BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21799_g1_i1 len=1640 path=[8615:0-583 6479:584-609 10247:610-1027
6905:1028-1064 7601:1065-1128 7006:1129-1164 8163:1165-1639]

Length=1640
                                                                      Score     E

ref|XP_002517269.1|  Auxin-induced protein 5NG4, putative               540   0.0      Ricinus communis
ref|XP_009620096.1|  PREDICTED: WAT1-related protein At5g07050-like     538   0.0      
ref|XP_006482028.1|  PREDICTED: WAT1-related protein At5g07050-like     538   0.0      
emb|CAH58631.1|  nodulin-like protein                                   535   0.0      Plantago major [cart-track plant]
ref|XP_009788498.1|  PREDICTED: WAT1-related protein At5g07050-like     536   0.0      
ref|XP_011070079.1|  PREDICTED: WAT1-related protein At5g07050-like     536   0.0      
ref|XP_010111209.1|  Auxin-induced protein 5NG4                         534   0.0      
ref|XP_009790909.1|  PREDICTED: WAT1-related protein At5g07050-li...    532   0.0      
ref|XP_011015432.1|  PREDICTED: WAT1-related protein At5g07050-like     533   0.0      
ref|XP_009620098.1|  PREDICTED: WAT1-related protein At5g07050-like     530   0.0      
ref|XP_011079091.1|  PREDICTED: WAT1-related protein At5g07050-like     531   0.0      
gb|EYU20823.1|  hypothetical protein MIMGU_mgv1a008005mg                531   0.0      
emb|CDP06236.1|  unnamed protein product                                531   0.0      
ref|XP_009610629.1|  PREDICTED: WAT1-related protein At5g07050-li...    530   0.0      
ref|XP_011040724.1|  PREDICTED: WAT1-related protein At5g07050          529   0.0      
ref|XP_002283348.1|  PREDICTED: WAT1-related protein At5g07050          528   0.0      Vitis vinifera
ref|XP_009621489.1|  PREDICTED: WAT1-related protein At5g07050-li...    526   2e-180   
ref|XP_002308862.2|  hypothetical protein POPTR_0006s03200g             524   2e-179   Populus trichocarpa [western balsam poplar]
ref|XP_006430497.1|  hypothetical protein CICLE_v10012013mg             520   2e-178   
ref|XP_002323220.2|  hypothetical protein POPTR_0016s03120g             520   8e-178   Populus trichocarpa [western balsam poplar]
ref|XP_011041376.1|  PREDICTED: WAT1-related protein At5g07050          516   2e-176   
ref|XP_010244423.1|  PREDICTED: WAT1-related protein At5g07050          516   2e-176   
ref|XP_004249118.1|  PREDICTED: WAT1-related protein At5g07050          512   4e-175   
ref|XP_009800321.1|  PREDICTED: WAT1-related protein At5g07050-like     512   7e-175   
ref|XP_006364778.1|  PREDICTED: WAT1-related protein At5g07050-like     510   1e-174   
ref|XP_004294697.1|  PREDICTED: auxin-induced protein 5NG4-like         508   1e-173   
gb|AFK34273.1|  unknown                                                 508   1e-173   
ref|XP_006339335.1|  PREDICTED: WAT1-related protein At5g07050-like     502   2e-171   
ref|XP_006604312.1|  PREDICTED: WAT1-related protein At5g07050-like     503   2e-171   
ref|XP_007162036.1|  hypothetical protein PHAVU_001G118300g             504   2e-171   
ref|NP_001242267.1|  uncharacterized protein LOC100811617               503   3e-171   
ref|XP_008788560.1|  PREDICTED: WAT1-related protein At5g07050-like     502   6e-171   
ref|XP_004249327.1|  PREDICTED: WAT1-related protein At5g07050-li...    501   1e-170   
ref|XP_010673090.1|  PREDICTED: WAT1-related protein At5g07050          502   1e-170   
ref|XP_010055600.1|  PREDICTED: WAT1-related protein At5g07050-like     501   1e-170   
ref|XP_010055591.1|  PREDICTED: WAT1-related protein At5g07050-like     496   9e-169   
ref|XP_004493327.1|  PREDICTED: WAT1-related protein At5g07050-li...    492   3e-167   
ref|XP_010938846.1|  PREDICTED: WAT1-related protein At5g07050-like     493   3e-167   
ref|XP_008810183.1|  PREDICTED: WAT1-related protein At5g07050-like     491   1e-166   
ref|XP_010906409.1|  PREDICTED: WAT1-related protein At5g07050-like     488   7e-166   
gb|EYU18591.1|  hypothetical protein MIMGU_mgv1a007543mg                489   1e-165   
ref|XP_008795134.1|  PREDICTED: WAT1-related protein At5g07050-like     486   6e-165   
ref|XP_006339251.1|  PREDICTED: WAT1-related protein At5g07050-like     485   2e-164   
gb|KDP22890.1|  hypothetical protein JCGZ_01964                         483   4e-164   
ref|XP_006432378.1|  hypothetical protein CICLE_v10001335mg             481   1e-162   
ref|XP_010906432.1|  PREDICTED: WAT1-related protein At5g07050-like     480   1e-162   
ref|XP_006471332.1|  PREDICTED: WAT1-related protein At5g07050-like     480   2e-162   
ref|XP_009391606.1|  PREDICTED: WAT1-related protein At5g07050-like     475   1e-160   
ref|XP_004249326.1|  PREDICTED: WAT1-related protein At5g07050          475   1e-160   
gb|KHG09563.1|  Auxin-induced 5NG4                                      475   3e-160   
ref|XP_009403831.1|  PREDICTED: WAT1-related protein At5g07050-like     475   5e-160   
ref|XP_004307206.1|  PREDICTED: auxin-induced protein 5NG4-like         472   4e-159   
ref|XP_007218075.1|  hypothetical protein PRUPE_ppa006848mg             471   7e-159   
ref|XP_003564421.1|  PREDICTED: WAT1-related protein At5g07050          470   1e-158   
gb|KDP40571.1|  hypothetical protein JCGZ_24570                         470   2e-158   
ref|XP_004493329.1|  PREDICTED: WAT1-related protein At5g07050-li...    466   3e-158   
ref|XP_011020462.1|  PREDICTED: WAT1-related protein At5g07050          469   5e-158   
ref|XP_008443233.1|  PREDICTED: WAT1-related protein At5g07050-like     469   6e-158   
ref|XP_009419851.1|  PREDICTED: WAT1-related protein At5g07050-like     468   7e-158   
ref|XP_004167156.1|  PREDICTED: auxin-induced protein 5NG4-like         468   8e-158   
gb|KFK25097.1|  hypothetical protein AALP_AA8G066000                    468   9e-158   
gb|KGN59418.1|  hypothetical protein Csa_3G818270                       468   1e-157   
ref|XP_004136769.1|  PREDICTED: auxin-induced protein 5NG4-like         468   1e-157   
ref|XP_002525547.1|  Auxin-induced protein 5NG4, putative               468   2e-157   Ricinus communis
ref|XP_009361913.1|  PREDICTED: WAT1-related protein At5g07050-like     466   4e-157   
ref|XP_011034692.1|  PREDICTED: WAT1-related protein At5g07050-like     467   5e-157   
ref|XP_010096006.1|  Auxin-induced protein 5NG4                         466   1e-156   
emb|CDX70003.1|  BnaA10g23520D                                          465   1e-156   
ref|XP_009122385.1|  PREDICTED: WAT1-related protein At5g07050          464   3e-156   
ref|XP_002267371.1|  PREDICTED: WAT1-related protein At5g07050          464   3e-156   Vitis vinifera
ref|XP_002299181.1|  hypothetical protein POPTR_0001s06980g             464   5e-156   Populus trichocarpa [western balsam poplar]
ref|XP_009395155.1|  PREDICTED: WAT1-related protein At5g07050-like     463   6e-156   
ref|XP_002303952.2|  hypothetical protein POPTR_0003s19170g             464   6e-156   Populus trichocarpa [western balsam poplar]
ref|XP_006644860.1|  PREDICTED: WAT1-related protein At5g07050-like     463   9e-156   
ref|XP_009370627.1|  PREDICTED: WAT1-related protein At5g07050-like     462   1e-155   
ref|XP_008346651.1|  PREDICTED: WAT1-related protein At5g07050-like     462   1e-155   
ref|XP_002458648.1|  hypothetical protein SORBIDRAFT_03g037390          462   4e-155   Sorghum bicolor [broomcorn]
gb|ACL54205.1|  unknown                                                 461   1e-154   Zea mays [maize]
ref|NP_001055529.2|  Os05g0409500                                       460   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001150619.1|  nodulin-like protein                               459   4e-154   Zea mays [maize]
gb|EAY98030.1|  hypothetical protein OsI_19945                          459   5e-154   Oryza sativa Indica Group [Indian rice]
ref|XP_008375333.1|  PREDICTED: WAT1-related protein At5g07050-like     458   5e-154   
ref|XP_006399183.1|  hypothetical protein EUTSA_v10015938mg             458   7e-154   
ref|XP_003523924.1|  PREDICTED: WAT1-related protein At5g07050-like     456   4e-153   
dbj|BAB92246.1|  putative nodulin MtN21                                 455   1e-152   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02715.1|  predicted protein                                      455   1e-152   
ref|XP_003526345.1|  PREDICTED: WAT1-related protein At5g07050-like     454   3e-152   
gb|EEC71658.1|  hypothetical protein OsI_04113                          454   4e-152   Oryza sativa Indica Group [Indian rice]
ref|XP_002441090.1|  hypothetical protein SORBIDRAFT_09g020200          453   7e-152   Sorghum bicolor [broomcorn]
ref|NP_001239827.1|  uncharacterized protein LOC100804390               454   7e-152   
ref|XP_003545806.1|  PREDICTED: WAT1-related protein At5g07050-like     452   1e-151   
ref|XP_002873292.1|  hypothetical protein ARALYDRAFT_487525             452   2e-151   
ref|XP_008445949.1|  PREDICTED: WAT1-related protein At5g07050          451   3e-151   
ref|XP_010067678.1|  PREDICTED: WAT1-related protein At5g07050          452   3e-151   
emb|CDM84603.1|  unnamed protein product                                451   3e-151   
ref|XP_007148806.1|  hypothetical protein PHAVU_005G015900g             451   4e-151   
gb|EMS48876.1|  Auxin-induced protein 5NG4                              450   7e-151   
ref|XP_008655310.1|  PREDICTED: uncharacterized protein LOC100384...    450   1e-150   
ref|XP_003568462.2|  PREDICTED: WAT1-related protein At5g07050-like     449   2e-150   
ref|XP_007010782.1|  Nodulin MtN21 /EamA-like transporter family ...    450   3e-150   
ref|XP_011085946.1|  PREDICTED: WAT1-related protein At5g07050          449   3e-150   
ref|XP_004962102.1|  PREDICTED: WAT1-related protein At5g07050-like     449   3e-150   
ref|XP_004144320.1|  PREDICTED: auxin-induced protein 5NG4-like         449   1e-149   
gb|ACR34989.1|  unknown                                                 447   1e-149   Zea mays [maize]
ref|XP_008455745.1|  PREDICTED: WAT1-related protein At5g07050-like     448   4e-149   
gb|EMT31802.1|  Auxin-induced protein 5NG4                              445   9e-149   
ref|NP_196322.3|  nodulin MtN21 /EamA-like transporter family pro...    444   3e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151540.1|  PREDICTED: auxin-induced protein 5NG4-like         443   5e-148   
ref|XP_010423261.1|  PREDICTED: WAT1-related protein At5g07050          443   6e-148   
ref|XP_003628011.1|  Auxin-induced protein 5NG4                         442   8e-148   
dbj|BAK04850.1|  predicted protein                                      442   1e-147   
ref|XP_010456426.1|  PREDICTED: WAT1-related protein At5g07050-like     442   1e-147   
ref|XP_006654584.1|  PREDICTED: WAT1-related protein At5g07050-like     442   1e-147   
gb|EYU26922.1|  hypothetical protein MIMGU_mgv1a007458mg                442   2e-147   
gb|EEC79453.1|  hypothetical protein OsI_20446                          441   3e-147   Oryza sativa Indica Group [Indian rice]
ref|NP_001055921.1|  Os05g0493800                                       441   3e-147   Oryza sativa Japonica Group [Japonica rice]
gb|AFW82369.1|  hypothetical protein ZEAMMB73_445023                    440   6e-147   
gb|EMT14666.1|  Auxin-induced protein 5NG4                              440   1e-146   
ref|XP_006289728.1|  hypothetical protein CARUB_v10003296mg             437   1e-145   
ref|XP_009790910.1|  PREDICTED: WAT1-related protein At5g07050-li...    434   8e-145   
ref|XP_009610630.1|  PREDICTED: WAT1-related protein At5g07050-li...    432   5e-144   
ref|XP_010495095.1|  PREDICTED: WAT1-related protein At5g07050-like     433   6e-144   
ref|NP_001151393.1|  nodulin-like protein                               432   1e-143   Zea mays [maize]
gb|AFW78503.1|  nodulin-like protein                                    430   5e-143   
ref|XP_004499808.1|  PREDICTED: WAT1-related protein At5g07050-like     431   5e-143   
ref|XP_009621490.1|  PREDICTED: WAT1-related protein At5g07050-li...    427   2e-142   
ref|NP_001170095.1|  hypothetical protein                               431   3e-142   Zea mays [maize]
gb|ABR16695.1|  unknown                                                 429   4e-142   Picea sitchensis
gb|KGN54680.1|  hypothetical protein Csa_4G420210                       427   3e-141   
emb|CAA75575.1|  MtN21                                                  426   3e-141   Medicago truncatula
ref|XP_011091919.1|  PREDICTED: WAT1-related protein At5g07050-like     425   5e-141   
ref|XP_004511088.1|  PREDICTED: WAT1-related protein At5g07050-like     425   1e-140   
gb|ABR18253.1|  unknown                                                 426   1e-140   Picea sitchensis
ref|XP_008443232.1|  PREDICTED: WAT1-related protein At5g07050-like     424   2e-140   
gb|KGN59420.1|  hypothetical protein Csa_3G819280                       423   3e-140   
gb|ADN33888.1|  nodulin-like protein                                    422   3e-140   
ref|XP_004136770.1|  PREDICTED: auxin-induced protein 5NG4-like         418   8e-139   
gb|ABK25095.1|  unknown                                                 416   3e-137   Picea sitchensis
gb|AFW81938.1|  hypothetical protein ZEAMMB73_476289                    417   2e-136   
ref|XP_007133643.1|  hypothetical protein PHAVU_011G196800g             411   2e-135   
ref|XP_003566095.1|  PREDICTED: WAT1-related protein At5g07050-like     410   2e-135   
ref|XP_004170561.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-induce...    410   3e-135   
gb|KHN12183.1|  Auxin-induced protein 5NG4                              408   8e-135   
ref|XP_002440000.1|  hypothetical protein SORBIDRAFT_09g024200          406   8e-134   Sorghum bicolor [broomcorn]
emb|CBI35062.3|  unnamed protein product                                405   8e-134   
ref|XP_004493328.1|  PREDICTED: WAT1-related protein At5g07050-li...    392   3e-129   
ref|XP_008231618.1|  PREDICTED: WAT1-related protein At5g07050          385   3e-126   
emb|CDX79964.1|  BnaA05g01920D                                          383   1e-124   
ref|XP_009142715.1|  PREDICTED: WAT1-related protein At2g40900-like     381   8e-124   
ref|XP_006411357.1|  hypothetical protein EUTSA_v10016763mg             380   2e-123   
emb|CDY53669.1|  BnaC04g52190D                                          380   3e-123   
ref|XP_006402969.1|  hypothetical protein EUTSA_v10006038mg             379   3e-123   
ref|NP_181622.2|  nodulin MtN21-like transporter family protein         379   8e-123   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525433.1|  PREDICTED: WAT1-related protein At2g40900          377   3e-122   
ref|XP_006294359.1|  hypothetical protein CARUB_v10023376mg             377   4e-122   
ref|NP_001044551.1|  Os01g0803300                                       374   5e-122   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010508790.1|  PREDICTED: WAT1-related protein At2g40900-like     375   1e-121   
emb|CDY06954.1|  BnaA04g23610D                                          373   9e-121   
ref|XP_009141949.1|  PREDICTED: WAT1-related protein At2g40900-like     372   3e-120   
gb|AAB86450.1|  putative integral membrane protein nodulin              372   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881745.1|  nodulin MtN21 family protein                       372   5e-120   
ref|XP_010517531.1|  PREDICTED: WAT1-related protein At2g40900          371   7e-120   
ref|XP_003566093.1|  PREDICTED: uncharacterized protein LOC100824174    382   1e-119   
ref|XP_010312165.1|  PREDICTED: WAT1-related protein At5g07050-li...    363   1e-118   
ref|XP_002878097.1|  hypothetical protein ARALYDRAFT_486104             366   2e-118   
emb|CDY14752.1|  BnaC04g47490D                                          364   2e-117   
emb|CDY68060.1|  BnaCnng57410D                                          363   5e-117   
emb|CDY35431.1|  BnaA03g19290D                                          363   6e-117   
gb|EMS55812.1|  Auxin-induced protein 5NG4                              362   6e-117   
ref|NP_191221.1|  nodulin MtN21-like transporter family protein         362   2e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427495.1|  PREDICTED: WAT1-related protein At3g56620 is...    361   2e-116   
ref|XP_009133465.1|  PREDICTED: WAT1-related protein At2g40900-like     361   6e-116   
emb|CDX76001.1|  BnaA04g02650D                                          360   8e-116   
gb|AAM64766.1|  nodulin-like protein                                    358   3e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516269.1|  PREDICTED: WAT1-related protein At3g56620-like     358   3e-115   
ref|XP_010504569.1|  PREDICTED: WAT1-related protein At3g56620-like     357   8e-115   
ref|XP_009139089.1|  PREDICTED: WAT1-related protein At3g56620-like     357   8e-115   
ref|XP_010664224.1|  PREDICTED: WAT1-related protein At1g21890          357   2e-114   
gb|KFK34904.1|  hypothetical protein AALP_AA5G208800                    355   4e-114   
emb|CDY56779.1|  BnaAnng14440D                                          355   9e-114   
ref|XP_010063373.1|  PREDICTED: WAT1-related protein At4g08300-like     354   1e-113   
ref|XP_010505847.1|  PREDICTED: WAT1-related protein At2g40900-like     354   1e-113   
ref|XP_007010783.1|  Nodulin MtN21 /EamA-like transporter family ...    351   1e-112   
ref|XP_009116364.1|  PREDICTED: WAT1-related protein At3g56620          351   2e-112   
ref|XP_010274315.1|  PREDICTED: WAT1-related protein At1g21890          351   3e-112   
emb|CDX72122.1|  BnaC08g27520D                                          350   4e-112   
gb|KDP32785.1|  hypothetical protein JCGZ_12077                         348   2e-111   
ref|XP_010272782.1|  PREDICTED: WAT1-related protein At1g21890-like     348   3e-111   
ref|XP_002302243.2|  nodulin MtN21 family protein                       348   5e-111   Populus trichocarpa [western balsam poplar]
ref|XP_009104012.1|  PREDICTED: WAT1-related protein At3g56620-like     347   6e-111   
gb|KHG29332.1|  Auxin-induced 5NG4                                      344   1e-109   
ref|XP_011027560.1|  PREDICTED: WAT1-related protein At4g08300-like     343   4e-109   
gb|KHG16518.1|  Auxin-induced 5NG4                                      343   4e-109   
gb|ABS52574.1|  nodulin family protein                                  342   7e-109   Gossypium hirsutum [American cotton]
ref|XP_007133644.1|  hypothetical protein PHAVU_011G1969001g            339   9e-109   
gb|KHG29659.1|  Auxin-induced 5NG4                                      342   1e-108   
gb|KHG18008.1|  Auxin-induced 5NG4                                      342   1e-108   
tpg|DAA57218.1|  TPA: hypothetical protein ZEAMMB73_947627              338   1e-108   
ref|XP_002306626.2|  hypothetical protein POPTR_0005s15810g             341   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_011074856.1|  PREDICTED: WAT1-related protein At1g44800-like     341   2e-108   
gb|KHG23400.1|  Auxin-induced 5NG4                                      341   2e-108   
ref|XP_007019027.1|  Nodulin MtN21 /EamA-like transporter family ...    341   3e-108   
emb|CDX94896.1|  BnaC05g07750D                                          339   8e-108   
ref|XP_010260186.1|  PREDICTED: WAT1-related protein At2g39510-like     339   1e-107   
gb|KGN54575.1|  hypothetical protein Csa_4G365050                       338   2e-107   
ref|XP_003566085.1|  PREDICTED: WAT1-related protein At5g07050-like     339   2e-107   
ref|XP_007223359.1|  hypothetical protein PRUPE_ppa007464mg             338   2e-107   
ref|XP_009344114.1|  PREDICTED: WAT1-related protein At4g08300-like     337   3e-107   
ref|XP_008782344.1|  PREDICTED: WAT1-related protein At1g21890-like     338   4e-107   
ref|XP_010091381.1|  Auxin-induced protein 5NG4                         336   8e-107   
ref|XP_008391905.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    336   1e-106   
gb|KFK42327.1|  hypothetical protein AALP_AA2G241800                    336   2e-106   
ref|XP_010253282.1|  PREDICTED: WAT1-related protein At2g39510-like     335   4e-106   
ref|XP_009340894.1|  PREDICTED: WAT1-related protein At1g21890-like     334   5e-106   
ref|XP_010534673.1|  PREDICTED: WAT1-related protein At1g21890 is...    336   6e-106   
ref|XP_011069552.1|  PREDICTED: WAT1-related protein At1g21890-like     335   7e-106   
ref|XP_008369847.1|  PREDICTED: WAT1-related protein At2g37460-like     334   7e-106   
ref|XP_009623147.1|  PREDICTED: WAT1-related protein At4g08300 is...    335   9e-106   
ref|XP_008802062.1|  PREDICTED: WAT1-related protein At1g21890-like     333   1e-105   
ref|XP_004290852.1|  PREDICTED: auxin-induced protein 5NG4-like         333   2e-105   
ref|XP_007019030.1|  Nodulin MtN21 /EamA-like transporter family ...    333   2e-105   
gb|KHG10291.1|  Auxin-induced 5NG4                                      333   3e-105   
ref|XP_009377106.1|  PREDICTED: WAT1-related protein At2g37460-like     332   4e-105   
emb|CDY00403.1|  BnaC07g14230D                                          332   5e-105   
ref|XP_009623146.1|  PREDICTED: WAT1-related protein At4g08300 is...    333   7e-105   
ref|XP_008219662.1|  PREDICTED: WAT1-related protein At1g21890-like     332   8e-105   
ref|XP_008444144.1|  PREDICTED: WAT1-related protein At1g44800-like     331   1e-104   
gb|ACD56621.1|  putative nodulin-like protein                           331   1e-104   Gossypioides kirkii
ref|XP_006661686.1|  PREDICTED: WAT1-related protein At4g08290-like     330   1e-104   
ref|XP_010999364.1|  PREDICTED: WAT1-related protein At4g08300-like     331   2e-104   
gb|EEC66707.1|  hypothetical protein OsI_33030                          330   2e-104   Oryza sativa Indica Group [Indian rice]
ref|XP_010544709.1|  PREDICTED: WAT1-related protein At4g08290 is...    330   4e-104   
ref|XP_010926422.1|  PREDICTED: WAT1-related protein At1g21890-like     330   4e-104   
ref|XP_004983289.1|  PREDICTED: WAT1-related protein At4g08290-like     329   5e-104   
ref|XP_009340891.1|  PREDICTED: WAT1-related protein At4g08290-like     330   6e-104   
ref|XP_007141061.1|  hypothetical protein PHAVU_008G164000g             329   7e-104   
ref|XP_003544681.1|  PREDICTED: WAT1-related protein At1g44800-like     329   7e-104   
ref|NP_001064323.1|  Os10g0210500                                       328   1e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006472756.1|  PREDICTED: WAT1-related protein At1g21890-like     328   1e-103   
ref|XP_010554740.1|  PREDICTED: WAT1-related protein At2g40900-like     328   2e-103   
ref|XP_006434165.1|  hypothetical protein CICLE_v10001460mg             328   2e-103   
gb|KFK44291.1|  hypothetical protein AALP_AA1G239100                    328   2e-103   
