),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 199/262 (76%), Gaps = 4/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ K Y+EGRP+YP +LF++I SKTP HDLVWDVGTGTGQAA SL   Y  V+ 
Sbjct  1    MAKLFIKQAKNYAEGRPSYPSKLFEYITSKTPFHDLVWDVGTGTGQAAQSLAAHYTTVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL++A  LPNV +  TP  M++ E+E  V    +VDLVT+AQALHWF+LP+FYQ
Sbjct  61   TDTSPKQLEYATKLPNVHYRQTPSTMSIEEVEKMVAPPGTVDLVTVAQALHWFNLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
             V+ VLKKP G+IAAWCY  PEV++++D++ +R Y T+   +W+  R+LVD++Y+TI+FP
Sbjct  121  NVRCVLKKPHGIIAAWCYSLPEVNNAIDTVLRRIYKTDFGPYWDAPRRLVDEEYKTIEFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG E     EF A+K ME E Y  Y+RS S YQTAK+ G+E+LS+++V++  RAWN
Sbjct  181  FEAVDGEEPIT--EFAAEKEMEFEEYLIYLRSWSSYQTAKDLGIELLSNEVVEELERAWN  238

Query  215  EDG-KTQKIVAFPIYLRIGKVG  153
            EDG K +K+  FPI+L+IG+VG
Sbjct  239  EDGVKGKKVAKFPIHLKIGRVG  260



>ref|XP_010036344.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
Length=288

 Score =   319 bits (818),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 148/267 (55%), Positives = 196/267 (73%), Gaps = 2/267 (1%)
 Frame = -1

Query  947  EELKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKY  768
            E  + MA+LF KQ ++Y++GRP+YP QLF FIASKTP  DL WDVGTG+GQAA SL E Y
Sbjct  16   ERERDMAELFGKQARRYADGRPSYPPQLFQFIASKTPSRDLAWDVGTGSGQAARSLAEIY  75

Query  767  KNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHL  588
            KNVV TD SP QL+ A  LPN+R+  T P ++ AEL+  V AES+VDLVTIA ALHWF  
Sbjct  76   KNVVATDVSPEQLELAQRLPNIRYELTSPVVSRAELQQKVAAESTVDLVTIAMALHWFDR  135

Query  587  PTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYR  411
            P FY+Q K +LKKPDGVIAAW Y  P V+  VDSIY+ +Y+ + + +W P  ++V  +YR
Sbjct  136  PNFYRQAKRLLKKPDGVIAAWGYTMPRVTGPVDSIYEEFYSMDSNPYWSPTHRVVIDEYR  195

Query  410  TIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDF  231
             +DFPF+PV+G E  GP  F A++ M L+ +  ++RS+S Y  AK +GVE+L  D+V+ +
Sbjct  196  DMDFPFEPVEGMEDTGPVRFVAERAMGLDEFLTFVRSTSPYLKAKEEGVELLGRDVVERY  255

Query  230  TRAWNED-GKTQKIVAFPIYLRIGKVG  153
             RAWNE+ G+ +K+V FP++LRIGKVG
Sbjct  256  RRAWNEEGGEAEKVVKFPVFLRIGKVG  282



>ref|XP_002455523.1| hypothetical protein SORBIDRAFT_03g012620 [Sorghum bicolor]
 ref|XP_002457738.1| hypothetical protein SORBIDRAFT_03g012610 [Sorghum bicolor]
 gb|EES00643.1| hypothetical protein SORBIDRAFT_03g012620 [Sorghum bicolor]
 gb|EES02858.1| hypothetical protein SORBIDRAFT_03g012610 [Sorghum bicolor]
Length=260

 Score =   318 bits (815),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 185/259 (71%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY   RP YP +LFDFIASKTPR D+ WDVGTG GQAA SL   Y+ VVG
Sbjct  1    MANLFLKQAKQYVATRPVYPPELFDFIASKTPRRDMAWDVGTGNGQAAASLATLYEAVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +A  LPNVR+V TPP++ L  + A V A +SVDL+T+AQA HW  LP FY 
Sbjct  61   TDTSAQQLAYATRLPNVRYVHTPPDLPLEGIHATVAAPASVDLITVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q + VL+   GV+AAWCY  P + ++VD+++ R Y  ++++W P R++VD +YR+ DFPF
Sbjct  121  QARSVLRHGHGVLAAWCYTEPRIDAAVDAVFWRLYHGSENYWAPNRRMVDDEYRSADFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPV+G  H GP++F   + M+L+ Y  YI S S YQTAK+ GVE+L  D VQ+F  AW  
Sbjct  181  DPVEGETHTGPFQFSTHRRMDLDDYLMYITSWSAYQTAKDNGVELLDEDTVQEFAAAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            DGK  K V +PI+LRIGKV
Sbjct  241  DGKEVKTVTYPIFLRIGKV  259



>ref|XP_010090908.1| Putative methyltransferase [Morus notabilis]
 gb|EXB41196.1| Putative methyltransferase [Morus notabilis]
Length=264

 Score =   318 bits (816),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 200/262 (76%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+L+  + K Y+E RP+YP QLF+FIAS TP H L WDVGTG+GQAA SL   YKNV+ 
Sbjct  1    MAELYNWKAKTYAEIRPSYPPQLFEFIASHTPSHLLAWDVGTGSGQAARSLARFYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S   L+FA  LPNV++  T   M++AE+E  +  +SS+DLVT AQA+HWF LP+FYQ
Sbjct  61   TDASRKPLEFASELPNVQYKHTSLTMSIAEVEQKIAPKSSLDLVTAAQAVHWFDLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPG-RKLVDQKYRTIDF  399
            QVKWVLKKP GVIAAWCY  P+V+SSVD+++Q++YT +   FW+   RK+VD +YRTIDF
Sbjct  121  QVKWVLKKPHGVIAAWCYTEPKVNSSVDAVFQQFYTDDSWPFWDSKVRKVVDDEYRTIDF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+PVDG +  GP+EF A++ M+L+ +FAYI S S YQTAK +G+E+L  D+++ F  AW
Sbjct  181  PFEPVDGLDDTGPFEFVAERGMDLDQFFAYITSWSAYQTAKVEGIELLRKDVIERFECAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
            NED   QK+V FP++L+IG+VG
Sbjct  241  NEDKNDQKVVKFPVHLKIGRVG  262



>ref|XP_004967532.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Setaria 
italica]
Length=262

 Score =   318 bits (815),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 182/259 (70%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY   RP+YP +LFDFIASKTPR DL WDVGTG GQAA SL + YK VVG
Sbjct  1    MANLFLKQAKQYVATRPSYPPELFDFIASKTPRRDLAWDVGTGNGQAAASLAKLYKAVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL FA  LPNVR+V T P++ L  + A V    + DL+T+AQA HW  LP FY 
Sbjct  61   TDTSAQQLAFAAPLPNVRYVHTAPDLPLDGIHAAVAGPGTADLITVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q + VL+   GV+AAWCY  P VS++VD+++ R Y  +Q +W P R++VD +YR  DFPF
Sbjct  121  QARSVLRPEQGVLAAWCYTEPRVSAAVDAVFWRLYRGSQPYWAPNRRMVDDEYRGADFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPVDG  H GP+EF  ++ M+L+ Y  YI S S YQTAK KGVE+L    VQ+F  AW  
Sbjct  181  DPVDGEAHTGPFEFSTERAMDLDGYLTYITSWSAYQTAKEKGVELLDEATVQEFAAAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            DGK  K V +PI+LRIGKV
Sbjct  241  DGKEVKAVTYPIFLRIGKV  259



>ref|XP_009380624.1| PREDICTED: putative methyltransferase DDB_G0268948 [Musa acuminata 
subsp. malaccensis]
Length=261

 Score =   318 bits (814),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 146/259 (56%), Positives = 187/259 (72%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF KQ + Y E RP+YP+ LF FIASKTP+HDL WDVGTG+GQAA+SL   YK VV 
Sbjct  1    MANLFCKQAQNYVETRPSYPEDLFRFIASKTPQHDLAWDVGTGSGQAAVSLARLYKRVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL FAP LPN+ +  TPP ++  +L  +V   S+VDLV +AQALHWF LPTFY 
Sbjct  61   TDTSQEQLSFAPRLPNIDYRHTPPTLSPTDLHQHVAPPSTVDLVCVAQALHWFDLPTFYD  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL KP GV+A WCY  P V  +VD+++ R YT +  FW   R++VD +YR++ FP+
Sbjct  121  GVNSVLAKPGGVLAVWCYTEPRVDPAVDTVFWRLYTESGRFWAAARQMVDDEYRSMLFPY  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPVDG E  GP+EF A++ M++ +Y  YIRS S YQTAK +GVE+L+ ++V D  +AW  
Sbjct  181  DPVDGEESTGPFEFAAERAMDMGTYLTYIRSWSAYQTAKERGVELLTDEMVSDLEKAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            DGK  K+V FPI+LRIGKV
Sbjct  241  DGKAVKVVRFPIFLRIGKV  259



>gb|KCW47881.1| hypothetical protein EUGRSUZ_K01627 [Eucalyptus grandis]
Length=268

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 194/262 (74%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF KQ ++Y++GRP+YP QLF FIASKTP  DL WDVGTG+GQAA SL E YKNVV 
Sbjct  1    MAELFGKQARRYADGRPSYPPQLFQFIASKTPSRDLAWDVGTGSGQAARSLAEIYKNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD SP QL+ A  LPN+R+  T P ++ AEL+  V AES+VDLVTIA ALHWF  P FY+
Sbjct  61   TDVSPEQLELAQRLPNIRYELTSPVVSRAELQQKVAAESTVDLVTIAMALHWFDRPNFYR  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            Q K +LKKPDGVIAAW Y  P V+  VDSIY+ +Y+ + + +W P  ++V  +YR +DFP
Sbjct  121  QAKRLLKKPDGVIAAWGYTMPRVTGPVDSIYEEFYSMDSNPYWSPTHRVVIDEYRDMDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PV+G E  GP  F A++ M L+ +  ++RS+S Y  AK +GVE+L  D+V+ + RAWN
Sbjct  181  FEPVEGMEDTGPVRFVAERAMGLDEFLTFVRSTSPYLKAKEEGVELLGRDVVERYRRAWN  240

Query  215  ED-GKTQKIVAFPIYLRIGKVG  153
            E+ G+ +K+V FP++LRIGKVG
Sbjct  241  EEGGEAEKVVKFPVFLRIGKVG  262



>ref|XP_010672978.1| PREDICTED: putative methyltransferase DDB_G0268948 [Beta vulgaris 
subsp. vulgaris]
Length=269

 Score =   317 bits (811),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/254 (59%), Positives = 184/254 (72%), Gaps = 1/254 (0%)
 Frame = -1

Query  911  QGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQ  732
              KQYS GRP+YP QLF FIAS TP H L WDVGTGTGQA  SL E YKNV+GTD S  Q
Sbjct  13   NAKQYSGGRPSYPPQLFKFIASHTPSHLLAWDVGTGTGQAIPSLAELYKNVIGTDVSATQ  72

Query  731  LQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLK  552
            L+ AP LPNV +  TP  +++ ++E  +  ESS+DL+TIAQA+HWF LP  Y+ V+W LK
Sbjct  73   LECAPKLPNVNYYDTPRVLSINDVEQKIAPESSIDLITIAQAMHWFDLPKLYEVVRWALK  132

Query  551  KPDGVIAAWCYDFPEVSSSVDSIYQRYYT-TNQHFWEPGRKLVDQKYRTIDFPFDPVDGC  375
            KP G+IAAWCY  PEV+  VD+I+  +Y   +   WE   K VD KYR+I FPF+PVDG 
Sbjct  133  KPHGIIAAWCYTTPEVNEEVDAIFWPFYKGISGPGWEETTKAVDDKYRSIHFPFEPVDGL  192

Query  374  EHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQK  195
             H GP+EFKA+K+M LE YFAYIRS S Y  AK KGVE+L+ +L+ +F RAW  DGK  K
Sbjct  193  GHTGPFEFKAEKVMSLEDYFAYIRSWSAYNAAKEKGVEMLTDELLVEFKRAWINDGKNDK  252

Query  194  IVAFPIYLRIGKVG  153
            +V FPIYLR+G+VG
Sbjct  253  VVKFPIYLRMGRVG  266



>ref|XP_006387172.1| hypothetical protein POPTR_1614s00200g, partial [Populus trichocarpa]
 gb|ERP46086.1| hypothetical protein POPTR_1614s00200g, partial [Populus trichocarpa]
Length=236

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 182/235 (77%), Gaps = 1/235 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+ Q KQY+E RP+YPQ+LF FIASKTP HDLVWDVGTG+GQAA SL   YK+V G
Sbjct  1    MAELFVNQAKQYAETRPSYPQELFQFIASKTPAHDLVWDVGTGSGQAARSLAGIYKHVTG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FAP LPNV +  TP  M+++ LE  V  +SSVDLVTIAQA+HWF L  FYQ
Sbjct  61   TDTSLKQLEFAPKLPNVSYHHTPSVMSMSGLEQTVSTQSSVDLVTIAQAMHWFDLHAFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKPDG IAAWCY  PEV+ SVDS+   +Y+ +   + EP  KL+D KY +IDFP
Sbjct  121  QVKWILKKPDGAIAAWCYTVPEVNDSVDSVLNPFYSIDSDPYLEPQLKLIDDKYMSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDF  231
            F+PV+G +H GP++F A+KLM+L+ YF Y+RS S YQTAK KGVE+L  D+++ F
Sbjct  181  FEPVEGADHTGPFKFVAEKLMDLDEYFTYLRSWSAYQTAKTKGVELLRDDMIESF  235



>gb|EMT32692.1| hypothetical protein F775_26316 [Aegilops tauschii]
Length=260

 Score =   313 bits (802),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 184/259 (71%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ K Y+  RP YP +LF FIASKT RHDL WDVGTG+GQAA+SL + YKNVVG
Sbjct  1    MANLFLKQAKHYAAARPDYPAELFQFIASKTARHDLAWDVGTGSGQAAVSLAKLYKNVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +AP LPNVR+  TP ++ L  + A V    SVD+VT+AQA HW  LP FY 
Sbjct  61   TDTSAQQLAYAPALPNVRYAHTPADLPLEGIHAAVAPPGSVDVVTVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QV+ +L+   GV+AAWCY  P V ++VD+++ R Y  +Q  W P RK+VD +YR+ DFPF
Sbjct  121  QVRSLLRA-HGVLAAWCYTEPRVGAAVDAVFWRLYDGSQPHWAPNRKMVDDEYRSADFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPVDG  H GP+EF   + M+L+ YF YI+S S YQTAK+ GVE+L    VQDF  AW  
Sbjct  180  DPVDGETHTGPFEFSTDRRMDLDDYFTYIKSWSAYQTAKDNGVELLDDATVQDFADAWGG  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
            D +  K V +PI+LRIGKV
Sbjct  240  DREEVKTVRYPIFLRIGKV  258



>gb|KFK36988.1| hypothetical protein AALP_AA4G197900 [Arabis alpina]
Length=268

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 192/265 (72%), Gaps = 5/265 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP YP +LFDFIASKTP HDL WDVG G+GQA+ SL   YKNV+ 
Sbjct  1    MAKLFIKQAEQYAAARPNYPTKLFDFIASKTPCHDLAWDVGAGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP M+L+E+E  V  ESSVDLVT+AQALHWF L TFY+
Sbjct  61   TDTSSTQLEFAAKLPNVRYELTPPVMSLSEIEQLVAPESSVDLVTVAQALHWFDLTTFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKP+GV+AAWCY  P+V+++VD I++R+Y      +W+  R+LV+  YR I+FP
Sbjct  121  NVKHVLKKPNGVLAAWCYTNPKVNATVDEIFERFYVERLGPYWDKARRLVEDGYRGIEFP  180

Query  395  FDPVDGCE----HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            F+ + G E     + P  F  +K M  E +  Y+RSSS YQTAK KGVE+L++++  +  
Sbjct  181  FEKIMGDESMESQSFPVRFVTEKEMVFEEFMTYLRSSSAYQTAKEKGVELLTAEMEGEIA  240

Query  227  RAWNEDGKTQKIVAFPIYLRIGKVG  153
             +W EDGK +KIV +PIYL IG+VG
Sbjct  241  SSWKEDGKEKKIVRYPIYLLIGRVG  265



>dbj|BAJ98314.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK00977.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=266

 Score =   311 bits (796),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/259 (56%), Positives = 184/259 (71%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ K Y+  RP YP +LF FIASKT RHDL WDVGTG+GQAA+SL + YK VVG
Sbjct  1    MANLFLKQAKHYAAARPDYPAELFQFIASKTARHDLAWDVGTGSGQAAVSLAKLYKKVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +AP LPNVR+  TP ++ L  + A V    SVD+VT+AQA HW  LP FY 
Sbjct  61   TDTSAQQLAYAPALPNVRYAHTPADLPLEGIHAAVAPPGSVDVVTVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q + +L+   GV+AAWCY  P V ++VD+++ R Y  +Q  W P RK+VD +YR+ DFPF
Sbjct  121  QTRSLLRA-HGVLAAWCYTEPRVGAAVDAVFWRLYNGSQPHWAPNRKMVDDEYRSADFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPVDG +H GP+EF  ++ M+L+ YF YI+S S YQTAK+ GVE+L  D V+ F  AW +
Sbjct  180  DPVDGEDHTGPFEFSTERSMDLDDYFTYIKSWSAYQTAKDNGVELLDEDTVRAFADAWGD  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
            D    K V +PI+LRIGKV
Sbjct  240  DRGEVKTVRYPIFLRIGKV  258



>gb|ACN25247.1| unknown [Zea mays]
 gb|AFW80591.1| embryonic abundant protein-like protein [Zea mays]
Length=262

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 183/259 (71%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY   RP YP +LFDFIASKTPR D+ WDVGTG GQAA SL + YK+VVG
Sbjct  1    MANLFLKQAKQYVATRPVYPPELFDFIASKTPRRDMAWDVGTGNGQAAASLAKLYKHVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +A  L N R+V TP ++ L  + A V   +SVDLVT+AQA HW  LP FY 
Sbjct  61   TDTSAQQLAYATRLSNTRYVHTPADLPLEGIHATVAPPASVDLVTVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q + VL+   GV+AAWCY  P V+++VD+++ R Y  +Q FW P R++VD +YR+ DFPF
Sbjct  121  QARSVLRPGHGVLAAWCYTEPRVNAAVDAVFWRLYHGSQGFWAPNRRMVDDEYRSADFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPV+G +H GP++F   + M+L+ Y  YI S S YQTAK+ GVE+L +  VQ+F  AW  
Sbjct  181  DPVEGEKHTGPFQFSTHRRMDLDDYLMYITSWSAYQTAKDNGVELLDAPTVQEFAAAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            D K  K V +PI+LRIGKV
Sbjct  241  DAKEVKTVTYPIFLRIGKV  259



>emb|CDY14767.1| BnaC04g47640D [Brassica napus]
Length=268

 Score =   310 bits (793),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 192/264 (73%), Gaps = 4/264 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA  F+ Q KQY+  RP YP QLF+FIASKTP HDL WDVGTG+GQA+ SL   YKNV+ 
Sbjct  1    MAKFFINQAKQYAAARPNYPIQLFEFIASKTPCHDLAWDVGTGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP M+L+E+E  V  ESSVDLVT+AQALHWF LPTFY 
Sbjct  61   TDTSSKQLEFAAKLPNVRYELTPPVMSLSEIEQLVAPESSVDLVTVAQALHWFDLPTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKPDGV AAWCY  PEV+++VD +++R+Y      +W+  R+LV+  Y+ I+FP
Sbjct  121  NVKHVLKKPDGVFAAWCYTNPEVNAAVDEVFRRFYKEKLGPYWDKARRLVEDGYKGIEFP  180

Query  395  FDPV--DGCEHNG-PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTR  225
            F+ +  +  E    P  F  ++ M +E +  Y+RSSS YQTAK+KGVE+L++++  +F  
Sbjct  181  FEKIMDESTESQTFPVRFVTEREMGIEEFLTYLRSSSAYQTAKDKGVELLTAEMEGEFVG  240

Query  224  AWNEDGKTQKIVAFPIYLRIGKVG  153
            +W EDG+ +K+V FPIYL IG+VG
Sbjct  241  SWREDGEEKKVVRFPIYLLIGRVG  264



>gb|EAY89485.1| hypothetical protein OsI_11014 [Oryza sativa Indica Group]
Length=267

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/264 (57%), Positives = 182/264 (69%), Gaps = 5/264 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY+  RP YP +LFDFIASKT RHDL WDVGTG+GQA   L + YK+VVG
Sbjct  1    MANLFLKQAKQYAATRPAYPPELFDFIASKTARHDLAWDVGTGSGQAIPPLAKLYKDVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +AP LPNVR+V TPP++ L  + A V    SVDLVT+AQA HW  LP FY 
Sbjct  61   TDTSAQQLSYAPRLPNVRYVHTPPDLPLDGIHAAVAPPGSVDLVTVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPD-----GVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRT  408
            QV+ VL+ P      GV+AAWCY  P V ++VD  + R Y  +Q +W P R+LVD +Y  
Sbjct  121  QVRSVLRAPQPQQAAGVLAAWCYTEPCVDAAVDDAFWRLYNGSQPYWAPNRRLVDDRYSG  180

Query  407  IDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            +DFPFDPVDG  H GP+EF  ++ M+L+ Y AYI S S YQTAK KGVE+L    V+ F 
Sbjct  181  VDFPFDPVDGEAHTGPFEFSTERRMDLDGYLAYITSWSAYQTAKEKGVELLDEATVRGFA  240

Query  227  RAWNEDGKTQKIVAFPIYLRIGKV  156
             AW  D    K V +PI+LRIGKV
Sbjct  241  DAWGGDRVEVKTVRYPIFLRIGKV  264



>ref|XP_007162114.1| hypothetical protein PHAVU_001G125000g [Phaseolus vulgaris]
 gb|ESW34108.1| hypothetical protein PHAVU_001G125000g [Phaseolus vulgaris]
Length=277

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 181/252 (72%), Gaps = 3/252 (1%)
 Frame = -1

Query  905  KQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQ  726
            KQ+ + RP YP +LF FIASKTP HDL WDVGTG G AA SL E YKNV+ TD S  QL+
Sbjct  18   KQFPDARPGYPPKLFQFIASKTPSHDLAWDVGTGIGTAAKSLAEIYKNVIATDASEKQLE  77

Query  725  FAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKP  546
            FA  LPNVR+  TP  M++AE+E  V  + ++DLVT+A+A+HWF LPTFYQQVKWVLKKP
Sbjct  78   FATKLPNVRYQYTPSTMSMAEVEEMVAPKGTIDLVTVAEAMHWFDLPTFYQQVKWVLKKP  137

Query  545  DGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEH  369
             GVIAAWCY  P VS +VD++  + Y+T    +W+   KL D KY +I+FPF+ V+G +H
Sbjct  138  HGVIAAWCYYLPRVSDAVDTVLDQLYSTEASVYWDSACKLFDDKYASIEFPFELVEGADH  197

Query  368  NGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIV  189
             GP+EF  +  M L+ +  YIRS S YQTAK KGVE+L  D+V+    AW ED K  KIV
Sbjct  198  TGPFEFVTENEMNLDDFLTYIRSWSAYQTAKQKGVELLGEDVVKKLKLAWGEDAK--KIV  255

Query  188  AFPIYLRIGKVG  153
             FP+YLRIGKVG
Sbjct  256  KFPVYLRIGKVG  267



>ref|XP_003567596.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brachypodium 
distachyon]
Length=267

 Score =   308 bits (788),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 144/261 (55%), Positives = 183/261 (70%), Gaps = 2/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY+  RP YP +LF+FIASKT RHDL WDVGTG+GQA   L + YK VVG
Sbjct  1    MANLFLKQAKQYAATRPAYPPELFEFIASKTARHDLAWDVGTGSGQAIAPLAKLYKEVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +AP LPNVR+V TP ++ LA + A V   SSVD++T+AQA HW  LP FY 
Sbjct  61   TDTSAQQLSYAPPLPNVRYVHTPADLPLAGIHAAVAPPSSVDVITVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSS--SVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDF  399
              + VL+ P GV+AAWCY  P V +  +VD+ + R Y  +Q  W P RK+VD +YR+++F
Sbjct  121  DARSVLRAPHGVLAAWCYTEPRVDAGGAVDAAFWRLYEASQPHWAPNRKMVDDEYRSVEF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PFDPVDG  H GP+EF  ++ M+L+ Y  YI S S YQTAK+KGVE+L    V++F  AW
Sbjct  181  PFDPVDGEAHTGPFEFSTERRMDLDDYLTYISSWSAYQTAKDKGVELLDEATVREFAAAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
              D    K V +P++LRIGKV
Sbjct  241  GGDRGVVKTVRYPVFLRIGKV  261



>ref|XP_009141988.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brassica 
rapa]
Length=268

 Score =   307 bits (787),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 191/264 (72%), Gaps = 4/264 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA  F+ Q KQY+  RP YP QLF+ IASKTP HDL WDVGTG+GQA+ SL   YKNV+ 
Sbjct  1    MAKFFINQAKQYAAARPNYPIQLFEVIASKTPCHDLAWDVGTGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP M+L+E+E  V  ESSVDLVT+AQALHWF LPTFY 
Sbjct  61   TDTSSKQLEFAAKLPNVRYELTPPVMSLSEVEQLVAPESSVDLVTVAQALHWFDLPTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKPDGV AAWCY  PEV+++VD +++R+Y      +W+  R+LV+  Y+ I+FP
Sbjct  121  NVKHVLKKPDGVFAAWCYTNPEVNAAVDEVFRRFYKEKLGPYWDKARRLVEDGYKGIEFP  180

Query  395  FDPV--DGCEHNG-PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTR  225
            F+ +  +  E    P  F  ++ M +E +  Y+RSSS YQTAK+KGVE+L++++  +F  
Sbjct  181  FEKIMDESTESQTFPVRFVTEREMGIEEFLTYLRSSSAYQTAKDKGVELLTAEMEGEFVG  240

Query  224  AWNEDGKTQKIVAFPIYLRIGKVG  153
            +W EDG+ +K+V FPIYL IG+VG
Sbjct  241  SWREDGEEKKVVRFPIYLLIGRVG  264



>ref|XP_006294798.1| hypothetical protein CARUB_v10023848mg [Capsella rubella]
 gb|EOA27696.1| hypothetical protein CARUB_v10023848mg [Capsella rubella]
Length=270

 Score =   306 bits (785),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 192/266 (72%), Gaps = 6/266 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP YP +LF+FIASKTP HDL WDVGTG+GQA+ SL   YKNV+ 
Sbjct  1    MAKLFIKQAEQYAAARPNYPIKLFEFIASKTPSHDLAWDVGTGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP M+ +E+E  V  ESSVDLVTIAQALHWF L TFY 
Sbjct  61   TDTSCKQLEFAAKLPNVRYELTPPTMSTSEIEKLVAPESSVDLVTIAQALHWFDLKTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKP+GVIAAWCY  PEV+++VD ++QR+Y      +W+  R+LV+  YR I+FP
Sbjct  121  NVKHVLKKPNGVIAAWCYTNPEVNAAVDDVFQRFYDEKLGPYWDKARRLVEDGYRGIEFP  180

Query  395  FDPVDGCEH-----NGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDF  231
            F+ ++  +      N P +F  ++ M  + +  Y+RSSS YQTAK KGVE+L++++  +F
Sbjct  181  FEKIEDDDESTESKNFPVKFVTEREMVFQEFMTYLRSSSAYQTAKEKGVELLTAEMEGEF  240

Query  230  TRAWNEDGKTQKIVAFPIYLRIGKVG  153
              +W EDG  +K+V +PI+L IG+VG
Sbjct  241  ADSWKEDGIEKKVVRYPIHLLIGRVG  266



>ref|XP_006830346.1| hypothetical protein AMTR_s00116p00046640 [Amborella trichopoda]
 gb|ERM97762.1| hypothetical protein AMTR_s00116p00046640 [Amborella trichopoda]
Length=261

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/259 (56%), Positives = 187/259 (72%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ K Y+EGRP YP +LF+FIASKT  HDLVWDVGTG+GQAA+SL   YKN+V 
Sbjct  1    MAGLFDKQAKLYAEGRPDYPFELFEFIASKTADHDLVWDVGTGSGQAAVSLANLYKNIVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL FA   PNVR++ TP +M   ++   +  + SVDLVT+AQALHWF   TFYQ
Sbjct  61   TDISQQQLSFAHPHPNVRYLHTPFSMPPTDVTRAIAPQGSVDLVTVAQALHWFDPNTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVKW+LKKP GV AAWCY  P+V+ +VDSI    YTT+ HFW   RKLVD +YRT++FPF
Sbjct  121  QVKWLLKKPGGVFAAWCYTLPKVNEAVDSILANLYTTSDHFWASERKLVDAEYRTLEFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            +PV+G EH GP+ F+  + M+LE++  +IR+ S YQTA  +GVE+LS ++V+ F +AW  
Sbjct  181  EPVEGEEHTGPFVFERTREMDLEAFLTWIRTWSAYQTAHMEGVELLSEEVVKKFEQAWKN  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                  +  +PI+LRIG++
Sbjct  241  SVGKDALARYPIFLRIGRI  259



>ref|NP_001151125.1| embryonic abundant protein-like [Zea mays]
 gb|ACG41705.1| embryonic abundant protein-like [Zea mays]
Length=262

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 181/259 (70%), Gaps = 0/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY   RP YP +LFDFIASKTPR D+ WDVGTG GQAA SL + YK+VVG
Sbjct  1    MANLFLKQAKQYVATRPVYPPELFDFIASKTPRRDMAWDVGTGNGQAAASLAKLYKHVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +A  L N R+V TP ++ L  + A V   +SVDLVT+AQA HW  LP FY 
Sbjct  61   TDTSAQQLAYATRLSNTRYVHTPADLPLEGIHATVAPPASVDLVTVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q + VL+   GV+AAWCY  P V ++VD+++ R Y  +Q +W P R++VD +YR+ DFPF
Sbjct  121  QARSVLRPGHGVLAAWCYTEPRVDAAVDAVFWRLYHGSQGYWAPNRRMVDDEYRSADFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPV+G  H GP++F   + M+L+ Y  YI S S YQTA++ GVE+L +  VQ+F  AW  
Sbjct  181  DPVEGENHTGPFQFSTHRRMDLDDYLMYITSWSAYQTAQDNGVELLDAPTVQEFAAAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            D K  K V +PI+LRIGKV
Sbjct  241  DAKEVKTVTYPIFLRIGKV  259



>ref|NP_181669.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAC78535.1| putative embryo-abundant protein [Arabidopsis thaliana]
 gb|AAL62359.1| putative embryo-abundant protein [Arabidopsis thaliana]
 gb|AAP13415.1| At2g41380 [Arabidopsis thaliana]
 gb|AEC09967.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=269

 Score =   306 bits (783),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 188/265 (71%), Gaps = 5/265 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP+YP +LF++IASKTP HDL WDVG G+GQA+ SL   YKNV+ 
Sbjct  1    MAKLFIKQAEQYAAARPSYPTKLFEYIASKTPCHDLAWDVGAGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP M+ +E+E  V  ESSVDLVT+AQALHWF L  FY 
Sbjct  61   TDTSSKQLEFAAKLPNVRYEITPPTMSSSEIEKLVAPESSVDLVTVAQALHWFDLTNFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKP+GVIAAWCY  PEV+ +VD ++QR+Y       W+  R+LV+  YR I+FP
Sbjct  121  NVKHVLKKPNGVIAAWCYTNPEVNDAVDKVFQRFYDEKLGPHWDLARRLVEDGYRGIEFP  180