ref|XP_009767374.1|  PREDICTED: WAT1-related protein At4g08300-like     328   2e-103   
ref|XP_010916579.1|  PREDICTED: WAT1-related protein At1g21890-like     328   2e-103   
emb|CDY04680.1|  BnaC05g17180D                                          328   2e-103   
emb|CDP15800.1|  unnamed protein product                                328   2e-103   
ref|XP_002528467.1|  Auxin-induced protein 5NG4, putative               328   3e-103   Ricinus communis
ref|XP_010459911.1|  PREDICTED: WAT1-related protein At1g21890          328   4e-103   
ref|XP_008219763.1|  PREDICTED: WAT1-related protein At4g08300          327   4e-103   
ref|XP_002306625.2|  hypothetical protein POPTR_0005s15820g             327   5e-103   Populus trichocarpa [western balsam poplar]
ref|XP_004290853.1|  PREDICTED: auxin-induced protein 5NG4-like         327   5e-103   
gb|EYU23896.1|  hypothetical protein MIMGU_mgv1a008243mg                327   5e-103   
ref|XP_010064999.1|  PREDICTED: WAT1-related protein At4g08300-like     327   5e-103   
ref|XP_010498646.1|  PREDICTED: WAT1-related protein At1g21890-like     327   5e-103   
gb|KCW49646.1|  hypothetical protein EUGRSUZ_K03164                     328   9e-103   
ref|XP_006593592.1|  PREDICTED: WAT1-related protein At1g44800-like     327   9e-103   
ref|XP_006307681.1|  hypothetical protein CARUB_v10009309mg             327   1e-102   
ref|XP_010477438.1|  PREDICTED: WAT1-related protein At1g21890-like     327   1e-102   
ref|XP_004302750.1|  PREDICTED: auxin-induced protein 5NG4-like         325   1e-102   
ref|XP_010037869.1|  PREDICTED: WAT1-related protein At2g37460-like     325   3e-102   
ref|XP_010999362.1|  PREDICTED: WAT1-related protein At4g08290 is...    325   3e-102   
ref|XP_006416254.1|  hypothetical protein EUTSA_v10007890mg             325   4e-102   
emb|CDY01310.1|  BnaA07g10830D                                          325   5e-102   
ref|XP_009390255.1|  PREDICTED: WAT1-related protein At1g21890-like     324   6e-102   
ref|XP_009103277.1|  PREDICTED: WAT1-related protein At1g21890          324   1e-101   
ref|XP_009346345.1|  PREDICTED: WAT1-related protein At1g21890-like     324   1e-101   
ref|XP_004142085.1|  PREDICTED: auxin-induced protein 5NG4-like         323   1e-101   
gb|ACU23200.1|  unknown                                                 323   2e-101   Glycine max [soybeans]
ref|XP_009390894.1|  PREDICTED: WAT1-related protein At1g21890-like     323   2e-101   
ref|XP_008241503.1|  PREDICTED: WAT1-related protein At2g37460-like     323   2e-101   
ref|XP_002893187.1|  T26F17.11                                          323   2e-101   
ref|XP_009398157.1|  PREDICTED: WAT1-related protein At1g21890-like     322   2e-101   
ref|XP_007205382.1|  hypothetical protein PRUPE_ppa007333mg             322   3e-101   
ref|XP_002274909.2|  PREDICTED: WAT1-related protein At2g37460-like     323   4e-101   Vitis vinifera
gb|KHG10292.1|  Auxin-induced 5NG4                                      322   4e-101   
ref|NP_001240202.1|  uncharacterized protein LOC100811114               322   7e-101   
ref|XP_004493898.1|  PREDICTED: WAT1-related protein At2g37460-li...    321   9e-101   
ref|XP_006351896.1|  PREDICTED: WAT1-related protein At4g08300-like     321   9e-101   
ref|XP_010939363.1|  PREDICTED: WAT1-related protein At1g21890 is...    321   1e-100   
ref|XP_010538980.1|  PREDICTED: WAT1-related protein At4g08300          321   1e-100   
ref|XP_008447554.1|  PREDICTED: WAT1-related protein At2g37460-like     320   2e-100   
ref|XP_009363179.1|  PREDICTED: WAT1-related protein At1g21890-like     320   2e-100   
ref|NP_173607.1|  WAT1-related protein                                  320   2e-100   
gb|KHN47031.1|  Auxin-induced protein 5NG4-like protein                 320   2e-100   
ref|XP_007009430.1|  Nodulin MtN21 /EamA-like transporter family ...    320   2e-100   
ref|XP_010669710.1|  PREDICTED: WAT1-related protein At4g08300-like     320   3e-100   
ref|NP_001137108.1|  hypothetical protein                               319   3e-100   
ref|XP_007223104.1|  hypothetical protein PRUPE_ppa007123mg             319   7e-100   
ref|XP_007223097.1|  hypothetical protein PRUPE_ppa007061mg             319   7e-100   
ref|XP_008388240.1|  PREDICTED: WAT1-related protein At1g21890          319   8e-100   
dbj|BAK04730.1|  predicted protein                                      318   9e-100   
ref|XP_009151420.1|  PREDICTED: WAT1-related protein At4g08300 is...    318   1e-99    
ref|XP_008233581.1|  PREDICTED: WAT1-related protein At2g39510-li...    317   1e-99    
gb|AAL38712.1|  putative nodulin protein                                318   1e-99    
emb|CDY49560.1|  BnaAnng10230D                                          318   1e-99    
gb|KHN09198.1|  Auxin-induced protein 5NG4                              318   2e-99    
ref|XP_006581581.1|  PREDICTED: WAT1-related protein At4g08300          318   2e-99    
ref|XP_004498328.1|  PREDICTED: WAT1-related protein At1g44800-li...    318   2e-99    
ref|XP_008219762.1|  PREDICTED: WAT1-related protein At4g08290          318   2e-99    
ref|XP_011027136.1|  PREDICTED: WAT1-related protein At2g39510-like     318   2e-99    
ref|XP_003521346.1|  PREDICTED: WAT1-related protein At2g37460-like     317   2e-99    
ref|XP_010911519.1|  PREDICTED: WAT1-related protein At5g07050-like     315   2e-99    
ref|XP_004161682.1|  PREDICTED: auxin-induced protein 5NG4-like         317   2e-99    
ref|XP_009409675.1|  PREDICTED: WAT1-related protein At1g21890-like     317   3e-99    
ref|XP_002315243.2|  hypothetical protein POPTR_0010s21630g             317   3e-99    
ref|XP_007144467.1|  hypothetical protein PHAVU_007G158600g             317   3e-99    
emb|CDY63388.1|  BnaCnng41950D                                          317   4e-99    
ref|XP_008391904.1|  PREDICTED: WAT1-related protein At1g21890-like     317   5e-99    
emb|CBI32681.3|  unnamed protein product                                317   5e-99    
ref|XP_006296517.1|  hypothetical protein CARUB_v10025706mg             316   6e-99    
ref|XP_009614496.1|  PREDICTED: WAT1-related protein At2g37460-li...    316   7e-99    
ref|XP_011023754.1|  PREDICTED: LOW QUALITY PROTEIN: WAT1-related...    315   8e-99    
ref|XP_002284452.2|  PREDICTED: WAT1-related protein At4g08290          316   8e-99    
ref|XP_010684183.1|  PREDICTED: WAT1-related protein At2g37460-like     316   8e-99    
ref|XP_004250321.2|  PREDICTED: WAT1-related protein At4g08300-like     317   9e-99    
ref|XP_004145365.1|  PREDICTED: auxin-induced protein 5NG4-like         315   1e-98    
ref|XP_010427496.1|  PREDICTED: WAT1-related protein At3g56620 is...    315   1e-98    
ref|XP_008371417.1|  PREDICTED: WAT1-related protein At2g39510-like     314   2e-98    
gb|KGN61714.1|  hypothetical protein Csa_2G231960                       315   2e-98    
ref|XP_010530196.1|  PREDICTED: WAT1-related protein At4g08300-like     313   2e-98    
gb|EYU22954.1|  hypothetical protein MIMGU_mgv1a0088041mg               315   2e-98    
gb|AAF16542.1|AC013482_16  T26F17.11                                    315   2e-98    
ref|XP_009778852.1|  PREDICTED: WAT1-related protein At2g37460-li...    315   2e-98    
gb|KHN09434.1|  Auxin-induced protein 5NG4                              315   2e-98    
gb|KFK36842.1|  hypothetical protein AALP_AA4G179000                    314   3e-98    
gb|AGZ85011.1|  hypothetical protein 6                                  315   3e-98    
gb|KHN02414.1|  Auxin-induced protein 5NG4-like protein                 315   3e-98    
ref|XP_003601053.1|  Auxin-induced protein 5NG4                         315   4e-98    
ref|NP_192570.2|  nodulin MtN21 /EamA-like transporter family pro...    314   4e-98    
gb|AFK47115.1|  unknown                                                 314   5e-98    
emb|CDY20446.1|  BnaC04g05980D                                          314   5e-98    
ref|NP_181282.1|  nodulin MtN21-like transporter family protein         314   5e-98    
ref|XP_002513792.1|  Auxin-induced protein 5NG4, putative               314   5e-98    
ref|XP_009143306.1|  PREDICTED: WAT1-related protein At2g39510-like     314   5e-98    
ref|XP_003553527.1|  PREDICTED: WAT1-related protein At2g37460-like     314   5e-98    
gb|KHG11891.1|  Auxin-induced 5NG4                                      314   6e-98    
ref|XP_010063982.1|  PREDICTED: WAT1-related protein At4g08290-like     313   6e-98    
ref|XP_002312071.1|  nodulin MtN21 family protein                       314   6e-98    
ref|XP_010682440.1|  PREDICTED: WAT1-related protein At4g08300-like     314   7e-98    
gb|AFK35679.1|  unknown                                                 313   8e-98    
ref|XP_010517305.1|  PREDICTED: WAT1-related protein At2g39510          313   8e-98    
ref|XP_002308146.2|  hypothetical protein POPTR_0006s08270g             315   8e-98    
ref|XP_009143490.1|  PREDICTED: WAT1-related protein At2g37460-like     313   9e-98    
emb|CAB45800.1|  nodulin-like protein                                   313   9e-98    
ref|XP_007137403.1|  hypothetical protein PHAVU_009G124100g             314   9e-98    
ref|XP_010505629.1|  PREDICTED: WAT1-related protein At2g39510-like     313   9e-98    
ref|XP_003537193.1|  PREDICTED: WAT1-related protein At2g37460-li...    313   1e-97    
ref|XP_003625520.1|  Auxin-induced protein 5NG4                         313   1e-97    
ref|XP_008466700.1|  PREDICTED: WAT1-related protein At4g08290          313   1e-97    
ref|XP_009388785.1|  PREDICTED: WAT1-related protein At1g21890-like     312   1e-97    
gb|AFK37217.1|  unknown                                                 313   1e-97    
ref|XP_010509005.1|  PREDICTED: WAT1-related protein At2g39510-like     313   2e-97    
emb|CDY53594.1|  BnaA05g34670D                                          313   2e-97    
ref|XP_006397314.1|  hypothetical protein EUTSA_v10028745mg             312   2e-97    
gb|KFK36195.1|  hypothetical protein AALP_AA4G090300                    312   2e-97    
gb|ACJ84735.1|  unknown                                                 312   2e-97    
ref|XP_009141815.1|  PREDICTED: WAT1-related protein At2g39510          312   2e-97    
ref|XP_002881660.1|  nodulin MtN21 family protein                       312   3e-97    
ref|XP_002489200.1|  hypothetical protein SORBIDRAFT_0012s002110        312   3e-97    
ref|NP_181483.1|  nodulin MtN21-like transporter family protein         312   3e-97    
ref|XP_010039216.1|  PREDICTED: WAT1-related protein At2g37460-like     312   3e-97    
ref|XP_004246473.1|  PREDICTED: WAT1-related protein At2g37460-like     312   3e-97    
ref|XP_006341065.1|  PREDICTED: WAT1-related protein At2g37460-like     312   3e-97    
ref|XP_011019904.1|  PREDICTED: WAT1-related protein At2g37460-li...    310   5e-97    
ref|XP_002872390.1|  nodulin MtN21 family protein                       311   6e-97    
emb|CDX93378.1|  BnaC04g45180D                                          311   6e-97    
ref|XP_003590513.1|  Auxin-induced protein 5NG4                         311   6e-97    
gb|KCW49650.1|  hypothetical protein EUGRSUZ_K03168                     313   7e-97    
ref|XP_006411179.1|  hypothetical protein EUTSA_v10016823mg             311   7e-97    
ref|XP_007162672.1|  hypothetical protein PHAVU_001G170400g             311   8e-97    
ref|XP_006294412.1|  hypothetical protein CARUB_v10023430mg             311   9e-97    
ref|XP_010517017.1|  PREDICTED: WAT1-related protein At2g37460          310   1e-96    
gb|KFK36632.1|  hypothetical protein AALP_AA4G149800                    310   2e-96    
gb|KHN05928.1|  Auxin-induced protein 5NG4                              310   2e-96    
ref|XP_006410933.1|  hypothetical protein EUTSA_v10016799mg             310   2e-96    
ref|XP_010509331.1|  PREDICTED: WAT1-related protein At2g37460-like     310   2e-96    
ref|XP_010669871.1|  PREDICTED: WAT1-related protein At2g39510          309   2e-96    
gb|EMS45454.1|  Auxin-induced protein 5NG4                              309   3e-96    
gb|AFK37263.1|  unknown                                                 310   3e-96    
ref|XP_006287944.1|  hypothetical protein CARUB_v10001177mg             309   3e-96    
gb|AFK35983.1|  unknown                                                 309   3e-96    
ref|XP_009347451.1|  PREDICTED: WAT1-related protein At2g39510-like     308   4e-96    
ref|XP_010438422.1|  PREDICTED: WAT1-related protein At4g08290-like     310   4e-96    
gb|KFK32145.1|  hypothetical protein AALP_AA6G204100                    309   4e-96    
ref|XP_010529854.1|  PREDICTED: WAT1-related protein At2g37460-like     309   5e-96    
gb|EYU28266.1|  hypothetical protein MIMGU_mgv1a008729mg                308   5e-96    
ref|XP_002284458.1|  PREDICTED: WAT1-related protein At4g08290 is...    309   6e-96    
gb|KHG26265.1|  Auxin-induced 5NG4                                      308   7e-96    
ref|XP_010063981.1|  PREDICTED: WAT1-related protein At4g08290-like     308   8e-96    
ref|XP_002872388.1|  hypothetical protein ARALYDRAFT_489740             308   8e-96    
ref|XP_010505334.1|  PREDICTED: WAT1-related protein At2g37460-like     308   1e-95    
ref|XP_010421740.1|  PREDICTED: WAT1-related protein At4g08300-li...    308   1e-95    
ref|XP_008646318.1|  PREDICTED: WAT1-related protein At1g44800-like     308   1e-95    
ref|XP_007009428.1|  Nodulin MtN21 /EamA-like transporter family ...    308   1e-95    
ref|XP_009151422.1|  PREDICTED: WAT1-related protein At4g08290          308   1e-95    
emb|CDX75163.1|  BnaC09g25190D                                          308   1e-95    
ref|XP_004955229.1|  PREDICTED: WAT1-related protein At1g21890-like     308   2e-95    
gb|ABB47055.1|  nodulin MtN21 family protein, putative, expressed       305   2e-95    
emb|CDX93255.1|  BnaC04g46410D                                          306   3e-95    
ref|XP_004307548.1|  PREDICTED: auxin-induced protein 5NG4-like         305   4e-95    
emb|CDY07016.1|  BnaA04g22990D                                          306   5e-95    
ref|XP_006397315.1|  hypothetical protein EUTSA_v10028726mg             306   5e-95    
ref|XP_010455252.1|  PREDICTED: WAT1-related protein At4g08300          306   6e-95    
ref|XP_009798400.1|  PREDICTED: WAT1-related protein At2g39510          306   6e-95    
emb|CDY29141.1|  BnaA09g53940D                                          306   6e-95    
ref|XP_010553301.1|  PREDICTED: WAT1-related protein At2g37460-like     306   7e-95    
ref|XP_006289117.1|  hypothetical protein CARUB_v10002538mg             306   9e-95    
ref|XP_002893995.1|  nodulin MtN21 family protein                       305   1e-94    
ref|XP_011094815.1|  PREDICTED: WAT1-related protein At2g37460-like     305   1e-94    
ref|XP_010039215.1|  PREDICTED: WAT1-related protein At2g37460-like     306   1e-94    
ref|XP_011070209.1|  PREDICTED: WAT1-related protein At5g07050-like     300   1e-94    
ref|XP_010455250.1|  PREDICTED: WAT1-related protein At4g08290-like     305   1e-94    
ref|XP_010999363.1|  PREDICTED: WAT1-related protein At4g08290 is...    303   1e-94    
ref|XP_010421738.1|  PREDICTED: WAT1-related protein At4g08290          305   2e-94    
ref|NP_175101.1|  bidirectional amino acid transporter SIAR1            305   2e-94    
ref|XP_009107474.1|  PREDICTED: WAT1-related protein At1g44800          305   2e-94    
ref|XP_010534481.1|  PREDICTED: WAT1-related protein At2g39510-like     305   2e-94    
emb|CBI19038.3|  unnamed protein product                                307   3e-94    
ref|XP_006436050.1|  hypothetical protein CICLE_v10031857mg             304   3e-94    
emb|CDX79734.1|  BnaC03g20700D                                          303   3e-94    
ref|XP_010436420.1|  PREDICTED: WAT1-related protein At4g08300-like     304   3e-94    
gb|EEC74071.1|  hypothetical protein OsI_09081                          304   4e-94    
emb|CDY07788.1|  BnaA03g17230D                                          303   4e-94    
ref|XP_009347454.1|  PREDICTED: WAT1-related protein At2g39510-like     303   4e-94    
ref|XP_009133180.1|  PREDICTED: WAT1-related protein At2g37460-like     303   5e-94    
ref|XP_009625314.1|  PREDICTED: WAT1-related protein At2g39510-like     303   6e-94    
ref|XP_007218251.1|  hypothetical protein PRUPE_ppa008064mg             302   6e-94    
emb|CDY18444.1|  BnaA04g21430D                                          303   7e-94    
ref|XP_002454615.1|  hypothetical protein SORBIDRAFT_04g034330          303   8e-94    
gb|AAM62626.1|  nodulin protein, putative                               303   8e-94    
gb|KCW49647.1|  hypothetical protein EUGRSUZ_K03165                     306   1e-93    
gb|KDP35589.1|  hypothetical protein JCGZ_09027                         303   1e-93    
emb|CDY12554.1|  BnaC06g00800D                                          303   1e-93    
emb|CDY63536.1|  BnaCnng42250D                                          301   1e-93    
gb|AAM65570.1|  nodulin-like protein                                    303   1e-93    
emb|CDY14996.1|  BnaA10g08600D                                          303   1e-93    
ref|XP_003544696.1|  PREDICTED: WAT1-related protein At4g08290-like     302   1e-93    
ref|NP_001048238.1|  Os02g0768300                                       303   1e-93    
ref|XP_009141663.1|  PREDICTED: WAT1-related protein At2g37460          302   1e-93    
ref|XP_007027104.1|  Nodulin MtN21 /EamA-like transporter family ...    303   2e-93    
dbj|BAC43205.1|  putative nodulin                                       302   2e-93    
ref|XP_003543089.1|  PREDICTED: WAT1-related protein At4g08290-li...    301   2e-93    
gb|AAM62850.1|  nodulin-like protein                                    301   2e-93    
ref|NP_192569.1|  nodulin MtN21 /EamA-like transporter family pro...    302   2e-93    
ref|XP_007141063.1|  hypothetical protein PHAVU_008G164200g             301   2e-93    
ref|XP_009123503.1|  PREDICTED: WAT1-related protein At1g44800-like     302   2e-93    
ref|XP_010664225.1|  PREDICTED: WAT1-related protein At4g08290 is...    301   3e-93    
gb|EMS60728.1|  Auxin-induced protein 5NG4                              302   3e-93    
ref|XP_010421739.1|  PREDICTED: WAT1-related protein At4g08300-li...    301   5e-93    
ref|XP_006649078.1|  PREDICTED: WAT1-related protein At1g21890-like     300   5e-93    
ref|XP_006305116.1|  hypothetical protein CARUB_v10009485mg             301   6e-93    
ref|XP_009357771.1|  PREDICTED: WAT1-related protein At2g39510-like     299   6e-93    
dbj|BAJ98418.1|  predicted protein                                      301   7e-93    
ref|XP_007019025.1|  Nodulin MtN21 /EamA-like transporter family ...    300   8e-93    
gb|EPS73987.1|  hypothetical protein M569_00767                         298   9e-93    
ref|XP_006655900.1|  PREDICTED: WAT1-related protein At1g21890-like     300   1e-92    
ref|XP_003542469.1|  PREDICTED: WAT1-related protein At2g37460-like     300   1e-92    
gb|KHN04117.1|  Auxin-induced protein 5NG4                              299   1e-92    
ref|XP_010479058.1|  PREDICTED: WAT1-related protein At1g44800-like     299   2e-92    
ref|XP_010461452.1|  PREDICTED: WAT1-related protein At1g44800          299   2e-92    
ref|XP_006393710.1|  hypothetical protein EUTSA_v10011570mg             299   3e-92    
gb|EMT04611.1|  Auxin-induced protein 5NG4                              299   4e-92    
gb|KHG24903.1|  Auxin-induced 5NG4                                      298   4e-92    
gb|KHN33840.1|  Auxin-induced protein 5NG4                              298   4e-92    
ref|XP_008371332.1|  PREDICTED: WAT1-related protein At2g39510-like     297   5e-92    
gb|KHN48995.1|  Auxin-induced protein 5NG4                              298   5e-92    
dbj|BAD35697.1|  putative MtN21                                         298   7e-92    
gb|EAZ36228.1|  hypothetical protein OsJ_20548                          298   8e-92    
ref|XP_011072605.1|  PREDICTED: WAT1-related protein At2g39510-li...    298   8e-92    
emb|CDP05672.1|  unnamed protein product                                298   1e-91    
gb|EAZ00107.1|  hypothetical protein OsI_22111                          298   1e-91    
ref|XP_004164556.1|  PREDICTED: auxin-induced protein 5NG4-like         295   2e-91    
ref|XP_009337582.1|  PREDICTED: WAT1-related protein At2g39510          296   2e-91    
ref|XP_010554433.1|  PREDICTED: WAT1-related protein At2g39510-like     296   2e-91    
ref|XP_003601058.1|  Auxin-induced protein 5NG4                         296   3e-91    
ref|XP_008785769.1|  PREDICTED: WAT1-related protein At1g21890-like     305   3e-91    
gb|EMS46274.1|  Auxin-induced protein 5NG4                              296   4e-91    
ref|XP_007009429.1|  Nodulin MtN21 /EamA-like transporter family ...    298   5e-91    
ref|NP_001241603.1|  uncharacterized protein LOC100812537               295   5e-91    
ref|XP_002284091.1|  PREDICTED: WAT1-related protein At2g39510          295   6e-91    
ref|XP_011077436.1|  PREDICTED: WAT1-related protein At2g37460-like     295   8e-91    
gb|KHN09193.1|  Auxin-induced protein 5NG4                              296   8e-91    
gb|KHN47036.1|  Auxin-induced protein 5NG4-like protein                 295   9e-91    
gb|AFK33380.1|  unknown                                                 291   1e-90    
ref|NP_001148990.1|  nodulin protein                                    295   1e-90    
gb|AFK39842.1|  unknown                                                 294   1e-90    
ref|XP_010554592.1|  PREDICTED: WAT1-related protein At2g39510-like     295   1e-90    
gb|EYU38348.1|  hypothetical protein MIMGU_mgv1a009263mg                294   1e-90    
ref|XP_008370940.1|  PREDICTED: WAT1-related protein At2g39510-like     293   2e-90    
ref|XP_003601062.1|  Auxin-induced protein 5NG4                         295   2e-90    
ref|XP_003527931.1|  PREDICTED: WAT1-related protein At4g08290-like     295   2e-90    
ref|NP_001141126.1|  uncharacterized protein LOC100273211               295   3e-90    
ref|XP_006343754.1|  PREDICTED: WAT1-related protein At2g39510-like     293   5e-90    
gb|KHG12908.1|  Auxin-induced 5NG4                                      290   8e-90    
ref|XP_009141664.1|  PREDICTED: WAT1-related protein At2g37460-li...    292   2e-89    
gb|KCW65509.1|  hypothetical protein EUGRSUZ_G02914                     291   2e-89    
gb|KGN51272.1|  hypothetical protein Csa_5G505820                       291   3e-89    
ref|XP_004149823.1|  PREDICTED: auxin-induced protein 5NG4-like         291   3e-89    
emb|CDY18443.1|  BnaA04g21440D                                          291   4e-89    
gb|EMT33815.1|  Auxin-induced protein 5NG4                              291   4e-89    



>ref|XP_002517269.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF45062.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=372

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/335 (84%), Positives = 309/335 (92%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  GCLG+F Q+ KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFAT AI
Sbjct  1     MEGN-GCLGSFIQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATLAI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERKVRPKITF +F+QIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALVLERKVRPKITFPMFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKVDIKKVRCQAKV+GT+VTV GAMLMTLYKGH +NF+WS  +H  S+++
Sbjct  120   TFVMAVLCRMEKVDIKKVRCQAKVIGTIVTVAGAMLMTLYKGHVINFIWSEHVH--SQTS  177

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P  ++  S KDW+KGSILLI+ATLAWASFFI+QA+TLR+Y AQLSL +LVCFMGTLQSI
Sbjct  178   APAATTGSSDKDWLKGSILLIIATLAWASFFILQAVTLRRYAAQLSLTSLVCFMGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ S WTIGWDMNLLAAAYAGIVSS IAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHKPSAWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFIL EKI++GG++GAVLIV GLYAVLWG
Sbjct  298   IVAIMGSFILTEKIFLGGVLGAVLIVAGLYAVLWG  332



>ref|XP_009620096.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=411

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/336 (85%), Positives = 310/336 (92%), Gaps = 1/336 (0%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK  C  +FFQ+AKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGKGECGCSFFQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERK+RPK++  +FLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFALILERKIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAV+CRMEKVDIKKVRCQAKV+GT+VTV GAMLMTLYKGH VN LWSN I+ T+ S+
Sbjct  121   TFVMAVICRMEKVDIKKVRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLWSNHINSTTNSS  180

Query  925   VPQTSSA-DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             + +TS A +S KDW KGSILLI AT AWASFFI+Q IT+RKYTA LSL ALVCFMGTLQS
Sbjct  181   ISETSGATNSDKDWFKGSILLIFATFAWASFFILQNITMRKYTAPLSLTALVCFMGTLQS  240

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVTF MEH+ SVWTIG+DMNLLAAAYAGIVSSSIAYYVQG+VM+KRGPVFVTAFSPLMM
Sbjct  241   IAVTFVMEHKPSVWTIGFDMNLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMM  300

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAIMGSFILAEKIY+GGI+GAVLIV GLY+VLWG
Sbjct  301   IIVAIMGSFILAEKIYIGGILGAVLIVAGLYSVLWG  336



>ref|XP_006482028.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
Length=405

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/335 (84%), Positives = 309/335 (92%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK GC GNF Q+ KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGK-GCCGNFLQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALLLERKVRPKITFPIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKV+IKK+RCQAK+VGT+VTV GAMLMT+YKG+ +N +WS  IH  + S 
Sbjct  120   TFVMAVLCRMEKVEIKKIRCQAKMVGTIVTVAGAMLMTIYKGNVINLVWSQHIHSHTSSP  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP  +++ S KDW+KGSILLILATLAWASFFI+QA+T+R+Y A LSL A+VCF+GTLQSI
Sbjct  180   VPAATTS-SDKDWLKGSILLILATLAWASFFILQAVTMRRYPAHLSLTAIVCFLGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ASVWTIGWDMNLLAAAYAGIVSS IAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  239   AVTFVMEHKASVWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIYVGG +GAV+IV GLYAVLWG
Sbjct  299   IVAIMGSFILAEKIYVGGALGAVVIVIGLYAVLWG  333



>emb|CAH58631.1| nodulin-like protein [Plantago major]
Length=364

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/335 (82%), Positives = 302/335 (90%), Gaps = 1/335 (0%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG+ GC GNFF++AKPYIAMI LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGR-GCFGNFFERAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ILERKVRPKITFTIF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIILERKVRPKITFTIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAV+CRME +D+KKVRCQAK+ GT+VTV GAMLMTLYKG  +NF WS FIHP   SN
Sbjct  120   TFVMAVICRMEILDLKKVRCQAKLFGTIVTVAGAMLMTLYKGRVINFFWSQFIHPGVSSN  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P  ++  S  DW+KGSILLI ATLAWA+FFI+QAIT+RKYTA LSL ALVCF+GTLQSI
Sbjct  180   APDQTTQHSDSDWLKGSILLITATLAWAAFFILQAITMRKYTAHLSLTALVCFLGTLQSI  239

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEHR   W +GWDMNLLAAAYAGIVSS IAYYVQG++MQKRGPVFVTAFSPLMMI
Sbjct  240   AVTLVMEHRPHAWVVGWDMNLLAAAYAGIVSSGIAYYVQGLIMQKRGPVFVTAFSPLMMI  299

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAE IY+GG++GAVLIV GLY+VLWG
Sbjct  300   IVAIMGSFILAENIYLGGVLGAVLIVIGLYSVLWG  334



>ref|XP_009788498.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=389

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/335 (85%), Positives = 307/335 (92%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK  C  +FFQ+AKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGKGECGCSFFQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERK+RPK++  +FLQIFVLGLLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAM
Sbjct  61    APFALILERKIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAV+CRMEKVDIKKVRCQAKV+GT+VTV GAMLMTLYKGH VN LWSN  H T  S+
Sbjct  121   TFVMAVICRMEKVDIKKVRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLWSN--HTTINSS  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             V +TS A+S KDW KGSILLI ATLAWASFFI+Q I +RKYTA LSL ALVCFMGTLQSI
Sbjct  179   VQETSGANSDKDWFKGSILLIFATLAWASFFILQNIAMRKYTAPLSLTALVCFMGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ SVWTIG+DMNLLAAAYAGIVSSSIAYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  239   AVTFVMEHKPSVWTIGFDMNLLAAAYAGIVSSSIAYYVQGVVMEKRGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVA MGSFILAEKIY+GGI+GAVLIV GLY+VLWG
Sbjct  299   IVATMGSFILAEKIYIGGILGAVLIVAGLYSVLWG  333



>ref|XP_011070079.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=404

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/343 (87%), Positives = 320/343 (93%), Gaps = 1/343 (0%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
             F+KAKPYIAMI LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALILERKV
Sbjct  13    FEKAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAIAPFALILERKV  72

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPKITFTIF+Q+FVLGLLGPVIDQN YYAGLKFTSPTFSCA+SNMLPAMTFVMAV+CRME
Sbjct  73    RPKITFTIFMQLFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLPAMTFVMAVICRME  132

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             KV++KK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN+IHP  KS VP T  +++ K
Sbjct  133   KVNLKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINMVWSNYIHP-QKSYVPTTIDSNTDK  191

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
             DWVKGSILLI+ATLAWASFFI+QAITLRKYTAQLSL ALVCFMGTLQSIAVTF MEH+  
Sbjct  192   DWVKGSILLIIATLAWASFFILQAITLRKYTAQLSLTALVCFMGTLQSIAVTFVMEHKPH  251

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+DMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA
Sbjct  252   AWAIGFDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  311

Query  532   EKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             EKIY+GG++GAVLIV GLY+VLWGKYKEYKEKE  E I EPVK
Sbjct  312   EKIYLGGVLGAVLIVIGLYSVLWGKYKEYKEKEAEELILEPVK  354



>ref|XP_010111209.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXC30687.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=411

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/335 (82%), Positives = 308/335 (92%), Gaps = 0/335 (0%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK GC GNFFQ+AKPYIAM SLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGKVGCFGNFFQRAKPYIAMASLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERK+RPKITF IF+QIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFAIVLERKIRPKITFPIFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKVD+KK+RCQAKV+GT+VTV GAMLMTLYKG+ +NF W++ IH    S 
Sbjct  121   TFVMAVLCRMEKVDVKKIRCQAKVLGTIVTVAGAMLMTLYKGNVINFFWTDHIHHLKSSA  180

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                 ++A + KDW+KGSILLI+ATLAWASFFI+QA+T+R+Y AQLSL  LVCF+GTLQS 
Sbjct  181   PEAAAAAAADKDWLKGSILLIIATLAWASFFILQAVTMRRYQAQLSLTMLVCFIGTLQST  240

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF +EHR SVWTIGWDMNLLAAAYAGIVSSS+AYYVQG VM+KRGPVFVTAFSPLMMI
Sbjct  241   AVTFVVEHRPSVWTIGWDMNLLAAAYAGIVSSSLAYYVQGRVMEKRGPVFVTAFSPLMMI  300

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVA+MGSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  301   IVAVMGSFILAEKIYLGGVLGAVLIVMGLYSVLWG  335



>ref|XP_009790909.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
sylvestris]
Length=397

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/354 (83%), Positives = 325/354 (92%), Gaps = 2/354 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GCL +FFQ+AKPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFATAAI
Sbjct  1     MENKAGCLSSFFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLGPVIDQNFYY GLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFALVLERKLRPKMTFMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKV IKK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN IH T+ SN
Sbjct  121   TFVMAVLCRMEKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIH-TNTSN  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ S+  + KDW+KGSILLILAT AWASFFI+Q +T+RKYTA LSL ALVCFMGTLQSI
Sbjct  180   VPE-SNEPTDKDWLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+AS W IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  239   AVTLVMEHKASAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             IVAIMGSFILAEKIY+GG++GAVLIV GLY+VLWGKYKEYKEKE+  AI EPVK
Sbjct  299   IVAIMGSFILAEKIYLGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVK  352



>ref|XP_011015432.1| PREDICTED: WAT1-related protein At5g07050-like [Populus euphratica]
Length=405

 Score =   533 bits (1372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/335 (83%), Positives = 305/335 (91%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  GCLG+FF++ KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGN-GCLGSFFERCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ILERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIILERKVRPKITFPIFMQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRME VDIKKVRCQAKV+GT+VTV GAM MTLYKG A+N +WS  +H  + S 
Sbjct  120   TFVMAVLCRMEIVDIKKVRCQAKVIGTIVTVAGAMFMTLYKGQAINLMWSEHVHTRTSSA  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                  SAD  KDW+ GSILLI+ATLAWASFFI+QA+TLR+Y+AQLSL  +VCF+GTLQSI
Sbjct  180   TATAGSAD--KDWLMGSILLIIATLAWASFFILQAVTLRRYSAQLSLTTIVCFLGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ S WTIGWDMNLLAAAYAGIVSSSIAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHKPSAWTIGWDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIYVGG++GA+LIV GLYAVLWG
Sbjct  298   IVAIMGSFILAEKIYVGGVLGAILIVAGLYAVLWG  332



>ref|XP_009620098.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana tomentosiformis]
Length=371

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/335 (84%), Positives = 307/335 (92%), Gaps = 8/335 (2%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG+  C  +F+Q+AKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGECSC--SFYQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  58

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERK+RPK++  +FLQIFVLGLLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAM
Sbjct  59    APFALILERKIRPKMSLMMFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAM  118

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKVD+KK RCQAKV+GT+VTV GAMLMTLYKGH VN LWS      + SN
Sbjct  119   TFVMAVLCRMEKVDLKKFRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLWS------TNSN  172

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ S A+S KDWVKGSILLI ATLAWASFFI+QAIT+RKYTA LSL ALVCF+GTLQSI
Sbjct  173   VPEVSGANSDKDWVKGSILLIFATLAWASFFILQAITMRKYTAPLSLTALVCFLGTLQSI  232

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH  SVWTIG+DMNLLAAAYAGIVSSSIAYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  233   AVTFVMEHEPSVWTIGFDMNLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMI  292

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIY+GGI+GAVLIV GLY+VLWG
Sbjct  293   IVAIMGSFILAEKIYIGGILGAVLIVAGLYSVLWG  327



>ref|XP_011079091.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=382

 Score =   531 bits (1367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/335 (84%), Positives = 306/335 (91%), Gaps = 5/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K  CLG+FF+KAKPYIAMI LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MERK-ACLGSFFEKAKPYIAMICLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERKVRPKITF IF+Q+FVLGLLGPVIDQNFYY GLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALVLERKVRPKITFMIFMQMFVLGLLGPVIDQNFYYVGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRME +D+KK+RCQAKVVGTVVTV GAMLMTLYKGH +N +WSN     + SN
Sbjct  120   TFVMAVLCRMEILDMKKLRCQAKVVGTVVTVAGAMLMTLYKGHVINLVWSN----RNTSN  175

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             V    + D+ KDWVKGSILLILATLAWASFFI+QAIT+RKYTAQLSL A+VCF+GTLQSI
Sbjct  176   VAALPTQDTDKDWVKGSILLILATLAWASFFILQAITMRKYTAQLSLTAIVCFLGTLQSI  235

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEHR + W IGWDMNLLAAAYAGIVSSSIAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  236   AVTFVMEHRPNAWAIGWDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMI  295

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIYVGG++GAVLIV GLY+VLWG
Sbjct  296   IVAIMGSFILAEKIYVGGVLGAVLIVIGLYSVLWG  330



>gb|EYU20823.1| hypothetical protein MIMGU_mgv1a008005mg [Erythranthe guttata]
Length=388

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/327 (85%), Positives = 302/327 (92%), Gaps = 1/327 (0%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             GNF +KAKPYIAMI LQFGYAGMNIITKVSLN GMSHYVLVVYRHAFATAAIAPFAL+LE
Sbjct  6     GNFMEKAKPYIAMICLQFGYAGMNIITKVSLNSGMSHYVLVVYRHAFATAAIAPFALLLE  65

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRPKITFTIF+Q+FVLGLLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMAVLC
Sbjct  66    RKVRPKITFTIFMQLFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVLC  125

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEKVDIKKVRCQAKV+GTVVTV GAMLMT+YKGH +N  WSN+IHP S +N P T   +
Sbjct  126   RMEKVDIKKVRCQAKVIGTVVTVAGAMLMTVYKGHVINMFWSNYIHPRSNNNNPSTPQ-N  184

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH  722
             + KDW+ GSILLILATLAWASFFI+QAITLRKYTAQLSL A+VCF+GTLQSIAVT  MEH
Sbjct  185   ADKDWLMGSILLILATLAWASFFILQAITLRKYTAQLSLTAIVCFLGTLQSIAVTLVMEH  244

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
             +   W IG+DMNLLAAAYAGIVSSSIAYYVQG+VMQKRGPVFVTAFSPLMMIIVAIMGSF
Sbjct  245   KTDAWKIGFDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIMGSF  304

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAE IY+GG++GAVLIV GLY+VLWG
Sbjct  305   ILAENIYLGGVLGAVLIVIGLYSVLWG  331



>emb|CDP06236.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/335 (84%), Positives = 305/335 (91%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK GCLGNFF  AKPY AMI LQFGYAGMN+ITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGK-GCLGNFFHSAKPYFAMICLQFGYAGMNVITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ LERKVRPKITF IF+QIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIFLERKVRPKITFPIFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKV IKK+RCQAKV+GTVVTV GAMLMTLYKGH +N +WS  + P   S 
Sbjct  120   TFVMAVLCRMEKVHIKKIRCQAKVIGTVVTVAGAMLMTLYKGHVINLVWSEHVQPHYSSA  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                 + +D  KDWVKGSILLILATLAWASFFI+QA T+++YTA LSL +LVCFMGTLQSI
Sbjct  180   PAAAAISD--KDWVKGSILLILATLAWASFFILQAFTMKRYTAPLSLTSLVCFMGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ASVWTIGWD+NLLAAAYAGIVSSSIAYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHKASVWTIGWDINLLAAAYAGIVSSSIAYYVQGLVMEKRGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIYVGG++GA+LIVFGLY+VLWG
Sbjct  298   IVAIMGSFILAEKIYVGGVLGAILIVFGLYSVLWG  332



>ref|XP_009610629.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   530 bits (1365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/335 (83%), Positives = 308/335 (92%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GCL +FFQ+AKPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFATAAI
Sbjct  1     MENKAGCLSSFFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLGPVIDQNFYY GLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFALVLERKLRPKMTFMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKV IKK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN IH T+ SN
Sbjct  121   TFVMAVLCRMEKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIH-TNTSN  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ + A + KDW+KGSILLILAT AWASFFI+Q +T+RKYTA LSL ALVCFMGTLQSI
Sbjct  180   VPEPNEA-TDKDWLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+ S W IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  239   AVTLVMEHKTSAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  299   IVAIMGSFILAEKIYLGGVLGAVLIVAGLYSVLWG  333



>ref|XP_011040724.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=405

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/335 (83%), Positives = 304/335 (91%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  GCLG+FF++ KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGN-GCLGSFFERCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ILERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIILERKVRPKITFPIFMQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRME VDIKKVRCQAKV+GT+VTV GAM MTLYKG A+N +WS  +H  + S 
Sbjct  120   TFVMAVLCRMEIVDIKKVRCQAKVIGTIVTVAGAMFMTLYKGQAINLMWSEHVHTRTSSA  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                  SAD  KDW+ GSILLI+ATLAWASFFI+QA+TLR+Y+AQLSL  +VCF+GTLQSI
Sbjct  180   TATAGSAD--KDWLMGSILLIIATLAWASFFILQAVTLRRYSAQLSLTTIVCFLGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ S WTIGW MNLLAAAYAGIVSSSIAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHKPSAWTIGWGMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIYVGG++GA+LIV GLYAVLWG
Sbjct  298   IVAIMGSFILAEKIYVGGVLGAILIVAGLYAVLWG  332



>ref|XP_002283348.1| PREDICTED: WAT1-related protein At5g07050 [Vitis vinifera]
 emb|CBI32824.3| unnamed protein product [Vitis vinifera]
Length=396