Query  395  FDPVDGCE----HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            F+ VD  E     + P  F  +K M  E Y  Y+RSSS YQTAK KG+E+L++++  +F 
Sbjct  181  FEKVDNDESTESQSFPVRFVTEKEMVFEEYMTYLRSSSAYQTAKEKGLELLTAEMEGEFA  240

Query  227  RAWNEDGKTQKIVAFPIYLRIGKVG  153
             +W EDGK +K+V +PIYL IG+V 
Sbjct  241  GSWKEDGKEKKVVRYPIYLLIGRVA  265



>ref|XP_004142649.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Cucumis 
sativus]
Length=259

 Score =   305 bits (782),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 192/264 (73%), Gaps = 12/264 (5%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ K Y+EGRP+YP +LF++IAS TP HDLVWDVGTGTGQAA SL   Y  V+ 
Sbjct  1    MAKLFIKQAKNYAEGRPSYPTKLFEYIASTTPAHDLVWDVGTGTGQAAQSLAAHYTTVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTSP QL+FA  LPNV +  TP  M++ E+E  V    SVDLVT+AQALHWF+LP+FYQ
Sbjct  61   TDTSPKQLEFATKLPNVHYHHTPSTMSIEEVEKMVAPPGSVDLVTVAQALHWFNLPSFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTI--D  402
             V+WVLKKP GVIAAWCY  PEV++ +D++ +R Y T+   +WE  R+LVD++Y+TI   
Sbjct  121  NVRWVLKKPHGVIAAWCYSLPEVNNGIDTVLRRIYKTDFGPYWEAPRRLVDEEYKTIEGG  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
               +P+         EF A+K ME E Y  Y+RS S YQTAK+ G+E+LS+++V++   A
Sbjct  181  GGGEPIT--------EFAAEKEMEFEEYLIYLRSWSSYQTAKDLGIELLSNEVVEELESA  232

Query  221  WNEDG-KTQKIVAFPIYLRIGKVG  153
            WNEDG K +K+  FPI+L+IG+VG
Sbjct  233  WNEDGVKGKKVAKFPIHLKIGRVG  256



>gb|AFK38407.1| unknown [Lotus japonicus]
Length=260

 Score =   305 bits (781),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 154/262 (59%), Positives = 185/262 (71%), Gaps = 5/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF KQ KQY +GRP+YP QLF FIASKTP H   WDV TG GQAA SL   Y+NV+ 
Sbjct  1    MAELFEKQAKQYVDGRPSYPPQLFQFIASKTPSHHRAWDVATGNGQAAKSLAALYENVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  + NVR+  TPP M+LAELE  V  + ++DLVTIAQALHWFHLPTFY+
Sbjct  61   TDASEKQLEFAEKISNVRYEYTPPTMSLAELEQIVAPQGTIDLVTIAQALHWFHLPTFYE  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSV-DSI-YQRYYTTNQHFWEPGRKLVDQKYRTIDF  399
            QVK VLKKP GVIAAW YD P    +V DSI +Q Y+     +WE   + V +K+ + DF
Sbjct  121  QVKLVLKKPHGVIAAWRYDLPGFCDAVLDSILHQLYFFDLDPYWETKSRSVREKFLSFDF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF PVD  +H GP+EF  + +M+L+S F YIRS S YQTAK KGVEIL  D+V+ F  AW
Sbjct  181  PFVPVD-TDHTGPFEFVMETMMDLDSLFTYIRSLSAYQTAKEKGVEILREDVVEKFKLAW  239

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
             EDG  QK+   PIYLRIG+V 
Sbjct  240  GEDG--QKVARSPIYLRIGRVS  259



>emb|CDY06927.1| BnaA04g23880D [Brassica napus]
Length=268

 Score =   305 bits (782),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 145/264 (55%), Positives = 191/264 (72%), Gaps = 4/264 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA  F+ Q KQY+  RP YP QLF+FIASKTP HDL WDVGTG+GQA+ SL   YKNV+ 
Sbjct  1    MAKFFINQAKQYAAARPNYPIQLFEFIASKTPCHDLAWDVGTGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  L NVR+  TPP M+L+E+E  V  ESSVDLVT+AQALHWF LPTFY 
Sbjct  61   TDTSSKQLEFAAKLSNVRYELTPPVMSLSEIEQLVAPESSVDLVTVAQALHWFDLPTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKPDGV AAWCY  PEV+++VD +++++Y      +W+  R+LV+  Y+ I+FP
Sbjct  121  NVKHVLKKPDGVFAAWCYTNPEVNAAVDEVFRQFYKEKLGPYWDKARRLVEDGYKGIEFP  180

Query  395  FDPV--DGCEHNG-PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTR  225
            F+ +  +  E    P  F  ++ M +E +  Y+RSSS YQTAK+KGVE+L++++  +F  
Sbjct  181  FEKIMDESTESQTFPVRFVTEREMGIEEFLTYLRSSSAYQTAKDKGVELLTAEMEGEFVG  240

Query  224  AWNEDGKTQKIVAFPIYLRIGKVG  153
            +W EDG+ +K+V FPIYL IG+VG
Sbjct  241  SWKEDGEEKKVVRFPIYLLIGRVG  264



>ref|XP_002879928.1| hypothetical protein ARALYDRAFT_903452 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56187.1| hypothetical protein ARALYDRAFT_903452 [Arabidopsis lyrata subsp. 
lyrata]
Length=269

 Score =   305 bits (780),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/265 (55%), Positives = 188/265 (71%), Gaps = 5/265 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP+YP +LF+++ASKTP HDL WDVG G+GQA+  L   YKNV+ 
Sbjct  1    MAKLFIKQAEQYAAARPSYPTKLFEYLASKTPCHDLAWDVGAGSGQASRWLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP M+ +E+E  V  ESSVDLVT+AQALHWF L  FY 
Sbjct  61   TDTSSKQLEFAARLPNVRYEITPPTMSSSEIEKLVAPESSVDLVTVAQALHWFDLTNFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKPDGVIAAWCY  PEV+++VD ++QR+Y       W+  R+LV+  YR I+FP
Sbjct  121  NVKHVLKKPDGVIAAWCYTNPEVNAAVDKVFQRFYDEKLGPHWDKARRLVEDGYRGIEFP  180

Query  395  FDPVDGCE----HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            F+ VD  E     + P  F  +K M  E Y  Y+RSSS YQTAK KG+E+L++++   F 
Sbjct  181  FEKVDNDESTESQSLPIRFVTEKEMVYEEYMTYLRSSSAYQTAKEKGLELLTTEMEGKFA  240

Query  227  RAWNEDGKTQKIVAFPIYLRIGKVG  153
             +W EDGK +K+V FPI+L IG+VG
Sbjct  241  DSWKEDGKEKKVVRFPIHLLIGRVG  265



>ref|XP_006411404.1| hypothetical protein EUTSA_v10017081mg [Eutrema salsugineum]
 gb|ESQ52857.1| hypothetical protein EUTSA_v10017081mg [Eutrema salsugineum]
Length=269

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 144/265 (54%), Positives = 189/265 (71%), Gaps = 5/265 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP YP +LF+FIASKTP HDL WDVG G+GQA+ SL   YK V+ 
Sbjct  1    MAKLFIKQAEQYAAARPNYPIKLFEFIASKTPCHDLAWDVGAGSGQASRSLAGIYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPN+R+  TPP M+ +E+E  V AESSVDLVT+AQALHWF L TFY 
Sbjct  61   TDTSSKQLEFAAKLPNIRYEVTPPVMSSSEIEQLVAAESSVDLVTVAQALHWFDLTTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKPDGVIAAWCY  P V+++VD +++R+Y      +W+  R+LV+  YR I+FP
Sbjct  121  NVKHVLKKPDGVIAAWCYTNPVVNAAVDEVFRRFYEERLGPYWDKARRLVEDGYRGIEFP  180

Query  395  FDPVDGCEHNG----PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            F+ +   E       P  F A++ M +E Y  Y+RSSS YQTAK KG+E+L+ ++  +F 
Sbjct  181  FEKIMDDESTESQRFPVRFVAEREMGVEDYLTYLRSSSAYQTAKEKGLELLTEEMEGEFA  240

Query  227  RAWNEDGKTQKIVAFPIYLRIGKVG  153
             +W +DG+ +K+V FPIYL IG+VG
Sbjct  241  GSWKKDGEEKKVVRFPIYLLIGRVG  265



>ref|XP_010508723.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=271

 Score =   303 bits (776),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 188/266 (71%), Gaps = 6/266 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP YP +LF+FIASKTP HDL WDVG G+GQA+ SL   YK V+ 
Sbjct  1    MAKLFIKQAEQYAAARPNYPIKLFEFIASKTPCHDLAWDVGAGSGQASRSLAGIYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNM-TLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
            TDTS  QL+FA  L NVR+  TPP M + +E+E  V  ESSVDLVT+AQALHWF L  FY
Sbjct  61   TDTSSKQLEFAEKLANVRYELTPPTMSSTSEIEKLVAKESSVDLVTVAQALHWFDLTNFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDF  399
              VK VLKKP+GVIAAWCY  PEV+++VD ++QR+Y       W+  R+LV+  YR I+F
Sbjct  121  SNVKHVLKKPNGVIAAWCYTNPEVNAAVDKVFQRFYDEELGPHWDKARRLVEDGYRGIEF  180

Query  398  PFDPVDGCEHNG----PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDF  231
            PF+ VD  E  G    P +F  +K M LE Y  Y+RSSS YQTAK KG+E+L++++  +F
Sbjct  181  PFEKVDEDESTGSQSLPVKFVTEKEMVLEEYMTYLRSSSAYQTAKEKGLELLTAEMEGEF  240

Query  230  TRAWNEDGKTQKIVAFPIYLRIGKVG  153
              +W EDG  +KIV FPI+L IG+VG
Sbjct  241  ADSWKEDGIEKKIVRFPIHLLIGRVG  266



>gb|AFW90528.1| embryo-abundant protein EMB [Phaseolus vulgaris]
Length=285

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 141/253 (56%), Positives = 186/253 (74%), Gaps = 5/253 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLF+KQ K+Y++ RP+YP QLF FIASKTP H+L WDVGTG+GQAA SL   Y+ V+ 
Sbjct  1    MADLFVKQAKEYADARPSYPPQLFQFIASKTPSHNLAWDVGTGSGQAAKSLSVIYEKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  + NVR+  TPP M++AELE  V +E SVDLVTIAQ+LHWF +PTFYQ
Sbjct  61   TDASAKQLEFAVKICNVRYQHTPPIMSMAELEEMVASEGSVDLVTIAQSLHWFDMPTFYQ  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
            QVKW+LKKP GVIAAWCY  P V   VD++   +Y++    +W+P RKLVD+ Y +IDFP
Sbjct  121  QVKWILKKPHGVIAAWCYYLPRVCDEVDTVLDEFYSSEVGPYWDPARKLVDKLYGSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+PVDG  H G +EF  +  M LE+ F YI+S + YQTAK+KGVE+L+ +++Q+   +W 
Sbjct  181  FEPVDGAHHTGTFEFVTETFMNLENSFPYIKSWAAYQTAKDKGVELLAEEVIQNSKLSWG  240

Query  215  EDGKTQKIVAFPI  177
            ++ K     +FP+
Sbjct  241  KNAKK----SFPV  249



>ref|XP_010517625.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X2 
[Camelina sativa]
Length=276

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 188/271 (69%), Gaps = 11/271 (4%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ +QY+  RP YP +LF+FIASKTP HDL WDVG G+GQA+ SL   YK V+ 
Sbjct  1    MAKLFIKQAEQYAAARPNYPIKLFEFIASKTPCHDLAWDVGAGSGQASRSLAGIYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNVR+  TPP MT +E+E  V  ESSVDLVT+AQALHWF L TFY 
Sbjct  61   TDTSSKQLEFAAKLPNVRYELTPPTMTTSEIEKLVATESSVDLVTVAQALHWFDLTTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKP+GVIAAWCY  PEV+++VD ++QR+Y       W+  R+LV+  YR I+FP
Sbjct  121  NVKHVLKKPNGVIAAWCYTNPEVNAAVDKVFQRFYDEKLGPHWDKARRLVEDGYRGIEFP  180

Query  395  FDPV----------DGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSD  246
            F+ V           G +     +F  ++ M LE Y  Y+RS+S YQTAK KG+EIL+++
Sbjct  181  FEKVDDDDDDDDESTGSQSLPVNKFVTEREMVLEEYMTYLRSTSAYQTAKEKGLEILTAE  240

Query  245  LVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            +  +F  +W EDG  +KIV FPI+L IG+VG
Sbjct  241  MEGEFADSWKEDGIEKKIVRFPIHLLIGRVG  271



>ref|XP_010508722.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=272

 Score =   301 bits (770),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 187/265 (71%), Gaps = 6/265 (2%)
 Frame = -1

Query  929  ADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGT  750
            A LF+KQ +QY+  RP YP +LF+FIASKTP HDL WDVG G+GQA+ SL   YK V+ T
Sbjct  3    AKLFIKQAEQYAAARPNYPIKLFEFIASKTPCHDLAWDVGAGSGQASRSLAGIYKKVIAT  62

Query  749  DTSPNQLQFAPNLPNVRFVCTPPNM-TLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            DTS  QL+FA  L NVR+  TPP M + +E+E  V  ESSVDLVT+AQALHWF L  FY 
Sbjct  63   DTSSKQLEFAEKLANVRYELTPPTMSSTSEIEKLVAKESSVDLVTVAQALHWFDLTNFYS  122

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKP+GVIAAWCY  PEV+++VD ++QR+Y       W+  R+LV+  YR I+FP
Sbjct  123  NVKHVLKKPNGVIAAWCYTNPEVNAAVDKVFQRFYDEELGPHWDKARRLVEDGYRGIEFP  182

Query  395  FDPVDGCEHNG----PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            F+ VD  E  G    P +F  +K M LE Y  Y+RSSS YQTAK KG+E+L++++  +F 
Sbjct  183  FEKVDEDESTGSQSLPVKFVTEKEMVLEEYMTYLRSSSAYQTAKEKGLELLTAEMEGEFA  242

Query  227  RAWNEDGKTQKIVAFPIYLRIGKVG  153
             +W EDG  +KIV FPI+L IG+VG
Sbjct  243  DSWKEDGIEKKIVRFPIHLLIGRVG  267



>gb|ACF74282.1| embryo-abundant protein EMB [Arachis hypogaea]
Length=221

 Score =   298 bits (763),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADLFLKQ K+Y++ RP+YP +LF FIASKTP H+L WDVGTG+GQAA  L   YKNV+G
Sbjct  1    MADLFLKQAKEYAKARPSYPTELFQFIASKTPSHELAWDVGTGSGQAAKHLAAIYKNVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  LPNV++  TPP M++ E+E  V A+ SVDLVTIAQ+LHWF LP+FY+
Sbjct  61   TDTSEKQLEFAIKLPNVKYQHTPPIMSMEEVEQKVAAQGSVDLVTIAQSLHWFDLPSFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYT-TNQHFWEPGRKLVDQKYRTIDFP  396
            QV WVLKKP GVIAA CY+ P VS  VD ++ +YY      +W+P RKLV+  YR+IDFP
Sbjct  121  QVNWVLKKPHGVIAAICYNVPRVSEEVDKVFDQYYVDVLSPYWDPARKLVEDNYRSIDFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKN  273
            F+PVDG +H GP+EF ++  M+LE+Y  +IRSSS YQTAK+
Sbjct  181  FEPVDGADHTGPFEFVSEVTMDLENYLTFIRSSSAYQTAKD  221



>ref|XP_003625029.1| Methyltransferase, putative [Medicago truncatula]
 gb|AES81247.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=367

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/267 (54%), Positives = 182/267 (68%), Gaps = 17/267 (6%)
 Frame = -1

Query  950  TEELKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEK  771
             + + +MA+LF+ QGK+Y++ RP+YP QLF FIASKTP H+LVWDV TG+GQAA SL   
Sbjct  48   NQRVIEMAELFVNQGKEYADARPSYPPQLFQFIASKTPSHNLVWDVATGSGQAAKSLATL  107

Query  770  YKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFH  591
            YKNV+ TD S  QL+FA  LPN+  + TP              + ++DLVTIAQ LHWF 
Sbjct  108  YKNVIATDVSEQQLEFATKLPNLEQIVTP--------------QGTIDLVTIAQGLHWFD  153

Query  590  LPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIY-QRYYTTNQHFWEPGRKLVDQKY  414
             P FYQQVKWVLKKP GVIAAWCY  P +S  VD++  Q Y+  ++ +W+   KLV+  Y
Sbjct  154  FPNFYQQVKWVLKKPHGVIAAWCYSLPRISDEVDTVVDQFYFIDSKPYWDSACKLVEDNY  213

Query  413  RTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQD  234
            R+IDFPF+ VDG +H GP+EF  + LM  +    YI+S S YQTAK KGVE+L  D+V+ 
Sbjct  214  RSIDFPFEAVDGVDHRGPFEFVTEILMSFDGLLTYIKSWSAYQTAKEKGVELLGEDVVEK  273

Query  233  FTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            F  AW EDG   K   FP+YLRIG+VG
Sbjct  274  FKLAWGEDG--HKTAKFPVYLRIGRVG  298



>ref|XP_010517624.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X1 
[Camelina sativa]
Length=284

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/279 (53%), Positives = 188/279 (67%), Gaps = 19/279 (7%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMS--------LG  777
            MA LF+KQ +QY+  RP YP +LF+FIASKTP HDL WDVG G+GQA+ S        L 
Sbjct  1    MAKLFIKQAEQYAAARPNYPIKLFEFIASKTPCHDLAWDVGAGSGQASRSVNSIPNFHLA  60

Query  776  EKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHW  597
              YK V+ TDTS  QL+FA  LPNVR+  TPP MT +E+E  V  ESSVDLVT+AQALHW
Sbjct  61   GIYKKVIATDTSSKQLEFAAKLPNVRYELTPPTMTTSEIEKLVATESSVDLVTVAQALHW  120

Query  596  FHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQ  420
            F L TFY  VK VLKKP+GVIAAWCY  PEV+++VD ++QR+Y       W+  R+LV+ 
Sbjct  121  FDLTTFYSNVKHVLKKPNGVIAAWCYTNPEVNAAVDKVFQRFYDEKLGPHWDKARRLVED  180

Query  419  KYRTIDFPFDPV----------DGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNK  270
             YR I+FPF+ V           G +     +F  ++ M LE Y  Y+RS+S YQTAK K
Sbjct  181  GYRGIEFPFEKVDDDDDDDDESTGSQSLPVNKFVTEREMVLEEYMTYLRSTSAYQTAKEK  240

Query  269  GVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            G+EIL++++  +F  +W EDG  +KIV FPI+L IG+VG
Sbjct  241  GLEILTAEMEGEFADSWKEDGIEKKIVRFPIHLLIGRVG  279



>gb|KEH23633.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=252

 Score =   283 bits (723),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 179/268 (67%), Gaps = 28/268 (10%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+L++ Q ++YS  RP+YP QLF FIASKTP H+LVWDV TG+GQA  SL   Y NVV 
Sbjct  1    MAELYVNQAREYSNARPSYPPQLFQFIASKTPSHNLVWDVATGSGQAPKSLATLYNNVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPN---------MTLAELEANVGAESSVDLVTIAQALH  600
            TD S  QL+FA  L NVR+  TP           M++AELE  V ++ ++DLVTIAQALH
Sbjct  61   TDASEKQLEFATLLHNVRYQHTPSTMSAQPRFLIMSMAELEQMVSSQGTIDLVTIAQALH  120

Query  599  WFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQ  420
            WF L TFY+QV WVLKKP G+IA WCY+ P V+ +VD+++ +                 +
Sbjct  121  WFDLSTFYKQVNWVLKKPHGIIATWCYNSPRVNDAVDALHDK-----------------E  163

Query  419  KYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLV  240
             Y T+DFPF PV+G +H GP+EF A+ +M+ + +  YIRS S YQT+KN GVE+L  D++
Sbjct  164  NYETVDFPFGPVEGVDHTGPFEFVAETVMDFDDFLTYIRSRSSYQTSKNNGVELLKEDVI  223

Query  239  QDFTRAWNEDGKTQKIVAFPIYLRIGKV  156
            ++F  A  EDG  QK V F +YLRIG+V
Sbjct  224  ENFKLARGEDG--QKTVKFQVYLRIGRV  249



>ref|XP_006421283.1| hypothetical protein CICLE_v10005866mg [Citrus clementina]
 gb|ESR34523.1| hypothetical protein CICLE_v10005866mg [Citrus clementina]
Length=216

 Score =   279 bits (714),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/261 (52%), Positives = 173/261 (66%), Gaps = 49/261 (19%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ KQY+E RP YP++LF FI SKT  HDL WDVGTG+GQAA SL   ++NV+G
Sbjct  1    MAELFIKQAKQYAETRPNYPEELFKFITSKTTNHDLAWDVGTGSGQAAASLSGIFENVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            T+TSP Q++FA  LPN+R+  T P M++AELE NV A+S+VDLVTIAQA+HWF LP FY 
Sbjct  61   TETSPKQIEFATKLPNIRYELTSPAMSIAELEQNVAAQSTVDLVTIAQAMHWFDLPQFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVKW                                                Y TIDFPF
Sbjct  121  QVKW------------------------------------------------YMTIDFPF  132

Query  392  DPVDGCEHNGPYE-FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            +PVDG +  GP++ F  +K M+ E YF YIRS S YQTAK+KGVE+L+ +++++F RAWN
Sbjct  133  EPVDGADSTGPFDRFVIEKTMDQEGYFTYIRSWSAYQTAKDKGVELLTENVIENFRRAWN  192

Query  215  EDGKTQKIVAFPIYLRIGKVG  153
            EDG+++K+V FPIYLRIGKVG
Sbjct  193  EDGQSRKVVRFPIYLRIGKVG  213



>gb|KDO49184.1| hypothetical protein CISIN_1g035840mg, partial [Citrus sinensis]
Length=213

 Score =   279 bits (713),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 169/212 (80%), Gaps = 2/212 (1%)
 Frame = -1

Query  782  LGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQAL  603
            L + YKNV+ TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVDLVTIA AL
Sbjct  1    LAKIYKNVIATDTSPKQLEFAIKLPNIRYQLTPPTMSITELEQNVATQSSVDLVTIAAAL  60

Query  602  HWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLV  426
            HWF LP FY+QVKWVLKKP+GVIAAW Y  PE++ SV ++++ + T + + FWEP RKLV
Sbjct  61   HWFDLPQFYKQVKWVLKKPNGVIAAWTYTMPEINESVGAVFKPFDTVDCEPFWEPQRKLV  120

Query  425  DQKYRTIDFPFDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSS  249
            D KY +IDFPF+PVDG ++ GP+ +F  +K+M+L++YF +IRS SGYQTAK+KGVE+L+ 
Sbjct  121  DNKYMSIDFPFEPVDGVDNTGPFDQFVLEKVMDLDNYFTFIRSCSGYQTAKDKGVELLTD  180

Query  248  DLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            +++  F  AWNEDG++QK+  FPIYLRIG+VG
Sbjct  181  NVMDKFKVAWNEDGQSQKVARFPIYLRIGQVG  212



>gb|AAM19356.1|AF369889_1 embryo-abundant protein EMB [Pisum sativum]
Length=261

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/260 (54%), Positives = 174/260 (67%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+ QGK+Y+  RP+YP QLF FIASK     L + +    GQAA SL   YKNV+ 
Sbjct  1    MAGLFVNQGKEYAIARPSYPPQLFQFIASKLLLTTL-FGMSPPEGQAAKSLANLYKNVIA  59

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNV++  TP  M++ E+E  V  + ++DLVTIAQ LHWF+LP FY+
Sbjct  60   TDVSEKQLEFATKLPNVQYQHTPSTMSIPEVEQIVAQQGTIDLVTIAQGLHWFNLPNFYE  119

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIY-QRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
            QVK+VLKKP GVIAAWCY  P +S  VD +  Q YY+    +W+  RKLV+   R+IDFP
Sbjct  120  QVKFVLKKPHGVIAAWCYFLPRISDEVDIVLDQFYYSDANPYWDSARKLVEDNIRSIDFP  179

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ VDG +H GP+EF  + LM  +    YIRS S YQTAK KGVE+L  D+V+ F  AW 
Sbjct  180  FEAVDGVDHTGPFEFVTETLMSFDGLLTYIRSWSAYQTAKEKGVELLREDVVEKFKVAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKV  156
            ED    K   FPIYLRIGKV
Sbjct  240  ED-HAPKTAKFPIYLRIGKV  258



>gb|ADQ74922.1| S-adenosylmethionine-dependent methyltransferase [Jatropha curcas]
Length=213

 Score =   266 bits (679),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 157/211 (74%), Gaps = 1/211 (0%)
 Frame = -1

Query  782  LGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQAL  603
            L E +KNV+ TDTS  QL+FAP LPNVR+  TPP + + E E  +  ESSVDLVTIAQA+
Sbjct  1    LAETFKNVIATDTSSKQLEFAPKLPNVRYQQTPPTIRMEEFEQYISIESSVDLVTIAQAM  60

Query  602  HWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLV  426
            HWF LP FY QVKWVLKKP GVIAAWCY  PEV+ S+DS+++ +Y  +   +WE GRK V
Sbjct  61   HWFDLPKFYHQVKWVLKKPHGVIAAWCYTVPEVNDSIDSVFKPFYAIDSEPYWEAGRKWV  120

Query  425  DQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSD  246
            D KY+ I FPF+PV+G +  GP +F  +++M L+ +F Y+RS S YQTAK KGV++L +D
Sbjct  121  DDKYQNIYFPFEPVEGSDDTGPVKFVIERVMRLDDFFTYLRSWSAYQTAKEKGVDLLRND  180

Query  245  LVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            +++ F  A NEDG  +K+V FP+YLRIGKVG
Sbjct  181  VIEKFKNARNEDGSDEKVVKFPVYLRIGKVG  211



>ref|XP_006491618.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Citrus 
sinensis]
Length=235

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 164/220 (75%), Gaps = 2/220 (1%)
 Frame = -1

Query  806  GTGQAAMSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVD  627
            G G A   L + Y++V+ TDTSP QL+FA  LPN+R+  TPP M++ ELE NV  +SSVD
Sbjct  15   GRGLARFMLAQIYQHVIATDTSPKQLKFAIKLPNIRYQLTPPTMSITELEQNVATQSSVD  74

Query  626  LVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHF  450
            LVTIA A HWF L  FY+QVKWVLKKP GVIAAW Y  PE++ SV ++++ + T + + F
Sbjct  75   LVTIASAPHWFDLRQFYKQVKWVLKKPSGVIAAWTYTMPEINESVGAVFKPFDTIDCKSF  134

Query  449  WEPGRKLVDQKYRTIDFPFDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKN  273
            W P RKLVD KY +IDFPF+PVDG E+ GP+ +F  +KLM+L+ YF +IRS S YQ A +
Sbjct  135  WAPQRKLVDNKYMSIDFPFEPVDGYENTGPFDQFVVEKLMDLDDYFKFIRSCSAYQKAND  194

Query  272  KGVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            KGVE+L+ ++++ F  AWNEDG++QKI  F +YLRIGKVG
Sbjct  195  KGVELLTENVMEKFKAAWNEDGQSQKIARFRVYLRIGKVG  234



>ref|XP_009630235.1| PREDICTED: putative methyltransferase DDB_G0268948 [Nicotiana 
tomentosiformis]
Length=270

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 164/216 (76%), Gaps = 4/216 (2%)
 Frame = -1

Query  788  MSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQ  609
            + L + YK VV TDTSP QLQ+A  LPNVR+VCT P M++ E+E+ +GA+ SVDL+TIA 
Sbjct  58   LQLAKLYKRVVATDTSPKQLQYATRLPNVRYVCTSPKMSMDEVESKIGAKPSVDLITIAA  117

Query  608  ALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQR-YYTTNQHFWEPGRK  432
            ALHWF LPTFYQQVKWVLKKP+GVIA W Y  P+V+SSVD++    YY     +WE  RK
Sbjct  118  ALHWFDLPTFYQQVKWVLKKPNGVIATWSYTTPQVNSSVDAVLINFYYNDAGPYWESPRK  177

Query  431  LVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILS  252
            LVD+KY+T+DFPF+PV GC H+GP++FK ++ ++L SYF Y++S S YQTAK K VE+L+
Sbjct  178  LVDEKYKTVDFPFEPVVGCGHSGPFQFKIERAIDLGSYFTYLKSLSPYQTAKEKSVELLT  237

Query  251  SDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVGILD  144
             D+V  F  A +E   +QK V FP+YLRIGKVG L+
Sbjct  238  GDVVDKFNSAGDE---SQKTVVFPVYLRIGKVGNLN  270



>gb|ABK22848.1| unknown [Picea sitchensis]
Length=266

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 173/266 (65%), Gaps = 7/266 (3%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q ++Y+ GRP YP QLF  IA  +P   L WDVGTG+GQAA++L E ++ V+ 
Sbjct  1    MAGLFDRQAREYANGRPQYPPQLFSLIAKHSPHRRLAWDVGTGSGQAALALSEIFERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q+ +AP  PN+ +  TP  M+L ELE+ VGAE SVDLVT+AQALH+F L TFY 
Sbjct  61   TDVSEQQISYAPRRPNITYTVTPRQMSLEELESTVGAEGSVDLVTVAQALHFFDLHTFYG  120

Query  572  QVKWVLKKPDGVIAAWCYDFPE-VSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
            QVK VL+KP GV AAWCY+    V+ SVD ++Q  Y  +  FW P R+LVD +Y TIDFP
Sbjct  121  QVKHVLRKPGGVFAAWCYNREAVVNPSVDRVFQDLYRASDPFWTPARQLVDSEYTTIDFP  180

Query  395  FDPV--DGCEH----NGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQD  234
            F  V  +G E       P +F A+K +  E Y + IRS S YQ AK KGVE+L   +V  
Sbjct  181  FRSVAQEGSEGEESTTAPIKFWAKKELGFEGYLSLIRSWSAYQIAKGKGVELLDDQIVAR  240

Query  233  FTRAWNEDGKTQKIVAFPIYLRIGKV  156
              +AW    +  K V++P++LRIG V
Sbjct  241  LKQAWGGSDEDVKTVSWPVFLRIGVV  266



>gb|KDO49181.1| hypothetical protein CISIN_1g0379611mg, partial [Citrus sinensis]
Length=212

 Score =   262 bits (669),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/212 (58%), Positives = 164/212 (77%), Gaps = 3/212 (1%)
 Frame = -1

Query  782  LGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQAL  603
            L + Y++V+ TDTSP QL+FA  LPN+R+  TP  M++ ELE NV  +SSVDLVTIA AL
Sbjct  1    LAQIYQHVIATDTSPKQLKFAIKLPNIRYQLTP-TMSITELEQNVATQSSVDLVTIASAL  59

Query  602  HWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLV  426
            HWF LP FY+QVKWVLKKP GVIAAW Y  PE++ SV ++++ + T + + FW P RKLV
Sbjct  60   HWFDLPQFYKQVKWVLKKPSGVIAAWTYTMPEINESVGAVFKPFDTIDCNPFWAPQRKLV  119