 Score =   528 bits (1359),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/335 (83%), Positives = 306/335 (91%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK GCLG+FFQ+ KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGK-GCLGSFFQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERKVRPKIT  IFLQ+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALVLERKVRPKITLPIFLQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEK+D+KK RCQAKVVGTVVTV GAMLMTLYKG  V  +WS ++HP + + 
Sbjct  120   TFVMAVLCRMEKLDMKKFRCQAKVVGTVVTVAGAMLMTLYKGPIVEMVWSKYVHPHNSNA  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                + S+D  KDWVKGSILLI+AT AWASFFI+QAIT+R+Y A LSL ++VCF+GTLQSI
Sbjct  180   AENSGSSD--KDWVKGSILLIIATFAWASFFILQAITMRRYQAHLSLTSIVCFLGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEHR S WTIGWDMNLLAAAYAGIVSSSIAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHRPSAWTIGWDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKI++GG++GAVLIV GLY+VLWG
Sbjct  298   IVAIMGSFILAEKIFLGGVIGAVLIVAGLYSVLWG  332



>ref|XP_009621489.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Nicotiana 
tomentosiformis]
Length=397

 Score =   526 bits (1355),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 292/354 (82%), Positives = 322/354 (91%), Gaps = 2/354 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GCL +FFQ+AKPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFATAAI
Sbjct  1     MENKAGCLSSFFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLGPVIDQNFYY GLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFALVLERKLRPKMTFMMFLQIFVLGLLGPVIDQNFYYMGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKV IKK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN IH T+ SN
Sbjct  121   TFVMAVLCRMEKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIH-TNTSN  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ +   + KD +KGSILLILAT AWASFFI+Q +T+RKYTA LSL ALVCFMGTLQSI
Sbjct  180   VPEPNEV-TDKDLLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+ S W IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  239   AVTLVMEHKTSAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             IVAIMGSFILAEKIY+GG++GAVLIV GLY+VLWGKYKEYKEKE+  AI EPVK
Sbjct  299   IVAIMGSFILAEKIYIGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVK  352



>ref|XP_002308862.2| hypothetical protein POPTR_0006s03200g [Populus trichocarpa]
 gb|EEE92385.2| hypothetical protein POPTR_0006s03200g [Populus trichocarpa]
Length=405

 Score =   524 bits (1349),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 279/335 (83%), Positives = 305/335 (91%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  GCLG++FQ+ KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGN-GCLGSYFQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ILERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIILERKVRPKITFPIFMQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRME VDIKKVRCQAKV+GT+VTV GAM MTLYKG A+N +WS  ++  + S 
Sbjct  120   TFVMAVLCRMEIVDIKKVRCQAKVIGTIVTVAGAMFMTLYKGQAINLMWSKHVNTQTSSA  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                T SAD  KDW+ GSILLI+ATLAWASFFI+QA+TLR+Y+AQLSL  +VCF+GTLQSI
Sbjct  180   TATTGSAD--KDWLMGSILLIIATLAWASFFILQAVTLRRYSAQLSLTTIVCFLGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ S WTIGWDMNLLAAAYAGIVSSSIAYYVQG+VMQKRGPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHKPSAWTIGWDMNLLAAAYAGIVSSSIAYYVQGLVMQKRGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAE IYVGGI+GA+LIV GLYAVLWG
Sbjct  298   IVAIMGSFILAENIYVGGILGAILIVAGLYAVLWG  332



>ref|XP_006430497.1| hypothetical protein CICLE_v10012013mg [Citrus clementina]
 gb|ESR43737.1| hypothetical protein CICLE_v10012013mg [Citrus clementina]
Length=367

 Score =   520 bits (1339),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 273/335 (81%), Positives = 304/335 (91%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GC  NF Q+ KPYIAMISLQFGYAGMNIITKVSLNRGMS+YVLVVYRHAFATA +
Sbjct  1     MEEK-GCCSNFLQRCKPYIAMISLQFGYAGMNIITKVSLNRGMSNYVLVVYRHAFATAVV  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERKVRPKITF IF+Q+FVLGLLGPVIDQN YYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALLLERKVRPKITFPIFMQLFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
              FVM+V+CRMEKVDIKK+RCQAK+VGT+VTV GAMLMTLYKG+ +N +WS  IH  + S 
Sbjct  120   IFVMSVVCRMEKVDIKKIRCQAKMVGTIVTVAGAMLMTLYKGNVINLVWSQHIHGHTSSP  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP  +++ S KDW+KGSILLILATLAWASFFI+QA+T+R+Y A LSL A+VCF+GTLQSI
Sbjct  180   VPAATTS-SDKDWLKGSILLILATLAWASFFILQAVTMRRYPAHLSLTAIVCFLGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ASVWTIGWDMNLLAAAYAGIVSS IAYYVQG+VMQKRGPVFVTAFS LMMI
Sbjct  239   AVTFVMEHKASVWTIGWDMNLLAAAYAGIVSSGIAYYVQGLVMQKRGPVFVTAFSHLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSF+LAEKIYVGG++GAVLIV G YAVLWG
Sbjct  299   IVAIMGSFLLAEKIYVGGVLGAVLIVIGTYAVLWG  333



>ref|XP_002323220.2| hypothetical protein POPTR_0016s03120g [Populus trichocarpa]
 gb|EEF04981.2| hypothetical protein POPTR_0016s03120g [Populus trichocarpa]
Length=402

 Score =   520 bits (1338),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 274/335 (82%), Positives = 304/335 (91%), Gaps = 6/335 (2%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  G  G+FFQ++KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGN-GYSGSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ILERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIILERKVRPKITFPIFMQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRME VDIKKVRCQAKV+GT+VTV GAMLMTLYKG+ +N +WS  +H T  S+
Sbjct  120   TFVMAVLCRMEIVDIKKVRCQAKVIGTIVTVAGAMLMTLYKGNVINLIWSEHVH-THSSS  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+TS+    KDW+KGSILLI+AT AWASFFI+Q +TL +Y+A LSL  +VCF+GTLQSI
Sbjct  179   VPETSN----KDWIKGSILLIIATFAWASFFILQTVTLTRYSAHLSLTTIVCFLGTLQSI  234

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ S WTIGWDMNLLAAAYAGIVSSSI+YYVQG+VMQK GPVFVTAFSPLMMI
Sbjct  235   AVTFVMEHKPSAWTIGWDMNLLAAAYAGIVSSSISYYVQGLVMQKTGPVFVTAFSPLMMI  294

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAE IYVGG++GA+LIV GLYAVLWG
Sbjct  295   IVAIMGSFILAENIYVGGVLGAILIVAGLYAVLWG  329



>ref|XP_011041376.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=402

 Score =   516 bits (1328),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 273/335 (81%), Positives = 304/335 (91%), Gaps = 6/335 (2%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  G  G+FFQ++KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGN-GYFGSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA+ILERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAIILERKVRPKITFPIFMQMFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVL RME VDIKKVRCQAKV+GT+VTV GAMLMTLYKG+ +N +WS  +H T  S+
Sbjct  120   TFVMAVLFRMEIVDIKKVRCQAKVIGTIVTVAGAMLMTLYKGNVINLIWSEHLH-TQSSS  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+T++    KDW+KGSILLI+AT AWASFFI+Q +TL +Y+A LSL ALVCF+GTLQSI
Sbjct  179   VPETTN----KDWIKGSILLIIATFAWASFFILQTVTLTRYSAHLSLTALVCFLGTLQSI  234

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ S WTIGWDMNLLAAAYAGIV+SSI+YYVQG+VMQK GPVFVTAFSPLMMI
Sbjct  235   AVTFVMEHKPSAWTIGWDMNLLAAAYAGIVTSSISYYVQGLVMQKTGPVFVTAFSPLMMI  294

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAE IYVGG++GA+LIV GLYAVLWG
Sbjct  295   IVAIMGSFILAENIYVGGVLGAILIVAGLYAVLWG  329



>ref|XP_010244423.1| PREDICTED: WAT1-related protein At5g07050 [Nelumbo nucifera]
Length=397

 Score =   516 bits (1328),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 269/330 (82%), Positives = 298/330 (90%), Gaps = 2/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC  NF Q+ KPY+AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPFAL
Sbjct  2     GCCSNFIQRCKPYVAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERKVRPK+T  +FLQIFVLGLLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMA
Sbjct  62    VLERKVRPKMTLPVFLQIFVLGLLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             VLCRMEK+D+KKVRCQAKVVGT+VTV GAMLMTLYKG  +  +W+  +HP + +    T 
Sbjct  122   VLCRMEKIDMKKVRCQAKVVGTIVTVAGAMLMTLYKGPIMEMVWTKHVHPHNSNATDATG  181

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             ++D  KDW KGSILLI+ATLAWASFFI+QAITLR+Y+AQLSL ALV F+GTLQSIAVTF 
Sbjct  182   TSD--KDWAKGSILLIIATLAWASFFILQAITLRRYSAQLSLTALVVFLGTLQSIAVTFV  239

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH  SVWTIGWDMNLLAAAYAGI+SSSIAYYVQG+VMQKRGPVFVTAFSPLMMIIVAIM
Sbjct  240   MEHSTSVWTIGWDMNLLAAAYAGIISSSIAYYVQGLVMQKRGPVFVTAFSPLMMIIVAIM  299

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFIL E IY+GGI+GA+LIV GLY+VLWG
Sbjct  300   GSFILFENIYLGGILGAILIVAGLYSVLWG  329



>ref|XP_004249118.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   512 bits (1318),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 269/330 (82%), Positives = 300/330 (91%), Gaps = 3/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GCL NF+Q+ KPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT AIAPFAL
Sbjct  9     GCLSNFYQRGKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATLAIAPFAL  68

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERK+RPK+TF +F QIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMA
Sbjct  69    LLERKLRPKMTFMMFFQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMA  128

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             VLCRMEKV IKK+RCQAKV+GT+VTV GAMLMTLYKGH +N +WSN IH  + +NV Q S
Sbjct  129   VLCRMEKVHIKKLRCQAKVIGTIVTVAGAMLMTLYKGHVINLVWSNNIH--TNNNVSQ-S  185

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             +  S KDW+KGSILLI AT AWASFFI+QAIT++KYTA LSL  LVCFMGTLQSIAVT  
Sbjct  186   NETSDKDWLKGSILLIGATFAWASFFILQAITMKKYTAPLSLTTLVCFMGTLQSIAVTLV  245

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH+ S W +G+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMIIVAIM
Sbjct  246   MEHKPSAWAVGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIM  305

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  306   GSFILAEKIYLGGVLGAVLIVAGLYSVLWG  335



>ref|XP_009800321.1| PREDICTED: WAT1-related protein At5g07050-like [Nicotiana sylvestris]
Length=399

 Score =   512 bits (1318),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 273/335 (81%), Positives = 304/335 (91%), Gaps = 11/335 (3%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG+  C  +F+Q+AKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYR+AFATA I
Sbjct  1     MEGECSC--SFYQRAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATAVI  58

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERK+RPK++  +FLQIFVLGLLGPVID+NFYYAGLK+TSPTFSCA+SNMLPAM
Sbjct  59    APFALILERKIRPKMSLMMFLQIFVLGLLGPVIDENFYYAGLKYTSPTFSCAMSNMLPAM  118

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMA LCRMEKVD+KK RCQAKV+GT+VTV GAMLMTLYKGH VN LWS      + S+
Sbjct  119   TFVMAFLCRMEKVDLKKFRCQAKVLGTIVTVAGAMLMTLYKGHVVNLLWS------TNSS  172

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+T   +S KDW KGSILLI ATL WASFFI+QAIT+RKYTA LSL ALVCFMGTLQSI
Sbjct  173   VPET---NSDKDWFKGSILLIFATLVWASFFILQAITMRKYTAPLSLTALVCFMGTLQSI  229

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF M+H+ SVWTIG+D+NLLAAAYAGIVSSSIAYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  230   AVTFVMDHKPSVWTIGFDINLLAAAYAGIVSSSIAYYVQGVVMEKRGPVFVTAFSPLMMI  289

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIY+GGI+GA+LIV GLY+VLWG
Sbjct  290   IVAIMGSFILAEKIYIGGILGAMLIVAGLYSVLWG  324



>ref|XP_006364778.1| PREDICTED: WAT1-related protein At5g07050-like [Solanum tuberosum]
Length=382

 Score =   510 bits (1314),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 270/330 (82%), Positives = 299/330 (91%), Gaps = 4/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GCL NF+Q+ KPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT AIAPFAL
Sbjct  9     GCLSNFYQRGKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATLAIAPFAL  68

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERK+RPK+TF +FLQIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMA
Sbjct  69    LLERKLRPKMTFMMFLQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMA  128

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             VLCRMEKV IKK+RCQAKV+GT+VTV GAMLMTLYKGH +N +W+N     + SNV Q S
Sbjct  129   VLCRMEKVHIKKLRCQAKVIGTIVTVAGAMLMTLYKGHVINLVWAN---TNNTSNVSQ-S  184

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             +  S KDW+KGSILLI AT AWASFFI+QAIT+RKYTA LSL ALVCFMGTLQSIAVT  
Sbjct  185   NETSDKDWLKGSILLIGATFAWASFFILQAITMRKYTAPLSLTALVCFMGTLQSIAVTLV  244

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH+ S W IG+DMNLLAA YAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMIIVAIM
Sbjct  245   MEHKPSAWAIGFDMNLLAAVYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMIIVAIM  304

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  305   GSFILAEKIYLGGVLGAVLIVAGLYSVLWG  334



>ref|XP_004294697.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=380

 Score =   508 bits (1308),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 303/335 (90%), Gaps = 3/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG  GC  +F Q +KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGNGGCFSSFIQSSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPKITF +F+++FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFALVLERKIRPKITFPVFMKLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEK+++KKVRCQAK++GT+VTV GAMLMTLYKG+ ++F WS     ++ +N
Sbjct  121   TFVMAVLCRMEKLEMKKVRCQAKLIGTIVTVAGAMLMTLYKGNIISFPWSAH---SNNTN  177

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                +++ +  KDW+KGSILLILAT AWASFFIIQA+T ++Y A LSL A+VCF+GTLQSI
Sbjct  178   NASSATNNEDKDWLKGSILLILATFAWASFFIIQAVTQKRYQAPLSLTAIVCFLGTLQSI  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ + WTIGWDMNLLAAAYAGIVSSS+AYY+QG+VMQK GPVFVTAFSPLMMI
Sbjct  238   AVTFVMEHKPAAWTIGWDMNLLAAAYAGIVSSSLAYYIQGLVMQKTGPVFVTAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVA+MGSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  298   IVAVMGSFILAEKIYLGGVLGAVLIVMGLYSVLWG  332



>gb|AFK34273.1| unknown [Lotus japonicus]
Length=392

 Score =   508 bits (1309),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 268/335 (80%), Positives = 305/335 (91%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG + C G+FFQ++KPYIAMISLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGDSWC-GSFFQRSKPYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERKVRP+ITF +F+Q+FVLGLLGPVIDQN YYAGLKFTSPT+SCALSN+LPAM
Sbjct  60    APFALVLERKVRPRITFVMFMQMFVLGLLGPVIDQNLYYAGLKFTSPTYSCALSNVLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TF+MAV+ RMEKVDI+KVRCQAKV+GT VTV GAMLMTLYKG  +NFL S + H   ++ 
Sbjct  120   TFLMAVIFRMEKVDIRKVRCQAKVLGTGVTVAGAMLMTLYKGKVINFLGSQYTH-HPRNY  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P  ++A + +DWVKGSILLI+ATLAWASFFI+QA+TLRKY+AQLSL A+VCF+GTLQSI
Sbjct  179   EPVNTNASAEQDWVKGSILLIIATLAWASFFILQAVTLRKYSAQLSLTAIVCFLGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH  SVW+IGWDMNLLAAAYAGIVSS I YYVQGIVMQK+GPVFVTAFSPLMM+
Sbjct  239   AVTFVMEHSPSVWSIGWDMNLLAAAYAGIVSSGITYYVQGIVMQKKGPVFVTAFSPLMMV  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMG+FILAEKIY+GGI+GA+LIV GLY VLWG
Sbjct  299   IVAIMGTFILAEKIYLGGILGAILIVIGLYQVLWG  333



>ref|XP_006339335.1| PREDICTED: WAT1-related protein At5g07050-like, partial [Solanum 
tuberosum]
Length=358

 Score =   502 bits (1292),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 267/332 (80%), Positives = 295/332 (89%), Gaps = 4/332 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K  C  +FFQ++KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYR+AFAT  IAPF
Sbjct  5     KEECNCSFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFATIVIAPF  64

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             ALILERK+RPK+T  +FLQIFVLGLLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMTFV
Sbjct  65    ALILERKIRPKMTLMMFLQIFVLGLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFV  124

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MAVLCRMEKVDIKK+RCQAKV+GT+VTV GAMLMTLYKGH VN +WSN I+    SN  Q
Sbjct  125   MAVLCRMEKVDIKKIRCQAKVLGTIVTVCGAMLMTLYKGHVVNLIWSNNIN----SNDTQ  180

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVT  737
              ++    KDWVKGSI LI AT AWASFFI+Q +T+RKYTA +SL ALVCFMGTLQSIAVT
Sbjct  181   VTNKTYDKDWVKGSIQLIFATFAWASFFILQNMTMRKYTAPISLTALVCFMGTLQSIAVT  240

Query  736   FAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVA  557
             F MEH+ S+W IG+DMNLLAAAYAGIVSSSIAYYVQG+VM+ RGPVFVTAFSPLMMIIV 
Sbjct  241   FVMEHKNSIWIIGFDMNLLAAAYAGIVSSSIAYYVQGLVMETRGPVFVTAFSPLMMIIVT  300

Query  556   IMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IMGSFILAE IY+GGI+GAVLIV G+Y+VLWG
Sbjct  301   IMGSFILAENIYIGGIIGAVLIVAGIYSVLWG  332



>ref|XP_006604312.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN08914.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=392

 Score =   503 bits (1295),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 263/335 (79%), Positives = 303/335 (90%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG   C G+FFQ+ KPYIAM+SLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGDGYC-GSFFQRCKPYIAMVSLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERKVRPK+TF +F+QIFVLGLLGPVIDQN YYAGLKFTSPT+SCA+SN+LPAM
Sbjct  60    APFAIVLERKVRPKMTFLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNILPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMA + RMEK+D++KVRCQAKV+GT+VTV GAMLMTLYKG  ++FL S ++H   ++ 
Sbjct  120   TFVMAAIFRMEKLDMRKVRCQAKVIGTIVTVAGAMLMTLYKGQVISFLGSKYMH-HPRNY  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ ++    KDW KGSILLILATL+WASFFI+QA+TLRKY AQLSL ALVC +GTLQSI
Sbjct  179   VPENTTDSGEKDWFKGSILLILATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ SVWTIGWDMNLLAAAYAGI+SS I YYVQGIVMQK+GPVFVTAFSPLMMI
Sbjct  239   AVTFVMEHKPSVWTIGWDMNLLAAAYAGIISSGITYYVQGIVMQKKGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMG+FILAEKIY+GG++GA+LIV GLY+VLWG
Sbjct  299   IVAIMGAFILAEKIYLGGVVGAILIVMGLYSVLWG  333



>ref|XP_007162036.1| hypothetical protein PHAVU_001G118300g [Phaseolus vulgaris]
 gb|ESW34030.1| hypothetical protein PHAVU_001G118300g [Phaseolus vulgaris]
Length=437

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 268/336 (80%), Positives = 301/336 (90%), Gaps = 2/336 (1%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             +MEG   C G+FFQ+ KPYIAMISLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAA
Sbjct  44    KMEGDGYC-GSFFQRCKPYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAA  102

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             IAPFAL+LERKVRPKITF +F+QIFVLGLLGPVIDQN YYAGLKFTSPT+SCA+SNMLPA
Sbjct  103   IAPFALVLERKVRPKITFLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNMLPA  162

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             MTFVMA + RMEKVDI+K RCQAKV+GT+VTV GAMLMTLYKG  ++FL S ++H   ++
Sbjct  163   MTFVMAAIFRMEKVDIRKFRCQAKVIGTIVTVAGAMLMTLYKGQVISFLGSEYMH-HPRN  221

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
              VP+ ++    KDW KGSILLI+ATLAWASFFI+QA+TLRKY AQLSL ALVC +GTLQS
Sbjct  222   YVPENTTDSGEKDWFKGSILLIIATLAWASFFILQAVTLRKYPAQLSLTALVCALGTLQS  281

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVTF MEH+ SVWTIGWDMNLLAAAYAGI+SS I YYVQGIVMQK+GPVFVTAFSP MM
Sbjct  282   IAVTFVMEHKTSVWTIGWDMNLLAAAYAGIISSGITYYVQGIVMQKKGPVFVTAFSPFMM  341

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAIMG+FILAEKIY+GG+ GAVLIV GLY+VLWG
Sbjct  342   IIVAIMGAFILAEKIYLGGVAGAVLIVMGLYSVLWG  377



>ref|NP_001242267.1| uncharacterized protein LOC100811617 [Glycine max]
 gb|ACU19947.1| unknown [Glycine max]
Length=393

 Score =   503 bits (1294),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 264/335 (79%), Positives = 303/335 (90%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG   C G+FFQ+ KPYIAMISLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGDGYC-GSFFQRCKPYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERKVRPKITF +F+QIFVLGLLGPVIDQN YYAGLKFTSPT+SCA+SNMLPA 
Sbjct  60    APFAIVLERKVRPKITFLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNMLPAT  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMA + RMEK++++KVRCQAKV+GTVVTV GAMLMTLYKG  ++FL S ++H   ++ 
Sbjct  120   TFVMAAIFRMEKLNVRKVRCQAKVIGTVVTVAGAMLMTLYKGQVISFLGSKYMH-HPRNY  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ ++    KDW KGS+LL+LATL+WASFFI+QA+TLRKY AQLSL ALVC +GTLQSI
Sbjct  179   VPENNTDSGEKDWFKGSVLLVLATLSWASFFILQAVTLRKYPAQLSLTALVCALGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF MEH+ SVWTIGWDMNLLAAAYAGI+SS IAYYVQGIVMQK+GPVFVTAFSPLMMI
Sbjct  239   AVTFVMEHKPSVWTIGWDMNLLAAAYAGIISSGIAYYVQGIVMQKKGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMG+FILAEKIY+GG++GA+LIV GLY+VLWG
Sbjct  299   IVAIMGTFILAEKIYLGGVIGAILIVMGLYSVLWG  333



>ref|XP_008788560.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=400

 Score =   502 bits (1292),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 260/330 (79%), Positives = 298/330 (90%), Gaps = 2/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   F Q+AKPYIAMISLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  2     GCCSGFLQRAKPYIAMISLQFGYAGMNIITKVSLNNGMSHYVLVVYRHAFATLSIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKV PKITF+IF+QIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SN+LPAMTFV+A
Sbjct  62    ILERKVWPKITFSIFVQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNILPAMTFVIA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             VLCRMEKVD+KKVRCQAKVVGT VTV GAMLMTLYKG  +  +W+  +HP  +S+ P+T+
Sbjct  122   VLCRMEKVDLKKVRCQAKVVGTFVTVAGAMLMTLYKGPIMEMVWTKHVHP-HRSSAPETT  180

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              + S KDW+KGSI +I+ATLAWAS F++QA+TL++Y+AQLSL  L+CFMGTLQ+IAVT  
Sbjct  181   DS-SDKDWIKGSIFVIIATLAWASLFVLQAVTLKQYSAQLSLTTLICFMGTLQAIAVTLV  239

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH+ S WTIGWDMNLLAAAYAGIV+SSIAYYVQG+V+Q+RGPVF +AFSPLMMIIVAIM
Sbjct  240   MEHKPSAWTIGWDMNLLAAAYAGIVTSSIAYYVQGLVIQRRGPVFASAFSPLMMIIVAIM  299

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKIY+GG++GAVLI  GLY+VLWG
Sbjct  300   GSFILAEKIYLGGVLGAVLIAVGLYSVLWG  329



>ref|XP_004249327.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Solanum 
lycopersicum]
Length=393

 Score =   501 bits (1290),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 266/336 (79%), Positives = 298/336 (89%), Gaps = 6/336 (2%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
              ++GK  C  NFFQ++KPYIAMISLQFGYAGMNIITKVSLN+GMSHYVLVVYR+AFAT  
Sbjct  4     NIKGKCNC--NFFQRSKPYIAMISLQFGYAGMNIITKVSLNKGMSHYVLVVYRNAFATLV  61

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             IAPFALILERK+RPK+T  +FLQIFVL LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPA
Sbjct  62    IAPFALILERKIRPKMTLMMFLQIFVLSLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPA  121

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             M FVMAVLCRMEKVDIKK+RCQAKV+GT+VT+GGAMLMTLYKGH VN +WSN I+P    
Sbjct  122   MIFVMAVLCRMEKVDIKKIRCQAKVLGTIVTMGGAMLMTLYKGHVVNLIWSNNINP----  177

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             NV Q ++ +  KDWVKGSILLI AT AWASFFI+Q I +RKYTA +SL ALVCFMGTLQS
Sbjct  178   NVTQITNENYDKDWVKGSILLIFATFAWASFFILQYIIMRKYTAPISLTALVCFMGTLQS  237

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVTF MEH+ S+WTIG+DMN LA AYAGI+SSS+AYYVQG+VM+K GPVFVTAFSPLMM
Sbjct  238   IAVTFVMEHKNSIWTIGFDMNFLAVAYAGIMSSSLAYYVQGLVMEKIGPVFVTAFSPLMM  297

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAIMG FIL EKIY+GGI+GAVLIV GLY+VLWG
Sbjct  298   IIVAIMGFFILDEKIYIGGIIGAVLIVAGLYSVLWG  333



>ref|XP_010673090.1| PREDICTED: WAT1-related protein At5g07050 [Beta vulgaris subsp. 
vulgaris]
Length=416

 Score =   502 bits (1292),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 267/336 (79%), Positives = 298/336 (89%), Gaps = 3/336 (1%)
 Frame = -2

Query  1465  MEGKTGCLGN-FFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             MEGK     N F +K+KPYIAMI LQFGYAGMNI+TKVSLN GMSHYVLVVYRHAFATA 
Sbjct  1     MEGKGNHNSNTFLEKSKPYIAMICLQFGYAGMNIVTKVSLNGGMSHYVLVVYRHAFATAV  60

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             IAPFAL+LER +RPK+TF IFLQIFVLGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLPA
Sbjct  61    IAPFALVLERGIRPKMTFPIFLQIFVLGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPA  120

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             MTFVMAV+CRMEKVDIKK+RCQAKVVGT+VTV GAMLMTLYKG  VN  WS  IHP   +
Sbjct  121   MTFVMAVICRMEKVDIKKLRCQAKVVGTIVTVAGAMLMTLYKGRVVNMFWSAHIHPAHTA  180

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             +    ++AD  KDW KGSILLILATLAWA+FFI+QAIT+R+Y+AQLSL  LVCF+GTLQS
Sbjct  181   SAAAAAAAD--KDWAKGSILLILATLAWAAFFILQAITMRRYSAQLSLTTLVCFLGTLQS  238

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVTF MEH+ S WTIGWDMNLLAAAY+GI++S IAYYVQG+VM+KRGPVF TAFSPLMM
Sbjct  239   IAVTFVMEHKPSAWTIGWDMNLLAAAYSGIIASGIAYYVQGVVMEKRGPVFATAFSPLMM  298

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAIMGSFILAEKIYVGG++GAV+IV GLY+VLWG
Sbjct  299   IIVAIMGSFILAEKIYVGGVIGAVVIVIGLYSVLWG  334



>ref|XP_010055600.1| PREDICTED: WAT1-related protein At5g07050-like [Eucalyptus grandis]
 gb|KCW89996.1| hypothetical protein EUGRSUZ_A02192 [Eucalyptus grandis]
Length=401

 Score =   501 bits (1290),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 274/360 (76%), Positives = 312/360 (87%), Gaps = 3/360 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             ++MEGK G   +F Q+A+PYIAM+SLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFAT 
Sbjct  4     LQMEGKAGRWSDFMQRARPYIAMVSLQFGYAGMNIITKVSLNGGMSHYVLVVYRHAFATV  63

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFALILERKVRPK+TF +F+QIFVLGLLGPVIDQN YYAGLKFTSPTFSCA+SNMLP
Sbjct  64    VIAPFALILERKVRPKMTFLVFMQIFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLP  123

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTFVMA LCRMEKVD+KKVRC AKVVGTVVTVGGAMLMTLYKG+ +NF WS  +H  + 
Sbjct  124   AMTFVMAFLCRMEKVDMKKVRCVAKVVGTVVTVGGAMLMTLYKGNVLNFPWSANLHGHAA  183

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQ  752
             +      SAD  KDW KGSI LI+AT AWASFFI+QA+TL++Y A LSL A+V FMGTLQ
Sbjct  184   NGSEAPESAD--KDWAKGSIFLIIATFAWASFFILQAVTLKRYPAHLSLTAMVVFMGTLQ  241

Query  751   SIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLM  572
             SIAVTF +EH+ASVW+IG+DMNLLAAAYAGIVSSSIAYYVQG+VM+KRGPVFVTAFSPLM
Sbjct  242   SIAVTFVVEHKASVWSIGFDMNLLAAAYAGIVSSSIAYYVQGVVMKKRGPVFVTAFSPLM  301

Query  571   MIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKDQNR  392
             MI+VAIMGSFILAEKIY+GG++G+VLIV GLY+VLWG   +  +++  E I EPVKD   
Sbjct  302   MIVVAIMGSFILAEKIYLGGVLGSVLIVAGLYSVLWG-KYKEYQEKEAEEIPEPVKDHQN  360



>ref|XP_010055591.1| PREDICTED: WAT1-related protein At5g07050-like [Eucalyptus grandis]
 gb|KCW89995.1| hypothetical protein EUGRSUZ_A02191 [Eucalyptus grandis]
Length=405

 Score =   496 bits (1278),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 266/335 (79%), Positives = 299/335 (89%), Gaps = 2/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK G   +F Q+A+PYIAM+SLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFAT  I
Sbjct  1     MEGKAGRWSDFMQRARPYIAMMSLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATVVI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERKVRPK+TF +F+QIFVLGLLGPVIDQN YYAGLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFALILERKVRPKMTFLVFMQIFVLGLLGPVIDQNLYYAGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMA L RMEKVD+KKVRC AKVVGTVVTVGGAMLMTLYKG+ + F WS  +H  + + 
Sbjct  121   TFVMAALFRMEKVDMKKVRCVAKVVGTVVTVGGAMLMTLYKGNVLTFPWSAHLHGHATNG  180

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                  SAD  +DWVKGSI LI+AT AWASFFI+QA+TL++Y A LSL A+V FMGTLQSI
Sbjct  181   SEAPESAD--QDWVKGSIFLIIATFAWASFFILQAVTLKRYPAHLSLTAMVVFMGTLQSI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF +EH+ASVW+IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  239   AVTFVVEHKASVWSIGFDMNLLAAAYAGIVSSSLAYYVQGLVMKKRGPVFVTAFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEKIY+GG++G+VLIV GLY+VLWG
Sbjct  299   IVAIMGSFILAEKIYLGGVLGSVLIVVGLYSVLWG  333



>ref|XP_004493327.1| PREDICTED: WAT1-related protein At5g07050-like isoform X1 [Cicer 
arietinum]
Length=392

 Score =   492 bits (1267),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 257/335 (77%), Positives = 299/335 (89%), Gaps = 4/335 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG +    +FFQ+ KPYIAMISLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGNSA---SFFQRCKPYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  57

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERK+RPKI+F +F+Q+FVLGLLGPVIDQN YYAGLKFTSPT+SCA+SN+LPAM
Sbjct  58    APFAIVLERKIRPKISFLMFMQMFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNILPAM  117

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVL RMEK+DI+K+RCQ KV+GTV+TV GAMLMTLYKG  +N L S ++H   K+ 
Sbjct  118   TFVMAVLFRMEKLDIRKLRCQVKVIGTVITVAGAMLMTLYKGEVINILGSQYMH-HPKNY  176

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P+ ++    KDW KGSILL++AT AWASFFI+QA+TLRKY+AQLSL A+VCF+GTLQSI
Sbjct  177   SPENNTDSGEKDWFKGSILLLIATFAWASFFILQAVTLRKYSAQLSLTAIVCFLGTLQSI  236

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT+ MEHR SVW IGWDMNLLAAAYAGI+SS + YYVQGIVMQK+GPVFVTAFSPLMMI
Sbjct  237   AVTYVMEHRPSVWNIGWDMNLLAAAYAGIISSGLTYYVQGIVMQKKGPVFVTAFSPLMMI  296

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMG+FILAEK+Y+GGI+GA LIV GLY+VLWG
Sbjct  297   IVAIMGTFILAEKLYLGGIIGATLIVIGLYSVLWG  331



>ref|XP_010938846.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=407

 Score =   493 bits (1268),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 272/377 (72%), Positives = 318/377 (84%), Gaps = 2/377 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC G FFQ++KPY+AMISLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  5     GCCGKFFQRSKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSIAPFAL  64

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKVRPK+TF IF+QIF LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+A
Sbjct  65    ILERKVRPKLTFWIFMQIFALGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLA  124

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             VLCRMEKVD+KKV+CQAKVVGT+VTV GAMLMTLYKG  +  +W+  +HP  ++NVP  +
Sbjct  125   VLCRMEKVDLKKVKCQAKVVGTLVTVAGAMLMTLYKGPIMEMVWTKHLHP-HQANVP-VA  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
                + KDW KGSI LI+ATLAWAS FI+QA TL+KY A LSL +L+CF+GTLQ+I VT  
Sbjct  183   MDSTDKDWFKGSIFLIIATLAWASLFILQAATLKKYDAPLSLTSLICFVGTLQAIVVTLV  242

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             ME + SVW IGWDMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIVAIM
Sbjct  243   MERKPSVWRIGWDMNLLAAAYAGIVTSSIAYYVQGLVIQDRGPVFASAFSPLMMIIVAIM  302

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKDQNRimmmmvv  371
             GSFILAEKIY+GG++GAVLIV GLY+VLWGKY++ KEK+  E +  P+  +       V+
Sbjct  303   GSFILAEKIYMGGVLGAVLIVVGLYSVLWGKYRDNKEKKEQEGMELPMAIKGTEGNGQVM  362

Query  370   veedcvdieMQKTEANN  320
                +   +E+QK +ANN
Sbjct  363   DIIEVDKVEVQKAKANN  379



>ref|XP_008810183.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=407

 Score =   491 bits (1264),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 274/383 (72%), Positives = 323/383 (84%), Gaps = 3/383 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME +  C G FFQ+ KPY+AMISLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFA  +I
Sbjct  1     MEIQGSC-GKFFQRCKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFAALSI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERKVRPKITF IF+QIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALILERKVRPKITFWIFMQIFMLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEKV++KKVRCQAKVVGT+VTV GAMLMTLYKG  +  +W+  +HP  ++N
Sbjct  120   TFVMAVLCRMEKVNLKKVRCQAKVVGTLVTVAGAMLMTLYKGPIMEMVWAKHVHP-HQAN  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP    + + +DW KGSI LI+ATLAWAS FI+QA TL+KY A LSL +L+C +GTLQ++
Sbjct  179   VPAAMDS-TDRDWFKGSIFLIIATLAWASLFILQAATLKKYDAPLSLTSLICSVGTLQAV  237

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+ S W IGWDMNLLAAAYAGIV+SSIAYYVQG+VMQ+RGPVF +AFSPLMMI
Sbjct  238   AVTLVMEHKPSAWRIGWDMNLLAAAYAGIVTSSIAYYVQGLVMQERGPVFASAFSPLMMI  297

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKDQNRim  386
             IVAIMGSFILAEK+Y+GG++GAVLIV GLY+VLWGKYKE KEK+  EA+  P+  +    
Sbjct  298   IVAIMGSFILAEKVYMGGVLGAVLIVAGLYSVLWGKYKENKEKKEQEAMELPMAIKGNEG  357

Query  385   mmmvvveedcvdieMQKTEANNR  317
                V+   +  ++E++K +ANN+
Sbjct  358   NGQVMDIMEVDEVELEKAKANNK  380



>ref|XP_010906409.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=379

 Score =   488 bits (1257),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 253/336 (75%), Positives = 296/336 (88%), Gaps = 8/336 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC  +F Q+AKPY+AMISLQFGYAGMNII+KVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  2     GCCSDFLQRAKPYVAMISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLG------PVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
               ER V P+ITF+IF+QIFVLGLLG      PVIDQNFYYAGLKFTSPTFSCA+SN+LPA
Sbjct  62    YFERNVWPRITFSIFVQIFVLGLLGLVYVSRPVIDQNFYYAGLKFTSPTFSCAMSNILPA  121

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             MTFVMAV+CRMEKVD+KK+RCQAKVVGT+VTV GAMLMTLYKG  +  +W+  + P  +S
Sbjct  122   MTFVMAVICRMEKVDLKKIRCQAKVVGTLVTVAGAMLMTLYKGPIMEMVWTKHVQP-HRS  180

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             +VP+T+ + S KDW+KGSI L++ATLAWA+ F++QA+TL++Y+AQLSL  L+CFMGTLQ+
Sbjct  181   SVPETTDS-SDKDWLKGSIFLVIATLAWAALFVLQAVTLKQYSAQLSLTTLICFMGTLQA  239

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVT  MEH+ SVW IGWDMNLLAAAYAGIV+SSIAYYVQG+VMQ RGPVF +AFSPLMM
Sbjct  240   IAVTLVMEHKPSVWKIGWDMNLLAAAYAGIVTSSIAYYVQGLVMQSRGPVFASAFSPLMM  299

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAIM SFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  300   IIVAIMDSFILAEKIYLGGVLGAVLIVVGLYSVLWG  335



>gb|EYU18591.1| hypothetical protein MIMGU_mgv1a007543mg [Erythranthe guttata]
Length=404

 Score =   489 bits (1258),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 268/338 (79%), Positives = 296/338 (88%), Gaps = 22/338 (7%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK G +GN+F+ AKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MEGK-GKIGNWFESAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERKVRPKITF IF+Q+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFAILLERKVRPKITFKIFMQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVLCRMEK+++KKV CQAKV GT+VTVGGAMLMT+Y+GH +N  WS+FIHP  +S 
Sbjct  120   TFVMAVLCRMEKLNMKKVMCQAKVAGTIVTVGGAMLMTVYRGHVINMFWSSFIHP-KQSY  178

Query  925   VPQTSS-ADSG--KDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTL  755
             VP TS+ ADS   KDW+KGSILLI+ATLAWASFFI+QAIT+RKYTA LSL ALVCFMGTL
Sbjct  179   VPTTSNHADSSADKDWLKGSILLIIATLAWASFFILQAITMRKYTAHLSLTALVCFMGTL  238

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             QSIAVTF MEH+ + W IG+DMNLLAAAYA                 KRGPVFVTAFSPL
Sbjct  239   QSIAVTFVMEHKPNAWVIGFDMNLLAAAYA-----------------KRGPVFVTAFSPL  281

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MMIIVAIMGSFILAEKIYVGG++GAVLIV GLY+VLWG
Sbjct  282   MMIIVAIMGSFILAEKIYVGGVLGAVLIVIGLYSVLWG  319



>ref|XP_008795134.1| PREDICTED: WAT1-related protein At5g07050-like [Phoenix dactylifera]
Length=390

 Score =   486 bits (1251),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 271/384 (71%), Positives = 321/384 (84%), Gaps = 4/384 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             +E++G+ G    FFQ+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT 
Sbjct  1     MEIQGRCG---KFFQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATL  57

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
             +IAPFALILERKVRPK+T  IF+QIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SN+LP
Sbjct  58    SIAPFALILERKVRPKLTLWIFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNILP  117

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTFVMAVLCRMEKVD+K+VRCQAKVVGT+VTV GAMLMTLYKG  V  +W+  +HP  +
Sbjct  118   AMTFVMAVLCRMEKVDLKRVRCQAKVVGTLVTVAGAMLMTLYKGPIVEMVWTKHVHP-RQ  176

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQ  752
              N P  ++  + KDW KGSI LI+ATLAWAS FI+QA TL+KY A LSL +L+CF+GTLQ
Sbjct  177   MNAPPAATDSADKDWFKGSIFLIIATLAWASLFILQAATLKKYDAPLSLTSLICFVGTLQ  236

Query  751   SIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLM  572
             +IAVT  ME + SVW IGWDMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLM
Sbjct  237   AIAVTLVMERKPSVWRIGWDMNLLAAAYAGIVTSSIAYYVQGLVIQSRGPVFASAFSPLM  296

Query  571   MIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKDQNR  392
             MI+VAIMGSFIL E IY+GG++GA+LIV GLY+VLWGKYKE KE+E  EA+  P   +  
Sbjct  297   MIVVAIMGSFILFENIYLGGVLGAILIVAGLYSVLWGKYKENKEEEEQEAMELPRTIKGN  356

Query  391   immmmvvveedcvdieMQKTEANN  320
                  V+   +  ++E++KT+ANN
Sbjct  357   EGKGQVMDIAEVDEVELEKTKANN  380



>ref|XP_006339251.1| PREDICTED: WAT1-related protein At5g07050-like [Solanum tuberosum]
Length=385

 Score =   485 bits (1248),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 262/335 (78%), Positives = 295/335 (88%), Gaps = 14/335 (4%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG+  C  NFFQ++KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYR+AFA A I
Sbjct  1     MEGECNC--NFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRNAFAAAII  58

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLGP+IDQNFYYAGLK TSPTFSCA+SNMLPAM
Sbjct  59    APFALLLERKIRPKMTFMMFLQIFVLGLLGPLIDQNFYYAGLKLTSPTFSCAISNMLPAM  118

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFV+AVLCRMEKV++KK+  QAKV+GT+VT+GGA+LMTLYKG  VN +WSN I       
Sbjct  119   TFVIAVLCRMEKVNLKKIGSQAKVLGTIVTMGGAILMTLYKGQIVNLIWSNQI-------  171

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                  S    K+W+KGSILLI ATLAWASFFI+QAIT+RKYTA LSLIALVCFMGTLQS+
Sbjct  172   -----SGTYDKEWLKGSILLIFATLAWASFFILQAITMRKYTAPLSLIALVCFMGTLQSM  226

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             A+TF MEH+ SVW IG+DMNLLAAAYAGIVSSSIAYYV G VM+K+GPVFVTAFSPLMMI
Sbjct  227   ALTFVMEHKTSVWAIGFDMNLLAAAYAGIVSSSIAYYVHGQVMEKKGPVFVTAFSPLMMI  286

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEK Y+GGI+GA++IV GLY VLWG
Sbjct  287   IVAIMGSFILAEKFYIGGIVGALVIVAGLYFVLWG  321



>gb|KDP22890.1| hypothetical protein JCGZ_01964 [Jatropha curcas]
Length=354

 Score =   483 bits (1242),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 256/305 (84%), Positives = 280/305 (92%), Gaps = 2/305 (1%)
 Frame = -2

Query  1375  MNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRPKITFTIFLQIFVLGLLG  1196
             MNIITKVSLN GMSHYVLVVYRHAFATA IAPFA++LERKVRPKITF I LQIFVLGLLG
Sbjct  1     MNIITKVSLNGGMSHYVLVVYRHAFATAVIAPFAIVLERKVRPKITFPILLQIFVLGLLG  60

Query  1195  PVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvt  1016
             PVIDQNFYY GLKFTSPTFSCA+SNMLPAMTFVMAVLCRMEKVDIKKVRCQAKV+GTVVT
Sbjct  61    PVIDQNFYYMGLKFTSPTFSCAMSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKVIGTVVT  120

Query  1015  vgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWASF  836
             VGGAMLMTLYKGH +N +WS  +H T  S++P T+ +D  KDW+KGSILLILATLAWASF
Sbjct  121   VGGAMLMTLYKGHVINLIWSEHVH-THTSSLPDTTGSDD-KDWLKGSILLILATLAWASF  178

Query  835   FIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIV  656
             FI+QA+TL++Y+AQLSL +LVCFMGTLQSI VT  MEH+AS W IGWDMNLLAAAYAGIV
Sbjct  179   FILQAVTLKRYSAQLSLTSLVCFMGTLQSIVVTIVMEHKASAWAIGWDMNLLAAAYAGIV  238

Query  655   SSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLY  476
             SSSIAYYVQG+VMQKRGPVFVTAFSPLMMI+VAIMGSFILAEKIY+GG++G VLIV GLY
Sbjct  239   SSSIAYYVQGLVMQKRGPVFVTAFSPLMMIVVAIMGSFILAEKIYLGGVLGGVLIVAGLY  298