Query  425  DQKYRTIDFPFDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSS  249
            D+KY +IDFPF+PVDG E+ GP+ +F  +K+M+L+ YF +IRS S YQ AK+KGVE+L+ 
Sbjct  120  DKKYMSIDFPFEPVDGYENTGPFDQFVVEKMMDLDDYFKFIRSCSAYQKAKDKGVELLTE  179

Query  248  DLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
            ++++ F  AWNEDG++QKI  F +YLRIGKVG
Sbjct  180  NVMEKFKAAWNEDGQSQKIARFRVYLRIGKVG  211



>ref|XP_008793339.1| PREDICTED: putative methyltransferase DDB_G0268948 [Phoenix dactylifera]
Length=227

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/218 (56%), Positives = 155/218 (71%), Gaps = 0/218 (0%)
 Frame = -1

Query  809  TGTGQAAMSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSV  630
            TG       L + YK+VVGTDTS  QL FAP LPNVR+V TP  ++L EL+++V A S+V
Sbjct  7    TGLTSLFPQLAKIYKSVVGTDTSREQLAFAPELPNVRYVHTPATISLPELQSDVAAPSTV  66

Query  629  DLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHF  450
            DL+T+AQA+HWFHLPTFY Q + +L+ P GV+AAWCY  P V   VDS++ R YT +  F
Sbjct  67   DLITVAQAVHWFHLPTFYAQARHLLRGPHGVLAAWCYTVPRVDPPVDSVFSRLYTESGPF  126

Query  449  WEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNK  270
            W P R+ VD + R+IDFPFDPV+   H GP+EF  ++ M+LE+Y  YIRS S YQTA+ K
Sbjct  127  WAPQRRTVDDELRSIDFPFDPVEEEAHTGPFEFMEEREMDLETYLTYIRSWSAYQTAREK  186

Query  269  GVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKV  156
             VE+LS  +V D  RAW  DGK  K+V +PI+LRIGKV
Sbjct  187  AVELLSDGVVTDLERAWGGDGKVVKLVRYPIFLRIGKV  224



>gb|ABK25859.1| unknown [Picea sitchensis]
Length=266

 Score =   255 bits (651),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/259 (48%), Positives = 161/259 (62%), Gaps = 6/259 (2%)
 Frame = -1

Query  914  KQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPN  735
            +Q  +Y  GRP YP QLF FIA  +P   L WDVGTG+GQAA++L E ++ V+ TD S  
Sbjct  8    RQALEYVNGRPQYPPQLFSFIAKHSPHRRLAWDVGTGSGQAALALSEMFERVIATDVSEQ  67

Query  734  QLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVL  555
            Q+ +AP  PN+ +  T   M+L ELE+ VG E SVDLVT+AQALHW  L TFY  VK VL
Sbjct  68   QISYAPRRPNITYAVTARAMSLQELESTVGEEGSVDLVTVAQALHWLDLDTFYGHVKHVL  127

Query  554  KKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPV---  384
            +KP GV AAWCY  P V+ SVD +++  +  +  FW+P RK+VD+ Y T+ FPF  V   
Sbjct  128  RKPGGVFAAWCYREPVVNPSVDCVFEEVFRASVAFWDPPRKMVDEGYATVCFPFRSVVQE  187

Query  383  ---DGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
               +G     P +F A+K M LE Y  Y+RS   YQ AK  GV++L    V  F  AW E
Sbjct  188  GSEEGASTTAPIKFWAKKEMGLEPYLNYMRSWHAYQKAKATGVDLLDEQTVARFKDAWAE  247

Query  212  DGKTQKIVAFPIYLRIGKV  156
                 K V+FP++LRIG V
Sbjct  248  SENDVKTVSFPVFLRIGVV  266



>gb|ACE97886.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
Length=178

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 140/178 (79%), Gaps = 1/178 (1%)
 Frame = -1

Query  710  PNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIA  531
            P VR+  TPP M++ ELE  V  +SSVDLVTIAQALHWF LP+FYQQVKWVLKKP GV+A
Sbjct  1    PYVRYQQTPPVMSMGELEQTVSTQSSVDLVTIAQALHWFDLPSFYQQVKWVLKKPHGVVA  60

Query  530  AWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYE  354
            AWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFPF+PV+G ++ GP++
Sbjct  61   AWCYTIPEVNDSVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFPFEPVEGTDNTGPFK  120

Query  353  FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFP  180
            F A+K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWNEDG  QK+V FP
Sbjct  121  FVAEKMMDLDEYFTYIRSWSAYQTAKEKGVELLRDDVIESFKRAWNEDGHGQKVVRFP  178



>gb|AAB01567.1| embryo-abundant protein [Picea glauca]
Length=266

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/259 (47%), Positives = 159/259 (61%), Gaps = 6/259 (2%)
 Frame = -1

Query  914  KQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPN  735
            +Q  +Y  GRP YP QLF FIA  +P   L WDVGTG+GQAA++L E ++ V+ TD S  
Sbjct  8    RQALEYVNGRPQYPPQLFSFIAKHSPHRRLAWDVGTGSGQAALALSEMFERVIATDVSEQ  67

Query  734  QLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVL  555
            Q+ +AP  PN+ +  TP  M+L ELE+ VG E SVDLVT+AQALHW  L TFY  VK VL
Sbjct  68   QISYAPRRPNITYAVTPRAMSLQELESTVGEEGSVDLVTVAQALHWLDLDTFYGHVKHVL  127

Query  554  KKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPV---  384
            +KP GV AA CY  P V+ SVD +++  +  +  F +P RK+VD+ Y T+ FPF  V   
Sbjct  128  RKPGGVFAALCYREPVVNPSVDCVFEEVFRASVAFGDPPRKMVDEGYATVCFPFRSVVQE  187

Query  383  ---DGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
               +G     P +F  +K M LE Y  Y+RS   YQ AK  GV++L    V  F  AW E
Sbjct  188  GSEEGESTTAPIKFWPKKEMGLEPYLNYMRSWHAYQKAKATGVDLLDEQTVARFKDAWAE  247

Query  212  DGKTQKIVAFPIYLRIGKV  156
                 K V+FP++LRIG V
Sbjct  248  SENDAKTVSFPVFLRIGVV  266



>gb|ACE97878.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97881.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97883.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97889.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97890.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97894.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97910.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97912.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
Length=178

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -1

Query  710  PNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIA  531
            P VR+  TPP M++ ELE  V  +SSVDLVTIAQALHWF LP+FYQQVKWVLKKP GV+A
Sbjct  1    PYVRYQQTPPVMSMGELEQTVSTQSSVDLVTIAQALHWFDLPSFYQQVKWVLKKPHGVVA  60

Query  530  AWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYE  354
            AWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFPF+PV+G ++ GP++
Sbjct  61   AWCYTIPEVNDSVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFPFEPVEGTDNTGPFK  120

Query  353  FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFP  180
            F  +K+M+L+ YF YIRS S YQTAK KGVE+L  D++Q F RAWNEDG  QK+V FP
Sbjct  121  FVTEKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIQSFKRAWNEDGHGQKVVRFP  178



>gb|ACE97895.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
Length=178

 Score =   241 bits (615),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -1

Query  710  PNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIA  531
            P VR+  TPP M++ ELE  V  +SSVDLVTIAQALHWF LP+FYQQVKWVLKKP GV+A
Sbjct  1    PYVRYQQTPPVMSMGELEQTVSTQSSVDLVTIAQALHWFDLPSFYQQVKWVLKKPHGVVA  60

Query  530  AWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYE  354
            AWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFPF+PV+G ++ GP++
Sbjct  61   AWCYTIPEVNDSVDSVFNPFYSNDSDPYWEPQRKLVDNKYMSIDFPFEPVEGTDNTGPFK  120

Query  353  FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFP  180
            F  +K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWNEDG  QK+V FP
Sbjct  121  FVTEKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWNEDGHGQKVVRFP  178



>gb|ACE97877.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97879.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97884.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97885.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97887.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97888.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97891.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97892.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97893.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97896.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97897.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97898.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97899.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97900.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97901.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97902.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97905.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97906.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97907.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97908.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97909.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97911.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
Length=178

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -1

Query  710  PNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIA  531
            P VR+  TPP M++ ELE  V  +SSVDLVTIAQALHWF LP+FYQQVKWVLKKP GV+A
Sbjct  1    PYVRYQQTPPVMSMGELEQTVSTQSSVDLVTIAQALHWFDLPSFYQQVKWVLKKPHGVVA  60

Query  530  AWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYE  354
            AWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFPF+PV+G ++ GP++
Sbjct  61   AWCYTIPEVNDSVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFPFEPVEGTDNTGPFK  120

Query  353  FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFP  180
            F  +K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWNEDG  QK+V FP
Sbjct  121  FVTEKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWNEDGHGQKVVRFP  178



>gb|ACE97880.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97882.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97903.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
 gb|ACE97904.1| S-adenosylmethionine-dependent methyltransferase [Populus tremula]
Length=178

 Score =   241 bits (614),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -1

Query  710  PNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIA  531
            P VR+  TPP M++ ELE  V  +SSVDLVTIAQALHWF LP+FYQQVKWVLKKP GV+A
Sbjct  1    PYVRYEQTPPVMSMGELEQTVSTQSSVDLVTIAQALHWFDLPSFYQQVKWVLKKPHGVVA  60

Query  530  AWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYE  354
            AWCY  PEV+ SVDS++  +Y+ +   +WEP RKLVD KY +IDFPF+PV+G ++ GP++
Sbjct  61   AWCYTIPEVNDSVDSVFNPFYSIDSDPYWEPQRKLVDNKYMSIDFPFEPVEGTDNTGPFK  120

Query  353  FKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFP  180
            F  +K+M+L+ YF YIRS S YQTAK KGVE+L  D+++ F RAWNEDG  QK+V FP
Sbjct  121  FVTEKMMDLDEYFTYIRSWSAYQTAKAKGVELLRDDVIESFKRAWNEDGHGQKVVRFP  178



>emb|CDY71071.1| BnaAnng35990D, partial [Brassica napus]
Length=194

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 137/184 (74%), Gaps = 1/184 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA  F+ Q KQY+  RP YP QLF+FIASKTP HDL WDVGTG+GQA+ SL   YKNV+ 
Sbjct  1    MAKFFINQAKQYAAARPNYPIQLFEFIASKTPCHDLAWDVGTGSGQASRSLAGIYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL+FA  L NVR+  TPP M+L+E+E  V  ESSVDLVT+AQALHWF LPTFY 
Sbjct  61   TDTSSKQLEFAAKLSNVRYELTPPVMSLSEIEQLVAPESSVDLVTVAQALHWFDLPTFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH-FWEPGRKLVDQKYRTIDFP  396
             VK VLKKPDGV AAWCY  PEV+++VD +++++Y      +W+  R+LV+  Y+ I+FP
Sbjct  121  NVKHVLKKPDGVFAAWCYTNPEVNAAVDEVFRQFYKEKLGPYWDKARRLVEDGYKGIEFP  180

Query  395  FDPV  384
            F+ +
Sbjct  181  FEKI  184



>gb|AFK34705.1| unknown [Medicago truncatula]
Length=187

 Score =   230 bits (587),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%), Gaps = 1/185 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+ F KQGK+Y++ RP+YP QLF FIASKTP HDL WDV TGTGQAA SL   YKNV+ 
Sbjct  1    MAEHFAKQGKEYADSRPSYPPQLFQFIASKTPSHDLAWDVATGTGQAAKSLSTLYKNVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+FA  LPNVR+  TP  M++ ELE  V  + ++DLVTIAQALHW  L TFY+
Sbjct  61   TDASEKQLEFATKLPNVRYQHTPSTMSMTELEQMVSPQGTIDLVTIAQALHWLDLSTFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTN-QHFWEPGRKLVDQKYRTIDFP  396
            QV WVLKKP+GV+A WCY  P V+ +V +++ + Y+ + + +W+  R+L++  YR IDFP
Sbjct  121  QVNWVLKKPNGVLAIWCYTSPRVNDAVGALHDKLYSFDAKPYWDSRRELLEDNYRNIDFP  180

Query  395  FDPVD  381
            FDPV+
Sbjct  181  FDPVE  185



>ref|XP_002967028.1| hypothetical protein SELMODRAFT_86924 [Selaginella moellendorffii]
 gb|EFJ31627.1| hypothetical protein SELMODRAFT_86924 [Selaginella moellendorffii]
Length=261

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/261 (45%), Positives = 157/261 (60%), Gaps = 5/261 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF  Q + Y+  RP YP  LF+F+AS T  H  VWDVGTG GQAA+ L E +  V+ 
Sbjct  1    MAGLFDTQAEIYAAARPDYPDSLFEFLASVT-HHGCVWDVGTGNGQAAIKLAEIFDRVIA  59

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QLQ AP  PN+++  T  ++T  EL + +G + S+DLVT+AQALHWF L  FY 
Sbjct  60   TDVSSQQLQQAPQRPNIKYAVTSKSITRDELHSVIGPDHSLDLVTVAQALHWFDLDAFYG  119

Query  572  QVKWVLKKPD---GVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
             V  +L++     GV+AAWCY    V + VD++   +Y     +W P R+LVD  YRTID
Sbjct  120  HVGAMLRRGGDRPGVLAAWCYQLCHVDADVDAVLTEFYAATSPYWAPQRQLVDNGYRTID  179

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+PV G    GP  F++ K + L    AY RS S  QTA +KGV IL  +    F ++
Sbjct  180  FPFEPVAGQASTGPLRFESIKRLNLGQLLAYFRSWSAVQTAMDKGVAIL-EEFRPAFEKS  238

Query  221  WNEDGKTQKIVAFPIYLRIGK  159
            W  D    K V +P++L +GK
Sbjct  239  WGGDPMVVKTVTWPVHLLVGK  259



>ref|XP_009353781.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
Length=258

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/259 (43%), Positives = 162/259 (63%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y  GRPTYP++ +  +A+ TP+H L WDVGTG GQAA SLGE Y+ V+G
Sbjct  1    MAGLFDKQAEDYLVGRPTYPKEWYSMLAALTPKHSLAWDVGTGNGQAAFSLGEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P V ++ TP  M+  EL   +G E+SVDLVT+A+A+HWF LP FY 
Sbjct  61   TDISESQLKSALQHPRVGYIHTPMTMSDDELVDLIGGENSVDLVTVAEAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP GVIA W Y+     + ++ + +R+Y  ++ FW+P R+ + + YRT+ FPF
Sbjct  121  LVKRVLRKPGGVIAVWGYNACVTHAEIEDVLKRFYEASKPFWDPKREYLREGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P   +  K +  E     +RSSS   TAK++GV++LS +++++  RAW  
Sbjct  181  ESIGLGSEGQPVALEIPKEVSFEGVLRMLRSSSSVHTAKDQGVDLLSQEVIEEIQRAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                +  V F  ++  GKV
Sbjct  241  PNVVRN-VTFKAFMLAGKV  258



>ref|XP_008347924.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
 ref|XP_008365318.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=258

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 155/259 (60%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y E RPTYP++ F  +A+ TP H L WDVGTG GQAA SLGE Y+ V+G
Sbjct  1    MAGLFDKQAELYLEARPTYPKEWFSMLAALTPNHSLAWDVGTGNGQAAFSLGEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            +D S +QL+ A   P VR+V TP  M+  +L   +G E SVDLVT+A A+HWF LP FY 
Sbjct  61   SDISESQLKLALQHPRVRYVHTPMTMSDDDLVELIGGEBSVDLVTVAVAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP G IA W Y+        D + + +   ++ FW+P  + V + YRT+ FPF
Sbjct  121  VVKRVLRKPGGXIAVWSYNAIVTDPEXDDLLKHFREASKPFWDPKTEYVWEGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P   +    M  E      RSSS +  AK++GV++LS +++++  RAW +
Sbjct  181  ESVGLGSEGQPVPLEMPMEMSFEGVMRMFRSSSAFNKAKDQGVDLLSQEVIENLQRAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                +K+ A  +++  GKV
Sbjct  241  PNLVRKVTA-KVFMLAGKV  258



>ref|XP_009355317.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
 ref|XP_009355318.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
Length=258

 Score =   220 bits (560),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 160/259 (62%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + YS  RPTYP++ F  +A+ TP H L WDVGTG GQAA SLGE Y+ V+G
Sbjct  1    MAGLFDKQAELYSVARPTYPKEWFSMLAALTPNHSLAWDVGTGNGQAAFSLGEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            +D S +QL+ A   P VR+V TP  M+  +L   +G E+SVDLVT+A+A+HWF LP FY 
Sbjct  61   SDISESQLKLALQHPRVRYVHTPMTMSDDDLVELIGGENSVDLVTVAEAVHWFDLPRFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP GVIA W Y+       +D + + ++  ++ F +P  + + + YRT+ FPF
Sbjct  121  VVKRVLRKPGGVIAVWGYNGSVTDPELDDLLKHFHEASKPFRDPKTEYLWEGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P   +  K M  E     IRSS+ + TAK++GV++LS +++++  RAW  
Sbjct  181  ESVGLGSAGQPVPLEMPKEMSFEGVMRMIRSSTAFITAKDQGVDLLSQEVIEELQRAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                +K+ +   ++  GKV
Sbjct  241  PNLVRKVTS-KAFMLAGKV  258



>ref|XP_008361673.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=258

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 158/259 (61%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y   RPTYP++ +  +A+ TP+H L WDVGTG GQAA SLGE Y+ V+G
Sbjct  1    MAGLFDKQAEDYLVARPTYPKEWYSMLAALTPKHSLAWDVGTGNGQAAFSLGEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            +D S +QL+ A   P VR+V TP  M+  EL   +G E+SVDLVT+A+A+HWF LP FY 
Sbjct  61   SDISESQLKSALQHPRVRYVHTPVTMSDDELVDLIGGENSVDLVTVAEAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK +L KP  +IA W Y+       ++ + +R+Y  ++ FW+P R+ + + YRT+ FPF
Sbjct  121  LVKSILCKPSYMIAVWGYNDIVTHPEIEGVLKRFYEASKPFWDPKREYLWEGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P   +  K +  E     +RSSS   TAK++GV++LS +++++  RAW  
Sbjct  181  ESVGLGSEGQPVALEILKEVSFEGVLRMLRSSSAVNTAKDQGVDLLSQEVIEEIQRAWGR  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                +  V F  +   GKV
Sbjct  241  PNVVRN-VTFKAFTLAGKV  258



>ref|XP_010674434.1| PREDICTED: putative methyltransferase DDB_G0268948 [Beta vulgaris 
subsp. vulgaris]
Length=260

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/261 (41%), Positives = 159/261 (61%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y EGRP YP++ F ++A +T +H L WDVGTG GQAA+S+ E Y  V+ 
Sbjct  1    MAGLFDKQADLYLEGRPNYPKEWFSWLADRTSQHSLAWDVGTGNGQAAISVAEHYNQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL  A   P V+++ TPP ++  EL + +G ESSVDL+T+AQA+HWF LP FY 
Sbjct  61   TDVSEPQLNLAIQHPQVKYIHTPPFLSNNELISLIGPESSVDLITVAQAVHWFDLPNFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GVIA WCY+   VS + D I  +++ +   +W+P  + V   Y+T+ FPF
Sbjct  121  MVSQLLRKPGGVIAVWCYNDIVVSPTFDPIMNQFHKSTLPYWDPKIQYVFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P E +  K++  + +   ++S S   TAK KGV++L+ ++V +   AW  
Sbjct  181  EEIGLGREGHPMELEIPKMVSFKGFMEMLKSWSAVTTAKEKGVDLLNENVVTELMNAWG-  239

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
              +  K V++  ++  GKV I
Sbjct  240  GSELVKHVSYKAFMIAGKVRI  260



>ref|XP_008218716.1| PREDICTED: putative methyltransferase DDB_G0268948 [Prunus mume]
Length=263

 Score =   218 bits (554),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 155/259 (60%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP++ +  +A  TP H L WDVGTG GQAA+S+ E Y+ V+G
Sbjct  1    MAGLFDKQADVYLDARPTYPKEWYSKLAVLTPHHTLAWDVGTGNGQAALSVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  TP ++T  E+ A VG E SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSESQLQRAMLHPRVRYAHTPLSITDDEVIALVGGEDSVDLVTVAQAVHWFDLPKFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VLKKP GV A WCY+  EV  + D I +R++ T   FW+   + V   Y+T+ FPF
Sbjct  121  LVSRVLKKPGGVFAVWCYNDIEVDPTFDPIMKRFHDTTLPFWDKKVQYVFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P      K +  E +   +RS S   TAK++GV++L   +V++F  AW  
Sbjct  181  ESVGFGSEGNPLPLDIPKQLSFEGFLKMLRSWSAVTTAKDQGVDLLPEKVVKEFEGAWG-  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
              K  + V++  ++  GKV
Sbjct  240  GSKLVRSVSYKAFMLAGKV  258



>ref|XP_007226011.1| hypothetical protein PRUPE_ppa010114mg [Prunus persica]
 gb|EMJ27210.1| hypothetical protein PRUPE_ppa010114mg [Prunus persica]
Length=263

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/259 (44%), Positives = 154/259 (59%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP++ +  +A  TP H L WDVGTG GQAA+S+ E Y+ V+G
Sbjct  1    MAGLFDKQADVYLDARPTYPKEWYSKLAVLTPHHTLAWDVGTGNGQAALSVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  TP ++T  E+ A VG E SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSESQLQRAMLHPRVRYAHTPLSITDDEVIALVGGEDSVDLVTVAQAVHWFDLPKFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VLK P GV A WCY+  EV  + D I +R++ T   FW+   + V   Y+T+ FPF
Sbjct  121  LVSRVLKNPGGVFAVWCYNDIEVDPTFDPIMKRFHDTTLPFWDKNIQYVFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P      K +  E +   +RS S   TAK++GV++L   +V++F  AW  
Sbjct  181  ESVGLGSEGNPLPLDIPKQLSFEGFLKMLRSWSAVTTAKDQGVDLLPEKVVKEFEGAWG-  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
              K  + V++  ++  GKV
Sbjct  240  GSKLVRSVSYKAFMLAGKV  258



>ref|XP_001755836.1| predicted protein [Physcomitrella patens]
 gb|EDQ79509.1| predicted protein [Physcomitrella patens]
Length=259

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/261 (41%), Positives = 155/261 (59%), Gaps = 4/261 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ ++Y+  R  YP+ LF ++AS TP H + WDVGTG+GQAA+ L + Y+ VV 
Sbjct  1    MAALFSKQAREYALARAIYPKSLFSYLASLTPSHAVAWDVGTGSGQAAVQLADHYEKVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q+Q A   PN+ +  T P++T  E+   VG   +VDLV  AQALHWF L  FY 
Sbjct  61   TDASKQQIQQAAQRPNITYAVTNPHLTEEEVRTLVGDAETVDLVVCAQALHWFDLDNFYG  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL++P G+IAAW Y  P VS +VD++   +       W P  + ++++Y++I FPF
Sbjct  121  HVKRVLRRPGGIIAAWTYQTPSVSPAVDAVLHDFNEKVFQDWAPQVRYIEEEYKSISFPF  180

Query  392  DPVDGCE--HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
             PV G +    GP++F+A K   L  Y  ++RS S  Q A + G E+L+    + F  AW
Sbjct  181  QPVVGSKLTTTGPFQFEATKQATLNEYLTHLRSWSAVQKAIDSGREVLNEQQQKLFADAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
             +     +IV + +Y  IG +
Sbjct  241  GD--TPHRIVKWTLYTLIGTL  259



>ref|XP_010025773.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
Length=260

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 155/259 (60%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y++ RPTYP++ +  +A+  PR  L WDVGTG GQAA+ + E Y+ V+ 
Sbjct  1    MAGLFDKQAEIYADARPTYPREWYQKLAALNPRQALAWDVGTGNGQAALGVAEHYQQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL +A   P V+++ TPP+++  EL A VG E+SVDL+T+AQA+HWF LP FY 
Sbjct  61   TDVSESQLNYAIPHPRVQYMHTPPSISDDELLATVGGENSVDLITVAQAIHWFELPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP+GVIA W Y   +VS + D I ++++     +W P  +    +Y+T+ FPF
Sbjct  121  LVNRVLRKPEGVIAVWGYGAIQVSPTFDPILKKFFDATLPYWNPNVRYAFDQYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        +  E     +RS S    AK +GVE+LS  +V++F RAW  
Sbjct  181  ESVGLGSEGNPVALDIPTEVSFEGMLGILRSWSAVAMAKEQGVELLSEGVVREFERAWG-  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
              K  + V +  ++  GKV
Sbjct  240  GTKLVRNVVYKAFMLAGKV  258



>ref|XP_002310527.1| embryo-abundant family protein [Populus trichocarpa]
 gb|EEE90977.1| embryo-abundant family protein [Populus trichocarpa]
Length=260

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 151/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y +GRPTYP Q +  +A  T  H L WDVGTG GQAA+ + E Y+ V+G
Sbjct  1    MAGLFDKQADLYLDGRPTYPAQWYSMLADHTLHHSLAWDVGTGNGQAALGVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ +   P VR+  TP +M+  E+ + +G E SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSEAQLKRSMTHPRVRYFHTPLSMSDDEIISLIGGEDSVDLVTVAQAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP G++A WCY+   VS + DS ++R++ +   FW P   L  + Y+ + FPF
Sbjct  121  LVARLLRKPGGLLAVWCYNDAVVSPAFDSAFKRFHDSTLPFWHPNAFLAIEGYKRLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P E    K M  E +   I S S   TAK++GVE+LS  +V++    W  
Sbjct  181  ESIGLGSEEKPLELDIPKEMSFEGFLKMISSWSAVVTAKDQGVELLSQTVVKELETVWG-  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
              K  + V +  ++  GKV
Sbjct  240  GSKLVRSVIYKAFMLAGKV  258



>ref|XP_006645806.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Oryza 
brachyantha]
Length=211

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/259 (44%), Positives = 142/259 (55%), Gaps = 51/259 (20%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY+  RP YP +LFDFIASKT R DL WDVG+G+GQA   L + YK VV 
Sbjct  1    MANLFLKQAKQYAATRPAYPPELFDFIASKTARRDLAWDVGSGSGQAIPPLAKLYKEVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL +AP LPNVR+V TP                                     
Sbjct  61   TDTSAQQLSYAPRLPNVRYVHTP-------------------------------------  83

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
                    PD  +A       +   +VD  + R Y+ +Q +W P R+LVD +Y  +DF F
Sbjct  84   --------PDPPLAV------DGGGAVDDAFWRLYSGSQPYWAPNRRLVDDRYAGVDFLF  129

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPVDG  H GP+EF  ++ M+L+ Y  YI S S YQTAK KGVE+L    V+ F  AW  
Sbjct  130  DPVDGETHTGPFEFSTERRMDLDDYLTYITSWSAYQTAKEKGVELLDEATVRGFAEAWGG  189

Query  212  DGKTQKIVAFPIYLRIGKV  156
            D    K V +P++LRIGKV
Sbjct  190  DRAVVKTVRYPVFLRIGKV  208



>ref|XP_011022909.1| PREDICTED: putative methyltransferase DDB_G0268948 [Populus euphratica]
Length=260

 Score =   213 bits (542),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/259 (41%), Positives = 150/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y +GRPTYP Q +  +A  T  H L WDVGTG GQAA+ + E Y+ V+G
Sbjct  1    MAGLFDKQADLYLDGRPTYPAQWYSMLADHTLHHSLAWDVGTGNGQAALGVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ +   P VR+  TP +M+  E+ + +G E SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSEAQLKRSMTHPRVRYFHTPLSMSDDEIISLIGGEDSVDLVTVAQAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP G++A WCY+   VS + DS ++R++ +   FW P   L  + Y+ + FPF
Sbjct  121  LVARLLRKPGGLLAVWCYNDAVVSPAFDSAFKRFHDSTLPFWHPNAFLAIEGYKKLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            +         P E    K M  E +   I S S   TAK++GV++LS  +V++    W  
Sbjct  181  ESTGLGSEGKPLELDIPKEMSFEGFLKMISSWSAVVTAKDQGVDLLSQTVVKELETVWG-  239

Query  212  DGKTQKIVAFPIYLRIGKV  156
              K  + V F  ++  GKV
Sbjct  240  GSKVVRSVIFKAFMLAGKV  258



>ref|XP_002960983.1| hypothetical protein SELMODRAFT_74069 [Selaginella moellendorffii]
 gb|EFJ38522.1| hypothetical protein SELMODRAFT_74069 [Selaginella moellendorffii]
Length=245

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 137/225 (61%), Gaps = 4/225 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF  Q + Y+  RP YP  LF+F+AS T  H  VWDVGTG GQAA+ L E +  V+ 
Sbjct  1    MAGLFDTQAEIYAAARPDYPDSLFEFLASVT-HHGCVWDVGTGNGQAAIKLAEIFDRVIA  59

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QLQ AP  PN+++  T  ++T  EL + +G + S+DLVT+AQALHWF L  FY 
Sbjct  60   TDVSSQQLQQAPQRPNIKYAVTSKSITRDELHSVIGPDHSLDLVTVAQALHWFDLDAFYG  119

Query  572  QVKWVLKKPD---GVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
             V  +L++     GV+AAWCY    V + VD++   +Y     +W P R+LVD  YRTID
Sbjct  120  HVGAMLRRGGDRPGVLAAWCYQLCHVDADVDAVLTEFYAATSPYWAPQRQLVDNGYRTID  179

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKG  267
            FPF+PV G    GP  F++ K + L    AY RS S  QTA  +G
Sbjct  180  FPFEPVAGQASTGPLRFESIKRLNLGQLLAYFRSWSAVQTAMTRG  224



>ref|XP_009357638.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
Length=258

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 155/260 (60%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q   Y + RPTYP + +  +A  TP H L WDVGTG GQAA+S+ E Y+ V+G
Sbjct  1    MAGLFDRQADLYLDSRPTYPTEWYSKLADLTPHHTLAWDVGTGNGQAAVSVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  TP ++T  EL   +G E+SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDASESQLQRAMPHPRVRYAHTPLSITDDELIPLIGGENSVDLVTVAQAVHWFDLPKFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GV+A WCY+  EV    D I +R++ T   FW+   + +   Y+T+ FPF
Sbjct  121  LVSRLLRKPGGVLAVWCYNDIEVCPEFDPIMKRFHDTTLPFWDRNIQYIFDGYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
              V  GCE   P      K +  + +   + S S   TAK++GV++L   LV++F  AW 
Sbjct  181  QSVGFGCE-GSPLPLDIPKKLSFQGFLNMVGSWSAVVTAKHQGVDLLPEKLVKEFEGAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKV  156
               K  ++V +  ++  GKV
Sbjct  240  -GSKLARLVTYKAFMLAGKV  258



>ref|XP_008392237.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=258

 Score =   211 bits (536),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 154/260 (59%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP + +  +A  TP H L WDVGTG GQAA+S+ E Y+ V+G
Sbjct  1    MAGLFDKQADLYLDSRPTYPTEWYSKLADLTPHHTLAWDVGTGNGQAAVSVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QLQ A   P VR+V TP  +T  EL A +G E+SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSEAQLQRAMPHPRVRYVHTPLTITDDELIALIGGENSVDLVTVAQAVHWFDLPKFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GV+A WCY+  EV    D I +R++ T   FW+   + +   Y+T+ FPF
Sbjct  121  LVPRLLRKPGGVLAVWCYNDIEVCPEFDPIMKRFHDTTLPFWDRNIQYIFDGYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
              V  GCE   P      K +  + +   + S S   TAK++GV++L   LV++F  AW 
Sbjct  181  QSVGFGCE-GSPLPLDIPKKLSFQGFLKMVGSWSVVITAKHQGVDLLPEKLVEEFEGAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKV  156
               K  + V +  ++  GKV
Sbjct  240  -GSKLVRSVTYKAFMLAGKV  258