Query  475   AVLWG  461
              VLWG
Sbjct  299   LVLWG  303



>ref|XP_006432378.1| hypothetical protein CICLE_v10001335mg [Citrus clementina]
 gb|ESR45618.1| hypothetical protein CICLE_v10001335mg [Citrus clementina]
Length=409

 Score =   481 bits (1237),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 267/385 (69%), Positives = 312/385 (81%), Gaps = 6/385 (2%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K  C  NF + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPF
Sbjct  3     KLRCCSNFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A  LERK +PKITF +F+QIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV
Sbjct  63    AFFLERKAQPKITFKVFMQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MAV+CRMEK+++KKVRCQAKVVGT VTV GAM+MTLYKG  V   W+   HP  KS+   
Sbjct  123   MAVICRMEKINMKKVRCQAKVVGTAVTVAGAMIMTLYKGPIVELFWTQHAHPHDKSDA-T  181

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             TS+A S KDW  GSI LI+ATLAWAS F++Q   L  Y   QLSL +L+CF+GTLQ+IAV
Sbjct  182   TSTASSDKDWFLGSIFLIIATLAWASLFVLQTKALETYKNHQLSLTSLMCFVGTLQAIAV  241

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF +EH+ SVW IGWDMNLLAAAYAGIV+SSI+Y+VQG+V++KRGPVF TAFSPLMMIIV
Sbjct  242   TFVIEHKPSVWQIGWDMNLLAAAYAGIVTSSISYFVQGLVIKKRGPVFATAFSPLMMIIV  301

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK----DQNR  392
             AIMGSFILAE IY+G ++GA+LIV GLY+VLWGK+KE  E+  ++ I +PVK    + N 
Sbjct  302   AIMGSFILAENIYLGSVLGAILIVVGLYSVLWGKHKEKMEEFGVDEIPDPVKGNQVNGNF  361

Query  391   immmmvvveedcvdieMQKTEANNR  317
                 M+   E    +E+QK+EANN+
Sbjct  362   TASAMIEDIEANHHVELQKSEANNK  386



>ref|XP_010906432.1| PREDICTED: WAT1-related protein At5g07050-like [Elaeis guineensis]
Length=396

 Score =   480 bits (1236),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 260/343 (76%), Positives = 293/343 (85%), Gaps = 10/343 (3%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME + GC G FFQ+ KPY+AM SLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFAT +I
Sbjct  1     MESQ-GCCGKFFQRCKPYVAMTSLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALILERKVRPK+T  IFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  60    APFALILERKVRPKLTLWIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFV+AVLCRMEKVD+KKV+ QAKVVGTVVTV GAMLMTLYKG  V  +W+  IHP  + N
Sbjct  120   TFVLAVLCRMEKVDLKKVKYQAKVVGTVVTVAGAMLMTLYKGPIVEMVWTKHIHP-QEMN  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P  ++  + KDW+KGSI LI+ATLAWAS FI+QA TL+KY A LSL +L+CF+GTLQ+I
Sbjct  179   APPVATDSADKDWLKGSIFLIIATLAWASLFILQAATLKKYDAPLSLTSLICFVGTLQAI  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYA--------GIVSSSIAYYVQGIVMQKRGPVFVT  590
             AVT  MEH+ SVW IGWDMNLLAAA          GIV+SSIAYYVQG+V+Q RGPVF +
Sbjct  239   AVTLVMEHKPSVWRIGWDMNLLAAAXXXXXXXMLLGIVTSSIAYYVQGLVIQNRGPVFAS  298

Query  589   AFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AFSPLMMIIVAIMGSFILAEKIY+GG++GA+LIV GLY+VLWG
Sbjct  299   AFSPLMMIIVAIMGSFILAEKIYLGGVLGAILIVAGLYSVLWG  341



>ref|XP_006471332.1| PREDICTED: WAT1-related protein At5g07050-like [Citrus sinensis]
 gb|KDO44353.1| hypothetical protein CISIN_1g015299mg [Citrus sinensis]
Length=409

 Score =   480 bits (1236),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 267/385 (69%), Positives = 312/385 (81%), Gaps = 6/385 (2%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K  C  NF + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPF
Sbjct  3     KLRCCSNFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A  LERK +PKITF +F+QIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV
Sbjct  63    AFFLERKAQPKITFKVFMQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MAV+CRMEK+++KKVRCQAKVVGT VTV GAM+MTLYKG  V   W+   HP  KS+   
Sbjct  123   MAVICRMEKINMKKVRCQAKVVGTAVTVAGAMIMTLYKGPIVELFWTQHAHPHDKSDA-T  181

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             TS+A S KDW  GSI LI+ATLAWAS F++Q   L  Y   QLSL +L+CF+GTLQ+IAV
Sbjct  182   TSTASSEKDWFLGSIFLIIATLAWASLFVLQTKALETYKNHQLSLTSLMCFVGTLQAIAV  241

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF +EH+ SVW IGWDMNLLAAAYAGIV+SSI+Y+VQG+V++KRGPVF TAFSPLMMIIV
Sbjct  242   TFVIEHKPSVWQIGWDMNLLAAAYAGIVTSSISYFVQGLVIKKRGPVFATAFSPLMMIIV  301

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK----DQNR  392
             AIMGSFILAE IY+G ++GA+LIV GLY+VLWGK+KE  E+  ++ I +PVK    + N 
Sbjct  302   AIMGSFILAENIYLGSVLGAILIVVGLYSVLWGKHKEKMEEFGVDEIPDPVKGNQVNGNF  361

Query  391   immmmvvveedcvdieMQKTEANNR  317
                 M+   E    +E+QK+EANN+
Sbjct  362   TASAMIEDIEANHHVELQKSEANNK  386



>ref|XP_009391606.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   475 bits (1223),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 254/330 (77%), Positives = 288/330 (87%), Gaps = 3/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   FFQK KPY+AMISLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  3     GC-NKFFQKCKPYVAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATLSIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKVRPK+TF+IF+QIF LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+A
Sbjct  62    ILERKVRPKMTFSIFMQIFALGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+CRMEKV +KKVRCQAKVVGT+VTV GAMLMTLYKG  ++  W+        +NVP  +
Sbjct  122   VICRMEKVHLKKVRCQAKVVGTLVTVAGAMLMTLYKGPIMDMAWTKHAQ-LQHANVPAVA  180

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              + + KDW+KG I LI+ATLAWAS FI+QA TL+KY A LSL +L+CFMGTLQ+ AVT  
Sbjct  181   DS-TDKDWLKGCIFLIIATLAWASLFILQAATLKKYDAPLSLTSLICFMGTLQATAVTLF  239

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH+ SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q +GPVF +AFSPLMMIIVAIM
Sbjct  240   MEHKPSVWRIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQDKGPVFASAFSPLMMIIVAIM  299

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKIY+GGI+GA LIV GLY+VLWG
Sbjct  300   GSFILAEKIYLGGIVGAALIVAGLYSVLWG  329



>ref|XP_004249326.1| PREDICTED: WAT1-related protein At5g07050 [Solanum lycopersicum]
Length=383

 Score =   475 bits (1222),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 256/335 (76%), Positives = 291/335 (87%), Gaps = 14/335 (4%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG+  C  NFFQ++KPYIAMISLQFGYAGMNIITKVSLNRGMSHY LVVYR+AFAT  I
Sbjct  1     MEGECNC--NFFQRSKPYIAMISLQFGYAGMNIITKVSLNRGMSHYALVVYRNAFATLVI  58

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVL LLGP+IDQNFYYAGLK TSPTFSCA++NML AM
Sbjct  59    APFALLLERKIRPKMTFMMFLQIFVLSLLGPLIDQNFYYAGLKLTSPTFSCAITNMLSAM  118

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFV+AVLCRMEKV++KK+  QAKV GT+VT+ GA+LMTLYKG  VN +WSN I       
Sbjct  119   TFVIAVLCRMEKVNLKKIGSQAKVFGTIVTMCGAILMTLYKGQIVNLIWSNQI-------  171

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                T + D  K+W+KGSILLI ATLAWASFFI+QAIT+RKYTA LSLIALVCFMGTLQS+
Sbjct  172   ---TGTYD--KEWLKGSILLIFATLAWASFFILQAITMRKYTAPLSLIALVCFMGTLQSM  226

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             A+TF MEH+ SVW IG+DMNLLAAAYAGIVSSSIAYYV G VM+K+GPVFVTAFSP MMI
Sbjct  227   ALTFVMEHKTSVWAIGFDMNLLAAAYAGIVSSSIAYYVHGQVMEKKGPVFVTAFSPFMMI  286

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMGSFILAEK Y+GGI+GA++I+ GLY VLWG
Sbjct  287   IVAIMGSFILAEKFYIGGIVGALVILVGLYFVLWG  321



>gb|KHG09563.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=419

 Score =   475 bits (1223),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 250/333 (75%), Positives = 287/333 (86%), Gaps = 4/333 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K  C GNF + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPF
Sbjct  3     KLRCCGNFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             ALI ER+ +PKITF +F+QIF+L LLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTF 
Sbjct  63    ALIFERRGQPKITFPVFMQIFILALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFF  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MA +CRMEK+D+KKVRCQAK+VGT+VTV GAMLMTLYKG  V   WS  +HP  K +   
Sbjct  123   MAAMCRMEKIDVKKVRCQAKIVGTMVTVAGAMLMTLYKGPIVELFWSKNLHP--KQSYAD  180

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             T+ A + KDWVKGSILLILATLAWAS F++QA  L+ Y   QLSL +LVCF+GTLQ+I V
Sbjct  181   TTGA-TDKDWVKGSILLILATLAWASLFVLQAKALKTYKNHQLSLTSLVCFVGTLQAIVV  239

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF MEH+ S W IGWDMNLLAAAYAGIV+SSI+YYVQG+V++KRGPVF TAFSPLMMIIV
Sbjct  240   TFVMEHKVSAWQIGWDMNLLAAAYAGIVTSSISYYVQGMVIKKRGPVFATAFSPLMMIIV  299

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFIL EKI++GG++G++LIV GLY+VLWG
Sbjct  300   AIMGSFILDEKIFLGGVIGSILIVVGLYSVLWG  332



>ref|XP_009403831.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=427

 Score =   475 bits (1222),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 251/331 (76%), Positives = 286/331 (86%), Gaps = 1/331 (0%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G     FQ  KPY AMISLQFGYAGMNI+TK SLN+GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  5     GSRRKLFQVCKPYAAMISLQFGYAGMNILTKFSLNQGMSHYVLVVYRHAFATLSIAPFAL  64

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKVRP++TF IF+QIFVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+A
Sbjct  65    ILERKVRPRMTFAIFMQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLA  124

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+CRMEK+D+KKVRCQAKVVGT+VTV GAMLMTLYKG  +  +W+  +H  +   V    
Sbjct  125   VICRMEKLDLKKVRCQAKVVGTLVTVAGAMLMTLYKGPIMEMVWTKHMHAQAHQAVDVPV  184

Query  910   SADSG-KDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             +ADS  KDW KG I LI+ATLAWAS FI+QA  LR+Y A LSL +L+CF+GTLQ+IAVTF
Sbjct  185   AADSADKDWFKGCIFLIIATLAWASLFILQAAALRRYNAPLSLTSLICFVGTLQAIAVTF  244

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
               EHR SVW IGWDMNLLAAAYAGIV+SSIAYYVQG+V+Q +GPVF +AFSPLMMI+VAI
Sbjct  245   VTEHRLSVWRIGWDMNLLAAAYAGIVTSSIAYYVQGLVIQDKGPVFASAFSPLMMILVAI  304

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFIL+EKIY+GGI+GAVLIV GLY+VLWG
Sbjct  305   MGSFILSEKIYLGGIIGAVLIVVGLYSVLWG  335



>ref|XP_004307206.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=401

 Score =   472 bits (1214),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 250/333 (75%), Positives = 281/333 (84%), Gaps = 3/333 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K  C  NF + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPF
Sbjct  3     KPTCFSNFLENSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PKITF +F+QIF+L LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV
Sbjct  63    AFFFERKKQPKITFPVFMQIFILALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MAV+CRMEK+D+K VRCQAKV GTVVTV GAMLMTLYKG  V  LWS +IHP S      
Sbjct  123   MAVICRMEKLDMKTVRCQAKVAGTVVTVAGAMLMTLYKGPIVQMLWSKYIHPKSSYVTDT  182

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             T + D  K W  GS+LL +ATLAWAS F++Q   L+ Y   QLSL +LVCF+GTLQ+IAV
Sbjct  183   TGTGD--KRWFLGSVLLTIATLAWASLFVLQNKALKTYKDHQLSLTSLVCFIGTLQAIAV  240

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF MEH+ SVW IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+KRGPVF TAFSPLMMIIV
Sbjct  241   TFVMEHKPSVWKIGFDMNLLAAAYAGIVTSSISYYVQGLVMKKRGPVFATAFSPLMMIIV  300

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFILAEKI++G ++GAVLIV GLY+VLWG
Sbjct  301   AIMGSFILAEKIFLGSVLGAVLIVAGLYSVLWG  333



>ref|XP_007218075.1| hypothetical protein PRUPE_ppa006848mg [Prunus persica]
 gb|EMJ19274.1| hypothetical protein PRUPE_ppa006848mg [Prunus persica]
Length=393

 Score =   471 bits (1212),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 248/334 (74%), Positives = 282/334 (84%), Gaps = 3/334 (1%)
 Frame = -2

Query  1459  GKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiap  1280
              K GC  +F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAP
Sbjct  2     AKAGCFSSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAP  61

Query  1279  faliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTF  1100
             FA   ERK +PKIT  IF+QIFVL LLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTF
Sbjct  62    FAFFFERKAQPKITLPIFMQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTF  121

Query  1099  VMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVP  920
             VMAV+CRMEK+D+KKVRCQAKVVGTV+TV GAMLMTLYKG  V  LWS +IHP       
Sbjct  122   VMAVICRMEKLDMKKVRCQAKVVGTVLTVAGAMLMTLYKGPIVEMLWSKYIHPRKSYVTD  181

Query  919   QTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIA  743
              T + D  K W  GS+LL +ATLAWAS F++Q   L+ Y   QLSL ++VCF+GTLQ+IA
Sbjct  182   TTGTGD--KHWFLGSVLLTIATLAWASLFVLQNKALQTYRNHQLSLTSMVCFIGTLQAIA  239

Query  742   VTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMII  563
             VTF MEH+ SVW IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+ RGPVF TAFSPLMMII
Sbjct  240   VTFVMEHKPSVWKIGFDMNLLAAAYAGIVTSSISYYVQGLVMKTRGPVFATAFSPLMMII  299

Query  562   VAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VAIMGSFILAE+I++G ++GAVLIVFGLY+VLWG
Sbjct  300   VAIMGSFILAEQIFLGSVLGAVLIVFGLYSVLWG  333



>ref|XP_003564421.1| PREDICTED: WAT1-related protein At5g07050 [Brachypodium distachyon]
Length=392

 Score =   470 bits (1210),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 247/334 (74%), Positives = 291/334 (87%), Gaps = 4/334 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC G+FF+KAKPYIAMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  2     GCYGDFFEKAKPYIAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERKVRPK+T++ FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMA
Sbjct  62    LLERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHP---TSKSNVP  920
             V+ RMEKVDI+KVRCQAKV GTVVTV GAMLMTLYKG  +  +W++   P         P
Sbjct  122   VIFRMEKVDIRKVRCQAKVAGTVVTVAGAMLMTLYKGPLMQMVWTSHAQPHGNGGGEGGP  181

Query  919   QTSSAD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIA  743
               ++ D +G++W  GS+ +I+ATLAWAS FI+QA TL++Y+A LSL  L+CF+GTLQ+I 
Sbjct  182   VAAAVDPTGREWFLGSLFVIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIV  241

Query  742   VTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMII  563
             VTFAMEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMI+
Sbjct  242   VTFAMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIV  301

Query  562   VAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VA+MGSFILAEKIY+GG++G+VLIV GLY+VLWG
Sbjct  302   VAVMGSFILAEKIYLGGVLGSVLIVIGLYSVLWG  335



>gb|KDP40571.1| hypothetical protein JCGZ_24570 [Jatropha curcas]
Length=407

 Score =   470 bits (1209),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 255/355 (72%), Positives = 299/355 (84%), Gaps = 3/355 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             M+ + G    F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHA ATA I
Sbjct  1     MKSQLGSCLKFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA I ER+ +P+ITF IFLQ+FVLGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAM
Sbjct  61    APFAFIFERRAQPRITFPIFLQLFVLGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAV+ RMEK+D+KKVRCQAK++GT VTV GAMLMTLYKG  +  +WS   H + KS+
Sbjct  121   TFVMAVIFRMEKLDLKKVRCQAKLIGTAVTVAGAMLMTLYKGPIIEMVWSKHAH-SGKSD  179

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQS  749
               +T+  +  KDW KGSILLI+ATLAWAS F++Q   L+ Y   QLSL +LVCF+GT+Q+
Sbjct  180   TTETTGTND-KDWFKGSILLIIATLAWASLFVLQTKALKTYKNHQLSLTSLVCFIGTIQA  238

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVTF MEH+ASVW IGWDMNLLAAAYAGIV+SSI+YYVQG+V++K+GPVF TAFSPLMM
Sbjct  239   IAVTFVMEHKASVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVIKKKGPVFATAFSPLMM  298

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             IIVAIMGSFILAE+I++G I+G+VLIV GLY+VLWGK+KE  E    E I +PVK
Sbjct  299   IIVAIMGSFILAEQIFLGSIVGSVLIVIGLYSVLWGKHKEKMESVSDEDIPDPVK  353



>ref|XP_004493329.1| PREDICTED: WAT1-related protein At5g07050-like isoform X3 [Cicer 
arietinum]
Length=314

 Score =   466 bits (1200),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 244/318 (77%), Positives = 284/318 (89%), Gaps = 4/318 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG +    +FFQ+ KPYIAMISLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGNSA---SFFQRCKPYIAMISLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  57

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERK+RPKI+F +F+Q+FVLGLLGPVIDQN YYAGLKFTSPT+SCA+SN+LPAM
Sbjct  58    APFAIVLERKIRPKISFLMFMQMFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNILPAM  117

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAVL RMEK+DI+K+RCQ KV+GTV+TV GAMLMTLYKG  +N L S ++H   K+ 
Sbjct  118   TFVMAVLFRMEKLDIRKLRCQVKVIGTVITVAGAMLMTLYKGEVINILGSQYMH-HPKNY  176

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P+ ++    KDW KGSILL++AT AWASFFI+QA+TLRKY+AQLSL A+VCF+GTLQSI
Sbjct  177   SPENNTDSGEKDWFKGSILLLIATFAWASFFILQAVTLRKYSAQLSLTAIVCFLGTLQSI  236

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT+ MEHR SVW IGWDMNLLAAAYAGI+SS + YYVQGIVMQK+GPVFVTAFSPLMMI
Sbjct  237   AVTYVMEHRPSVWNIGWDMNLLAAAYAGIISSGLTYYVQGIVMQKKGPVFVTAFSPLMMI  296

Query  565   IVAIMGSFILAEKIYVGG  512
             IVAIMG+FILAEK+Y+GG
Sbjct  297   IVAIMGTFILAEKLYLGG  314



>ref|XP_011020462.1| PREDICTED: WAT1-related protein At5g07050 [Populus euphratica]
Length=406

 Score =   469 bits (1207),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 268/380 (71%), Positives = 316/380 (83%), Gaps = 5/380 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   F + +KPY AMI+LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPFAL
Sbjct  5     GCCSKFLESSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAL  64

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
               ERK++PKITF +F+QIFVL LLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMA
Sbjct  65    FFERKMQPKITFPVFMQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMA  124

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+ RMEK+DIKKVRCQAK++GT+VTV GAMLMTLYKG  V  LWS  IHP  KS V   +
Sbjct  125   VIFRMEKLDIKKVRCQAKLLGTLVTVAGAMLMTLYKGPIVEMLWSKHIHP-RKSYV-TDT  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTF  734
             +  + KDW KGSILLI+ATLAWAS F++Q   L+ Y   QLSL +LVCF+GTLQ+IAVTF
Sbjct  183   TGTTDKDWFKGSILLIIATLAWASLFVLQTKALKTYKNHQLSLTSLVCFIGTLQAIAVTF  242

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
             AMEH++SVW IGWDMNLLAAAYAGIV+SSI+YYVQG+V++K+GPVF TAFSPLMMIIVAI
Sbjct  243   AMEHKSSVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVIKKKGPVFATAFSPLMMIIVAI  302

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKD-QNRimmmm  377
             +GSFILAEKIY+GGI+G+VLIV GLY+VLWG   + K +   E I EPVK  Q     ++
Sbjct  303   LGSFILAEKIYLGGIVGSVLIVMGLYSVLWG-KHKEKMEVDPEEIPEPVKGVQGNGSSIV  361

Query  376   vvveedcvdieMQKTEANNR  317
             V+ + +  ++++QK EANN 
Sbjct  362   VIEDIEANEVQLQKAEANNN  381



>ref|XP_008443233.1| PREDICTED: WAT1-related protein At5g07050-like [Cucumis melo]
 gb|ADN33889.1| nodulin-like protein [Cucumis melo subsp. melo]
Length=400

 Score =   469 bits (1206),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 243/329 (74%), Positives = 281/329 (85%), Gaps = 1/329 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C+G FFQ A PYIA+ISLQFGYAGMNII+ VSLNRGMSHYVLVVYRHAFATA +APFAL+
Sbjct  6     CIGRFFQNANPYIAVISLQFGYAGMNIISVVSLNRGMSHYVLVVYRHAFATAVMAPFALV  65

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRPKIT+ IF+Q+F L LLGP+IDQNFYY GLK TSPTFSCA+SNMLPAMTFVMAV
Sbjct  66    LERKVRPKITWKIFIQMFALALLGPLIDQNFYYVGLKMTSPTFSCAISNMLPAMTFVMAV  125

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             +CRMEK+D+K+VRCQAK+ GT+VTV GAMLMT YKG  +N   +   H  S ++    + 
Sbjct  126   ICRMEKLDLKRVRCQAKLFGTIVTVVGAMLMTFYKGSVINIFGTGHSHQPSSADAAAVNH  185

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
                G +++KGSILLI+ATLAWA+FFI+Q ITLRKYTA LSL  +VCF+GTLQ+I VT AM
Sbjct  186   HHDG-EFIKGSILLIIATLAWAAFFILQVITLRKYTAHLSLTTMVCFLGTLQAIIVTLAM  244

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             EHR   W IGWDMNLLAAAYAGIV+S +AYYVQG+VM+ +GPVFVTAFSPLMM+IVA MG
Sbjct  245   EHRPGAWAIGWDMNLLAAAYAGIVTSGVAYYVQGLVMKTKGPVFVTAFSPLMMVIVAFMG  304

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             S ILAEKIYVGGI+GAVLIV GLY+VLWG
Sbjct  305   SLILAEKIYVGGIIGAVLIVIGLYSVLWG  333



>ref|XP_009419851.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=381

 Score =   468 bits (1204),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 244/326 (75%), Positives = 280/326 (86%), Gaps = 1/326 (0%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             N F+  KPY+AMISLQFGYAGMNII+KVSLN GMSHYVLVVYRHAFAT +IAPFALI ER
Sbjct  6     NLFRSCKPYLAMISLQFGYAGMNIISKVSLNHGMSHYVLVVYRHAFATLSIAPFALIFER  65

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
              VRPKITF IFLQIFVLGLLGPVIDQNFYY GL+ TSPTFSCALSNMLPAMTFV+AV+CR
Sbjct  66    NVRPKITFPIFLQIFVLGLLGPVIDQNFYYVGLRLTSPTFSCALSNMLPAMTFVLAVICR  125

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEK+ ++KVRCQAKV GT+VTV GAMLMTLYKG  +   W+    P  + NVP  ++  +
Sbjct  126   MEKLHMRKVRCQAKVAGTLVTVAGAMLMTLYKGPIMEMGWAKHADP-HQGNVPAAAADGT  184

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              KDW+KG + +I+ATLAWAS FI+QA T++KY A LSL +L+CFMGTLQ+IAVT  MEH+
Sbjct  185   DKDWLKGCVFVIIATLAWASLFILQAATMKKYDAPLSLTSLICFMGTLQAIAVTLIMEHK  244

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IG+DMNLLAAAYAGIV+SSIAYYVQ +VMQ RGPVF +AFSPLMMIIVAIMGSFI
Sbjct  245   PSVWRIGFDMNLLAAAYAGIVTSSIAYYVQSLVMQDRGPVFASAFSPLMMIIVAIMGSFI  304

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE IY+GG++GAVLIV GLY+VLWG
Sbjct  305   LAENIYLGGVVGAVLIVVGLYSVLWG  330



>ref|XP_004167156.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=397

 Score =   468 bits (1205),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 245/328 (75%), Positives = 283/328 (86%), Gaps = 1/328 (0%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             +G+FFQ A PYIA+ISLQFGYAGMNII+ VSLNRGMSHYVLVVYRHAFATA +APFALIL
Sbjct  7     IGHFFQSANPYIAVISLQFGYAGMNIISVVSLNRGMSHYVLVVYRHAFATAVMAPFALIL  66

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERKVRPKITF IF+Q+F L LLGP+IDQNFYY GLK TSPTFSCA+SNMLP+MTFVMAV+
Sbjct  67    ERKVRPKITFKIFIQMFALALLGPLIDQNFYYVGLKMTSPTFSCAISNMLPSMTFVMAVI  126

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
             CRMEK+D+K+VR QAK+ GT+VTV GAMLMT YKG  +NF  +   H  S ++    +  
Sbjct  127   CRMEKLDLKRVRYQAKLFGTIVTVVGAMLMTFYKGSVINFFSTEHGHQPSTADAAAVNHH  186

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
             + G ++VKGSILLI+ATLAWA+FFI+Q ITLRKYTA LSL  LVCF+GTLQ+I VT A+E
Sbjct  187   NDG-EFVKGSILLIIATLAWAAFFILQVITLRKYTAHLSLTTLVCFLGTLQAIVVTLALE  245

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             HR   W IGWDMNLLAAAYAGIV+S +AYYVQG+VM+ +GPVFVTAFSPLMM+IVA MGS
Sbjct  246   HRPGAWAIGWDMNLLAAAYAGIVTSGVAYYVQGLVMKTKGPVFVTAFSPLMMVIVAFMGS  305

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAEKIYVGGI+GAVLIV GLY+VLWG
Sbjct  306   FILAEKIYVGGIIGAVLIVIGLYSVLWG  333



>gb|KFK25097.1| hypothetical protein AALP_AA8G066000 [Arabis alpina]
Length=406

 Score =   468 bits (1205),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 242/338 (72%), Positives = 287/338 (85%), Gaps = 2/338 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  +GC  +F + +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMENLSGC-DSFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKITFTIF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKAQPKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTF++AV+ RME +D+KK+ CQAK++GTVVTV GAMLMT+YKG  V   W+ ++H    
Sbjct  120   AMTFILAVIFRMEMLDVKKLWCQAKIIGTVVTVAGAMLMTIYKGPIVELFWTKYLHLQDS  179

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTL  755
             S+  ++S+  S KD++KGSILLILATLAWAS F++QA  L+ Y   QLSL  LVCF+GTL
Sbjct  180   SHANESSNNTSDKDFLKGSILLILATLAWASLFVLQARILKTYAKHQLSLTTLVCFIGTL  239

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             Q+IAVTF MEH  S W IGWDMNLLAAAY+GIV+SSIAYYVQGIVM+KRGPVF TAFSPL
Sbjct  240   QAIAVTFVMEHNPSAWRIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPL  299

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MM+IVA+MGSF+LAEKI++GG++GAVLIV GLYAVLWG
Sbjct  300   MMVIVAVMGSFVLAEKIFLGGVIGAVLIVIGLYAVLWG  337



>gb|KGN59418.1| hypothetical protein Csa_3G818270 [Cucumis sativus]
Length=397

 Score =   468 bits (1204),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/328 (75%), Positives = 283/328 (86%), Gaps = 1/328 (0%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             +G+FFQ A PYIA+ISLQFGYAGMNII+ VSLNRGMSHYVLVVYRHAFATA +APFALIL
Sbjct  7     IGHFFQSANPYIAVISLQFGYAGMNIISVVSLNRGMSHYVLVVYRHAFATAVMAPFALIL  66

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERKVRPKITF IF+Q+F L LLGP+IDQNFYY GLK TSPTFSCA+SNMLP+MTFVMAV+
Sbjct  67    ERKVRPKITFKIFIQMFALALLGPLIDQNFYYVGLKMTSPTFSCAISNMLPSMTFVMAVI  126

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
             CRMEK+D+K+VR QAK+ GT+VTV GAMLMT YKG  +NF  +   H  S ++    +  
Sbjct  127   CRMEKLDLKRVRYQAKLFGTIVTVVGAMLMTFYKGSVINFFSTGHGHQPSTADAAAVNHH  186

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
             + G ++VKGSILLI+ATLAWA+FFI+Q ITLRKYTA LSL  LVCF+GTLQ+I VT A+E
Sbjct  187   NDG-EFVKGSILLIIATLAWAAFFILQVITLRKYTAHLSLTTLVCFLGTLQAIVVTLALE  245

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             HR   W IGWDMNLLAAAYAGIV+S +AYYVQG+VM+ +GPVFVTAFSPLMM+IVA MGS
Sbjct  246   HRPGAWAIGWDMNLLAAAYAGIVTSGVAYYVQGLVMKTKGPVFVTAFSPLMMVIVAFMGS  305

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAEKIYVGGI+GAVLIV GLY+VLWG
Sbjct  306   FILAEKIYVGGIIGAVLIVIGLYSVLWG  333



>ref|XP_004136769.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=397

 Score =   468 bits (1203),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 245/328 (75%), Positives = 283/328 (86%), Gaps = 1/328 (0%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             +G+FFQ A PYIA+ISLQFGYAGMNII+ VSLNRGMSHYVLVVYRHAFATA +APFALIL
Sbjct  7     IGHFFQSANPYIAVISLQFGYAGMNIISVVSLNRGMSHYVLVVYRHAFATAVMAPFALIL  66

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERKVRPKITF IF+Q+F L LLGP+IDQNFYY GLK TSPTFSCA+SNMLP+MTFVMAV+
Sbjct  67    ERKVRPKITFKIFIQMFALALLGPLIDQNFYYVGLKMTSPTFSCAISNMLPSMTFVMAVI  126

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
             CRMEK+D+K+VR QAK+ GT+VTV GAMLMT YKG  +NF  +   H  S ++    +  
Sbjct  127   CRMEKLDLKRVRYQAKLFGTIVTVVGAMLMTFYKGSVINFFSTGHGHQPSTADAAAVNHH  186

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
             + G ++VKGSILLI+ATLAWA+FFI+Q ITLRKYTA LSL  LVCF+GTLQ+I VT A+E
Sbjct  187   NDG-EFVKGSILLIIATLAWAAFFILQVITLRKYTAHLSLTTLVCFLGTLQAIVVTLALE  245

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             HR   W IGWDMNLLAAAYAGIV+S +AYYVQG+VM+ +GPVFVTAFSPLMM+IVA MGS
Sbjct  246   HRPGAWAIGWDMNLLAAAYAGIVTSGVAYYVQGMVMKTKGPVFVTAFSPLMMVIVAFMGS  305

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAEKIYVGGI+GAVLIV GLY+VLWG
Sbjct  306   FILAEKIYVGGIIGAVLIVIGLYSVLWG  333



>ref|XP_002525547.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF36806.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=415

 Score =   468 bits (1204),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 265/389 (68%), Positives = 313/389 (80%), Gaps = 8/389 (2%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             M+ + GC   F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA I
Sbjct  1     MKNQLGCCAKFLETSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLG-----PVIDQNFYYAGLKFTSPTFSCALSN  1121
              PFA I ERK +P+ITF IFLQ+FVL  LG     PVIDQNFYYAGLKFTSPTFSCA+SN
Sbjct  61    FPFAFIFERKAQPRITFPIFLQLFVLAFLGIYITRPVIDQNFYYAGLKFTSPTFSCAMSN  120

Query  1120  MLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHP  941
             MLPAMTF+MA++ RMEK+DIKK+RCQAK+ GTVVTV GAMLMTLYKG  V  +WS  +HP
Sbjct  121   MLPAMTFIMALIFRMEKLDIKKIRCQAKIAGTVVTVAGAMLMTLYKGPIVEMVWSKHVHP  180

Query  940   TSKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFM  764
               KS V   ++  + KDW+KGSILLI+ATLAWAS F++Q   L+ Y   QLSL  LVCFM
Sbjct  181   -RKSYV-TDTTGTTDKDWLKGSILLIIATLAWASLFVLQTKALKTYKNHQLSLTTLVCFM  238

Query  763   GTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAF  584
             GTLQ+IAVTFAMEH+ S W IGWDMNLLAAAYAGIV+SSI+YYVQG+V++KRGPVF TAF
Sbjct  239   GTLQAIAVTFAMEHKTSAWQIGWDMNLLAAAYAGIVTSSISYYVQGLVIKKRGPVFATAF  298

Query  583   SPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             SPLMMI+VAIMGSFILAEKI++GG++GAVLIV GLYAVLWGK+KE   ++  E I +PVK
Sbjct  299   SPLMMIVVAIMGSFILAEKIFLGGVIGAVLIVIGLYAVLWGKHKERMVQDSDEEILDPVK  358

Query  403   DQNRimmmmvvveedcvdieMQKTEANNR  317
                     + + + +  ++++QK EANN 
Sbjct  359   GVQGNGNSVAIQDIEANEVDLQKVEANNN  387



>ref|XP_009361913.1| PREDICTED: WAT1-related protein At5g07050-like [Pyrus x bretschneideri]
Length=396

 Score =   466 bits (1200),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 245/333 (74%), Positives = 282/333 (85%), Gaps = 3/333 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K GC G+F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHA ATA IAPF
Sbjct  3     KAGCFGSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PK+TF++F+QIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV
Sbjct  63    AFFFERKKQPKMTFSMFMQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             +AV+CRME +DIKKVRCQAKV+GTV+TV GAMLMTLYKG  V  LWS +IHP        
Sbjct  123   LAVICRMEVLDIKKVRCQAKVIGTVLTVAGAMLMTLYKGPIVEMLWSKYIHPRKSYVTDT  182

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             T + D  K W  GSI+L +ATLAWAS F++Q   L+ Y   QLSL +++C +GTLQ+IAV
Sbjct  183   TGTGD--KHWFLGSIMLTIATLAWASLFVLQNNALKTYKNHQLSLTSMICGIGTLQAIAV  240

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF ME + SVW IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+ RGPVF TAFSPLMMIIV
Sbjct  241   TFVMERKPSVWRIGFDMNLLAAAYAGIVTSSISYYVQGLVMKMRGPVFATAFSPLMMIIV  300

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFILAEKI++G ++GAVLIVFGLYAVLWG
Sbjct  301   AIMGSFILAEKIFLGSVLGAVLIVFGLYAVLWG  333



>ref|XP_011034692.1| PREDICTED: WAT1-related protein At5g07050-like [Populus euphratica]
Length=408

 Score =   467 bits (1201),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 248/331 (75%), Positives = 286/331 (86%), Gaps = 3/331 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHA ATA IAPFAL
Sbjct  5     GCCSKFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVIAPFAL  64

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             I ERK++P+ITF +F+QIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMA
Sbjct  65    IFERKMQPRITFPVFIQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMA  124

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+ RMEK+DIKKVRCQAK+VGT VTV GAMLMTLYKG  V  LWS +IHP  + +    +
Sbjct  125   VIFRMEKLDIKKVRCQAKLVGTAVTVAGAMLMTLYKGPVVEMLWSKYIHP--RKSFVTDT  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTF  734
             +  + KDW KGSI LI+ATLAW+S F++Q   L+ Y   QLSL +L+CF+GTLQ+IAVTF
Sbjct  183   TGTTDKDWFKGSIFLIIATLAWSSLFVLQTKALKTYKNHQLSLTSLMCFIGTLQAIAVTF  242

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
              MEH+ SVW IGWDMNLLAAAYAGIV+SSI+YYVQGIV++K+GPVF TAFSPLMMIIVAI
Sbjct  243   VMEHKPSVWVIGWDMNLLAAAYAGIVTSSISYYVQGIVIKKKGPVFATAFSPLMMIIVAI  302

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFILAEKI++GGI+G++LIV GLY+VLWG
Sbjct  303   MGSFILAEKIFLGGIVGSILIVIGLYSVLWG  333



>ref|XP_010096006.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB62699.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=406

 Score =   466 bits (1198),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 247/329 (75%), Positives = 280/329 (85%), Gaps = 3/329 (1%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             L NF + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPFA+  
Sbjct  4     LSNFLEVSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAIFF  63

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ER+ +PKIT  +F+QIF+L LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMAV+
Sbjct  64    ERRAQPKITLPVFMQIFMLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVI  123

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
             CRMEKVD+K+VRCQAKVVGT VTV GAMLMTLYKG  V  +WS  +HP  KS V  T + 
Sbjct  124   CRMEKVDMKRVRCQAKVVGTAVTVAGAMLMTLYKGPIVEMVWSKHVHP-RKSYVTDT-TG  181

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAM  728
             +  K W  GSI LI+ATLAWAS F++Q   L  Y   QLSL  LVCF+GTLQ+ AVTF M
Sbjct  182   NGEKHWFIGSIFLIIATLAWASLFVLQNKALNTYKNHQLSLTTLVCFIGTLQATAVTFVM  241

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             EH++S W IGWDMNLLAAAYAGIV+SSI+YYVQG+VM+KRGPVF TAFSPLMMIIVAIMG
Sbjct  242   EHKSSAWKIGWDMNLLAAAYAGIVTSSISYYVQGLVMKKRGPVFATAFSPLMMIIVAIMG  301

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             SFILAEKI++GG++GA+LIV GLY+VLWG
Sbjct  302   SFILAEKIFLGGVLGALLIVIGLYSVLWG  330



>emb|CDX70003.1| BnaA10g23520D [Brassica napus]
Length=399

 Score =   465 bits (1197),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 238/333 (71%), Positives = 283/333 (85%), Gaps = 1/333 (0%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K GC  +F + +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA IAPF
Sbjct  5     KLGCCESFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPF  64

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PKITFTIF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLPAMTF+
Sbjct  65    AFFFERKAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLPAMTFI  124

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             +AVL RME +D+KK+ CQAK+ GTVVTV GAMLMT+YKG  V   W+ ++H    ++   
Sbjct  125   LAVLFRMEVLDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTP  184

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTLQSIAV  740
             +S+++  KD++KGSILLI ATLAWAS F++QA  L+ Y+  QL+L  LVCF+GTLQ++AV
Sbjct  185   SSNSNDNKDFLKGSILLIFATLAWASLFVLQAKILKTYSKHQLTLTTLVCFIGTLQAVAV  244

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF MEH  S W IGWDMNLLAAAY+GIV+SSIAYYVQGIVM+KRGPVF TAFSPLMM+IV
Sbjct  245   TFVMEHNPSAWRIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIV  304

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSF+LAEKI++GG++GAVLIV GLYAVLWG
Sbjct  305   AIMGSFVLAEKIFLGGVIGAVLIVIGLYAVLWG  337



>ref|XP_009122385.1| PREDICTED: WAT1-related protein At5g07050 [Brassica rapa]
Length=399

 Score =   464 bits (1195),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 237/333 (71%), Positives = 283/333 (85%), Gaps = 1/333 (0%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K GC  +F + +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA IAPF
Sbjct  5     KLGCCESFLKSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPF  64

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PKITFTIF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLPAMTF+
Sbjct  65    AFFFERKAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAISNMLPAMTFI  124

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             +AVL RME +D+KK+ CQAK+ GTVVTV GAMLMT+YKG  V   W+ ++H    ++   
Sbjct  125   LAVLFRMEVLDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTP  184

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTLQSIAV  740
             +S+++  KD++KGSILLI ATLAWAS F++QA  L+ Y+  QL+L  LVCF+GTLQ++AV
Sbjct  185   SSNSNDNKDFLKGSILLIFATLAWASLFVLQAKILKTYSKHQLTLTTLVCFIGTLQAVAV  244

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF MEH  S W IGWDMNLLAAAY+GIV+SSIAYYVQGIVM+KRGPVF TAFSPLMM+IV
Sbjct  245   TFVMEHNPSAWKIGWDMNLLAAAYSGIVASSIAYYVQGIVMKKRGPVFATAFSPLMMVIV  304

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSF+LAE+I++GG++GAVLIV GLYAVLWG
Sbjct  305   AIMGSFVLAERIFLGGVIGAVLIVIGLYAVLWG  337



>ref|XP_002267371.1| PREDICTED: WAT1-related protein At5g07050 [Vitis vinifera]
Length=403

 Score =   464 bits (1195),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 247/330 (75%), Positives = 285/330 (86%), Gaps = 4/330 (1%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G F   +KPY+AMISLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFATA IAPFA+ 
Sbjct  6     CCGGFLHSSKPYLAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATAVIAPFAIF  65

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERK +PKITF +F+QIFVL LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMTFVMAV
Sbjct  66    LERKAQPKITFRVFMQIFVLALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFVMAV  125

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+D+K+VRCQAKVVGT+VTV GAM+MTLYKG  +  +W+  +H TSKS    T+S
Sbjct  126   IFRMEKIDMKRVRCQAKVVGTIVTVAGAMVMTLYKGPIMEMVWTKHMH-TSKSVGSGTTS  184

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYT-AQLSLIALVCFMGTLQSIAVTFA  731
              D  KDW  GSI +I+ATLAWAS F++QA  L+ Y   QLSL  L+CF+GTLQ+IAVTF 
Sbjct  185   TD--KDWFMGSIFVIIATLAWASLFVLQAHALKTYKHHQLSLTTLICFIGTLQAIAVTFV  242

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH+ SVWTIGWDMNLLAAAYAGIV+SSI+YYVQG+V++ RGPVF TAFSPLMMIIVAIM
Sbjct  243   MEHKTSVWTIGWDMNLLAAAYAGIVTSSISYYVQGLVIKSRGPVFATAFSPLMMIIVAIM  302

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKI++GG++GA+LIV GLY+VLWG
Sbjct  303   GSFILAEKIFLGGVLGAILIVAGLYSVLWG  332



>ref|XP_002299181.1| hypothetical protein POPTR_0001s06980g [Populus trichocarpa]
 gb|EEE83986.1| hypothetical protein POPTR_0001s06980g [Populus trichocarpa]
Length=407

 Score =   464 bits (1194),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 248/331 (75%), Positives = 285/331 (86%), Gaps = 3/331 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHA ATA IAPFAL
Sbjct  5     GCCSKFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAVIAPFAL  64

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             I ERK++P+ITF +F+QIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMA
Sbjct  65    IFERKMQPRITFPVFMQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMA  124

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+ RMEK+D+KKVRCQAK+VGT VTV GAMLMTLYKG  V  LWS  IHP  + +    +
Sbjct  125   VIFRMEKLDMKKVRCQAKLVGTAVTVAGAMLMTLYKGPIVEMLWSKHIHP--RKSFVTDT  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTF  734
             +  + KDW KGSI LI+ATLAW+S F++Q   L+ Y   QLSL +L+CF+GTLQ+IAVTF
Sbjct  183   TGTTDKDWFKGSIFLIIATLAWSSLFVLQTKALKTYKNHQLSLTSLMCFIGTLQAIAVTF  242

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
              MEH+ SVW IGWDMNLLAAAYAGIV+SSI+YYVQGIV++K+GPVF TAFSPLMMIIVAI
Sbjct  243   VMEHKPSVWAIGWDMNLLAAAYAGIVTSSISYYVQGIVIKKKGPVFATAFSPLMMIIVAI  302

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFILAEKI++GGI+G+VLIV GLY+VLWG
Sbjct  303   MGSFILAEKIFLGGIVGSVLIVIGLYSVLWG  333



>ref|XP_009395155.1| PREDICTED: WAT1-related protein At5g07050-like [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   463 bits (1191),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 244/330 (74%), Positives = 282/330 (85%), Gaps = 2/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G    + ++AKPYIAMISLQFGYAGMNIITKVSL  GMSHYVLVVYRHAFAT +I PFAL
Sbjct  2     GGYSEYLRRAKPYIAMISLQFGYAGMNIITKVSLTNGMSHYVLVVYRHAFATLSIFPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
              LERKVRP +T  +FLQIFVLGLLGPVIDQNFYY GLK TSPTFSCA+SN+LPAMTFVMA
Sbjct  62    FLERKVRPAMTKWVFLQIFVLGLLGPVIDQNFYYVGLKLTSPTFSCAMSNILPAMTFVMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             VLCRMEKVD+KKV  QAKV GT+VTV GAMLMTLYKG  V  +W+  +HP + SN P  +
Sbjct  122   VLCRMEKVDLKKVIYQAKVAGTLVTVAGAMLMTLYKGPLVEMVWTKHVHPHA-SNSPAAT  180