>ref|XP_008378902.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=258

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 150/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M  +F K  + Y  GRPTYP++ F  +A+ +P H L WDVGTG GQAA SLGE Y+ V G
Sbjct  1    MEGIFDKHAEVYLVGRPTYPKEWFSMLATLSPNHSLAWDVGTGNGQAAFSLGEHYEQVXG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P VR+V TP  M+  +L   +G E+SVDLVT A+A+HWF LP FY 
Sbjct  61   TDMSESQLKLALQHPRVRYVHTPMXMSXDDLVELIGGENSVDLVTAAEAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP GVIA W Y+       +D + +R+    + FW+P    + + YRT+ FPF
Sbjct  121  VVKRVLRKPGGVIAVWGYNDSVTDPELDDVLKRFREACKPFWDPKMDYLWEGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P   +  K    E     +RS SG   AK++GV++LS +++++  R W  
Sbjct  181  ESVGLGSEGRPAPLEMPKETSFEGVVRMLRSYSGVNAAKDQGVDLLSQEVIEELQRVWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                +K+     ++  GKV
Sbjct  241  PNLVRKVTT-KAFMLAGKV  258



>ref|XP_007048464.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX92621.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=260

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/261 (40%), Positives = 155/261 (59%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q   Y + RP YP + +  +A++T  H L WD GTG GQAA+ + E Y++V+G
Sbjct  1    MAGLFDEQADLYLDARPNYPSEWYSMLAARTLHHHLAWDAGTGNGQAAIGVAEHYEHVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V+++ T  +++  EL A++G E+SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSEAQLKHAIPHPRVKYLNTSLSISNDELLASIGGENSVDLVTVAQAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GV+A W Y+   VS + D + +R++ T   FW P  + +   YRT+ FPF
Sbjct  121  LVTRVLRKPGGVLAVWGYNDIAVSPTFDPVMKRFHDTTLPFWNPNIQYIFDGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P      K +  E +   +RS S   TAKN+GV++LS  +V++F  AW  
Sbjct  181  ESVGLGSEGQPLALDIPKKLSFEGFLGMLRSWSAVVTAKNQGVDLLSQMVVKEFESAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
                +  VA+  ++  GKV +
Sbjct  241  SNLVRS-VAYKAFMLAGKVKL  260



>ref|XP_009355319.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
Length=258

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/259 (41%), Positives = 149/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M  +F K    Y  GRPTYP++ F  +A+ TP H L WDVGTG GQAA SLGE Y+ V+G
Sbjct  1    MEGIFGKHADVYLAGRPTYPKEWFSMLAALTPNHSLAWDVGTGNGQAAFSLGEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P VR+V TP  M+  +L   +G E+SVDLVT A+A+HWF LP FY 
Sbjct  61   TDMSESQLKLALQHPRVRYVHTPMTMSDDDLVELIGGENSVDLVTAAEAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP GVIA W Y+       +D + +R+    + FW+P    + + YRT+ FPF
Sbjct  121  VVKRVLRKPGGVIAVWGYNDSVTDPELDDVLKRFREACKPFWDPKMDYLWEGYRTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P   +  K    E     +RS SG   AK++GV++LS +++++    W  
Sbjct  181  ESVGLGSEGQPAPLEMPKETSFEGVVRMLRSYSGVNAAKDQGVDLLSQEVIEELQTVWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                +K+     ++  GKV
Sbjct  241  PNLVRKVTT-KAFMLAGKV  258



>gb|EEE59267.1| hypothetical protein OsJ_11290 [Oryza sativa Japonica Group]
Length=209

 Score =   207 bits (526),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/259 (44%), Positives = 136/259 (53%), Gaps = 53/259 (20%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LFLKQ KQY+  RP YP +LFDFIASKT RHDL WDVGTG+GQA  +L + YK+VVG
Sbjct  1    MANLFLKQAKQYAATRPAYPPELFDFIASKTARHDLAWDVGTGSGQAIPALAKLYKDVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TDTS  QL      P         ++ L  + A V    SVDLVT+AQA HW  LP FY 
Sbjct  61   TDTSAQQLFLRAAPPQRALRPHAADLPLDGIHAAVAPPGSVDLVTVAQAFHWLDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            Q +                                                     DFPF
Sbjct  121  QRR-----------------------------------------------------DFPF  127

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            DPVDG  H GP+EF  ++ M+L+ Y AYI S S YQTAK KGVE+L    V+ F  AW  
Sbjct  128  DPVDGEAHTGPFEFSTERRMDLDGYLAYITSWSAYQTAKEKGVELLDEATVRGFADAWGG  187

Query  212  DGKTQKIVAFPIYLRIGKV  156
            D    K V +PI+LRIGKV
Sbjct  188  DRVEVKTVRYPIFLRIGKV  206



>ref|XP_007213119.1| hypothetical protein PRUPE_ppa023887mg [Prunus persica]
 gb|EMJ14318.1| hypothetical protein PRUPE_ppa023887mg [Prunus persica]
Length=261

 Score =   208 bits (529),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 112/261 (43%), Positives = 157/261 (60%), Gaps = 4/261 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y +GRPTYP++ +  +A+ TP H L WDVGTG GQAA+S+ E Y+ V+G
Sbjct  1    MAGLFDKQAEVYLDGRPTYPKEWYSKLAALTPHHTLAWDVGTGNGQAAISVAEHYELVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  T  N+T  E+ A +G E SVDLVT+A A+HWF LP FY 
Sbjct  61   TDVSESQLQHAIPHPRVRYAHTALNITDEEVIALLGGEDSVDLVTVATAVHWFDLPKFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +LKKP GV+A W Y   EVS + D + +R++ T   F +   +     Y+T+ FPF
Sbjct  121  LVSRLLKKPGGVLAVWTYSGIEVSPTFDPVMKRFHDTTLPFQDNRAQYAFDGYKTLPFPF  180

Query  392  DPVD--GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
              +   GCE N P        +  E    +++S S   TAK++GV++L   +V++F  AW
Sbjct  181  QSLTGFGCEGN-PLPLAVPAKLSFEGVLKFLKSWSAVTTAKDQGVDLLPEKVVKEFEAAW  239

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
              D K  K V++  ++  GKV
Sbjct  240  G-DSKLVKSVSYKAFMLAGKV  259



>gb|ABN07992.1| embryo-abundant protein EMB, putative [Medicago truncatula]
Length=176

 Score =   205 bits (521),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 122/176 (69%), Gaps = 3/176 (2%)
 Frame = -1

Query  677  MTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSS  498
            M++ ELE  V  + ++DLVTIAQ LHWF  P FYQQVKWVLKKP GVIAAWCY  P +S 
Sbjct  1    MSIPELEQIVTPQGTIDLVTIAQGLHWFDFPNFYQQVKWVLKKPHGVIAAWCYSLPRISD  60

Query  497  SVDSIY-QRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELES  321
             VD++  Q Y+  ++ +W+   KLV+  YR+IDFPF+ VDG +H GP+EF  + LM  + 
Sbjct  61   EVDTVVDQFYFIDSKPYWDSACKLVEDNYRSIDFPFEAVDGVDHRGPFEFVTEILMSFDG  120

Query  320  YFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVG  153
               YI+S S YQTAK KGVE+L  D+V+ F  AW EDG   K   FP+YLRIG+VG
Sbjct  121  LLTYIKSWSAYQTAKEKGVELLGEDVVEKFKLAWGEDG--HKTAKFPVYLRIGRVG  174



>ref|XP_006380385.1| hypothetical protein POPTR_0007s04400g [Populus trichocarpa]
 gb|ERP58182.1| hypothetical protein POPTR_0007s04400g [Populus trichocarpa]
Length=261

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 111/263 (42%), Positives = 154/263 (59%), Gaps = 4/263 (2%)
 Frame = -1

Query  932  MAD-LFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVV  756
            MAD LF KQ   YSE RP YP + F  +A+ TP+H + WDVGTG GQAA+ + E+YK V+
Sbjct  1    MADHLFNKQAAIYSEARPRYPSEWFSMLAALTPQHSVAWDVGTGNGQAAIGVAEQYKKVI  60

Query  755  GTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
             TD S  QL+ A   P V++V TP  M+  EL + +G E SVDL+T A A+ WF L  FY
Sbjct  61   ATDISDEQLKHAIPHPQVQYVHTPLAMSDDELVSLIGGEDSVDLITAATAVQWFDLDRFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
              VK VL+KP G+IA WCY   E S  +D I +R++     F     K+  Q Y+T+ FP
Sbjct  121  PIVKRVLRKPGGIIAVWCYGSMEFSPEIDGILRRFFELGIPFQSQSFKIAVQCYKTLPFP  180

Query  395  FDPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+ V  GCE   P E   +K M  +    ++RS      AK +GV++L  +L+++F RAW
Sbjct  181  FESVGVGCEGQ-PLELDMRKEMSFQGLLKFLRSLPVVHIAKEQGVDLLPEELLKEFERAW  239

Query  218  NEDGKTQKIVAFPIYLRIGKVGI  150
             E    +  + +  Y+  GKV +
Sbjct  240  GEPEMVRTAI-YKTYMLAGKVKL  261



>ref|XP_009344894.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
Length=259

 Score =   206 bits (523),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/262 (44%), Positives = 151/262 (58%), Gaps = 4/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP++ +  +A  TP H L WDVGTG GQAA+ + E YK V+G
Sbjct  1    MAGLFDKQADLYLDSRPTYPKEWYSKLADLTPHHSLAWDVGTGNGQAAIGVAEHYKQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  TP  MT  EL A +G E+SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSESQLQRAMPHPRVRYAHTPFTMTNDELIAMIGGENSVDLVTVAQAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L KP GV+A WCY+  EV    D I +R   T   ++    + V   Y+T+ FP 
Sbjct  121  LVSRLL-KPGGVLAVWCYNRIEVCPEFDPIVKRLEDTTLPYYHRNIQYVFDGYKTLPFPL  179

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
              V  GCE   P      K +  E +   +RS S   TAK +GV++L   LV++F  AW 
Sbjct  180  QSVGFGCE-GSPLALDIPKKLSFEGFLKMVRSWSAVNTAKEQGVDLLPEKLVKEFEVAWG  238

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               K  + V++  ++  GKV +
Sbjct  239  -GSKLVRSVSYKAFMLAGKVKV  259



>ref|XP_010027445.1| PREDICTED: putative methyltransferase DDB_G0268948, partial [Eucalyptus 
grandis]
Length=261

 Score =   205 bits (522),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 153/256 (60%), Gaps = 3/256 (1%)
 Frame = -1

Query  923  LFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDT  744
            LF KQ + Y + RPTYP++ +  +A+ TP   L WDVGTG GQA++ + E Y+ V+ TD 
Sbjct  7    LFDKQAEIYVDARPTYPREWYQKLAALTPHQALAWDVGTGNGQASLEVAEHYQQVIATDA  66

Query  743  SPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVK  564
            S +QL +A   P VR++ TPP+++  EL A VG E+SVDL+T+AQA+HWF LP F+  V 
Sbjct  67   SESQLNYAIPHPRVRYMHTPPSISDDELFAMVGGENSVDLITVAQAIHWFELPKFFSLVN  126

Query  563  WVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPV  384
             VL+KP+GVIA W Y   +V+ + D + ++++     +W P  + V  +Y+T+ FPF+ V
Sbjct  127  RVLRKPEGVIAVWGYPAIQVNPTFDLVPKKFFDVTLPYWNPNVRYVFNQYKTLPFPFESV  186

Query  383  DGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGK  204
                            +  E     +RS S   TAK +GVE+LS  LV++F RAW   G 
Sbjct  187  GLGSEGNSVALNIPTEVSFEGILGILRSWSAVATAKEQGVELLSEGLVREFERAW---GG  243

Query  203  TQKIVAFPIYLRIGKV  156
            T+  V +   +  GKV
Sbjct  244  TKLDVVYKTSMLAGKV  259



>gb|ABK25958.1| unknown [Picea sitchensis]
Length=263

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 113/248 (46%), Positives = 150/248 (60%), Gaps = 5/248 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ K+Y + RPTYP   F  +AS T  H L WDVG G GQA++S+ E Y  V+ 
Sbjct  1    MAGLFDKQAKEYLKYRPTYPASWFSELASLTANHQLAWDVGAGNGQASVSIAEHYDRVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V +V TPP MT  EL + VG   SVDLVT+A A+HWF L TFY 
Sbjct  61   TDISKQQLELARKHPKVTYVLTPPVMTDEELTSIVGEGGSVDLVTVATAVHWFDLETFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVK VL+KP GVIA W Y    +SS+VD +Y+ +  +   +    R    + YRT+ FPF
Sbjct  121  QVKRVLRKPGGVIAVWSYVSSSISSAVDEMYRDFIESALPYANLKRPYTLEGYRTLPFPF  180

Query  392  DPV----DGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTR  225
            +PV     G E N P E + +K + L+ Y    +SS+   TA+ KGVE+L+  +++ F  
Sbjct  181  EPVLESGKGGEGN-PVETEMEKDVTLDEYLGLFKSSAAVTTAREKGVELLNESVLRRFRD  239

Query  224  AWNEDGKT  201
            AW ++ KT
Sbjct  240  AWGDENKT  247



>ref|XP_006366473.1| PREDICTED: putative methyltransferase DDB_G0268948-like, partial 
[Solanum tuberosum]
Length=263

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 149/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            +A+LF  Q + YS+  PTYP + F  +A  T RH L WDVGTG GQAA+ + E YK V+ 
Sbjct  1    IAELFNNQARFYSDAWPTYPGEWFSMLAQHTTRHSLAWDVGTGNGQAAIGVVEHYKKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL  A   P ++++ TP +M+  EL + VG E SVDL+ +A  +HWF LP FY 
Sbjct  61   TDVSKDQLSHAQKHPRIQYIHTPLSMSDEELVSIVGGEHSVDLIIVAATVHWFDLPRFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL++P G+IA W Y+   VS   D  ++ +  +   +W P  K V   Y+T+ FPF
Sbjct  121  IVNRVLRRPGGIIAVWAYELMNVSPEFDPKFKSFLDSTLPYWHPNIKFVFNGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V     N P E + QK +  + +   ++S S   TA  KGV++L   LV++F   W  
Sbjct  181  ESVGLGLENEPIEVEIQKDISFDGFLGLLKSLSAINTANEKGVDLLPQKLVEEFEVEWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                ++++ F  ++ +GKV
Sbjct  241  PKLVRRVI-FKAFMLVGKV  258



>ref|XP_011022910.1| PREDICTED: putative methyltransferase DDB_G0268948 [Populus euphratica]
Length=261

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 153/263 (58%), Gaps = 4/263 (2%)
 Frame = -1

Query  932  MAD-LFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVV  756
            MAD LF +Q   YSE RP YP + F  +A+ TP+H + WDVGTG GQAA+ + E+YK V+
Sbjct  1    MADHLFNEQAAIYSEARPRYPSEWFSMLAALTPQHSVAWDVGTGNGQAAIGVAEQYKKVI  60

Query  755  GTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
             TD S  QL+ A   P V++V TP  M   EL + +G E SVDL+T + A+ WF L  FY
Sbjct  61   ATDISDEQLKHAIPHPQVQYVHTPLAMPDDELVSLIGGEDSVDLITASTAVQWFDLDRFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
              VK VL+KP G+IA WCY   E S  +D I +R++     F     K+  Q Y+T+ FP
Sbjct  121  PIVKRVLRKPGGIIAVWCYGSMEFSPEIDGILRRFFELGIPFQSQSFKIALQCYKTLPFP  180

Query  395  FDPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+ V  GCE   P E   +K M  +    ++RS      AK +GV++L  +L+++F RAW
Sbjct  181  FESVGVGCEGQ-PLELDMRKEMSFQGLLKFLRSLPVVHIAKEQGVDLLPEELLKEFERAW  239

Query  218  NEDGKTQKIVAFPIYLRIGKVGI  150
             E    +  + +  Y+  GKV +
Sbjct  240  GEPEMVRTAI-YKTYMLAGKVKL  261



>ref|XP_008343524.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
 ref|XP_008354105.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=259

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 150/262 (57%), Gaps = 4/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP++ +  +A  TP H L WDVGTG GQAA+ + E YK V+G
Sbjct  1    MAGLFDKQADLYLDSRPAYPKEWYSKLADLTPHHSLAWDVGTGNGQAAIGVAEHYKQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  TP  MT  EL A +G ESS DLVT+AQA+HWF LP FY 
Sbjct  61   TDVSESQLQRAMPHPLVRYAHTPLTMTDDELIALIGGESSXDLVTVAQAVHWFDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L KP GV+A WCY+  EV    D I +R   T+  ++    + V   Y+T+ FPF
Sbjct  121  LVSRLL-KPGGVLAVWCYNHIEVCPEFDPIVKRLEDTSLPYYHRNIQYVFDGYKTLPFPF  179

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
                 GCE   P      K +  E +   +RS S   TAK +GV++L   LV++F  AW 
Sbjct  180  QSAGFGCE-GSPLALDIPKKLSFEGFLKMVRSWSAVNTAKEQGVDLLPEKLVKEFEVAWG  238

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               K  + V++  ++  GKV +
Sbjct  239  -GTKLVRSVSYKAFMLAGKVKV  259



>ref|XP_009335928.1| PREDICTED: putative methyltransferase DDB_G0268948 [Pyrus x bretschneideri]
Length=258

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 151/260 (58%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP + +  +A  TP H L WDVGTG GQAA+S+ E Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDSRPTYPTEWYSKLADLTPHHTLAWDVGTGNGQAAVSVAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QLQ A   P VR+  TP  +T  EL   +G E+SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDASESQLQRAMPHPRVRYAHTPLTITDDELIPLIGGENSVDLVTVAQAVHWFDLPKFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GV+A WCY+  EV    D I +R++ T   FW+   + +   Y+T+ FPF
Sbjct  121  LVSRLLRKPGGVLAVWCYNDIEVCPEFDPIMKRFHDTTLPFWDRNIQYIFDGYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
              V  GCE   P      K +  + +   + S S   TAK++GV++L    V++F  AW 
Sbjct  181  QNVGFGCE-GSPLPLDFPKKLSFQGFLNMVGSWSAVVTAKHQGVDLLPEKPVKEFEGAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKV  156
               K  + V +  ++  GKV
Sbjct  240  -GSKLVRSVTYKAFMLAGKV  258



>ref|XP_002522831.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF39529.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=260

 Score =   202 bits (514),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 152/260 (58%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPT+P++ F  +++ T  H L WD GTG GQAA+ + E Y  V+ 
Sbjct  1    MAGLFDKQAAIYLDARPTFPKEWFSMLSALTLHHSLAWDAGTGNGQAAICVAEHYDQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q++ A   P VR+  TP +M+  E+ + VGAE SVDLVT++ A+H+F L  FY 
Sbjct  61   TDISEEQIKHAIPNPRVRYFHTPSSMSDDEIVSLVGAEHSVDLVTVSVAVHYFDLERFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVK +L+KP G+IA W Y+   V+S  D + +R+Y +   F  P  K   + Y+T+ FPF
Sbjct  121  QVKRLLRKPGGIIAVWTYNTISVNSEFDPVMRRFYESTLPFQNPKAKFAFECYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P      K M  E     +RS S   TAK++GV++LS ++V++F  AW 
Sbjct  181  ESVGVGCEGQ-PTTLDMPKEMSFEGMLGLLRSWSAVNTAKDQGVDLLSENVVKEFEDAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKV  156
                T +   F  Y+  GKV
Sbjct  240  -GSNTVRTAIFKTYMIAGKV  258



>gb|KDP31464.1| hypothetical protein JCGZ_15344 [Jatropha curcas]
Length=260

 Score =   202 bits (513),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 107/260 (41%), Positives = 151/260 (58%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K    Y + RPT+P Q F  +AS TPRH L WD GTG GQAA+S+ E Y  V+ 
Sbjct  1    MAGLYDKLAGTYRDARPTFPTQWFSMLASLTPRHSLAWDAGTGNGQAAISIAEYYDRVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            T+ S  QL+ A   P V+++ TP +M+  E+ + +G E+SVDLVT++ A+HWF L  FY 
Sbjct  61   TEISEEQLEHAMKHPRVQYLHTPSSMSDDEVVSLIGGENSVDLVTVSVAVHWFDLERFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
            QVK +L+KP GVIA W Y+  +V+   D+I   +Y  +  F  P  K     Y+T+ FPF
Sbjct  121  QVKRLLRKPGGVIAVWTYNLIQVNPEFDAIMWGFYERSIPFQNPKTKYAFDCYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P      K M  E     + S S   TAK +GVE+LS +++++F  AW 
Sbjct  181  ENVGVGCEGQ-PMILDMPKEMSFEGLLGLVGSWSAVGTAKEQGVELLSENVIKEFETAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKV  156
                 + ++ F  Y+  GKV
Sbjct  240  GSDLVRTVI-FKTYMLAGKV  258



>ref|XP_002306269.2| hypothetical protein POPTR_0005s06850g [Populus trichocarpa]
 gb|EEE93265.2| hypothetical protein POPTR_0005s06850g [Populus trichocarpa]
Length=260

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 152/261 (58%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A+ TP H L WDVGTG GQAA+ + E+YK V+ 
Sbjct  1    MAGLFDKQASIYVDARPRYPSEWFSMLAALTPHHCLAWDVGTGNGQAAVGVSERYKQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P +R++ TP  M+  EL   +G E+SVDL+T+A A+HWF L  FY 
Sbjct  61   TDISEEQLKHAKPHPQIRYLHTPLTMSDDELVTLLGGENSVDLITVASAVHWFDLEKFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V+ VL+ P G++A WCY   ++S  +D + + ++     F  P  K   + Y+T+ FPF
Sbjct  121  IVRRVLRNPGGILAVWCYSGIQLSPEIDLLLRTHFERTFPFRNPNVKYAVECYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P E + QK M  E     ++S S + TAK +GV++LS ++V++F  AW  
Sbjct  181  ESVGVGSEGQPLELEMQKEMSFEGLLKLLKSLSSFNTAKGQGVDLLSEEVVREFESAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
                + I+ +  Y+  GKV +
Sbjct  241  PELVRTII-YKTYMLAGKVKL  260



>ref|XP_010526986.1| PREDICTED: putative methyltransferase DDB_G0268948 [Tarenaya 
hassleriana]
Length=261

 Score =   201 bits (510),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/262 (40%), Positives = 150/262 (57%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP + +  +A  T R DL WDVGTG GQAA+S+ E Y  V+ 
Sbjct  1    MAGLFDKQADLYLDARPTYPSEWYSKLAGITLRRDLAWDVGTGNGQAALSIAEHYDRVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P V +  TPP+MT  EL   +G E+SVDL+T+AQA+HWF LP FY 
Sbjct  61   TDVSESQLKLAMPNPKVVYHHTPPSMTDDELVDLIGGENSVDLITVAQAVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP GVIA WCY    V+   D++ +R++T    FW+ P  + +   Y+T+ FP
Sbjct  121  LATRLLRKPSGVIAVWCYSDVVVNQEFDAVLKRFHTETLPFWKYPNIQYLFDAYKTLPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P E +       E     +RS S    AK+KG ++LS ++V++   AW 
Sbjct  181  FEGVGMGSEGEPMELEMPTTTAFEGIVRMLRSWSAVVAAKDKGFDLLSENVVRELETAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++  G+V +
Sbjct  241  GSRLVRNVV-YKAFMLAGRVRV  261



>ref|XP_010270319.1| PREDICTED: putative methyltransferase DDB_G0268948 [Nelumbo nucifera]
Length=444

 Score =   206 bits (523),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/262 (39%), Positives = 154/262 (59%), Gaps = 1/262 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q   Y + RPTYP + +  +A+ TPR  L WDVGTG GQAA+ + E Y+ V+G
Sbjct  1    MAGLFDRQADVYVDARPTYPSEWYSMLAAVTPRRTLAWDVGTGNGQAALGVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR+V TPP+++  E+ + VG E+SVDLVT+AQA+HWF LP FY 
Sbjct  61   TDVSEAQLKRAMPHPRVRYVHTPPSISDEEIISVVGGENSVDLVTVAQAVHWFDLPNFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GV+A W Y+   V+   D +++R++ T   FW+P  + +   Y T+ FPF
Sbjct  121  LVARLLRKPGGVLAIWGYNDCTVNPEFDLVFKRFHDTTLDFWDPRIQHIFDGYSTLSFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P           + +   +RS S   T K +GV++LS ++V++   AW  
Sbjct  181  ESVGLGSEGKPLMLDMPIETSFDGFIGMVRSWSMVATTKERGVDLLSEEVVKELEIAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKVGIL  147
                Q ++ +  ++  GKV ++
Sbjct  241  SELIQTVI-YKAFMLAGKVKMV  261


 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 104/192 (54%), Gaps = 1/192 (1%)
 Frame = -1

Query  731  LQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLK  552
               A  +  VR++ TP +++  EL +++G E+SVDL+T+AQA+HWF LP FY  V  +LK
Sbjct  252  FMLAGKVKMVRYLHTPLSISDDELISSLGEENSVDLITVAQAVHWFDLPNFYSLVTRLLK  311

Query  551  KPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVDGCE  372
            KP G++A W Y+   VS   D + +R+  T   FW+P    V   Y T+  PF+ +    
Sbjct  312  KPGGIVAVWGYNEFAVSPIFDPVLKRFRDTTMQFWDPHIGYVFDDYSTLPSPFESIGLGT  371

Query  371  HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKI  192
               P     QK    E +   +RS S   TAK +G+++LS  +V++   +W    K  + 
Sbjct  372  EGKPLMLDMQKETSFEGFLGLLRSWSAVTTAKERGIDLLSQGVVKELESSWGGP-KLIRT  430

Query  191  VAFPIYLRIGKV  156
            V +  ++  GKV
Sbjct  431  VIYKSFMLAGKV  442



>ref|XP_002274567.1| PREDICTED: putative methyltransferase DDB_G0268948 [Vitis vinifera]
 emb|CBI24366.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/262 (39%), Positives = 152/262 (58%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y + RP YP   +  +A+ TP H L WDVGTG GQAA+ + E Y+ V+ 
Sbjct  1    MAGLFDKQAEIYLDARPNYPSHWYSKLAALTPHHSLAWDVGTGNGQAALGVAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V+++ TP ++   E+   +G E SVDLVT+AQA+HWF LPTFY 
Sbjct  61   TDVSEAQLKCAIPHPRVKYLHTPLSLPDDEIVRLIGGEGSVDLVTVAQAVHWFDLPTFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GV A W Y+   VS + D + +R++ T   FW    + +   Y+T+ FPF
Sbjct  121  LVARLLRKPGGVFAVWGYNDIAVSPTFDPVMKRFHDTTLPFWNEKIQYIFDGYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P      K +  + +   +RS S   TAK++G+++LS  +V++F  AW 
Sbjct  181  ESVGLGCEGQ-PVSLDIPKKLSFDGFLRMLRSWSAVTTAKDRGIDLLSERVVKEFETAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               +    V +  ++  GKV +
Sbjct  240  -GSRVVPSVTYNAFMLAGKVKL  260



>ref|XP_011022892.1| PREDICTED: putative methyltransferase DDB_G0268948 [Populus euphratica]
 ref|XP_011015448.1| PREDICTED: putative methyltransferase DDB_G0268948 [Populus euphratica]
Length=260

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/262 (40%), Positives = 148/262 (56%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF  Q   Y + RP YP + F  +AS TP H L WDVGTG GQAA+ + E YK V+ 
Sbjct  1    MAGLFDNQAAIYVDVRPRYPSEWFSMLASLTPDHSLAWDVGTGNGQAAVGVAEHYKQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V ++ TP  ++  EL   +G E+SVDL+T+A A+HWF L  FY 
Sbjct  61   TDISEEQLKHAIPHPQVHYLHTPLMISDDELVHLLGGENSVDLITVASAVHWFDLEKFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP G+ A WCY   + S  +D +   ++     F  P  K   + Y+T+ FPF
Sbjct  121  IVKRVLRKPGGIFAVWCYSGFKFSPEIDVLLAVHFERTFPFQNPNFKHALECYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P E   +K M  +    + RS S + TAK +GV++LS ++VQ+   AW 
Sbjct  181  ESVGVGCE-GQPLELDMEKKMSFQGLLKFFRSLSAFNTAKGQGVDLLSDEVVQELESAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               +  + V +  Y+  GKV +
Sbjct  240  -GPEVVRTVIYKTYMLAGKVKL  260



>ref|XP_010106890.1| Putative methyltransferase [Morus notabilis]
 gb|EXC12606.1| Putative methyltransferase [Morus notabilis]
Length=260

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 151/261 (58%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA  F KQ   Y++ RP YP + +  +A+ TP H   WDVGTG GQAA+ + E Y+ V+G
Sbjct  1    MAGQFDKQADIYADARPNYPTEWYSKLAALTPLHTFAWDVGTGNGQAALGVAEHYEQVIG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR+  TP   +  E+ + +G E+SVDL+T+AQA+HWF LP FY 
Sbjct  61   TDVSEAQLERATPHPRVRYFHTPLTTSDDEIISLIGGENSVDLITVAQAVHWFDLPRFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP GVIA WCY+   VS + D + +R+    + F++   K V   YRT+ FPF
Sbjct  121  LVSRLLRKPGGVIAVWCYNGITVSPTFDPLMKRFEDRARPFYDENIKYVFDGYRTLLFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P      K +  + +   + S S   TAK++GV++LS ++V++F  AW  
Sbjct  181  EGVGLGSEGSPLALDIPKELSFDKFLRMVGSWSAVITAKSQGVDLLSEEVVKEFESAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
              K  + V +  ++  GKV I
Sbjct  241  P-KLVRSVCYNAFMLAGKVRI  260



>ref|XP_006465127.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Citrus 
sinensis]
Length=260

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 100/259 (39%), Positives = 149/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ K Y + RPTY ++ +  +AS T  H L WDVGTG GQAA+ + E Y+ V+ 
Sbjct  1    MARLFDKQAKLYLDARPTYTREWYSMLASLTTHHLLAWDVGTGNGQAALGVVEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P +R+  TP +++  EL   +G E+SVDLVT+AQA+HW+ LP FY 
Sbjct  61   TDVSEEQLKHAMPHPRIRYHHTPLSISEEELVTLIGGENSVDLVTVAQAVHWYDLPKFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  +L+KP G+IA WCY    VS   D + +++Y T   +W+   + +   Y+ + FPF
Sbjct  121  IVTRILRKPGGIIAVWCYKSFAVSPEFDPVMKQFYDTTLPYWKINVQYLTDDYKELPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P E    K +  E +   +RS S   TA  +GV++LS  +V++   AW  
Sbjct  181  ESVGLGFEGQPLELDMPKEVSFEGFLRMLRSFSAVNTAVEQGVDLLSEKVVKELETAWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
                + I+ +  ++ +GKV
Sbjct  241  CELVRTII-YKTFMLVGKV  258



>ref|XP_006380389.1| hypothetical protein POPTR_0007s04550g [Populus trichocarpa]
 gb|ERP58186.1| hypothetical protein POPTR_0007s04550g [Populus trichocarpa]
Length=260

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 148/262 (56%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF  Q   Y + RP YP + F  +A+ TP H L WDVGTG GQAA+ + E YK V+ 
Sbjct  1    MAGLFDNQAAIYVDVRPRYPGEWFSMLAALTPDHSLAWDVGTGNGQAAVGVAEHYKQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V ++ TP  M+  EL   +G E+SVDL+T+A A+HWF L  FY 
Sbjct  61   TDISEEQLKHAIPHPQVHYLHTPLMMSDDELVHLLGGENSVDLITVASAVHWFDLEKFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+KP G+ A WCY   + S  +D +   ++     F  P  K   + Y+T+ FPF
Sbjct  121  IVKRVLRKPGGIFAVWCYSRIKFSPEIDVLLAVHFERTFPFQNPNFKHALECYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P E   +K M  +    + RS S + TAK +GV++LS ++V++   AW 
Sbjct  181  ESVGVGCE-GQPLELDMEKKMSFQGLLKFFRSLSAFNTAKGQGVDLLSDEVVKELESAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               +  + V +  Y+  GKV +
Sbjct  240  -GPEVVRTVIYTTYMLAGKVKL  260



>ref|XP_006442085.1| hypothetical protein CICLE_v10024436mg, partial [Citrus clementina]
 gb|ESR55325.1| hypothetical protein CICLE_v10024436mg, partial [Citrus clementina]
Length=178

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 126/197 (64%), Gaps = 32/197 (16%)
 Frame = -1

Query  782  LGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQAL  603
            L   +KNV+G +TSP Q++FA  LPN+R+  TPP M+ AELE NV A+S+VDLVT AQA+
Sbjct  8    LAGIFKNVIGMETSPKQIEFATKLPNIRYQVTPPAMSTAELEQNVAAQSTVDLVTTAQAM  67

Query  602  HWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVD  423
            HWF LP FY QV+WVLKKP                                    RKLVD
Sbjct  68   HWFDLPQFYNQVRWVLKKP-------------------------------IVHKQRKLVD  96

Query  422  QKYRTIDFPFDPVDGCEHNGPY-EFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSD  246
             KY TIDFPF+PVDG +  GP+ +F  ++ M+LESYF YIRS S YQTAK+K VE+L+ +
Sbjct  97   SKYMTIDFPFEPVDGADSTGPFDQFAIEETMDLESYFTYIRSWSAYQTAKDKDVELLNEN  156

Query  245  LVQDFTRAWNEDGKTQK  195
            ++ +F  AWNED ++QK
Sbjct  157  VMGNFKLAWNEDRQSQK  173



>ref|XP_006382875.1| hypothetical protein POPTR_0005s06730g [Populus trichocarpa]
 gb|ERP60672.1| hypothetical protein POPTR_0005s06730g [Populus trichocarpa]
Length=260

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/262 (40%), Positives = 148/262 (56%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF KQ   Y + RP YP + F  +AS TP H L WD GTG GQAA+ + E YK V+ 
Sbjct  1    MAELFDKQAAIYLDARPRYPSEWFSMLASLTPDHSLAWDAGTGNGQAAIDVSEHYKQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V++  +P +M+  EL   +G E+SVDLV +A A+HWF L  FY 
Sbjct  61   TDISEEQLKHAIQHPQVQYFHSPSSMSDDELVNLIGGENSVDLVVVATAVHWFDLEKFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VLKKP GV+A W Y+  +VS  +D + +++Y     F  P      + Y+T+ FPF
Sbjct  121  VVNRVLKKPGGVVAVWSYNIIQVSPDMDPLLRKFYEGTFPFQNPKAMYAFECYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P E    + M  E     + S+S   TAK +GV +LS ++V++   AW 
Sbjct  181  ESVGVGCE-GQPLELDMPREMSFERLLKLLSSASAVNTAKEQGVNLLSEEVVRELESAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               +  + V +  Y+  GKV +
Sbjct  240  -GPELVRTVNYKSYMLAGKVKL  260



>ref|XP_010027620.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
Length=260

 Score =   196 bits (499),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 150/259 (58%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y + RPTYP + +  +A+ T ++ L WDVGTG GQAA+ + + Y+ V+ 
Sbjct  1    MAGLFDKQAETYLQARPTYPSEWYSMLAACTSQNSLAWDVGTGNGQAALDVAKHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL FA   P VR+V TP +M+  E+ A +G E+ VDL+T+A A+HWF LP FY+
Sbjct  61   TDVSEAQLSFAMPHPRVRYVHTPQSMSEDEMVALMGGENRVDLITVATAVHWFDLPKFYK  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K +L+KP G++A W Y+   V+   D++ +R       FW    K + + YR + FPF
Sbjct  121  LAKRLLRKPGGLLAVWAYNDIVVNPEFDTVRKRLLEKYSRFWPADAKYIFEGYRNLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P +    K +  E    + +SSS + +AK +GV++LS +++++   +W  
Sbjct  181  ESVGLGSEGEPLQLDIPKELSFEGCLMFFKSSSAFASAKEQGVDLLSEEVIKELESSWGG  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
              K  + V +  ++  G V
Sbjct  241  PNKI-RTVTYKAFMLAGTV  258



>ref|XP_010929024.1| PREDICTED: putative methyltransferase DDB_G0268948 [Elaeis guineensis]
Length=260

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/247 (39%), Positives = 145/247 (59%), Gaps = 2/247 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF+KQ   Y+E RP+YP+  F  +AS T +H L WD GTG GQAA+S+ E Y+ V+ 
Sbjct  1    MAGLFVKQAAIYAEARPSYPKDWFSKLASLTAQHKLAWDAGTGNGQAAISVAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A     VR+V TP +    +L +  G E SVDLVT+AQA+HWF LP+FY 
Sbjct  61   TDVSDAQLKRAIPHSKVRYVHTPLSTPETDLASVSGGEGSVDLVTVAQAVHWFDLPSFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GVIA W Y++    S ++ + +R+  T   +W+P  + V   Y+ + FPF
Sbjct  121  LVNRVLRKPGGVIAVWGYNYR--ISPIEDVMKRFLDTTLPYWDPRARYVIDGYKNLPFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
              +       P E    + +  +++   ++S S   TAK +GV++LS ++V++   AW  
Sbjct  179  KSIGLGSEGDPLELDMGQDLSFDAFLGVLKSWSAVTTAKERGVDLLSEEVVKELETAWGG  238

Query  212  DGKTQKI  192
                +++
Sbjct  239  SSLVRRV  245



>ref|XP_008370320.1| PREDICTED: putative methyltransferase DDB_G0268948 [Malus domestica]
Length=254

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 146/257 (57%), Gaps = 4/257 (2%)
 Frame = -1

Query  917  LKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSP  738
            + Q   Y + RP YP++ +  +A  TP H L WDVGTG GQAA+ + E YK V+GTD S 
Sbjct  1    MDQADLYLDSRPAYPKEWYSKLADLTPHHSLAWDVGTGNGQAAIGVAEHYKQVIGTDVSE  60

Query  737  NQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWV  558
            +QLQ A   P VR+  TP  MT  EL A +G ESS DLVT+AQA+HWF LP FY  V  +
Sbjct  61   SQLQRAMPHPLVRYAHTPLTMTDDELIALIGGESSXDLVTVAQAVHWFDLPKFYSLVSRL  120

Query  557  LKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVD-  381
            L KP GV+A WCY+  EV    D I +R   T+  ++    + V   Y+T+ FPF     
Sbjct  121  L-KPGGVLAVWCYNHIEVCPEFDPIVKRLEDTSLPYYHRNIQYVFDGYKTLPFPFQSAGF  179

Query  380  GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKT  201
            GCE   P      K +  E +   +RS S   TAK +GV++L   LV++F  AW    K 
Sbjct  180  GCE-GSPLALDIPKKLSFEGFLKMVRSWSAVNTAKEQGVDLLPEKLVKEFEVAWG-GTKL  237

Query  200  QKIVAFPIYLRIGKVGI  150
             + V++  ++  GKV +
Sbjct  238  VRSVSYKAFMLAGKVKV  254



>ref|XP_004299745.1| PREDICTED: putative methyltransferase DDB_G0268948-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=260

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/241 (39%), Positives = 144/241 (60%), Gaps = 2/241 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y E RPTYP++ +  +A+ TP+H L WD GTG GQAA+ L E Y+ VV 
Sbjct  1    MAGLFDKQAEIYVEARPTYPKEWYSKLAALTPQHSLAWDAGTGNGQAALGLSEHYQQVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGA--ESSVDLVTIAQALHWFHLPTF  579
            TD S  QL++A   P +R++ TP +++  E+   +G   E+S+DL+T+A+A+HWF LP F
Sbjct  61   TDISEEQLKYAIQHPRIRYIHTPTSLSEDEMVNLIGGGHENSLDLITVAEAVHWFDLPQF  120

Query  578  YQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDF  399
            Y   K +L+KP G+IA W Y+   V+   D ++ R+      F  P  K V   Y+T+ F
Sbjct  121  YSLAKRLLRKPGGIIAVWAYNRMLVNPEFDPVFDRFRENCIPFTHPNSKYVRAGYKTLPF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ V       P   +  K +  +     +RS S    AK++GV++LS +++++F RAW
Sbjct  181  PFESVGMGREGEPLTLEIPKEVSFQGVERMLRSYSAVIRAKDQGVDMLSEEVIKEFERAW  240

Query  218  N  216
             
Sbjct  241  G  241



>emb|CAN76825.1| hypothetical protein VITISV_039111 [Vitis vinifera]
Length=261

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/263 (40%), Positives = 153/263 (58%), Gaps = 4/263 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y + RP YP   +  +A+ TP H L WDVGTG GQAA+ + E Y+ V+ 
Sbjct  1    MAGLFDKQAEIYLDARPNYPPHWYSKLAALTPHHSLAWDVGTGNGQAALGVAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V+++ TP ++   E+   +G E SVDLVT+AQA+HWF LPTFY 
Sbjct  61   TDVSEAQLKCAIPHPRVKYLHTPLSLPDDEIVRLIGGEGSVDLVTVAQAVHWFDLPTFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFW-EPGRKLVDQKYRTIDFP  396
             V  +L+KP GV A W Y+   VS + D + +R++ T   FW E  + +    Y+T+ FP
Sbjct  121  LVARLLRKPGGVFAVWGYNDIAVSPTFDPVMKRFHDTTLPFWNEKIQYIFVDGYKTLPFP  180

Query  395  FDPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            F+ V  GCE   P      K +  + +   +RS S   TAK++G+++LS  +V++F  AW
Sbjct  181  FESVGLGCEGQ-PVSLDIPKKLSFDGFLRMLRSWSAVTTAKDRGIDLLSERVVKEFETAW  239

Query  218  NEDGKTQKIVAFPIYLRIGKVGI  150
                +    V +  ++  GKV +
Sbjct  240  G-GSRVVPSVTYNAFMLAGKVKL  261



>ref|XP_011031148.1| PREDICTED: uncharacterized protein LOC105130372 [Populus euphratica]
Length=260

 Score =   193 bits (490),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/262 (40%), Positives = 146/262 (56%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+L+ KQ   Y + RP YP + F  +AS TP H L WD GTG GQAA+ + E YK V+ 
Sbjct  1    MAELYDKQAAIYLDARPRYPSEWFSMLASLTPDHSLAWDAGTGNGQAAIDVSEHYKQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V++  +P +M+  EL   +G E+SVDLV  A A+HWF L  FY 
Sbjct  61   TDVSEEQLKHAIQHPQVQYFHSPSSMSDDELANLIGGENSVDLVVAATAVHWFDLEKFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VLKKP GV+A W Y+  +VS  +D + +++Y     F  P      + Y+T+ FPF
Sbjct  121  VVNRVLKKPGGVVAVWSYNIIQVSPEMDPLLRKFYEGTFPFQNPKVMYAFECYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P E      M  E     + S+S   TAK +GV +LS ++V++   AW 
Sbjct  181  ESVGVGCE-GQPLELDLPMEMSFERLLKLLSSASAVNTAKEQGVNLLSDEVVRELESAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               +  + V +  Y+  GKV +
Sbjct  240  -GPELVRTVNYRTYMLAGKVKL  260



>ref|XP_002270565.1| PREDICTED: putative methyltransferase DDB_G0268948 [Vitis vinifera]
 emb|CAN76824.1| hypothetical protein VITISV_039110 [Vitis vinifera]
 emb|CBI24365.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   192 bits (488),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 102/262 (39%), Positives = 152/262 (58%), Gaps = 6/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y + RP YP   +  +A+ TP+H L WDVG G GQAA+ + E Y+ V+ 
Sbjct  1    MAGLFNKQAEIYLDARPNYPPHWYSMLAALTPQHSLAWDVGMGNGQAALGVAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V+++ TP ++   E+   +G E SVDLVT+AQA+HWF LPTFY 
Sbjct  61   TDVSEAQLKCAIPHPRVKYLHTPLSLPDDEIVRLIGGEGSVDLVTVAQAVHWFDLPTFYP  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFW-EPGRKLVDQKYRTIDFP  396
             V  +L+KP GV A W Y+   VS + D + +R++ T   FW E  + +    Y+T+ FP
Sbjct  121  LVARLLRKPGGVFAVWGYNDIAVSPTFDPVMKRFHDTTLTFWNEKIQCIFVDGYKTLPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P      K +  + +   +RS +   TAK++GV++LS  +V++F  AW 
Sbjct  181  FESVGLGREGQPVSLDIHKKLSFDGFLRMLRSWAAVTTAKDQGVDLLSERVVKEFETAW-  239

Query  215  EDGKTQKI--VAFPIYLRIGKV  156
              G +Q +  V +  ++  GKV
Sbjct  240  --GGSQVVPSVTYKAFMLEGKV  259



>ref|XP_011011392.1| PREDICTED: uncharacterized protein LOC105115977 isoform X1 [Populus 
euphratica]
Length=260

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/262 (40%), Positives = 145/262 (55%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+L+ KQ   Y + RP YP + F  +AS TP H L WD GTG GQAA+ + E YK V+ 
Sbjct  1    MAELYDKQAAIYLDARPRYPSEWFSMLASLTPDHSLAWDAGTGNGQAAIDVSEHYKQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V++  +P  M+  EL   +G E+SVDLV  A A+HWF L  FY 
Sbjct  61   TDVSEEQLKHAIQHPQVQYFHSPSTMSDDELVNLIGGENSVDLVVAATAVHWFDLEKFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VLKKP GV+A W Y+  +VS  +D + +++Y     F  P      + Y+T+ FPF
Sbjct  121  VVNRVLKKPGGVVAVWSYNIIQVSPEMDPLLRKFYEGTFPFQNPKVMYAFECYKTLPFPF  180

Query  392  DPVD-GCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V  GCE   P E      M  E     + S+S   TAK +GV +LS ++V++   AW 
Sbjct  181  ESVGVGCEGQ-PLELDLPMEMSFERLLKLLSSASAVNTAKEQGVNLLSDEVVRELESAWG  239

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
               +  + V +  Y+  GKV +
Sbjct  240  -GPELVRNVNYRTYMLAGKVKL  260



>ref|XP_010031282.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
 ref|XP_010031283.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
Length=263

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/232 (41%), Positives = 142/232 (61%), Gaps = 3/232 (1%)
 Frame = -1

Query  905  KQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQ  726
            K Y   RP YP Q F  +++ T RH L WD GTG GQAA+++ E Y+ V+ TD S   L+
Sbjct  12   KGYVATRPRYPDQWFSKLSALTSRHALAWDAGTGNGQAAIAVAEHYERVIATDISEPMLK  71

Query  725  FAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKP  546
                 P V+++ TPP+++  E+ A +G E+SVDL+T+A A+HWF +P FY   K VL+KP
Sbjct  72   QGIPHPRVQYLHTPPSLSEDEMVAMLGGENSVDLITVATAVHWFDIPKFYSVAKRVLRKP  131

Query  545  DGVIAAWCY-DFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVD-GCE  372
             GVIA W Y D  EV+   + I +R     + +W+PG +   ++YR + FPF+ V  GCE
Sbjct  132  GGVIAVWTYTDMIEVNPEFERILRRLREACKPYWKPGAQYFFEEYRNLPFPFESVGLGCE  191

Query  371  HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
               P + +  + M  E+  + +R++S   TAK  GV++L+ D+V++F  AW 
Sbjct  192  GQ-PAQLEMPREMSFETLLSVLRTASAVATAKQHGVDLLTDDVVKEFETAWG  242



>ref|XP_010031284.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
Length=259

 Score =   190 bits (482),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 95/232 (41%), Positives = 143/232 (62%), Gaps = 3/232 (1%)
 Frame = -1

Query  905  KQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQ  726
            K Y   RP YP Q F  +++ T RH L WD GTG GQAA+++ E Y+ VV TD S   L+
Sbjct  12   KGYVATRPQYPDQWFSKLSALTSRHALAWDAGTGNGQAAITVAEHYERVVATDISEPMLK  71

Query  725  FAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKP  546
                 P V+++  P +++  E+ A +G E+SVDL+T+A A+HWF +P FY   K VL+KP
Sbjct  72   QGIPHPRVQYLHMPSSLSEDEMVAMLGGENSVDLITVATAVHWFDIPKFYSVAKRVLRKP  131

Query  545  DGVIAAWCY-DFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVD-GCE  372
             GVIA W Y D  EV+  ++ I +R    ++ +W+PG + V ++YR + FPF+ V  GCE
Sbjct  132  GGVIAVWTYTDMIEVNPKIEHILRRLREASKPYWKPGVQYVFEEYRNLPFPFESVGLGCE  191

Query  371  HNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
               P + +  + M  E++ +  R+SS   TAK  GV++L+ D+V++F  AW 
Sbjct  192  -GQPVQLEMPREMSFETFLSCQRTSSAVATAKQDGVDLLTDDVVKEFETAWG  242



>ref|XP_004298772.1| PREDICTED: putative methyltransferase DDB_G0268948-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=277

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 146/242 (60%), Gaps = 2/242 (1%)
 Frame = -1

Query  935  KMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVV  756
            +MA LF KQ + Y E RPTYP++ +  +A+ TP+H L WDVGTG GQAA SL E Y+ VV
Sbjct  17   RMAGLFDKQAEVYLEARPTYPKEWYMKLAALTPKHSLAWDVGTGNGQAACSLSEHYQQVV  76

Query  755  GTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANV--GAESSVDLVTIAQALHWFHLPT  582
            G+D S  QL+ A   P VR++ TP +++  E+   +  G E+SVDL+T+A+A+HWF LP 
Sbjct  77   GSDISEEQLKHAMQHPRVRYIHTPTSISEDEMINLIAGGHENSVDLITVAEAIHWFDLPQ  136

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ +L+K  GVIA W Y+   VS   D + +  +     +++P    + + YRT+ 
Sbjct  137  FYSLVRRLLRKAGGVIAVWGYNNTVVSLDFDLLMKPLHKKMLPYYDPKTSYLWEGYRTLP  196

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+ V       P E   ++    +    ++RS S   TAK++GV++L  +++++  + 
Sbjct  197  FPFESVGLGREGEPMELDIKREQSFQGLVRFMRSCSAVTTAKDQGVDLLPEEVIEELKQV  256

Query  221  WN  216
            W 
Sbjct  257  WG  258



>ref|XP_010911762.1| PREDICTED: putative methyltransferase DDB_G0268948 [Elaeis guineensis]
Length=259

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 148/257 (58%), Gaps = 4/257 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA+LF+KQ   Y++ RP YP++ F  +AS T  H L WD GTG GQAA+S+ E Y+ V+ 
Sbjct  1    MAELFVKQAAIYAKARPNYPKEWFSKLASLTTHHKLAWDAGTGNGQAAVSVAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q++ A   P V+++ TP +    +L + +G E SVDLVT+A A+HWF LP+FY 
Sbjct  61   TDVSEAQIKRAIPHPKVQYIHTPLSTLEQDLVSMLGGEGSVDLVTVATAVHWFDLPSFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GV+A W Y +    S ++ + +R+Y +   + +   + V + YRT+ FPF
Sbjct  121  IVNRVLRKPGGVVAVWSYSYD--ISPLEDVMKRFYVSCLPYMDDRARYVFEGYRTLPFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        +  + +   +R+ S   TAK +GV++LS ++V++   AW  
Sbjct  179  ESVGLGTEGNPTSVDMDLEISFDGFMELLRTGSAVNTAKERGVDLLSEEVVKELRTAWG-  237

Query  212  DGKTQKIVAFPIYLRIG  162
             G   + V F  ++  G
Sbjct  238  -GSDIRKVTFKAFMLAG  253



>ref|XP_004298773.1| PREDICTED: putative methyltransferase DDB_G0268948-like isoform 
2 [Fragaria vesca subsp. vesca]
 ref|XP_004298774.1| PREDICTED: putative methyltransferase DDB_G0268948-like isoform 
3 [Fragaria vesca subsp. vesca]
Length=260

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 145/241 (60%), Gaps = 2/241 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ + Y E RPTYP++ +  +A+ TP+H L WDVGTG GQAA SL E Y+ VVG
Sbjct  1    MAGLFDKQAEVYLEARPTYPKEWYMKLAALTPKHSLAWDVGTGNGQAACSLSEHYQQVVG  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANV--GAESSVDLVTIAQALHWFHLPTF  579
            +D S  QL+ A   P VR++ TP +++  E+   +  G E+SVDL+T+A+A+HWF LP F
Sbjct  61   SDISEEQLKHAMQHPRVRYIHTPTSISEDEMINLIAGGHENSVDLITVAEAIHWFDLPQF  120

Query  578  YQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDF  399
            Y  V+ +L+K  GVIA W Y+   VS   D + +  +     +++P    + + YRT+ F
Sbjct  121  YSLVRRLLRKAGGVIAVWGYNNTVVSLDFDLLMKPLHKKMLPYYDPKTSYLWEGYRTLPF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ V       P E   ++    +    ++RS S   TAK++GV++L  +++++  + W
Sbjct  181  PFESVGLGREGEPMELDIKREQSFQGLVRFMRSCSAVTTAKDQGVDLLPEEVIEELKQVW  240

Query  218  N  216
             
Sbjct  241  G  241



>emb|CDX85742.1| BnaA02g00710D [Brassica napus]
Length=261

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 142/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  H L WD  TG GQAA+++ + Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLAGLTDHHVLAWDAATGNGQAALAVADHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+FA   P + +  TP +MT  EL   +G ESSVDL+T+AQA+HWF LP FY 
Sbjct  61   TDISESQLKFATTHPKIDYRHTPSSMTDDELVELIGGESSVDLITVAQAVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
              K VL+KP G+IA W Y+   VS   D +  R++     +W+ P  + V   Y  + FP
Sbjct  121  VAKRVLRKPGGIIAVWGYNDVVVSPEFDKVQYRFHAETLPYWKYPNIQHVFDAYGALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P   +  K    E      +S S   TA+ KGVE+L   LV++   AW 
Sbjct  181  FESVGMGSEGRPLMLEMPKTTSFEGILRMFKSWSAIVTAREKGVELLPESLVKELETAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++ +G+V +
Sbjct  241  GKDLIRNVV-YKAFMIVGRVSV  261



>ref|XP_001757338.1| predicted protein [Physcomitrella patens]
 gb|EDQ77823.1| predicted protein [Physcomitrella patens]
Length=262

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/262 (39%), Positives = 144/262 (55%), Gaps = 3/262 (1%)
 Frame = -1

Query  938  KKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNV  759
            K+  +LF+KQ + Y   RP  P++L+ ++AS TP H+L WDVGTG GQAA  + + YK V
Sbjct  3    KETENLFVKQAEVYKRARPHAPEELYSYLASLTPSHELAWDVGTGNGQAAAVISKHYKKV  62

Query  758  VGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTF  579
            + TD +  QL  A   PN+ +  TP  ++  +L   VG E SVDLV I +ALHWF L  F
Sbjct  63   IATDVAAEQLSHAEQRPNITYAATPTTLSKDDLTRIVGPEGSVDLVLIVEALHWFDLDKF  122

Query  578  YQQVKWVLKKPDGVIAAWCY-DFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            Y  VK+VL+KP G+IAA  Y     V+  +D +   +  T +H W P    V   Y+ + 
Sbjct  123  YDNVKYVLRKPGGLIAATVYPPMLRVNPRLDKVLNDFNDTIKHHWAPQVDHVVNLYKNLP  182

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF PV+  +      FK      L+ Y  Y+ S S  QTA + G + L+    + F  A
Sbjct  183  FPFAPVEQADERVS-RFKMSLDATLDDYLNYLESWSAVQTAIDNGEDPLNEHWRKLFAEA  241

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W    +T+  V +P  + +GKV
Sbjct  242  WGA-PETEHTVKWPFKVLLGKV  262



>ref|XP_010527089.1| PREDICTED: putative methyltransferase DDB_G0268948 [Tarenaya 
hassleriana]
Length=334

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 144/266 (54%), Gaps = 2/266 (1%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            +  +A L  +Q   Y E RPTYP+  +  +  KT  H+  WDVGTG GQAA+ L E Y  
Sbjct  1    MSNLATLSAEQASAYKESRPTYPRSWYKMLTEKTTFHERAWDVGTGNGQAAVGLAEYYNR  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD +  QL  A   P V ++ TP +M+  EL A +G E+SVDLVT AQALH+F L  
Sbjct  61   VVATDINQGQLNKATKHPKVTYLLTPESMSENELVAVLGGENSVDLVTAAQALHYFDLDK  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  VK VL+KP GVIA W ++   +S  VD +++R   +   F  P   +    YRTI 
Sbjct  121  FYAVVKRVLRKPGGVIAVWVFNNIVISPPVDRVFKRLADSTVPFRTPRTDMSLAGYRTIS  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+ V       P        + L+ + AY+RS      AK +GV++L + L+ +F  A
Sbjct  181  FPFESVGIGSEGNPLPLDLPWKLSLDGFLAYLRSWQLVVKAKQQGVDLLPASLIDEFKAA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKVGILD  144
            W  +  + K V +  ++  GK    D
Sbjct  241  WGSN--SVKTVVYKFFMIAGKCKASD  264



>ref|XP_010453118.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=261

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 141/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  HDL WD  TG GQAA+++ E Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLADLTDHHDLAWDAATGNGQAALAVAEHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP +MT  EL   +G E+SVDL+T+AQ +HWF LP FY 
Sbjct  61   TDVSESQLKLATPHPRISYHHTPQSMTDDELVELIGGENSVDLITVAQGVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP G+IA W Y+   VS   D I  R++ T   FW+ P  + +   Y  + FP
Sbjct  121  VATRLLRKPGGIIAVWGYNDVIVSPEFDPIQYRFHATTLPFWKYPYIQHIFDSYEALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P + +  K    E      +S S   TA+ KGVE+L   LV++  +AW 
Sbjct  181  FESVGMGSEGKPLKLEMPKTTSFEGIMRMFKSWSSIVTAREKGVELLPESLVRELEQAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                  + V +  ++  GKV +
Sbjct  241  -GADVIRPVVYKAFMIAGKVRV  261



>ref|XP_002871442.1| hypothetical protein ARALYDRAFT_487916 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47701.1| hypothetical protein ARALYDRAFT_487916 [Arabidopsis lyrata subsp. 
lyrata]
Length=261

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 141/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  H L WD  TG GQAA+++ E Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLADLTDHHGLAWDAATGNGQAALAVAEHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP +MT  EL   +G E+SVDL+T+AQ +HWF LP FY 
Sbjct  61   TDVSESQLKLATPHPRISYRHTPSSMTDDELVELIGGENSVDLITVAQGVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP G+IA W Y+   VS   D++  R++ T   FW+ P  + +   Y  + FP
Sbjct  121  VATRLLRKPGGIIAVWGYNDVIVSPEFDAVQYRFHATTLPFWKYPYIQHIFDSYEALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P + +  K    E      +S S   TA+ KGVE+L   LV++   AW 
Sbjct  181  FESVGMGSEGKPLKLEMPKTTSFEGIIRMFKSWSAIVTAREKGVELLPESLVRELETAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++  GKV +
Sbjct  241  GSDLVRSVV-YKAFMIAGKVRV  261



>ref|XP_006289611.1| hypothetical protein CARUB_v10003164mg [Capsella rubella]
 gb|EOA22509.1| hypothetical protein CARUB_v10003164mg [Capsella rubella]
Length=261

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 140/262 (53%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y E RP YP + F  +A  T  H L WD  TG GQAA+++ E Y+ V+ 
Sbjct  1    MAGLFDKQADLYLEARPNYPSEWFSKLADLTDHHGLAWDAATGNGQAALAVAEHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP +MT  EL   +G E+SVDL+T+AQ +HWF LP FY 
Sbjct  61   TDVSESQLKLATPHPRINYRHTPQSMTDDELVELIGGENSVDLITVAQGVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP G+IA W Y+   V+   D I  R++ T   FW+ P  + V   Y  + FP
Sbjct  121  VATRLLRKPGGIIAVWGYNDVIVNPEFDPIQYRFHATTLPFWKYPYIQHVFDAYEALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P + +  K    E       S S   TA+ KG+E+L   LVQ+  +AW 
Sbjct  181  FESVGMGSEGKPLKLEMPKTTSFEGIMRMFNSWSAIVTAREKGIELLPESLVQELEKAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++  GKV +
Sbjct  241  GSDLIRPVV-YKAFMISGKVRV  261



>ref|XP_010929248.1| PREDICTED: putative methyltransferase DDB_G0268948 [Elaeis guineensis]
Length=264

 Score =   184 bits (466),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 93/247 (38%), Positives = 140/247 (57%), Gaps = 2/247 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y++ RP+YP++ F  +AS T  H L WD GTG GQAA+S+ E Y+ V+ 
Sbjct  1    MAGLFEKQAATYADARPSYPKEWFAKLASLTAHHTLAWDAGTGNGQAAVSIAEHYEQVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL  A   P VR+V TP +    +L + +G E SVDLVT+AQA+HWF L  FY 
Sbjct  61   TDVSEAQLNHAFPHPKVRYVHTPLSTPEPDLVSILGGEGSVDLVTVAQAVHWFDLSRFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GVIA W Y++      ++ + +R + T   +W+P       +YRT+ FPF
Sbjct  121  LVNRVLRKPGGVIAVWGYNYN--MGHLEDVMKRLFETTIPYWDPRAWYAFDRYRTLPFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
              +       P+    ++ M  + +   ++S S   TA  +GV++LS ++V++    W  
Sbjct  179  QGIGFGSEGDPFCLDLEQDMTFDGFLRMLKSWSAVTTAMEQGVDLLSQEVVKELEAEWGG  238

Query  212  DGKTQKI  192
                +++
Sbjct  239  SSVVRRL  245



>ref|XP_010527091.1| PREDICTED: putative methyltransferase DDB_G0268948 [Tarenaya 
hassleriana]
Length=348

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/263 (40%), Positives = 148/263 (56%), Gaps = 6/263 (2%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            +  +A L   Q   Y E RPTYP   +  ++ KT  H+  WDVGTG GQAA+ + + Y N
Sbjct  1    MGDLATLSGSQAAAYKEARPTYPSSWYKMLSEKTAYHERAWDVGTGNGQAALGVADYYNN  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD +  QL  A   P V ++ TP +M+  EL A VG E+SVDLVT+AQALH+F L  
Sbjct  61   VVATDINQAQLNQATKHPKVTYLLTPESMSENELVAMVGGENSVDLVTVAQALHYFDLDK  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  VK VL+KP GVIA W ++   VS  VD +++R   +   +  P   +    YRTI 
Sbjct  121  FYAVVKRVLRKPGGVIAVWVFNEIVVSPPVDRVFERLSDSTVPYRTPRTDMALAGYRTIS  180

Query  401  FPFDPVD-GCEHNG-PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFT  228
            FPF+ V  G E N  P +   +  + L+ + AY+RS      AK +GV++L + L+ +F 
Sbjct  181  FPFESVGIGSEGNSLPLDLPWK--LSLDGFLAYLRSWQLVVKAKQQGVDLLPASLIDEFK  238

Query  227  RAWNEDGKTQKIVAFPIYLRIGK  159
             AW  +    K V +  ++  GK
Sbjct  239  AAWGSN--PVKTVVYKFFMIAGK  259



>ref|XP_010911453.1| PREDICTED: putative methyltransferase DDB_G0268948 [Elaeis guineensis]
Length=259

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 148/257 (58%), Gaps = 4/257 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ KQ + Y++ RP YP+  F  +AS T  H   WD GTG+GQAA+++ E Y+ V+ 
Sbjct  1    MAGLYEKQAEIYAQARPKYPRGWFTKLASLTAHHKRAWDAGTGSGQAAVNVAEHYEEVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q++ A   P V++V TP +++  +L + +G E SVDLVT+A A+HWF LP+FY 
Sbjct  61   TDVSEAQIKHATPHPKVQYVHTPLSISEQDLVSMLGGEGSVDLVTVATAVHWFDLPSFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GV+A W Y +    S ++ + +R+Y ++  + +   +   + YRT+ FPF
Sbjct  121  IVNRVLRKPGGVVAVWSYSYD--ISPLEDVMKRFYVSSLPYMDDRARYAFEGYRTLPFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        +  + +   +R+ S   TAK +GV++LS ++V++   AW  
Sbjct  179  ESVGLGTEGNPTSVDMDLEISFDGFVELLRTGSAVNTAKERGVDLLSEEVVKELRTAWG-  237

Query  212  DGKTQKIVAFPIYLRIG  162
             G   + V F  ++  G
Sbjct  238  -GSDIRKVTFKAFMLAG  253



>gb|KFK25364.1| hypothetical protein AALP_AA8G103700 [Arabis alpina]
Length=259

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/260 (36%), Positives = 142/260 (55%), Gaps = 2/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A+ T  +   WD  TG GQAA+++ E Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLANLTDHNHSAWDAATGNGQAALAVAEHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL  A   P + +  TP +MT  EL   +G E+S+DL+T+AQA+HWF LP FY 
Sbjct  61   TDVSESQLNLATPHPKINYHHTPSSMTDDELVELIGGENSIDLITVAQAIHWFDLPKFYT  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                VL+KP+G+IA W Y+   V+   D++  R++     +W+ P  + +   Y  + FP
Sbjct  121  IANRVLRKPNGIIAVWGYNDVVVTPEFDAVQYRFHAKTLPYWKYPNIQHIFDSYEALQFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P + +  K    E      +S S   TAK KGVE+L+  LV++   AW 
Sbjct  181  FESVGMGLEGKPLKLEMVKTTSFEGILRMFKSWSAIVTAKEKGVELLTESLVKELEDAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKV  156
               K  + V +  ++ +GK+
Sbjct  241  -GSKLIRTVVYKAFMIVGKI  259



>ref|NP_196644.1| methyltransferase [Arabidopsis thaliana]
 emb|CAB96838.1| embryonic abundant protein-like [Arabidopsis thaliana]
 gb|AAO24556.1| At5g10830 [Arabidopsis thaliana]
 dbj|BAF00142.1| embryonic abundant protein -like [Arabidopsis thaliana]
 gb|AED91601.1| methyltransferase [Arabidopsis thaliana]
Length=261

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 141/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  H L WD  TG GQAA+++ E Y++VV 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLADLTDHHGLAWDAATGNGQAALAVAEHYESVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP +MT  EL   +G E+SVDL+T+AQ +HWF LP FY 
Sbjct  61   TDVSESQLKLATPHPKINYRHTPTSMTDDELVELIGGENSVDLITVAQGVHWFDLPRFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP G+IA W Y+   VS   D++  R + T   FW+ P  + +   Y  + FP
Sbjct  121  VATRLLRKPGGIIAVWGYNDVIVSPEFDAVQYRLHATTLPFWKYPYIQHIFDSYEALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P + +  K    E      +S S   TA+ KGVE+L   LV++   AW 
Sbjct  181  FENVGMGSEGEPLKLEMPKTTSFEGIIRMFKSWSAIVTAREKGVELLPESLVRELETAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++  GKV +
Sbjct  241  GSDLVRSVV-YKAFMIAGKVRV  261



>ref|XP_006646053.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Oryza 
brachyantha]
Length=265

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 139/263 (53%), Gaps = 6/263 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF  Q  QY+  RP YP+ LF  +A+ T  H + WDVGTG GQAA+ + E Y +VV 
Sbjct  1    MAGLFTSQAAQYAAARPVYPKDLFAKLAALTAHHRVAWDVGTGNGQAAIGVAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAE---LEANVGAESSVDLVTIAQALHWFHLPT  582
            TD S  Q++ A   P VR++ TP          L   +G E SVDL+T+A+A HWF LP 
Sbjct  61   TDVSAEQVRRAVPHPRVRYLHTPDADAAPADDGLVMALGGEGSVDLITVAEAAHWFDLPA  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY   + +L++P GVIA W Y++    S V+ +  R++ T   FW+P  + V   YR + 
Sbjct  121  FYGVARRLLRRPGGVIAVWGYNYR--VSPVEDMMARFFHTTLPFWDPRARYVMDGYRDLP  178

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPFD V   +   P  F     M        +RS S   TA+ +GV++L    V+   + 
Sbjct  179  FPFDDVGAGKEGEPAGFDVAHEMSFAGLVGMLRSWSAVATARRQGVDLLDERAVRRLEQE  238

Query  221  WNEDGKTQKIVAFPIYLRIGKVG  153
            W      ++ V F  +L  G VG
Sbjct  239  WGGASLVRE-VTFKAFLLAGTVG  260



>ref|XP_006399580.1| hypothetical protein EUTSA_v10014426mg [Eutrema salsugineum]
 gb|ESQ41033.1| hypothetical protein EUTSA_v10014426mg [Eutrema salsugineum]
Length=261

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/260 (36%), Positives = 142/260 (55%), Gaps = 2/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RPTYP + F  +A  T  H L WD  TG GQAA+++ + Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPTYPSEWFSKLAGLTDHHGLAWDAATGNGQAALAVADHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP +MT  EL   +G E+SVDL+T+AQA+HWF LP FY 
Sbjct  61   TDVSESQLKLATPHPKIDYRHTPSSMTADELVELIGGENSVDLITVAQAVHWFDLPKFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP G+IA W Y+   V+   D++  R++     +W+ P  + +   Y  + FP
Sbjct  121  VATRLLRKPGGIIAVWGYNDVLVTPEFDAVQYRFHAETLPYWKYPNIQHIFDSYEALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V+      P + +  K    E      +S S   TA+ KG+++L   LV++   AW 
Sbjct  181  FESVEMGSEGKPLKLEMPKATSFEGIIRMFKSWSAIVTAREKGIDLLPESLVRELEAAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKV  156
                 + +V +  ++  GKV
Sbjct  241  GSDLIRSVV-YKAFMIAGKV  259



>ref|XP_010491766.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=261

 Score =   182 bits (462),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 142/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  H L WD  TG GQAA+++ + Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLADLTDHHGLAWDAATGNGQAALAVADHYEKVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP +MT  EL   +G E+SVDL+T+AQ +HWF LP FY 
Sbjct  61   TDVSESQLKLATPHPRISYRHTPQSMTNDELVELIGGENSVDLITVAQGVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
                +L+KP G+IA W Y+   VS   D I  R+++T   FW+ P  + +   Y  + FP
Sbjct  121  VATRLLRKPGGIIAVWGYNDVIVSPEFDPIQYRFHSTTLPFWKYPYIQHIFDSYEALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P + +  K    E      +S S   TA+ KGVE+L   LV++  +AW 
Sbjct  181  FESVGMGSEGKPLKLEMPKTTSFEGIMRMFKSWSAIVTAREKGVELLPESLVKELEQAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++  GKV +
Sbjct  241  GSDLIRPVV-YKAFMIAGKVRV  261



>ref|XP_010929134.1| PREDICTED: putative methyltransferase DDB_G0268948 [Elaeis guineensis]
Length=259

 Score =   182 bits (461),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/257 (36%), Positives = 147/257 (57%), Gaps = 4/257 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ KQ + Y++ RP YP+  F  +AS T  H   WD GTG+GQAA+++ E Y+ V+ 
Sbjct  1    MAGLYEKQAEIYAQARPKYPRGWFTKLASLTAHHKRAWDAGTGSGQAAVNVAEHYEEVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q++ A     VR+V TP +++  +L + +G E SVDLVT+A A+HWF LP+FY 
Sbjct  61   TDVSEAQIKHATPHRKVRYVHTPLSISEQDLVSMLGGEGSVDLVTVATAVHWFDLPSFYS  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GV+A W Y +    S ++ + +R+Y ++  + +   +   + YRT+ FPF
Sbjct  121  IVNRVLRKPGGVVAVWSYSYD--ISPLEDVMKRFYVSSLPYMDDRARYAFEGYRTLPFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        +  + +   +R+ S   TAK +GV++LS ++V++   AW  
Sbjct  179  ESVGLGTEGNPTSVDMDLEISFDGFVELLRTGSAVNTAKERGVDLLSEEVVKELRTAWG-  237

Query  212  DGKTQKIVAFPIYLRIG  162
             G   + V F  ++  G
Sbjct  238  -GSDIRKVTFKAFMLAG  253



>ref|XP_010031281.1| PREDICTED: putative methyltransferase DDB_G0268948 [Eucalyptus 
grandis]
Length=263

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 147/253 (58%), Gaps = 4/253 (2%)
 Frame = -1

Query  908  GKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQL  729
             K Y   RP YP + F  +++ T RH L WD  TG GQAA+++ E Y+ VV TD S   L
Sbjct  11   AKGYVATRPQYPNEWFSKLSALTSRHALAWDASTGNGQAAVAIAEHYERVVATDISEPML  70

Query  728  QFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKK  549
            +     P V+++ TP +++  E  A +G E+SVDL+T+A A+HWF +P FY   K VL+K
Sbjct  71   KQGIPHPRVQYLYTPSSLSEDETVAMLGGENSVDLITVATAVHWFDIPKFYSIAKRVLRK  130

Query  548  PDGVIAAWCY-DFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVD-GC  375
            P GVIA W Y D    +   + + +R     + +W+PG + V ++Y+ + FPF+ V  GC
Sbjct  131  PGGVIAVWTYTDMIGATPEFERLLRRLREACKPYWKPGMQYVFEEYQNLPFPFESVGLGC  190

Query  374  EHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQK  195
            E   P + +  + +  E++ + +R+SS   TAK  GV++L+ D+V++F  AW     + +
Sbjct  191  EGQ-PAQLEMSREISFETFLSRLRTSSAVSTAKQNGVDLLTDDVVKEFETAWG-GSDSVR  248

Query  194  IVAFPIYLRIGKV  156
             V   +++  G V
Sbjct  249  TVKLKVFMLAGTV  261



>ref|XP_009125271.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brassica 
rapa]
Length=261

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/262 (37%), Positives = 139/262 (53%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  H L WD  TG GQAA+++ + Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLAGLTDHHILAWDAATGNGQAALAVADHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL+ A   P + +  TP  MT  E+   +G ESSVDL+T+AQA+HWF LP FY 
Sbjct  61   TDISESQLKLATPHPKIDYRHTPSTMTDDEMVELIGGESSVDLITVAQAVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
              K VL+KP G+IA W Y+   VS   D +  R++     +W+    + V   Y  + FP
Sbjct  121  VAKRVLRKPGGIIAVWGYNDVVVSPEFDKVQYRFHAETLPYWKYTNIQHVFDAYGALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P   +  K    E      +S S   TA+ KGVE+L   L+++   AW 
Sbjct  181  FESVGMGSEGRPLMLEMPKTTSFEGILRMFKSWSAIVTAREKGVELLPESLIKELETAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++ +GKV +
Sbjct  241  GKDLIRNVV-YKAFMIVGKVCV  261



>ref|XP_010547857.1| PREDICTED: putative methyltransferase DDB_G0268948 [Tarenaya 
hassleriana]
Length=262

 Score =   178 bits (452),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 145/262 (55%), Gaps = 3/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++      Y + RPTYP   F  +A  + R +L WD GTG GQAA+ + ++Y  V+ 
Sbjct  1    MSGVYDNHADAYLDARPTYPSDWFSKLAGLSLRRNLAWDAGTGNGQAAIGVADQYDRVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S   L+FA   P V +  TPP+MT  E+   +G E+SVDL+T+A A+HWF LP+FY 
Sbjct  61   TDVSETMLKFATPHPKVTYHHTPPSMTDEEMLDLIGGENSVDLITVATAVHWFDLPSFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPE-VSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDF  399
                +L+KP G+IA W Y     V+   DS+  R++     + + P  +     Y+T+ F
Sbjct  121  LATRLLRKPGGIIAVWSYSTEMVVNPDFDSVLSRFHDQTLPYCKFPQAQYFLDGYKTLPF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ V       P E + +K +  E     +RS S  +TAK KGV++L  ++V++   AW
Sbjct  181  PFESVGFGSEGEPVELEMKKTVSFEGLLRMLRSWSSVETAKQKGVDLLPENVVKELETAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKVG  153
               G  + +V +  ++ +G VG
Sbjct  241  GGVGLVRTVV-YKSFMLVGTVG  261



>emb|CDY40123.1| BnaC02g00070D [Brassica napus]
Length=261

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/262 (37%), Positives = 137/262 (52%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y + RP YP + F  +A  T  H L WD  TG GQAA+++ + Y+ V+ 
Sbjct  1    MAGLFDKQADLYLDARPNYPSEWFSKLAGLTDHHVLAWDAATGNGQAALAVADHYERVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P + +  TP  MT  EL   +G ESSVDL+T+AQA+HWF L  FY 
Sbjct  61   TDISEPQLKLATPHPKIDYRHTPSTMTDDELVELIGGESSVDLITVAQAVHWFDLSRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDFP  396
              K VL+KP G+IA W Y+   VS   D +  R++     +W+ P  + V   Y  + FP
Sbjct  121  VAKRVLRKPGGIIAVWGYNDVVVSPEFDEVQYRFHAQTLPYWKYPNIQHVFDAYGALPFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ V       P   +  K    E      +S S   TA+ KGVE+L   LV++   AW 
Sbjct  181  FESVGMGSEGEPLMLEMPKTTSFEGIVRMFKSWSALVTAREKGVELLPESLVKELETAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
                 + +V +  ++  GKV +
Sbjct  241  GADLIRNVV-YKAFMIAGKVSV  261



>ref|NP_001131999.1| hypothetical protein [Zea mays]
 ref|XP_008655179.1| PREDICTED: uncharacterized protein LOC100381876 isoform X1 [Zea 
mays]
 gb|ACF80659.1| unknown [Zea mays]
 gb|AFW83749.1| hypothetical protein ZEAMMB73_337529 [Zea mays]
Length=262

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 146/260 (56%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ KQ + Y++ RP YP++ F  +AS T  H   WD G GTGQAA+S+ E Y++VV 
Sbjct  1    MAGLYEKQSETYAKKRPQYPKEWFSMLASLTAGHQRAWDAGCGTGQAAISMAEHYESVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR++ TP +++  EL + VG E S+DLV +A ++HWF +P FY 
Sbjct  61   TDVSEGQLRHATAHPKVRYLHTPEHLSEDELVSLVGGEGSLDLVVVATSIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V   L+KP G++A W Y++ E+    D+++ + Y   + + +P   L  ++YR++ FPF
Sbjct  121  VVSRALRKPGGMLAVWGYNY-EIHPFEDALHGQLYPALRPYLDPRAGLAMERYRSLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA+ KGV  E ++   ++     W
Sbjct  180  EPVGVGAEGAPADVDIEVEMTLEDLVGFLNTGSVVTTARAKGVDLEAVTRAALKRVEEQW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
                   + + F  ++  G+
Sbjct  240  GGAPTVPRKLVFKAFMLAGR  259



>emb|CDM83614.1| unnamed protein product [Triticum aestivum]
Length=261

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 144/260 (55%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y++ RP YP++ F  +AS T  H   WD G G+GQA++S+ E Y  VV 
Sbjct  1    MAGLYEKPSETYAKKRPRYPKEWFSMLASLTAGHHRAWDAGCGSGQASVSIAEHYDGVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR++ TP ++   +L A VG E S+DLV +A A+HWF +P FY 
Sbjct  61   TDVSEGQLRHAIAHPKVRYLHTPEDLPEDDLVALVGGEGSLDLVIVATAIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GV+A W Y++ ++    D ++   Y   + + +P  +L  ++YR + FPF
Sbjct  121  VVNRVLRKPGGVLAVWGYNY-DIHPFGDKLHGTLYPAMRPYMDPRTRLAMERYRELPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA+ KGV  E L   ++++    W
Sbjct  180  EPVGVGREGEPADVDMEAEMTLEDLAGFVMTGSVATTAREKGVDLEALVKGVMKEVEEGW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
             ++    + + F  ++  G+
Sbjct  240  GDEPTVPRKLVFKAFMLAGR  259



>ref|XP_003569687.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brachypodium 
distachyon]
Length=261

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 143/261 (55%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MADL+ K  + Y++ RP YP++ F  +AS T  H   WD G G+GQA++S+ E Y +VV 
Sbjct  1    MADLYEKPSETYAKKRPRYPKEWFSMLASLTAGHHRAWDAGCGSGQASVSIAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+     P VR++ TP  +T   L A VG E S+DLV +A A+HWF +P FY 
Sbjct  61   TDVSEAQLRHGIAHPRVRYLHTPEGLTEDGLVALVGGERSLDLVIVATAIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V   LKKP GV+A W Y++ ++    D +  R Y   + + +P  +L  ++YR + FPF
Sbjct  121  VVSRALKKPGGVLAVWGYNY-DIRPFEDKLQGRLYAAARAYMDPRTRLAMERYRGLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M L+    ++ + S   TA+ +GV  E L   ++++    W
Sbjct  180  EPVGVGREGEPADVDMEVEMTLDDLAGFVMTGSVATTAREQGVDLEALVKGVMKEVEEEW  239

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
             +     + + F  ++  GK+
Sbjct  240  GDQPTVPRKLVFKAFMLAGKL  260



>ref|XP_010427085.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=310

 Score =   177 bits (450),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 141/259 (54%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L   + K Y + RP YP   +  IA++T  H L WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSENEAKAYLDARPRYPIDWYKKIAARTQDHKLAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP  M+  E+ A +G E+SVDL+  AQA+H+F L TFY 
Sbjct  61   TDINEAQLKRAIKHSRISYHHTPITMSEDEMVALIGGENSVDLIVAAQAVHFFDLTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  +D I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAVWVYNDIVISPEIDPIMKRLVDSTLPFRTPIMNLASDGYKTLMFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  ++RS      AK KGVE+++ DL+  F  AW +
Sbjct  181  ESIGMGSEGKPITLDIPHKLSLKGFIGFLRSWQPAMKAKEKGVELINEDLMTKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ENQV-KDVFYKAHMIVGKI  258



>ref|XP_002456250.1| hypothetical protein SORBIDRAFT_03g032930 [Sorghum bicolor]
 gb|EES01370.1| hypothetical protein SORBIDRAFT_03g032930 [Sorghum bicolor]
Length=262

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 145/260 (56%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y++ RP YP++ F  +A  T  H   WD G GTGQAA+S+ E Y++VV 
Sbjct  1    MAGLYEKPSETYAKKRPQYPKEWFSMLAGLTAGHQRAWDAGCGTGQAAISMAEHYESVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR++ TP ++T  EL + VG E S+DLV +A ++HWF +P FY 
Sbjct  61   TDVSEGQLRHAAAHPKVRYLHTPEHLTEDELVSLVGGEGSLDLVVVATSIHWFDIPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V   L+KP GV+A W Y++ E+     +++ + Y   + + +P   L  ++YR + FPF
Sbjct  121  VVNRALRKPGGVLAVWGYNY-EIHPFEGALHGQLYPALRPYQDPRAVLAMERYRHLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA+ KGV  E ++ D ++   + W
Sbjct  180  EPVGVGAEGAPADVDIEVEMTLEDLVGFLNTGSVVTTARAKGVDLEAVTRDALKRVEQEW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
                 + + + F  ++  G+
Sbjct  240  GGAPTSPRKLVFKAFMLAGR  259



>ref|XP_010527066.1| PREDICTED: uncharacterized protein LOC104804454 [Tarenaya hassleriana]
 ref|XP_010527067.1| PREDICTED: uncharacterized protein LOC104804456 [Tarenaya hassleriana]
Length=260

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 97/258 (38%), Positives = 140/258 (54%), Gaps = 1/258 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  KQ + Y   RP YP + +  +A+ T  H +VWDVG G GQAA+ + E Y  VV 
Sbjct  1    MAALSDKQAEAYLHARPRYPSEWYGKLAALTAEHKVVWDVGCGNGQAAVGVAEYYDKVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P V +  TP +M+  EL A VG E+SVDL+  AQA+H+F    FY 
Sbjct  61   TDISELQLKRAFKHPKVTYHHTPASMSDDELVALVGGENSVDLIVAAQAVHFFDTARFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+KP G+IA W Y+   +S  VD I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  IAKRVLRKPGGLIAVWVYNDLIISPEVDPIMKRVVDSTFPFRTPIMNLAFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        + L+ +  ++RS      AK +GVE+++ DL+++F  AW +
Sbjct  181  ESVGMGSEGEPIALDIPHKLSLKGFVGFLRSWQPAVKAKEQGVELITDDLIKEFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGK  159
            D   + +  +  Y+ +GK
Sbjct  241  DEPVRNVF-YKAYMIVGK  257



>gb|KFK35320.1| hypothetical protein AALP_AA5G269000 [Arabis alpina]
Length=261

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 141/262 (54%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + +MA L   Q K+Y   RP YP Q +  +AS+T  H + WDVGTG GQAA+ + E Y+ 
Sbjct  1    MAQMAALTETQAKEYMNARPKYPTQWYRVLASRTTDHKVAWDVGTGNGQAALGVAEYYQK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD +  Q+  A     V ++ TP +M+  +L A +G E+S+DL+ +AQ+LH+F L  
Sbjct  61   VVATDINEKQIALAKPHSKVTYIHTPTSMSDDDLVAKLGGENSIDLIVVAQSLHYFDLSR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY   K VL+K  GVIAAW Y+   V+  VDSI +R   +   +      L    Y+ ++
Sbjct  121  FYSIAKLVLRKQGGVIAAWVYNDLMVTPKVDSIMKRLVDSTIPYRTATMNLAFDGYKKLE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  +       P        + L+ Y  + +S      AK +G E+L+  ++ +F  A
Sbjct  181  FPFKDIRLGTQGRPKALNIPHKLSLDGYLGFFKSWQPLVKAKEQGQELLTPSIINEFKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W  D K  K V++  Y+  GK+
Sbjct  241  WG-DHKQVKDVSYKAYMLAGKL  261



>emb|CDY69664.1| BnaAnng31160D [Brassica napus]
 emb|CDY62656.1| BnaAnng18260D [Brassica napus]
 emb|CDX76165.1| BnaA04g04290D [Brassica napus]
Length=310

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 142/259 (55%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   +  IA++T  H   WDVGTG+G+AA+ L E Y+NVV 
Sbjct  1    MAALSEKEAEAYLDARPRYPMDWYKKIAAQTQDHKFAWDVGTGSGEAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A N   + +  TP NM+  E+ A VG E+S+DL+  AQA+H+F L TFY 
Sbjct  61   TDINEAQLKRAVNHSRISYHHTPKNMSEDEVVALVGGENSIDLIVAAQAVHFFDLTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  VD I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  IAKRVLRKEGGLIAIWVYNDIIISPEVDPIMKRLVDSTLPFRTPIMNLAFDSYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
              V       P        + L+ +  ++RS      AK +GVE+++ DL+  F   W +
Sbjct  181  KSVGMGSEGKPVTLDIPHKLSLKGFIGFLRSWQPAMKAKEQGVELVNEDLINKFEETWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ENQV-KDVFYKAHMIVGKI  258



>ref|NP_001044071.1| Os01g0716500 [Oryza sativa Japonica Group]
 dbj|BAB89823.1| embryonic abundant protein-like [Oryza sativa Japonica Group]
 dbj|BAF05985.1| Os01g0716500 [Oryza sativa Japonica Group]
 dbj|BAG95072.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55301.1| hypothetical protein OsJ_03255 [Oryza sativa Japonica Group]
Length=263

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 149/265 (56%), Gaps = 4/265 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ +  + Y++ RP YP   F  +A+ T  H   WD G GTGQA++S+ E Y +VV 
Sbjct  1    MAGLYERPSETYTKKRPRYPDAWFSKLAALTAGHHRAWDAGCGTGQASISIAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q++ A   P VR++ TP +++  +L A VG E S+DLV +A ++HWF +P FY 
Sbjct  61   TDASEGQIRHAVAHPKVRYLHTPVDLSEDDLVAMVGGEGSLDLVVVATSIHWFDIPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
                VLK+P GV+A W Y++ E+    D ++ + Y   + + +P  +L   +YR + FPF
Sbjct  121  VANRVLKRPGGVLAVWGYNY-EIHPFEDKLHGQLYPAMRPYMDPRTRLAMDRYRDLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M L+    ++++ S   TA+ KGV  E ++ D+++     W
Sbjct  180  EPVGVGREGEPADVDIEVDMTLDDLVGFLKTGSVVTTAREKGVDLEAVTKDVMKGVEAEW  239

Query  218  NEDGKTQKIVAFPIYLRIGKVGILD  144
             +    +K+V F  ++  GK  +L+
Sbjct  240  GDPAVARKLV-FKAFMLAGKPKVLN  263



>ref|XP_009139261.1| PREDICTED: uncharacterized protein LOC103863257 [Brassica rapa]
Length=368

 Score =   177 bits (449),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 146/268 (54%), Gaps = 1/268 (0%)
 Frame = -1

Query  959  EKYTEELKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSL  780
            +K  ++  KMA L  K+ + Y + RP YP   +  IA++T  H   WDVGTG+GQAA+ L
Sbjct  50   KKTRDKENKMAALSEKEAEAYLDARPRYPMDWYKKIAAQTQDHKFAWDVGTGSGQAAIGL  109

Query  779  GEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALH  600
             E Y+NVV TD +  QL+ A     + +  TP NM+  E+ A VG E+S+DL+  AQA+H
Sbjct  110  VEHYENVVATDINEAQLKRAVKHSRISYHHTPKNMSEDEVVALVGGENSIDLIVAAQAVH  169

Query  599  WFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQ  420
            +F L TFY   K VL+K  G+IA W Y+   +S  VD I +R   +   F  P   L   
Sbjct  170  FFDLTTFYNIAKRVLRKEGGLIAIWVYNDIIISPEVDPIMKRLVDSTLPFRTPIMNLAFD  229

Query  419  KYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLV  240
             Y+T+ FPF  V       P        + L+ +  ++RS      AK +GVE+++ DL+
Sbjct  230  SYKTLPFPFKSVGMGSEGKPVTLDIPHKLSLKGFIGFLRSWQPAMKAKEQGVELVNEDLI  289

Query  239  QDFTRAWNEDGKTQKIVAFPIYLRIGKV  156
              F   W ++ +  K V +  ++ +GK+
Sbjct  290  NKFEETWGDENQV-KDVFYKAHMIVGKI  316



>emb|CDX71759.1| BnaC08g31150D [Brassica napus]
Length=261

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 88/262 (34%), Positives = 141/262 (54%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + +MA L  KQ  +Y   RP YP   +  +A +T  H + WDVGTG GQAA+ + + Y+ 
Sbjct  1    MAQMATLTAKQANEYLNARPKYPTIWYKVLAGRTSNHKVAWDVGTGNGQAALGVADYYEK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD +  Q+  A   P V ++ TP +M+  +L A +G E+S+DL+  AQ+LH+F L  
Sbjct  61   VVATDINEKQISLAKPHPKVTYLHTPASMSDDDLVAKLGGENSIDLIVAAQSLHYFDLKR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ VL+K  G+IA W Y+   V+  VD+I +R   + + +  P   L    Y+ I+
Sbjct  121  FYAIVRRVLRKEGGIIAVWVYNDLVVTPKVDAIMKRLVDSTKPYRTPTMNLAFDGYKAIE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  +       P   +    + L+ Y  + +S      AK +G E+L   ++ +F  A
Sbjct  181  FPFKNIRLGTQGRPKALEIPHKLSLDGYLGFFKSWQPLVKAKEQGAELLKPSMINEFKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W +  +  K VA+  ++  GK+
Sbjct  241  WGDQNQV-KDVAYRAFMLAGKL  261



>ref|XP_006403611.1| hypothetical protein EUTSA_v10010557mg [Eutrema salsugineum]
 gb|ESQ45064.1| hypothetical protein EUTSA_v10010557mg [Eutrema salsugineum]
Length=314

 Score =   175 bits (444),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 141/259 (54%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   +  IA++T  H   WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MASLSEKEAEAYLDARPRYPIDWYKKIAARTLDHKFAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL  A     + +  TP NM+  E+ A +G E+S+DL+  AQA+H+F L TFY 
Sbjct  61   TDINEAQLTRAIKHSRISYHHTPKNMSEDEMVALIGGENSMDLIVAAQAVHFFDLTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  +D I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAVWVYNDIIISPEIDPIMKRLVDSTLPFRTPIMNLAFDSYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  ++RS      AK +GVE+++ DL+  F  AW +
Sbjct  181  ESIGMGSEGKPITLDIPHKLSLKGFLGFLRSWQPAMKAKEQGVELVNEDLITKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ENQV-KDVYYKAHMIVGKI  258



>ref|XP_006644622.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Oryza 
brachyantha]
Length=261

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 92/260 (35%), Positives = 146/260 (56%), Gaps = 4/260 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ +  + Y++ RP YP   F  +A+ T  H   WD G GTGQA++S+ E Y +VV 
Sbjct  1    MAGLYERPSETYAKKRPRYPDAWFARLAALTAGHHRAWDAGCGTGQASISIAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q++ A   P VR++ TP +++  +L A VG E S+DLV +A ++HWF +P FY 
Sbjct  61   TDVSEGQIRHAVPHPKVRYLHTPVDLSEDDLVALVGGEGSLDLVVVATSIHWFDIPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VLKKP GV+A W Y++ E+    D ++ + Y   + F +P  +L   +YR + FPF
Sbjct  121  VVNRVLKKPGGVLAVWGYNY-EIHPFEDKLHGQMYPAMRPFMDPRTRLAMDRYRDLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M L+    ++++ S   TA+ KGV  E +  D+++     W
Sbjct  180  EPVGVGREGEPADADIEVDMTLDDLVGFLKTGSVVTTAREKGVDLEAVIKDVMKRVEADW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
             +    +++V F  Y+  GK
Sbjct  240  GDPTVARRLV-FKAYMLAGK  258



>gb|EKD73604.1| hypothetical protein ACD_45C00253G0002 [uncultured bacterium]
Length=257

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 145/261 (56%), Gaps = 17/261 (7%)
 Frame = -1

Query  935  KMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVV  756
            K  + F  +   Y + RPTYP+ LF ++A+ T  HDLVWD GTGTGQAA++L   +K+++
Sbjct  2    KYTNHFADKSGDYGKFRPTYPEALFHYLANLTTDHDLVWDCGTGTGQAAIALAHYFKHII  61

Query  755  GTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
             TD +  QL  AP   NV +            E    A +SVDLVT+AQALHWF LP+FY
Sbjct  62   ATDVNQAQLDAAPQKSNVHY-------QHCNAEQTPIATASVDLVTVAQALHWFDLPSFY  114

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYY--TTNQHFWEPGRKLVDQKYRTID  402
             +V  VL KP G+IAAWCY    ++  +D + Q+ Y  T    +W   R  +D++Y+TI 
Sbjct  115  TEVNRVL-KPTGIIAAWCYSLGHLTPDIDRLIQKLYADTLGDMYWPKERHYIDEEYKTIL  173

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+ +       P +F  +K M       Y+++ S  +  + +      S ++ D  R 
Sbjct  174  FPFNKM-----TAP-KFTIEKRMNFADLLGYLQTWSALKEYQQRNHANPLSSIMSDLKRT  227

Query  221  WNEDGKTQKIVAFPIYLRIGK  159
            W  + +T+  + +PI+L +G+
Sbjct  228  WG-NPETEYTMIWPIHLLVGQ  247



>dbj|BAK01848.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   173 bits (439),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 90/260 (35%), Positives = 140/260 (54%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y+E RP YP++ F  +AS T  H   WD G G+GQA++S+ E Y  VV 
Sbjct  1    MAGLYEKPSETYAEKRPRYPEEWFSKLASLTAGHRRAWDAGCGSGQASVSIAEHYDGVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR++ TP  +   EL A VG E S+DLV +A A+HWF +P FY 
Sbjct  61   TDVSEGQLRHAIAHPKVRYLHTPEGLPEDELVALVGGEGSLDLVVVATAIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V   LKKP GV+A W Y++ ++    + +    Y   + + +P  +L  ++Y  + FPF
Sbjct  121  VVNRALKKPGGVLAVWGYNY-DIHPFGEKLQGTLYPAMRPYMDPRTRLAMERYHELPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA+ +GV  E L  D++++    W
Sbjct  180  EPVGVGREGEPADVDMEAEMTLEDLAGFVMTGSVATTARERGVDLEALVKDVMKEMEEGW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
             +     + + F  ++  G+
Sbjct  240  GDLPTVPRKLVFKAFMLAGR  259



>gb|EMT27832.1| hypothetical protein F775_06435 [Aegilops tauschii]
Length=261

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 142/260 (55%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y++ RP YP++ F  +AS T  H   WD G G+GQA++S+ E Y +VV 
Sbjct  1    MAGLYEKPSETYAKKRPRYPKEWFSMLASLTAGHHRAWDAGCGSGQASLSIAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR++ TP ++   +L A VG E S+DLV +A A+HWF +P FY 
Sbjct  61   TDVSEGQLRHAIAHPKVRYLHTPEDLAEDDLVALVGGEGSLDLVIVATAIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             V  VL+KP GV+A W Y++ ++    D ++       + + +P  +L  ++YR + FPF
Sbjct  121  VVNRVLRKPGGVLAVWGYNY-DIHPFGDKLHGALCPAMRPYMDPRTRLAMERYRDLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGV--EILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA  KGV  E L   ++++    W
Sbjct  180  EPVGVGREGEPADVDMEAEMTLEDLAGFVMTGSVATTAGEKGVDLEALVKGVMKEVEEGW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
             +     + + F  ++  G+
Sbjct  240  GDRPTVPRKLVFKAFMLAGR  259



>ref|XP_004135059.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Cucumis 
sativus]
 gb|KGN52142.1| hypothetical protein Csa_5G611730 [Cucumis sativus]
Length=265

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/263 (34%), Positives = 146/263 (56%), Gaps = 4/263 (2%)
 Frame = -1

Query  932  MADLFLKQ--GKQYSEGRP-TYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            MAD + K+   ++Y EGRP +YP + +  +A+ T  H L  D GTG GQAA+ + E YK 
Sbjct  1    MADKYEKENLAEKYLEGRPRSYPAEWYSRLAALTAGHSLACDFGTGNGQAALGVAEHYKK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            V+G D S +QL+ A     V+++  P +M+  E+  ++G E++VDL+  A+A+HWF LP 
Sbjct  61   VIGIDVSKSQLECAMKHERVQYLHLPASMSEDEMVKSIGEENTVDLIISAEAVHWFDLPK  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFW-EPGRKLVDQKYRTI  405
            FY     +L+KP G+IA W Y +  ++ + D+   R       +W E  ++ V + YRT+
Sbjct  121  FYAVATRLLRKPGGIIAVWGYYYISLNEAFDAAMNRLTEATLPYWDEKVKEYVLKGYRTM  180

Query  404  DFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTR  225
             FPF+ V       P E + ++    E    Y++S     TAK  GV+++  ++V++   
Sbjct  181  PFPFESVGIGSEGKPEEMEMEQKFSFEGMLKYLKSMGPVITAKENGVDVMCEEMVKELRD  240

Query  224  AWNEDGKTQKIVAFPIYLRIGKV  156
            AW   G   + V +  ++  GKV
Sbjct  241  AWGGGGDLVRTVVYKCFMIAGKV  263



>ref|XP_002878371.1| hypothetical protein ARALYDRAFT_486597 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54630.1| hypothetical protein ARALYDRAFT_486597 [Arabidopsis lyrata subsp. 
lyrata]
Length=261

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/262 (35%), Positives = 142/262 (54%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + ++  L  KQ  +Y   RP YP   +  +A +T  H + WDVGTG GQAA+ + E Y+ 
Sbjct  1    MAQLVALSGKQADEYLNARPKYPTLWYKVLAGRTSNHKVAWDVGTGNGQAAIGVAEYYEK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD + +QLQ A   P V +  TP +M+  +L   +G E+S+D++  AQALH+F L  
Sbjct  61   VVATDINESQLQRAMKHPKVTYHHTPSSMSDDDLVTLLGGENSIDIIIAAQALHYFDLKR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  VK VL+K  G+IA W Y+   ++  VDSI +R   +   F  P   L    YRTI+
Sbjct  121  FYPIVKRVLRKQGGIIAVWVYNDLIITPKVDSIMKRLVDSTLPFRNPTMNLAFDGYRTIE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  +       P   +    + L  +  +++S      AK +G ++L+S ++ +F  A
Sbjct  181  FPFKNIRMGTQGRPKALEIPHKLSLNGFLGFLKSWQPLVKAKEQGEDLLTSCMIDEFKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W +D K  K V +  Y+  GK+
Sbjct  241  WGDD-KQVKNVFYKAYMLAGKL  261



>ref|XP_010448882.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=262

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/251 (38%), Positives = 135/251 (54%), Gaps = 3/251 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++  Q   Y + RPTYP   +  +A+ + RH+L WD GTG GQAA+ + E Y+ VV 
Sbjct  1    MSGVYDNQADIYLDARPTYPSDWYSKLAALSHRHNLAWDAGTGNGQAAIGIAEHYERVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANV-GAESSVDLVTIAQALHWFHLPTFY  576
            TD S   L      P V +  TP +MT  E+   + G ESSVDL+T+A A+HWF LP FY
Sbjct  61   TDVSETMLNLGKPHPKVTYHHTPSSMTEDEMVDLIGGGESSVDLITVATAVHWFDLPRFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFP-EVSSSVDSIYQRYYT-TNQHFWEPGRKLVDQKYRTID  402
                 +L+KP G+IA W Y+    VS   DS+  R+   T  +F  P  +     Y+T+ 
Sbjct  121  AVANRLLRKPGGIIAVWSYNNDMAVSPEFDSLMARFNAETLPYFKFPESRYFLDGYKTLP  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+ V       P E + +K M  E     +RS S    AK KGV++LS ++V++   A
Sbjct  181  FPFESVGLGSEGKPIELEMKKTMSFEGLLRILRSWSAVGAAKEKGVDLLSDNVVKELETA  240

Query  221  WNEDGKTQKIV  189
            W      + IV
Sbjct  241  WGGSELVRTIV  251



>ref|XP_010547882.1| PREDICTED: putative methyltransferase DDB_G0268948 [Tarenaya 
hassleriana]
Length=282

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 141/262 (54%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + ++A L  KQ   Y + RP YP + F  +A++TP H++ WDVGTG G  A+ + E Y+ 
Sbjct  1    MAQLASLSDKQADAYLDARPRYPAEWFRMLAARTPGHNVAWDVGTGNGHPAVGVAEYYEK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD + +QL+ A   P V +  TP +M   +L + VG E+SVDL+  AQA+H+F L  
Sbjct  61   VVATDINDSQLKRAIKHPRVAYHHTPASMPDDDLVSLVGGENSVDLIIAAQAVHYFDLGR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY   + VLKKP GVIA   Y+   VS  VD I  R   +   F  P   L    Y+T+ 
Sbjct  121  FYNIARRVLKKPGGVIAVCVYNRLIVSPEVDPIMDRLVDSTLPFRNPTMNLAFDGYKTLP  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+ +       P  F     + L  +  ++RS      AK +GVE+++  L++ F  A
Sbjct  181  FPFESIGLGSEGNPVPFNIPHKLSLNGFLGFLRSWQPVVKAKEQGVELVTPTLLRQFQAA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W  D +  K V +  Y+  GKV
Sbjct  241  WG-DQEQVKDVFYKAYMLAGKV  261



>ref|XP_006292735.1| hypothetical protein CARUB_v10018982mg [Capsella rubella]
 gb|EOA25633.1| hypothetical protein CARUB_v10018982mg [Capsella rubella]
Length=311

 Score =   174 bits (441),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/259 (37%), Positives = 139/259 (54%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K  K Y + RP YP   +  IA++T  H   WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSEKDAKAYLDARPRYPMDWYKKIAARTQGHKFAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  Q++ A     + +  +P  M+  E+ A VG E+SVDL+  AQA+H+F L TFY 
Sbjct  61   TDINEAQIKRAIKHSRISYHHSPITMSEDEMVALVGGENSVDLIVAAQAVHFFDLTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  VD I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAVWVYNDIIISPEVDPIMKRLVDSTLPFRTPIMNLAFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  ++RS      AK KGVE+++ DL+  F  AW +
Sbjct  181  ESIGMGSEGKPITLDIPHKLSLKGFIRFLRSWQPSMKAKEKGVELINEDLITKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
              +  K V +  ++ +GK+
Sbjct  241  KNQV-KDVFYKAHMIVGKI  258



>ref|NP_001130612.1| uncharacterized protein LOC100191711 [Zea mays]
 gb|ACG25931.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=275

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 143/260 (55%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y++ RP YP++ F  +A  T  H   WD G GTGQAA+ + E Y++VV 
Sbjct  1    MAGLYEKPSETYAKKRPQYPKEWFSMLAGLTAGHQRAWDAGCGTGQAAIGMAEHYESVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q+Q A   P VR++ TP +++  E+ + VG E S+DLV +A ++HWF +P FY 
Sbjct  61   TDVSEGQIQHAIAHPKVRYLQTPEHLSEDEVVSLVGGEGSLDLVVVATSIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK  L+KP GV+A W Y++ E+    D+++ + Y   + + +P   L  ++YR + FPF
Sbjct  121  VVKRALRKPGGVLAVWGYNY-EIHPFEDALHGQLYPALRPYQDPRAVLAMERYRCLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKG--VEILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA+ KG  +E +  D ++     W
Sbjct  180  EPVGVGAEGAPADVDMEVEMTLEDLVGFLNTGSVVTTARAKGADLEAVCRDALKRVEDEW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
                   + + F  ++  G+
Sbjct  240  AGAPTVPRKLVFKAFMLAGR  259



>gb|ACF78902.1| unknown [Zea mays]
 tpg|DAA57872.1| TPA: hypothetical protein ZEAMMB73_630429 [Zea mays]
Length=275

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 143/260 (55%), Gaps = 3/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y++ RP YP++ F  +A  T  H   WD G GTGQAA+ + E Y++VV 
Sbjct  1    MAGLYEKPSETYAKKRPQYPKEWFSMLAGLTAGHQRAWDAGCGTGQAAIGMAEHYESVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  Q+Q A   P VR++ TP +++  E+ + VG E S+DLV +A ++HWF +P FY 
Sbjct  61   TDVSEGQIQHAIAHPKVRYLQTPEHLSEDEVVSLVGGEGSLDLVVVATSIHWFDVPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK  L+KP GV+A W Y++ E+    D+++ + Y   + + +P   L  ++YR + FPF
Sbjct  121  VVKRALRKPGGVLAVWGYNY-EIHPFEDALHGQLYPALRPYQDPRAVLAMERYRCLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKG--VEILSSDLVQDFTRAW  219
            +PV       P +   +  M LE    ++ + S   TA+ KG  +E +  D ++     W
Sbjct  180  EPVGVGAEGAPADVDMEVEMTLEDLVGFLNTGSVVTTARAKGADLEAVCRDALKRVEDEW  239

Query  218  NEDGKTQKIVAFPIYLRIGK  159
                   + + F  ++  G+
Sbjct  240  AGAPTVPRKLVFKAFMLAGR  259



>ref|XP_004969753.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Setaria 
italica]
Length=265

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/263 (33%), Positives = 146/263 (56%), Gaps = 6/263 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L+ K  + Y++ RP YP++ F  +A  T  H   WD G G+GQAA+S+ E Y++VV 
Sbjct  1    MAGLYEKPSETYAKKRPRYPKEWFSMLAGLTAGHHRAWDAGCGSGQAAISMAEHYESVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR+V TP +++  EL A VG + S+DL+ +A ++HWF +P FY 
Sbjct  61   TDVSEGQLRNAMAHPRVRYVHTPEHLSEDELVALVGGDGSLDLIVVATSIHWFDIPLFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLV-DQKYRTIDFP  396
                 L+KP GV+A W Y++ E+    D++  + Y   + + +P  +L  + +YR++ FP
Sbjct  121  VANRALRKPGGVLAVWGYNY-EIHPFEDALQGQLYAALRPYQDPRARLATEDRYRSLPFP  179

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKG----VEILSSDLVQDFT  228
            F+PV       P +   +  M LE    ++ + S   TA+ KG    +E +  D+++   
Sbjct  180  FEPVGVGAEGAPADVDMEVEMTLEDLAGFVMTGSVVTTAREKGAGEEMEAVVRDVMRRVE  239

Query  227  RAWNEDGKTQKIVAFPIYLRIGK  159
              W +     + +AF  ++  G+
Sbjct  240  EKWGDAPTVPRKLAFKAFMLAGR  262



>ref|XP_010434039.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=262

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 97/262 (37%), Positives = 139/262 (53%), Gaps = 4/262 (2%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++  Q   Y + RPTYP   +  +A+ + RH+L WD GTG GQAA+ + E Y+ VV 
Sbjct  1    MSGVYDNQADIYLDARPTYPSDWYSKLAALSHRHNLAWDAGTGNGQAAIGIAEHYERVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANV-GAESSVDLVTIAQALHWFHLPTFY  576
            TD S   L      P V +  TP  MT  E+   + G ESSVDL+T+A A+HWF LP FY
Sbjct  61   TDVSETMLNLGKPHPKVTYHHTPSTMTEDEMVDLIGGGESSVDLITVATAVHWFDLPRFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSS-SVDSIYQRYYT-TNQHFWEPGRKLVDQKYRTID  402
                 +L+KP G+IA W Y+   V S   DS+  R+   T  +F  P  +     Y+T+ 
Sbjct  121  AVANRLLRKPGGIIAVWSYNNDMVVSPEFDSLMARFNAETLPYFKFPECQYFLDGYKTLT  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF+ V       P E + +K M  E     +RS S    AK KGV++LS ++V++   A
Sbjct  181  FPFESVGLGSEGKPIELEMKKTMSFEGLLRILRSWSAVGAAKEKGVDLLSDNVVKELETA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W      + IV +  ++  G V
Sbjct  241  WGGSELVRTIV-YKTFMLAGTV  261



>ref|NP_193984.1| S-adenosyl-L-methionine-dependent methyltransferase domain-containing 
protein [Arabidopsis thaliana]
 emb|CAA22158.1| putative protein [Arabidopsis thaliana]
 emb|CAB79208.1| putative protein [Arabidopsis thaliana]
 gb|AAN13034.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84618.1| S-adenosyl-L-methionine-dependent methyltransferase domain-containing 
protein [Arabidopsis thaliana]
Length=261

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 140/261 (54%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++  Q   Y + RPTYP   +  +A+ + RH+L WD GTG GQAA+ + E Y+ VV 
Sbjct  1    MSGVYDSQADIYLDARPTYPADWYSKLAALSHRHNLAWDAGTGNGQAAIGIAEHYERVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S   L      P V +  TP +MT  E+   +G E+SVDL+T+A A+HWF LP FY 
Sbjct  61   TDVSETMLNLGKPHPKVTYHHTPSSMTEDEMVDLIGGENSVDLITVATAVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSS-SVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDF  399
                +L+KP G+IA W Y+   V +   DS+  R+      + + P  +     Y+T+ F
Sbjct  121  IANRLLRKPGGIIAVWSYNTDMVVNPEFDSVMTRFIAETLPYCKFPESQYFLDGYKTLPF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ V       P E + +K +  E +   +RS S    AK KGV++LS ++V++   AW
Sbjct  181  PFESVGLGSEGKPMELEMKKTVSFEGFLRMLRSWSAVGAAKEKGVDLLSDNVVKELETAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
                  + IV +  ++  G V
Sbjct  241  GGYELVRTIV-YKTFMLAGTV  260



>ref|XP_006413651.1| hypothetical protein EUTSA_v10026009mg [Eutrema salsugineum]
 gb|ESQ55104.1| hypothetical protein EUTSA_v10026009mg [Eutrema salsugineum]
Length=262

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/261 (36%), Positives = 139/261 (53%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++  Q   Y + RPTYP   +  +A+ + RH L WD GTG GQAA+ + E Y  VV 
Sbjct  1    MSGVYDNQADIYLDARPTYPADWYSKLAALSHRHHLAWDAGTGNGQAAIGIAEHYDRVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S   L        V +  TPP+MT  E+   +G E+SVDL+T+A A+HWF LP FY 
Sbjct  61   TDVSETMLNLGKPHLKVTYHHTPPSMTDDEMVNLIGGENSVDLITVATAVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPE-VSSSVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDF  399
                +L+KP G+IA W Y+    VS   DS+  R+      +++ P        Y+T+ F
Sbjct  121  IANRLLRKPGGIIAVWSYNTDMVVSPEFDSVMTRFNEKTTPYYKFPECHYFLDGYKTLPF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ V       P E + +K +  E +   +RS S    AK+KGV++LS ++V++   AW
Sbjct  181  PFENVGLGSEGKPMELEMKKTVSFEGFLRMLRSWSAVGAAKDKGVDLLSENVVKELETAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
                  + IV +  ++  G V
Sbjct  241  GGSELVRTIV-YKTFMLAGTV  260



>ref|XP_002877960.1| hypothetical protein ARALYDRAFT_485812 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54219.1| hypothetical protein ARALYDRAFT_485812 [Arabidopsis lyrata subsp. 
lyrata]
Length=311

 Score =   172 bits (436),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 139/258 (54%), Gaps = 1/258 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   +  IA++T  H   WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSEKEAEAYLDARPRYPIDWYKKIAARTLDHKFAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP  ++  E+ A VG E+SVDL+  AQA+H+F L TFY 
Sbjct  61   TDINEAQLKRAIKHSRISYHHTPTTISEDEMVALVGGENSVDLIVAAQAVHFFDLTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
             VK VL+K  G+I  W Y+   +S  +D I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VVKRVLRKEGGLIVVWVYNDIIISPEIDPIMKRLVDSTLPFRTPIMNLAFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  ++RS      AK KGVE+++ DL+  F  AW +
Sbjct  181  EAIGMGSEGKPITLDIPHKLSLKGFIGFLRSWQPAMKAKEKGVELINEDLITKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGK  159
              +  K V +  ++ +GK
Sbjct  241  KNQV-KDVFYKAHMIVGK  257



>ref|XP_008675410.1| PREDICTED: putative methyltransferase DDB_G0268948 isoform X1 
[Zea mays]
 tpg|DAA58743.1| TPA: hypothetical protein ZEAMMB73_220969 [Zea mays]
Length=264

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 142/264 (54%), Gaps = 9/264 (3%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q   Y+  RP YP+ LF  +++ T  H   WDVGTG GQAA+ + E Y +VV 
Sbjct  1    MAGLFTEQAAVYAAARPAYPKDLFAKLSALTAHHRRAWDVGTGNGQAAIGVAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFV----CTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLP  585
            TD S  QL+ A   P VR++     TP    L  +    G E+SVDL+T+AQA+HWF LP
Sbjct  61   TDVSAEQLRHATPHPKVRYLHTRDATPGEEDLVAMLG--GGEASVDLITVAQAVHWFDLP  118

Query  584  TFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTI  405
             FY   + VL++P GVIA W Y++    S V+ +  R+++T   +W+P  +     YR +
Sbjct  119  AFYGAARRVLRRPGGVIAVWGYNYR--VSPVEDMMARFFSTTLPYWDPRARYCTDGYRDL  176

Query  404  DFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTR  225
             FPF+ +   +   P     +  M  E     +RS S   TAK +GV++L + +V++   
Sbjct  177  PFPFEDIGLGKEGEPASLDVEHEMSFEGLIGMLRSWSAVTTAKQQGVDLLGARVVKELEE  236

Query  224  AWNEDGKTQKIVAFPIYLRIGKVG  153
             W      +K V +  +L  G  G
Sbjct  237  GWGGAELVRK-VTYKAFLLAGTPG  259



>ref|NP_191680.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 emb|CAB71051.1| putative protein [Arabidopsis thaliana]
 dbj|BAC43122.1| unknown protein [Arabidopsis thaliana]
 gb|AEE80173.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=261

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/262 (34%), Positives = 143/262 (55%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + ++A L  KQ  +Y   RP YP   +  +A +T  H + WDVGTG GQAA+ + E Y+ 
Sbjct  1    MAQLAALSGKQADEYLNARPKYPTIWYKVLAGRTSNHKVAWDVGTGNGQAAIGVAEYYQK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD + +QLQ A   P V +  TP +M+  +L   +G E+S+D++  AQALH+F L  
Sbjct  61   VVATDINESQLQRAMKHPKVTYYHTPSSMSDDDLVTLLGGENSIDIIIAAQALHYFDLKR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  VK VL+K  G+I  W Y+   ++  VDSI +R   +   +  P   L    Y+TI+
Sbjct  121  FYPIVKRVLRKQGGIIVVWVYNDLIITPKVDSIMKRLVDSTLPYRNPTMNLAFDGYKTIE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  +       P       ++ L+ +  +++S      AK +G ++L+S ++ +F  A
Sbjct  181  FPFKNIRMGTQGRPKALDIPHMLSLDGFLGFLKSWQPLVKAKEQGEDLLTSYMIDEFKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W +D +  K V +  ++  GK+
Sbjct  241  WGDDEQV-KDVHYKAFMLAGKL  261



>ref|XP_006402507.1| hypothetical protein EUTSA_v10006178mg [Eutrema salsugineum]
 gb|ESQ43960.1| hypothetical protein EUTSA_v10006178mg [Eutrema salsugineum]
Length=261

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 141/262 (54%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + +MA L   Q   Y   RP YP   +  +A +T  H + WDVGTG GQAA+ + + Y+ 
Sbjct  1    MAQMAALTKHQANDYLNARPKYPTVWYTVLAGQTSDHKMAWDVGTGNGQAAIGVAQYYQK  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD +  Q++ A     V ++ TP +M+  +L A +G E+S+DL+  AQ+LH+F L  
Sbjct  61   VVATDINEKQIELAKAHSKVTYIHTPASMSDDDLVAKLGGENSIDLIVAAQSLHYFDLKR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ VL+K  G+IA W Y+   V+  VD I +R   +   +  P   L  + Y+TI+
Sbjct  121  FYSIVRRVLRKQGGIIAVWVYNDLIVTPKVDYIMKRLVDSTIPYRNPTMNLAFEGYKTIE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  V       P   +    + L+ +  +++S      AK KGVE+L+  ++ +   A
Sbjct  181  FPFKNVGLGTQGSPKAHEIPHKLSLDGFIGFLKSWQPLLKAKEKGVELLTPCIINEIKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W  D K  K V++  Y+  GK+
Sbjct  241  WG-DHKQVKDVSYKAYMLAGKL  261



>ref|NP_190983.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 emb|CAB70989.1| embryonic abundant protein-like [Arabidopsis thaliana]
 gb|AAL36422.1| putative embryonic abundant protein [Arabidopsis thaliana]
 gb|AAM20016.1| putative embryonic abundant protein [Arabidopsis thaliana]
 dbj|BAD43297.1| embryonic abundant protein -like protein [Arabidopsis thaliana]
 gb|AEE79193.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=323

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/259 (36%), Positives = 139/259 (54%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   F  IA++T  H   WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSEKEAEAYLDARPRYPIDWFKKIAARTQDHKFAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QLQ A     + +  TP  ++  E+   +G E+SVDL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLQRAIKHSRISYHHTPTTISEDEMVDLLGGENSVDLIVAAQAVHFFDLNVFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  +D I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAVWVYNDIIISHEIDPIMKRLVDSTLPFRTPIMNLAFDGYKTLTFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  ++RS      AK KGVE+++ DL+  F  AW +
Sbjct  181  ETIGMGSEGKPITLDIPHKLSLKGFIGFLRSWQPAMKAKEKGVELINEDLITKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ETQV-KDVFYKAHMIVGKI  258



>emb|CDY13187.1| BnaC04g26480D [Brassica napus]
Length=318

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 140/259 (54%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   +  IA++T  H   WDVGTG+GQAA+ L E Y+NVV 
Sbjct  1    MAALSEKEAEAYLDARPRYPMDWYKKIAARTQDHKFAWDVGTGSGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP +M   E+ A +G E+SVDL+  AQA+H+F   TFY 
Sbjct  61   TDINEAQLKRAVKHSRISYHHTPKHMAEDEMVALLGGENSVDLIVAAQAVHFFDTTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +SS +D I +    +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAIWVYNDIVISSEIDPIMKILVDSTLPFRTPIMNLAFDSYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  ++RS      AK +GVE+++ DL+  F  AW +
Sbjct  181  ESIGMGSEGKPVRLDIPHKLSLKGFIGFLRSWQPAMKAKEQGVELVNEDLINKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +   +  +  ++ +GK+
Sbjct  241  ENQVNDVF-YKAHMIVGKI  258



>ref|XP_004159284.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Cucumis 
sativus]
Length=267

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 147/265 (55%), Gaps = 6/265 (2%)
 Frame = -1

Query  932  MADLFLKQ--GKQYSEGRP-TYPQQLFDFIASKTPRHDLVWDVGTGTG--QAAMSLGEKY  768
            MAD + K+   ++Y EGRP +YP + +  +A+ T  H L  D GTGTG  QAA+ + E Y
Sbjct  1    MADKYEKENLAEKYLEGRPRSYPAEWYSRLAALTAGHSLACDFGTGTGNGQAALGVAEHY  60

Query  767  KNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHL  588
            K V+G D S +QL+ A     V+++  P +M+  E+  ++G E++VDL+  A+A+HWF L
Sbjct  61   KKVIGIDVSKSQLECAMKHERVQYLHLPASMSEDEMVKSIGEENTVDLIISAEAVHWFDL  120

Query  587  PTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFW-EPGRKLVDQKYR  411
            P FY     +L+KP G+IA W Y +  ++ + D+   R       +W E  ++ V + YR
Sbjct  121  PKFYAVATRLLRKPGGIIAVWGYYYISLNEAFDAAMNRLTEATLPYWDEKVKEYVLKGYR  180

Query  410  TIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDF  231
            T+ FPF+ V       P E + ++    E    Y++S     TAK  GV+++  ++V++ 
Sbjct  181  TMPFPFESVGIGSEGKPEEMEMEQKFSFEGMLKYLKSMGPVITAKENGVDVMCEEMVKEL  240

Query  230  TRAWNEDGKTQKIVAFPIYLRIGKV  156
              AW   G   + V +  ++  GKV
Sbjct  241  RDAWGGGGDLVRTVVYKCFMIAGKV  265



>ref|XP_006392638.1| hypothetical protein EUTSA_v10011654mg [Eutrema salsugineum]
 gb|ESQ29924.1| hypothetical protein EUTSA_v10011654mg [Eutrema salsugineum]
Length=284

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/262 (36%), Positives = 141/262 (54%), Gaps = 2/262 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K    Y   RP YP   F  +A++T +H L WDVGTG GQAA+ L E ++ VV 
Sbjct  1    MAALSDKLADAYQNARPRYPIDWFTKLAARTGQHKLAWDVGTGNGQAAIGLAEYFEKVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP  M+  ++ A VG ++SVDL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLKRAVKHERISYHHTPTTMSEDQMVALVGGDNSVDLIVAAQAVHYFDLAPFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  VD+I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  ITKRVLRKEGGLIAVWVYNDLVISPEVDAIMKRLVDSTFPFRTPIMNLAFDGYKTLPFPF  180

Query  392  DPVDGCEHNG-PYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            + V G    G P        + L+ +  ++RS      AK +GVE+++ DL+  F  AW 
Sbjct  181  EGVKGMGCEGKPITLDIPHKLSLKGFIGFLRSWQPAMKAKERGVELVTEDLINRFEEAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKVGI  150
            +D   + I  +  ++ +GK+ +
Sbjct  241  DDDDVKDIF-YKAHMIVGKLSV  261



>ref|XP_010439329.1| PREDICTED: putative methyltransferase DDB_G0268948 [Camelina 
sativa]
Length=262

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/270 (36%), Positives = 141/270 (52%), Gaps = 20/270 (7%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++  Q   Y + RPTYP   +  +A+ + RH+L WD GTG GQAA+ + E Y  VV 
Sbjct  1    MSGVYDNQADIYLDARPTYPSDWYSKLAALSHRHNLAWDAGTGNGQAAIGIAEHYDRVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANV-GAESSVDLVTIAQALHWFHLPTFY  576
            TD S   L      P V +  TP +MT  E+   + G ESSVDL+T+A A+HWF LP FY
Sbjct  61   TDVSETMLNLGKPHPKVTYHHTPSSMTEDEMVNLIGGGESSVDLITVATAVHWFDLPRFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSS-SVDSIYQRY---------YTTNQHFWEPGRKLV  426
                 +L+KP G+IA W Y+   V S   DS+  R+         ++ +Q+F +      
Sbjct  121  AVANRLLRKPGGIIAVWSYNNDMVVSPEFDSLMARFNAETLPYFKFSESQYFLD------  174

Query  425  DQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSD  246
               Y+T+ FPF+ V       P E + +K M  E     +RS S    AK KGV++LS +
Sbjct  175  --GYKTLPFPFESVGLGSEGKPIELEMKKTMSFEGLLRILRSWSAVGAAKEKGVDLLSDN  232

Query  245  LVQDFTRAWNEDGKTQKIVAFPIYLRIGKV  156
            +V++   AW      + IV +  ++  G V
Sbjct  233  IVKELETAWGGSELVRTIV-YKTFMLAGTV  261



>ref|XP_006285991.1| hypothetical protein CARUB_v10007518mg [Capsella rubella]
 gb|EOA18889.1| hypothetical protein CARUB_v10007518mg [Capsella rubella]
Length=261

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 139/261 (53%), Gaps = 3/261 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            M+ ++  Q   Y + RPTYP   +  +A+ + RH+L WD GTG GQAA+ + E Y+ VV 
Sbjct  1    MSGVYDSQADIYLDARPTYPTDWYSKLAALSHRHNLAWDAGTGNGQAAIGIAEHYERVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S   L      P V +  TP +MT  E+   +G E+SVDL+T+A A+HWF LP FY 
Sbjct  61   TDVSETMLNLGKPHPKVTYHHTPSSMTEDEMVDLIGGENSVDLITVATAVHWFDLPRFYA  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSS-SVDSIYQRYYTTNQHFWE-PGRKLVDQKYRTIDF  399
                +L+KP G+IA W Y+   V S   DS+  R+      + + P        Y+T+ F
Sbjct  121  IANRLLRKPGGIIAVWSYNTDMVVSPEFDSVIARFNAETLPYCKFPESDYFLGGYKTLPF  180

Query  398  PFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAW  219
            PF+ V       P E + +K +  E +   ++S S    AK KGV++LS ++V++   AW
Sbjct  181  PFESVGLGSEGKPIELEMKKTVSFEGFLRMLKSWSAVGAAKEKGVDLLSDNVVKELETAW  240

Query  218  NEDGKTQKIVAFPIYLRIGKV  156
                  + I+ +  ++  G V
Sbjct  241  GGPELVRTII-YKTFMLAGTV  260



>gb|KFK34661.1| hypothetical protein AALP_AA5G175100 [Arabis alpina]
Length=309

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 94/258 (36%), Positives = 142/258 (55%), Gaps = 2/258 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   +  IA++T  H L WDVGTG GQAA+ L E Y+NV+ 
Sbjct  1    MAALSEKEAEAYLDARPRYPIDWYTKIAARTQDHKLAWDVGTGNGQAAIGLVEHYENVIA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP +M+  E+ A VG E+SVDL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLKRAIKHSRISYHHTPKDMSEDEMVALVGGENSVDLIVAAQAVHFFDLTIFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K +G+IA W Y+   +S  +D I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRK-EGLIAVWVYNDIIISPEIDPIMKRLVDSTLPFRTPIMNLAFDGYKTLPFPF  179

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        + L+ +  ++RS      AK +GVE+++ DL+  F  AW +
Sbjct  180  ENVGMGSEGKPITLDIPHKLSLKGFIGFLRSWQPAMKAKEQGVELINEDLITKFEEAWGD  239

Query  212  DGKTQKIVAFPIYLRIGK  159
            + +  K V +  ++ +GK
Sbjct  240  ENQV-KDVYYKAHMIVGK  256



>ref|XP_009116782.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brassica 
rapa]
Length=261

 Score =   169 bits (427),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 139/262 (53%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + +MA L  KQ  +Y   RPTYP   +  +A +T  H + WDVGTG GQAA+ + + Y+ 
Sbjct  1    MAQMATLTEKQANEYLNARPTYPTIWYKVLAGRTSNHKVAWDVGTGNGQAALGVADYYQR  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD     +  A   PNV ++ TP +M+  EL + +G E+S+DL+  AQ+LH+F L  
Sbjct  61   VVATDIDEKPMSIAKPHPNVTYLHTPASMSDDELVSKLGGENSIDLIVAAQSLHYFDLKR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ VL+K  G+IA W Y+   V+  VD+I +R   + + +      L    Y+ I+
Sbjct  121  FYAIVRRVLRKEGGIIAVWVYNDLVVTPKVDAIMKRLVDSTKPYRNLKMNLAFDGYKEIE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FP   +       P   +    + L+ Y  + +S      AK +G E+L   ++ +F  A
Sbjct  181  FPLKNIRLGTQGRPKALEIPHKLSLDGYLGFFKSWQPLVKAKEQGAELLKPSMINEFKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W +  +  K VA+  ++  GK+
Sbjct  241  WGDQNQV-KDVAYRAFMLAGKL  261



>ref|XP_010527092.1| PREDICTED: uncharacterized protein LOC104804474 [Tarenaya hassleriana]
Length=304

 Score =   169 bits (429),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 89/251 (35%), Positives = 134/251 (53%), Gaps = 0/251 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            +  ++ L   Q   Y + RPTYP+  F  +A KT  H+  WDVGTG GQAA+ + E YK 
Sbjct  1    MGSLSTLSEAQAGAYRDARPTYPRSWFKMLAGKTAMHERAWDVGTGNGQAAIGVAEHYKR  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD +  QL  A     V++  TP +M+  EL   VG + SVDLVT AQA+H+F L  
Sbjct  61   VVATDINKEQLTRAMRHRRVKYYLTPQHMSEDELVDLVGGDDSVDLVTAAQAVHYFDLEK  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ VL+KP GVIA W ++   +S ++D +++R       F      +    Y T+ 
Sbjct  121  FYNVVRRVLRKPGGVIAVWVFNEIAISPAIDKVFRRISDATIPFRNGRTNMALAGYNTMP  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  V        +  K +  + LE++  Y++S      AK KG ++L+  +++D   A
Sbjct  181  FPFKSVGIGSEGKSHPLKLRSRLSLEAFENYLKSWQLVVKAKEKGKDLLTKRVMRDLEDA  240

Query  221  WNEDGKTQKIV  189
            W    + + +V
Sbjct  241  WGGRNQVRDVV  251



>ref|XP_004969040.1| PREDICTED: putative methyltransferase DDB_G0268948-like [Setaria 
italica]
Length=280

 Score =   169 bits (427),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 134/257 (52%), Gaps = 3/257 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF KQ   Y+  RP YP  LF  +A+ T  H L WDVGTG GQAA+ + E Y +V+ 
Sbjct  21   MAGLFSKQAAVYAAARPAYPNDLFTKLAALTAHHCLAWDVGTGNGQAAIGVAEHYDSVLA  80

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S +QL  A   P V ++ TP      +L A +G E SVDL+T+A+A HWF LP FY 
Sbjct  81   TDVSEDQLLHAAPHPKVWYLHTPDATPGEDLVATLGGEGSVDLITVAEAAHWFDLPAFYD  140

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
                VL++P GVIA W Y++    S V+ +  R++ T   +W+P  +     YR + FPF
Sbjct  141  VAHRVLRRPGGVIAVWGYNY--RISPVEDMMTRFFNTTLPYWDPRARCCTDGYRDLPFPF  198

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
              +       P     ++ M  E     + S S   TAK +GV++L   +V+     W  
Sbjct  199  VDIGLGREGEPASLDMEQEMSFEGLIGMLSSWSAVTTAKQQGVDLLGERVVKQLEEEWGG  258

Query  212  DGKTQKIVAFPIYLRIG  162
                +K V F  +L  G
Sbjct  259  ASLVRK-VTFKAFLLAG  274



>gb|EAY75611.1| hypothetical protein OsI_03515 [Oryza sativa Indica Group]
Length=817

 Score =   176 bits (447),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/296 (32%), Positives = 161/296 (54%), Gaps = 6/296 (2%)
 Frame = -1

Query  1025  DTPPVLYMLKK*DFPCTSPRLWEKYTEELKKMADLFLKQGKQYSEGRPTYPQQLFDFIAS  846
             D P    +    D+ C    + EK  ++  +MA L+ +  + Y++ RP YP   F  +A+
Sbjct  526   DPPQQFALFTVQDWSCGPVEVIEK--KQRARMAGLYERPSETYTKKRPRYPDAWFSKLAA  583

Query  845   KTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLA  666
              T  H   WD G GTGQA++S+ E Y +VV TD S  Q++ A   P VR++ TP +++  
Sbjct  584   LTAGHHRAWDAGCGTGQASISIAEHYDSVVATDASEGQIRHAVAHPKVRYLHTPVDLSED  643

Query  665   ELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDS  486
             +L A VG E S+DLV +A ++HWF +P FY     VLK+P GV+A W Y++ E+    D 
Sbjct  644   DLVAMVGGEGSLDLVVVATSIHWFDIPLFYAVANRVLKRPGGVLAVWGYNY-EIHPFEDK  702

Query  485   IYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYI  306
             ++ + Y   + + +P  +L   +YR + FPF+PV       P +   +  M L+    ++
Sbjct  703   LHGQLYPAMRPYMDPRTRLAMDRYRDLPFPFEPVGVGREGEPADVDIEVDMTLDDLVGFL  762

Query  305   RSSSGYQTAKNKGV--EILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKVGILD  144
             ++ S   TA+ KGV  E ++ D+++     W +    +K+V F  ++  GK  +L+
Sbjct  763   KTGSVVTTAREKGVDLEAVTKDVMKGVEAEWGDPAVARKLV-FKAFMLAGKPKVLN  817



>emb|CDY48938.1| BnaA09g38990D [Brassica napus]
Length=261

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 138/262 (53%), Gaps = 1/262 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + +M  L  KQ  +Y   RPTYP   +  +A +T  H + WDVGTG GQAA+ + + Y+ 
Sbjct  1    MAQMVTLTEKQANEYLNARPTYPTIWYKVLAGRTSNHKVAWDVGTGNGQAALGVADYYQR  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD     +  A   PNV ++ TP +M+  EL + +G E+S+DL+  AQ+LH+F L  
Sbjct  61   VVATDIDEKPMSIAKPHPNVTYLHTPASMSDDELVSKLGGENSIDLIVAAQSLHYFDLKR  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ VL+K  G IA W Y+   V+  VD+I +R   + + +      L    Y+ I+
Sbjct  121  FYAIVRRVLRKEGGTIAVWVYNDLVVTPKVDAIMKRLVDSTKPYRNLKMNLAFDGYKEIE  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  +       P   +    + L+ Y  + +S      AK +G E+L   ++ +F  A
Sbjct  181  FPFKNIRLGTQGRPKALEIPHKLSLDGYLGFFKSWQPLVKAKEQGAELLKPSMINEFKEA  240

Query  221  WNEDGKTQKIVAFPIYLRIGKV  156
            W +  +  K VA+  ++  GK+
Sbjct  241  WGDQNQV-KDVAYRAFMLAGKL  261



>ref|XP_010504207.1| PREDICTED: uncharacterized protein LOC104781277 [Camelina sativa]
Length=311

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/260 (36%), Positives = 139/260 (53%), Gaps = 2/260 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L   + K Y + RP YP   +  IA++T  H   WD GTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSENEAKAYLDARPRYPIDWYKKIAARTQDHKFAWDAGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPN-MTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
            TD +  QL+ A     + +  TP   M+  E+ A +G E+SVDL+  AQA+H+F L TFY
Sbjct  61   TDINEEQLKRAIKHSRISYHHTPITIMSEDEMVALIGGENSVDLIVAAQAVHFFDLTTFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFP  396
               K VL+K  G+IA W Y+   +S  VD I +R   +   +  P   L    Y+T+ FP
Sbjct  121  NVAKRVLRKEGGLIAVWVYNDIIISPEVDPIMKRLVDSTLPYRTPIMNLAFDGYKTLTFP  180

Query  395  FDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWN  216
            F+ +       P        + L+ +  ++RS      AK KGVE+++ DL+  F  AW 
Sbjct  181  FESIGMGSEGEPITLNIPHKLSLKGFIGFLRSWQPAMKAKEKGVELINEDLITKFEEAWG  240

Query  215  EDGKTQKIVAFPIYLRIGKV  156
            ++ +  K V +  ++ +GK+
Sbjct  241  DENQV-KDVFYKAHMLVGKI  259



>gb|ACI23521.1| putative S-adenosylmethionine-dependent methyltransferase [Aegilops 
speltoides]
Length=216

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 125/215 (58%), Gaps = 1/215 (0%)
 Frame = -1

Query  905  KQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQ  726
            + Y++ RP YP++ F  +AS T  H   WD G G+GQA++S+ E Y  VV TD S  QL+
Sbjct  3    ETYAKKRPRYPKEWFSMLASLTAGHHRAWDAGCGSGQASVSIAEHYDGVVATDVSEGQLR  62

Query  725  FAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKP  546
             A   P VR++ +P ++T  EL A VG E S+DLV +A A+HWF +P FY  V  VL+KP
Sbjct  63   HAIAHPKVRYLHSPEDLTEDELVALVGGEGSLDLVIVATAIHWFDVPLFYAVVNRVLRKP  122

Query  545  DGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPFDPVDGCEHN  366
             GV+A W Y++ ++    D ++   Y   + + +P  +L  ++YR + FPF+PV      
Sbjct  123  GGVLAVWGYNY-DIHPFGDKLHGTLYPAMRPYMDPRTRLAMERYRELPFPFEPVGVGREG  181

Query  365  GPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVE  261
             P +   +  M LE    ++ + S   TA+ KGV+
Sbjct  182  EPADVDMEAEMTLEDLAGFVMTGSVATTAREKGVD  216



>gb|AAM65951.1| embryonic abundant protein-like [Arabidopsis thaliana]
Length=323

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 138/259 (53%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K+ + Y + RP YP   +  IA++T  H   WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSEKEAEAYLDARPRYPIDWYKKIAARTQDHKFAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP  ++  E+   +G E+SVDL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLKRAIKHSRISYHHTPTTISEDEMVDLLGGENSVDLIVAAQAVHFFDLNVFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  +D I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAVWVYNDIIISPEIDPIMKRLVDSTLPFRTPIMNLAFDGYKTLTFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L  +  ++RS      AK KGVE+++ DL+  F  AW +
Sbjct  181  ETIGMGSEGNPITLDIPHKLSLNGFIGFLRSWQPAMKAKEKGVELINEDLITKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ETQV-KDVFYKAHMIVGKI  258



>ref|XP_009116103.1| PREDICTED: uncharacterized protein LOC103841333 isoform X1 [Brassica 
rapa]
Length=310

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 137/259 (53%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K    Y + RP YP   +  IA +T  H   WDVGTG GQAA+ L + Y+NVV 
Sbjct  1    MAALSEKDASAYLDARPRYPTDWYKKIAERTQDHKFAWDVGTGNGQAAIGLVDHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP NM+  E+ A +G E+S+DL+  AQA+H+F L TFY 
Sbjct  61   TDINEAQLKRAIKHSRISYHHTPKNMSEDEMVALIGGENSMDLIVAAQAVHFFDLTTFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  +D I +    +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKDGGLIAIWVYNDIIISPEIDPIMKSLVDSTLPFRTPIMNLAFDSYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  +++S      AK +GVE++  DL+  F  AW +
Sbjct  181  ESIGMGSEGEPVRLDIPHKLSLKGFIGFLKSWQPAMKAKEQGVELVDEDLITKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ENQV-KDVYYKAHMIVGKI  258



>emb|CDX79160.1| BnaA01g12270D [Brassica napus]
Length=261

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 130/250 (52%), Gaps = 3/250 (1%)
 Frame = -1

Query  899  YSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQFA  720
            Y + RPTYP   +  +A+ +P H L WD GTG GQAA  + E Y  V+ TD S   L   
Sbjct  11   YLDARPTYPADWYSKLAALSPHHHLAWDAGTGNGQAATGIAEHYDRVIATDVSETMLHLG  70

Query  719  PNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDG  540
                 V +  TP +MT  E+   +G E+SVDL+T+A A+HWF LP FY     +L+KP G
Sbjct  71   KPHRKVTYHHTPSSMTEDEMVDLIGGENSVDLITVATAVHWFDLPRFYAIANRLLRKPGG  130

Query  539  VIAAWCYDFP-EVSSSVDSIYQRYY-TTNQHFWEPGRKLVDQKYRTIDFPFDPVDGCEHN  366
            +IA W Y     VS   D +  R    T  +F  P  + V   Y+++ FPF+ V      
Sbjct  131  IIAVWSYTTEMAVSPEFDPVMTRLSEKTMPYFKFPECQYVVDGYKSLPFPFESVGLGSEG  190

Query  365  GPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVA  186
             P E + ++ +  E +   +RS S    AK KGVE+LS D+V++   AW      + IV 
Sbjct  191  KPMELEMKRTVSFEGFLRMVRSWSAIGAAKEKGVELLSEDVVKELETAWGGSELVRTIV-  249

Query  185  FPIYLRIGKV  156
            +  ++  G V
Sbjct  250  YKTFMLAGTV  259



>ref|XP_002455863.1| hypothetical protein SORBIDRAFT_03g026460 [Sorghum bicolor]
 gb|EES00983.1| hypothetical protein SORBIDRAFT_03g026460 [Sorghum bicolor]
Length=263

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/248 (37%), Positives = 136/248 (55%), Gaps = 3/248 (1%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q   Y+  RP YP+ LF  +++ T  H   WDVGTG GQAA+ + E Y +VV 
Sbjct  1    MAGLFTEQAAVYAAARPAYPKDLFAKLSALTAHHRRAWDVGTGNGQAAIGVAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD S  QL+ A   P VR++ T   +   +L A +G E+SVDL+T+A A+HWF LP FY 
Sbjct  61   TDASVEQLRHATPHPRVRYLHTSDALPEDDLVAMLGGEASVDLITVALAVHWFDLPAFYG  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
                VL++P GVIA W Y++    S V+ +  R++ T   +W+P  +     YR + FPF
Sbjct  121  VACRVLRRPGGVIAVWGYNYR--MSPVEDMMARFFDTTLPYWDPRARYCTDGYRDLPFPF  178

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAK-NKGVEILSSDLVQDFTRAWN  216
            + +   +   P     ++ M  E     +RS S   TAK  +GV++L   +V++    W 
Sbjct  179  EDIGLGKEGEPASLDMEQEMSFEGLIGVLRSWSAVTTAKQQQGVDLLGERVVKELEEGWG  238

Query  215  EDGKTQKI  192
                 +K+
Sbjct  239  GASLVRKV  246



>ref|XP_006829945.1| hypothetical protein AMTR_s00073p00188940, partial [Amborella 
trichopoda]
 gb|ERM97361.1| hypothetical protein AMTR_s00073p00188940, partial [Amborella 
trichopoda]
Length=161

 Score =   163 bits (412),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 106/153 (69%), Gaps = 7/153 (5%)
 Frame = -1

Query  617  IAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPG  438
            +AQALHWF   TFYQ++ W+LKKP GV AAWCY  P+V+ +VDSI    YTT++HFW   
Sbjct  13   VAQALHWFDPNTFYQRLNWLLKKPGGVFAAWCYILPKVNEAVDSILANLYTTSEHFW-AS  71

Query  437  RKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEI  258
                  +YRT++FPF+PV+G EH GP+ F+  + M+LE++F +IR+ S YQTA   GVE+
Sbjct  72   EHFWASEYRTLEFPFEPVEGEEHTGPFVFEGTREMDLEAFFTWIRTWSAYQTAHKGGVEL  131

Query  257  LSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGK  159
            LS ++V+ F +AW         V +PI+L+IG+
Sbjct  132  LSEEVVKKFEQAWKNS------VRYPIFLQIGR  158



>ref|XP_009135961.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brassica 
rapa]
Length=261

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 91/250 (36%), Positives = 131/250 (52%), Gaps = 3/250 (1%)
 Frame = -1

Query  899  YSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVGTDTSPNQLQFA  720
            Y + RPTYP   +  +A+ +  H L WD GTG GQAA  + E Y  V+ TD S   L   
Sbjct  11   YLDARPTYPADWYSKLAALSHHHHLAWDAGTGNGQAATGIAEHYDRVIATDVSETMLHLG  70

Query  719  PNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQQVKWVLKKPDG  540
                 V +  TP +MT  E+   +G E+SVDL+T+A A+HWF LP FY   K +L+KP G
Sbjct  71   KPHRKVTYHHTPSSMTEDEMVDLIGGENSVDLITVATAVHWFDLPRFYAIAKRLLRKPGG  130

Query  539  VIAAWCYDFP-EVSSSVDSIYQRY-YTTNQHFWEPGRKLVDQKYRTIDFPFDPVDGCEHN  366
            +IA W Y     VS   D +  R+   T  +F  P  + V   Y+++ FPF+ V      
Sbjct  131  IIAVWSYTTEMAVSPEFDPVMTRFNEKTMPYFKFPECQYVVDGYKSLPFPFESVGLGSEG  190

Query  365  GPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVA  186
             P E + ++ +  E +   +RS S    AK KGVE+LS D+V++   AW      + IV 
Sbjct  191  KPMELEMKRTVSFEGFLRMVRSWSAIGAAKEKGVELLSEDVVKELETAWGGSELVRTIV-  249

Query  185  FPIYLRIGKV  156
            +  ++  G V
Sbjct  250  YKTFMLAGTV  259



>emb|CDX73502.1| BnaC08g25010D [Brassica napus]
Length=310

 Score =   167 bits (423),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 90/259 (35%), Positives = 136/259 (53%), Gaps = 1/259 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K    Y + RP YP   +  IA +T  H   WDVGTG GQAA+ L E Y+NVV 
Sbjct  1    MAALSEKDAAAYLDARPRYPIDWYKKIAERTQDHKFAWDVGTGNGQAAIGLVEHYENVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP NM+  E+ A +G E+S+DL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLKRAIKHSRISYHHTPKNMSEDEMVALIGGENSMDLIVAAQAVHFFDLTIFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  +D I +    +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKEGGLIAIWVYNDIIISPEIDPIMKSLVDSTLPFRTPVMNLAFDSYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P        + L+ +  +++S      AK +GVE++  DL+  F  AW +
Sbjct  181  ESIGMGSEGEPVRLDIPHKLSLKGFIGFLKSWQPAMKAKEQGVELVDEDLIAKFEEAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKV  156
            + +  K V +  ++ +GK+
Sbjct  241  ENQV-KDVYYKAHMIVGKI  258



>ref|XP_009793853.1| PREDICTED: putative methyltransferase DDB_G0268948, partial [Nicotiana 
sylvestris]
Length=107

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = -1

Query  782  LGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQAL  603
            L + YKNV+ TDTSP QL+FA  +PNV+++CT P M++A++E  +G ESSVDLVTIAQA+
Sbjct  4    LAKLYKNVIATDTSPKQLEFAVKVPNVQYICTSPKMSMAKIETKIGTESSVDLVTIAQAM  63

Query  602  HWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRY  471
            HWF LPTFYQQVKW+LKKP+GVIAAWCY  PEV++SVD I++++
Sbjct  64   HWFDLPTFYQQVKWLLKKPNGVIAAWCYTVPEVNNSVDPIFEKF  107



>ref|XP_009103727.1| PREDICTED: putative methyltransferase DDB_G0268948 [Brassica 
rapa]
Length=311

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 140/263 (53%), Gaps = 1/263 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K    Y   RP YP   F  +A++T +H L WDVGTG GQAA+ L E ++ VV 
Sbjct  1    MAALSDKLADAYQNARPRYPIDWFTKLAARTGQHKLAWDVGTGNGQAAIGLAEYFEKVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP  ++  ++ A VG ++SVDL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLKRAVKHERISYHHTPKELSEDKMVALVGGDNSVDLIVAAQAVHYFDLQPFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  VD+I +R   +   +  P   L    Y+T+ FPF
Sbjct  121  IAKRVLRKEGGLIAVWVYNDLVISPEVDAIMKRLVDSTFPYRTPVMNLAFDGYKTMPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P +      + L+ +  ++RS      AK +GVE+++ DL+  F  AW +
Sbjct  181  ESIGMGSEGKPIQLDIPHKLSLKGFVGFLRSWQPAMKAKERGVELVTEDLINQFEDAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKVGILD  144
            D   + I  +  ++ +GK+   D
Sbjct  241  DDDVKDIF-YKAHMIVGKLSSAD  262



>emb|CDY26104.1| BnaC06g10920D [Brassica napus]
Length=311

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 140/263 (53%), Gaps = 1/263 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  K    Y   RP YP   F  +A++T +H L WDVGTG GQAA+ L E ++ VV 
Sbjct  1    MAALSDKLADAYQNARPRYPIDWFTKLAARTGQHKLAWDVGTGNGQAAIGLAEYFEKVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ A     + +  TP  ++  ++ A VG ++SVDL+  AQA+H+F L  FY 
Sbjct  61   TDINEAQLKRAVKHERISYHHTPTELSEDKMVALVGGDNSVDLIVAAQAVHYFDLQPFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   +S  VD+I +R   +   +  P   L    Y+T+ FPF
Sbjct  121  IAKRVLRKEGGLIAVWVYNDLVISPEVDAIMKRLVDSTFPYRTPVMNLAFDGYKTMPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + +       P +      + L+ +  ++RS      AK +GVE+++ DL+  F  AW +
Sbjct  181  ESIGMGSEGKPIQLDIPHKLSLKGFVGFLRSWQPAMKAKERGVELVTEDLINQFEDAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKVGILD  144
            D   + I  +  ++ +GK+   D
Sbjct  241  DDDVKDIF-YKAHMIVGKLSSAD  262



>ref|XP_010527093.1| PREDICTED: probable S-adenosylmethionine-dependent methyltransferase 
CRG1 [Tarenaya hassleriana]
Length=300

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 129/244 (53%), Gaps = 0/244 (0%)
 Frame = -1

Query  941  LKKMADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKN  762
            + +++ L   Q   Y + RP YP+  F  +A KT  H+  WD GTG GQAA+ + E YK 
Sbjct  1    MGRLSSLSEAQAGAYRDARPPYPRSWFKMLAEKTDMHERAWDAGTGNGQAAIGVAEHYKR  60

Query  761  VVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPT  582
            VV TD S  QL+ A     V++  TP +M+  EL   VG + S+DLV  AQA+H+F+L  
Sbjct  61   VVATDISKEQLRRATPHQRVKYCLTPEHMSEDELVDLVGGDDSIDLVIAAQAVHYFNLEK  120

Query  581  FYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTID  402
            FY  V+ VL+KP GVIA W ++   +SS+VD +++R   +   F      +    Y  + 
Sbjct  121  FYNVVRRVLRKPGGVIAVWVFNEISISSAVDKVFRRISDSTIPFRNDRTNMALAGYNNLP  180

Query  401  FPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRA  222
            FPF  +        +  K    + LE +  Y++S      AK KG ++L+  ++ D   A
Sbjct  181  FPFRNIGIGSEGNSHALKLHSKLSLEGFKNYLKSWQLIVKAKGKGKDLLTKRVMSDLEDA  240

Query  221  WNED  210
            W  +
Sbjct  241  WGRN  244



>dbj|BAB89030.1| embryo-abundant protein EMB-like [Oryza sativa Japonica Group]
Length=298

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 141/295 (48%), Gaps = 39/295 (13%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA LF +Q  +Y+  RP YP+ LF  +AS T  H + WDVGTG GQAA+ + E Y +VV 
Sbjct  1    MAGLFTRQAAEYAAARPVYPKDLFVKLASLTAHHRVAWDVGTGNGQAAIGVAEHYDSVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTP-PNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFY  576
            TD S  QL+ A   P VR++ TP       +L A +G E  VDL+T+A+A HWF LP FY
Sbjct  61   TDVSAEQLRRAVPHPKVRYLHTPDAGADDDDLVAALGGEGCVDLITVAEAAHWFDLPAFY  120

Query  575  QQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWE----------------  444
               + +L+KP GVIA W Y++    S V+ +  R+  T   +W+                
Sbjct  121  GAARRLLRKPGGVIAVWGYNYR--VSPVEDMMSRFLHTTLPYWDSRARYITTWAQHTLQF  178

Query  443  ----------PGRK---------LVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELES  321
                      P RK          V   YR + FPFD V   +   P  F  +  M    
Sbjct  179  YNLAIASKHHPWRKESLTCCSCRYVIDGYRDLPFPFDGVGLGKEGEPAGFDMEHEMAFPG  238

Query  320  YFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKV  156
                +RS S   TA+ +GV++L   +V+     W      +K V F  +L  G V
Sbjct  239  LVRMLRSWSAVATARQRGVDLLDERVVRRLEEEWGGASLVRK-VTFKAFLLAGTV  292



>ref|XP_010040143.1| PREDICTED: putative methyltransferase DDB_G0268948, partial [Eucalyptus 
grandis]
Length=303

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 125/219 (57%), Gaps = 1/219 (0%)
 Frame = -1

Query  812  GTGTGQAAMSLGEKYKNVVGTDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESS  633
            G G G   + + E Y+ V+ TD S +QL +A   P V+++ TPP+++  EL A VG E+S
Sbjct  84   GRGGGTPVLQVAEHYQQVIATDVSESQLNYAIPHPRVQYMHTPPSISDDELLATVGGENS  143

Query  632  VDLVTIAQALHWFHLPTFYQQVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQH  453
            VDL+T+AQA+HWF LP FY  V  VL+KP+GVIA W Y   +VS + D I ++++     
Sbjct  144  VDLITVAQAIHWFELPKFYSLVNRVLRKPEGVIAVWGYGAIQVSPTFDPILKKFFDATLP  203

Query  452  FWEPGRKLVDQKYRTIDFPFDPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKN  273
            +W P  + V  +Y+T+ FPF+ V       P        +  E     +RS S    AK 
Sbjct  204  YWNPNVRYVFDQYKTLPFPFESVGLGSEGNPVALDIPTEVSFEGMLGILRSWSAVAMAKE  263

Query  272  KGVEILSSDLVQDFTRAWNEDGKTQKIVAFPIYLRIGKV  156
            +GVE+LS  +V++F RAW    K  + V +  ++  GKV
Sbjct  264  QGVELLSEGVVREFERAWGGT-KLVRNVVYKAFMLAGKV  301



>ref|XP_010527081.1| PREDICTED: uncharacterized protein LOC104804467 [Tarenaya hassleriana]
Length=309

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/261 (35%), Positives = 140/261 (54%), Gaps = 1/261 (0%)
 Frame = -1

Query  932  MADLFLKQGKQYSEGRPTYPQQLFDFIASKTPRHDLVWDVGTGTGQAAMSLGEKYKNVVG  753
            MA L  KQ + Y + RP YP   +  +A++T  H + WDVG G GQAA+ + E Y  VV 
Sbjct  1    MAALSDKQAEAYIDARPKYPMDWYRKLAARTLEHKVAWDVGCGNGQAAVGVAEYYDKVVA  60

Query  752  TDTSPNQLQFAPNLPNVRFVCTPPNMTLAELEANVGAESSVDLVTIAQALHWFHLPTFYQ  573
            TD +  QL+ +   P V +  TP +M+  EL A VG E+SVDL+  AQA+H+F    FY 
Sbjct  61   TDINELQLKRSFKHPKVTYRHTPASMSDDELVALVGGENSVDLIVAAQAVHYFDTVRFYN  120

Query  572  QVKWVLKKPDGVIAAWCYDFPEVSSSVDSIYQRYYTTNQHFWEPGRKLVDQKYRTIDFPF  393
              K VL+K  G+IA W Y+   ++  VD I +R   +   F  P   L    Y+T+ FPF
Sbjct  121  VAKRVLRKQGGLIAVWVYNDLIITPEVDRIMKRLVDSTFPFRTPIMNLAFDGYKTLPFPF  180

Query  392  DPVDGCEHNGPYEFKAQKLMELESYFAYIRSSSGYQTAKNKGVEILSSDLVQDFTRAWNE  213
            + V       P        + L+ +  ++RS      AK +GVE+++ DL++ F  AW +
Sbjct  181  ESVGMGSEGKPIALDIPHKLSLKGFVGFLRSWQPAVKAKEQGVELITEDLIKQFEDAWGD  240

Query  212  DGKTQKIVAFPIYLRIGKVGI  150
            D   + +  +  ++ +GKV +
Sbjct  241  DEPVRNVF-YKGHMIVGKVPV  260



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2469297046400