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              + S +DW  GSI LILATLAWAS F++QA+TLR+Y+AQLSL   +CF+GTLQ+IAVT  
Sbjct  181   ESSS-RDWFLGSIFLILATLAWASLFVLQAVTLRRYSAQLSLTTWICFVGTLQAIAVTLV  239

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH+ S WTIG+DMNLLAAAYAGIV+SS+AYYVQG+V+ KRGPVF +AFSPLMMIIVAIM
Sbjct  240   MEHKPSAWTIGFDMNLLAAAYAGIVTSSVAYYVQGLVIAKRGPVFASAFSPLMMIIVAIM  299

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFIL EKIY+GG++GA+LI+ GLY+VLWG
Sbjct  300   GSFILNEKIYLGGVLGAILIIIGLYSVLWG  329



>ref|XP_002303952.2| hypothetical protein POPTR_0003s19170g [Populus trichocarpa]
 gb|EEE78931.2| hypothetical protein POPTR_0003s19170g [Populus trichocarpa]
Length=406

 Score =   464 bits (1193),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 264/380 (69%), Positives = 313/380 (82%), Gaps = 5/380 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   F + +KPY AMI+LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPFAL
Sbjct  5     GCCSKFLESSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAL  64

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
               ERK++PKITF +F+QIFVL LLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMA
Sbjct  65    FFERKMQPKITFPVFMQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMA  124

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+ RMEK+DIKKVRCQAK++GT+VTV GAM MTLYKG  V  LWS  IHP  KS V   +
Sbjct  125   VIFRMEKLDIKKVRCQAKLLGTLVTVAGAMFMTLYKGPIVEMLWSKHIHP-RKSYV-TDT  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTF  734
             +  + KDW KGSILLI+ATLAWAS F++Q   L+ Y   QL+L +LVCF+GTLQ+IAVTF
Sbjct  183   TGTTDKDWFKGSILLIIATLAWASLFVLQTKALKTYKNHQLTLTSLVCFIGTLQAIAVTF  242

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
              MEH++SVW IGWDMNLLAAAYAGIV+SSI+YYVQG+V++K+GPVF TAFSPLMMI+VAI
Sbjct  243   TMEHKSSVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVIKKKGPVFATAFSPLMMIVVAI  302

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKD-QNRimmmm  377
             MGSFILAEKIY+GGI+G+ LIV GLY+VLWG   + K +   E I EPVK  Q     ++
Sbjct  303   MGSFILAEKIYLGGIVGSALIVMGLYSVLWG-KHKEKMEVDPEEIPEPVKGIQGNGNSIV  361

Query  376   vvveedcvdieMQKTEANNR  317
             V+ + +  ++++QK EANN 
Sbjct  362   VIEDIEANEVQLQKAEANNN  381



>ref|XP_006644860.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=394

 Score =   463 bits (1191),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 244/329 (74%), Positives = 286/329 (87%), Gaps = 2/329 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPY AMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LE
Sbjct  5     GGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLE  64

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRPK+T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV+ 
Sbjct  65    RKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIF  124

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK-SNVPQTSSA  905
             RMEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W++   P    +  P  ++ 
Sbjct  125   RMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWTSHAQPHGHGAEAPVAAAI  184

Query  904   D-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
             D SG++W  GS+ +I+ATLAWAS FI+QA TL++Y+A LSL  L+CF+GTLQ+I VTFAM
Sbjct  185   DPSGREWFLGSLFVIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTFAM  244

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             EHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA MG
Sbjct  245   EHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAGMG  304

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             SFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  305   SFILAEKIYLGGVLGAVLIVIGLYSVLWG  333



>ref|XP_009370627.1| PREDICTED: WAT1-related protein At5g07050-like [Pyrus x bretschneideri]
Length=395

 Score =   462 bits (1190),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 243/333 (73%), Positives = 283/333 (85%), Gaps = 3/333 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K GC G+F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPF
Sbjct  3     KAGCFGSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAIIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PK+TF++F+QIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV
Sbjct  63    AFFFERKKQPKMTFSMFIQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             +AV+ RME +DIKKVRCQAKV+GTV+TV GAMLMTLY+G  V  LWS +IHP +      
Sbjct  123   LAVIFRMEVLDIKKVRCQAKVLGTVLTVAGAMLMTLYRGPIVEMLWSKYIHPRTSYVTDT  182

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             T + D  K W+ GSI+L +ATLAWAS F++Q   L+ Y   QLSL +++C +GTLQ+IAV
Sbjct  183   TGTGD--KHWLLGSIMLTIATLAWASLFVLQNNALKTYKNHQLSLTSMICGIGTLQAIAV  240

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             T  MEH  SVW IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+ RGPVF T+FSPLMMIIV
Sbjct  241   TLVMEHEPSVWKIGFDMNLLAAAYAGIVTSSISYYVQGLVMKTRGPVFATSFSPLMMIIV  300

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFILAEKI++G ++GAVLIVFGLYAVLWG
Sbjct  301   AIMGSFILAEKIFLGSVLGAVLIVFGLYAVLWG  333



>ref|XP_008346651.1| PREDICTED: WAT1-related protein At5g07050-like [Malus domestica]
Length=395

 Score =   462 bits (1190),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 243/333 (73%), Positives = 280/333 (84%), Gaps = 3/333 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K GC G+F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHA ATA IAPF
Sbjct  3     KAGCFGSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPF  62

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PK+TF++F+QIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV
Sbjct  63    AFFFERKKQPKMTFSMFIQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFV  122

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             +AV+ RME +DIKKVRCQAKV+GTV+TV GAMLMTLY+G  V  LWS +IHP        
Sbjct  123   LAVIFRMEVLDIKKVRCQAKVLGTVLTVAGAMLMTLYRGPIVEMLWSKYIHPRKSYVTDT  182

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
             T + D  K W  GSI+L +ATLAWAS F++Q   L+ Y   QLSL +++C +GTLQ+IAV
Sbjct  183   TGTGD--KHWFLGSIMLTIATLAWASLFVLQNNALKTYKNHQLSLTSMICGIGTLQAIAV  240

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF MEH  S W IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+ RGPVF TAFSPLMMIIV
Sbjct  241   TFVMEHEPSAWKIGFDMNLLAAAYAGIVTSSISYYVQGLVMKTRGPVFATAFSPLMMIIV  300

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFILAEKI++G ++GAVLIVFGLYAVLWG
Sbjct  301   AIMGSFILAEKIFLGSVLGAVLIVFGLYAVLWG  333



>ref|XP_002458648.1| hypothetical protein SORBIDRAFT_03g037390 [Sorghum bicolor]
 gb|EES03768.1| hypothetical protein SORBIDRAFT_03g037390 [Sorghum bicolor]
Length=408

 Score =   462 bits (1188),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 246/335 (73%), Positives = 287/335 (86%), Gaps = 5/335 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC G+FF+KAKPYIAM SLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  2     GCYGDFFEKAKPYIAMTSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKVRPK+T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMA
Sbjct  62    ILERKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI-----HPTSKSN  926
             V+ RMEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W++       H      
Sbjct  122   VIFRMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMKMAWTSGHGHAQGHGAEAPA  181

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
                 +   SG++W  GS+ +I+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I
Sbjct  182   AVAAAIDPSGREWFLGSLFVIIATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQAI  241

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
              VTFAMEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMI
Sbjct  242   VVTFAMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMI  301

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVA+MGSFILAEKI++GG++GAVLIV GLY+VLWG
Sbjct  302   IVAVMGSFILAEKIFLGGVLGAVLIVIGLYSVLWG  336



>gb|ACL54205.1| unknown [Zea mays]
 tpg|DAA57217.1| TPA: nodulin-like protein [Zea mays]
Length=413

 Score =   461 bits (1186),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 245/330 (74%), Positives = 287/330 (87%), Gaps = 1/330 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G+FF KAKPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFALI
Sbjct  6     CYGDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALI  65

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRP +T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV
Sbjct  66    LERKVRPNMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAV  125

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W++  H        + + 
Sbjct  126   IFRMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMKMAWTSSGHAHGGGGGAEAAV  185

Query  907   AD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              D SG++W  GS+ +I+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTFA
Sbjct  186   IDPSGREWFLGSLFVIVATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQAIVVTFA  245

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA+M
Sbjct  246   MEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVM  305

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKI++GG++GAVLIV GLY+VLWG
Sbjct  306   GSFILAEKIFLGGVLGAVLIVIGLYSVLWG  335



>ref|NP_001055529.2| Os05g0409500 [Oryza sativa Japonica Group]
 gb|AAT58856.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE63706.1| hypothetical protein OsJ_18524 [Oryza sativa Japonica Group]
 dbj|BAF17443.2| Os05g0409500 [Oryza sativa Japonica Group]
Length=420

 Score =   460 bits (1184),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 245/326 (75%), Positives = 284/326 (87%), Gaps = 1/326 (0%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  QK KPY+AM+SLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  18    SLMQKCKPYVAMVSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  77

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRP+++F +FLQIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMAV+ R
Sbjct  78    KVRPRMSFWVFLQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVIFR  137

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEKV++KK RC AKVVGT+VTV GAMLMTLYKG AV  +W+  +H     +    ++A +
Sbjct  138   MEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRAVEMVWTKHMH-LHGPHQDAVAAAAA  196

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              KDW++GSI LI+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTFAMEH 
Sbjct  197   DKDWLRGSIFLIIATLAWASLFILQAATLKRYDAPLSLTTLICFVGTLQAIVVTFAMEHS  256

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+VMQ RGPVF +AFSPLMMIIVAIMGSFI
Sbjct  257   MSVWKIGFDMNLLAAAYAGIVTSSIAYYVQGLVMQSRGPVFASAFSPLMMIIVAIMGSFI  316

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  317   LAENIYLGGIIGSVLIVAGLYSVLWG  342



>ref|NP_001150619.1| nodulin-like protein [Zea mays]
 gb|ACG39776.1| nodulin-like protein [Zea mays]
Length=413

 Score =   459 bits (1182),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 244/330 (74%), Positives = 287/330 (87%), Gaps = 1/330 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G+FF KAKPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFALI
Sbjct  6     CYGDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALI  65

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRP +T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV
Sbjct  66    LERKVRPNMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAV  125

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEKVD+KK+RCQAKV GT+VTV GAM+MTLYKG  +   W++  H        + + 
Sbjct  126   IFRMEKVDLKKMRCQAKVAGTLVTVAGAMMMTLYKGPLMKMAWTSSGHAHGGGGGAEAAV  185

Query  907   AD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              D SG++W  GS+ +I+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTFA
Sbjct  186   IDPSGREWFLGSLFVIVATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQAIVVTFA  245

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA+M
Sbjct  246   MEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVM  305

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKI++GG++GAVLIV GLY+VLWG
Sbjct  306   GSFILAEKIFLGGVLGAVLIVIGLYSVLWG  335



>gb|EAY98030.1| hypothetical protein OsI_19945 [Oryza sativa Indica Group]
Length=419

 Score =   459 bits (1182),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 245/326 (75%), Positives = 284/326 (87%), Gaps = 1/326 (0%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  QK KPY+AM+SLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  17    SLMQKCKPYVAMVSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  76

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRP+++F +FLQIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFVMAV+ R
Sbjct  77    KVRPRMSFWVFLQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVMAVIFR  136

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEKV++KK RC AKVVGT+VTV GAMLMTLYKG AV  +W+  +H     +    ++A +
Sbjct  137   MEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRAVEMVWTKHMH-LHGPHQDAVAAAAA  195

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              KDW++GSI LI+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTFAMEH 
Sbjct  196   DKDWLRGSIFLIIATLAWASLFILQAATLKRYDAPLSLTTLICFVGTLQAIVVTFAMEHS  255

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+VMQ RGPVF +AFSPLMMIIVAIMGSFI
Sbjct  256   MSVWKIGFDMNLLAAAYAGIVTSSIAYYVQGLVMQSRGPVFASAFSPLMMIIVAIMGSFI  315

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  316   LAENIYLGGIIGSVLIVAGLYSVLWG  341



>ref|XP_008375333.1| PREDICTED: WAT1-related protein At5g07050-like [Malus domestica]
Length=392

 Score =   458 bits (1179),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 241/328 (73%), Positives = 279/328 (85%), Gaps = 3/328 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G+F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHA ATA IAPFA   E
Sbjct  7     GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAIATAIIAPFAFFFE  66

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK +PK+TF++F+QIF+LGLLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+AV+C
Sbjct  67    RKKQPKMTFSMFMQIFILGLLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVIC  126

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RME +DIKKVRCQAKV+GTV+TV GAMLMTLY+G  V  LWS +IHP        T + D
Sbjct  127   RMEVLDIKKVRCQAKVIGTVLTVAGAMLMTLYRGPIVEMLWSKYIHPRKSYVTDTTGTGD  186

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAME  725
               K W  GSI+L +ATLAWAS F++Q   L+ Y   QLSL +++C +GTLQ+IAVTF ME
Sbjct  187   --KHWFLGSIMLTIATLAWASLFVLQNNALKTYKNHQLSLTSMICGIGTLQAIAVTFVME  244

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              + SVW IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+ RGPVF TAFSPLMMIIVAIMGS
Sbjct  245   RKPSVWRIGFDMNLLAAAYAGIVTSSISYYVQGLVMKMRGPVFATAFSPLMMIIVAIMGS  304

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAEKI++G ++GAVLIVFGLYAVLWG
Sbjct  305   FILAEKIFLGSVLGAVLIVFGLYAVLWG  332



>ref|XP_006399183.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
 gb|ESQ40636.1| hypothetical protein EUTSA_v10015938mg [Eutrema salsugineum]
Length=406

 Score =   458 bits (1179),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 232/330 (70%), Positives = 280/330 (85%), Gaps = 1/330 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C  +F + +KPY AM+SLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA IAPFA  
Sbjct  8     CCESFLKSSKPYFAMVSLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATAVIAPFAFF  67

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
              ERK +PKITFTIF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLPAMTF++AV
Sbjct  68    FERKAQPKITFTIFVQLFILGLLGPVIDQNFYYVGLKYTSPTFSCAMSNMLPAMTFILAV  127

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             L RME +D+KK+ CQAK+ GTVVTV GAMLMT+YKG  V   W+ ++H    ++   +++
Sbjct  128   LFRMEMLDVKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHLQHANDTTSSNN  187

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTLQSIAVTFA  731
              +  KD++KGSILLILATLAWAS F++QA  L+ Y   Q+SL  L+CF+GTLQ++ VTFA
Sbjct  188   PNDSKDFLKGSILLILATLAWASLFVLQANILKTYAKHQISLTTLICFIGTLQAVVVTFA  247

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH  S W IGWDMNLLAAAY+GIV+SSI+YYVQG+VM+K+GPVF TAFSPLMM+IVAIM
Sbjct  248   MEHNPSAWRIGWDMNLLAAAYSGIVASSISYYVQGVVMKKKGPVFATAFSPLMMVIVAIM  307

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSF+LAEKIY+GG++GAVLIV GLYAVLWG
Sbjct  308   GSFVLAEKIYLGGVIGAVLIVIGLYAVLWG  337



>ref|XP_003523924.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
Length=398

 Score =   456 bits (1174),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 240/328 (73%), Positives = 280/328 (85%), Gaps = 1/328 (0%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
              NF + +KPY AMI+LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA +APFA ILE
Sbjct  10    ANFLENSKPYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVVAPFAFILE  69

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK +P+I F IF+QIF L LLGPVIDQNFYYAGLK TSPTFSCA+SN+LPAMTFVMAVLC
Sbjct  70    RKAQPRIKFPIFMQIFFLALLGPVIDQNFYYAGLKLTSPTFSCAMSNVLPAMTFVMAVLC  129

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+++KKVRCQAKVVGT+VTV G MLMTLYKG  V  +W+       + N    ++  
Sbjct  130   RMEKINMKKVRCQAKVVGTLVTVAGTMLMTLYKGPRVEMVWTKHAPHHGQINNATYTTTY  189

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAME  725
             S KDW  GSILLI+ATLAWAS F++QA  +  Y   QLSL +L+CF+GTLQ+IAVTF ME
Sbjct  190   SDKDWFIGSILLIIATLAWASLFVLQAKAIETYKNHQLSLTSLICFIGTLQAIAVTFIME  249

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             H+ SVWTIGWDMNLLAAAYAGIV+SSI+YYVQG+V++K+GPVF TAFSPLMMIIVAIMGS
Sbjct  250   HKPSVWTIGWDMNLLAAAYAGIVTSSISYYVQGLVIKKKGPVFATAFSPLMMIIVAIMGS  309

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAE+I++GG++GA+LIV GLY+VLWG
Sbjct  310   FILAEQIFLGGVLGAILIVLGLYSVLWG  337



>dbj|BAB92246.1| putative nodulin MtN21 [Oryza sativa Japonica Group]
 gb|EAZ13862.1| hypothetical protein OsJ_03785 [Oryza sativa Japonica Group]
Length=398

 Score =   455 bits (1171),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 284/331 (86%), Gaps = 4/331 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPY AMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LE
Sbjct  7     GGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLE  66

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRPK+T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV+ 
Sbjct  67    RKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIF  126

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI---HPTSKSNVPQTS  911
             RMEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W++ +   H          +
Sbjct  127   RMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWTSHVQAPHGHGAEAPAAAA  186

Query  910   SAD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             + D SG++W  GS+ +I+ATLAWAS FI+QA TL+KY+A LSL  L+CF+GTLQ+I VTF
Sbjct  187   AVDPSGREWFLGSLFVIIATLAWASLFILQAHTLKKYSAPLSLTTLICFVGTLQAIVVTF  246

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
             AMEHR SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA 
Sbjct  247   AMEHRPSVWAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAG  306

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  307   MGSFILAEKIYLGGVLGAVLIVVGLYSVLWG  337



>dbj|BAK02715.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   455 bits (1170),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 241/331 (73%), Positives = 286/331 (86%), Gaps = 5/331 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G  G+ F+KAKPYIAMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRH FAT +IAPFAL
Sbjct  6     GGYGDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHVFATVSIAPFAL  65

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKVRPK+T++ FLQIFVL LLGPVIDQNFYY GLK+T PTF+CA+SN+LPAMTFVMA
Sbjct  66    ILERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMA  125

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
              + RMEKVD++KVRCQAKV GTVVTV GAMLMTLYKG  +   W+N      ++N  +  
Sbjct  126   FIFRMEKVDLRKVRCQAKVAGTVVTVAGAMLMTLYKGPLMRMAWTNH----GQANGGEAP  181

Query  910   SAD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             + D +G++W  GS+ +I+ATLAWAS FI+QA TL++Y+A LSL  L+CF+GTLQ+I VTF
Sbjct  182   AIDPTGREWFLGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTF  241

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
             AMEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMI+VA+
Sbjct  242   AMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAV  301

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFIL+EKIY+GGI+G+VLIV GLY+VLWG
Sbjct  302   MGSFILSEKIYLGGILGSVLIVIGLYSVLWG  332



>ref|XP_003526345.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN26401.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=396

 Score =   454 bits (1168),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 246/347 (71%), Positives = 291/347 (84%), Gaps = 4/347 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
              NF + +KPY AMI++QFGYAGMNIITK+SLNRGMSHYVLVVYRHAFATA +APFA I E
Sbjct  10    ANFLENSKPYFAMIAIQFGYAGMNIITKISLNRGMSHYVLVVYRHAFATAVVAPFAFIFE  69

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK +P+ITF IF+QIF+L LLGPVIDQNFYYAGLK TSPTFSCA+SN+LPAMTFVMAVLC
Sbjct  70    RKAQPRITFPIFMQIFILALLGPVIDQNFYYAGLKLTSPTFSCAMSNVLPAMTFVMAVLC  129

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+++KKVRCQAKVVGT+VTV GAMLMTLYKG  V   W+       + N    ++  
Sbjct  130   RMEKINMKKVRCQAKVVGTLVTVAGAMLMTLYKGPMV---WTKDAPHNGQINNATNTTTY  186

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAME  725
             S KDW  GSILLI+ATLAWAS F++QA  +  Y   QLSL +L+CF+GTLQ+IAVTF ME
Sbjct  187   SDKDWFIGSILLIIATLAWASLFVLQAKAIETYKNHQLSLTSLICFIGTLQAIAVTFVME  246

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             H+ SVWTIGWDMNLLAAAYAGIV+SSI YYVQG+V++K+GPVF TAFSPLMMIIVAIMGS
Sbjct  247   HKPSVWTIGWDMNLLAAAYAGIVTSSITYYVQGLVIKKKGPVFATAFSPLMMIIVAIMGS  306

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             FIL+E++++GG++GA+LIV GLY+VLWGK+KE   K  +E I  PVK
Sbjct  307   FILSEQLFLGGVLGAILIVIGLYSVLWGKHKEQVVKNEVEDIPLPVK  353



>gb|EEC71658.1| hypothetical protein OsI_04113 [Oryza sativa Indica Group]
Length=398

 Score =   454 bits (1167),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 283/331 (85%), Gaps = 4/331 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPY AMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LE
Sbjct  7     GGFLEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALLLE  66

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRPK+T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV+ 
Sbjct  67    RKVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIF  126

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI---HPTSKSNVPQTS  911
             RMEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W + +   H          +
Sbjct  127   RMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWMSHVQAPHGHGAEAPAAAA  186

Query  910   SAD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             + D SG++W  GS+ +I+ATLAWAS FI+QA TL+KY+A LSL  L+CF+GTLQ+I VTF
Sbjct  187   AVDPSGREWFLGSLFVIIATLAWASLFILQAHTLKKYSAPLSLTTLICFVGTLQAIVVTF  246

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
             AMEHR SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA 
Sbjct  247   AMEHRPSVWAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAG  306

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  307   MGSFILAEKIYLGGVLGAVLIVVGLYSVLWG  337



>ref|XP_002441090.1| hypothetical protein SORBIDRAFT_09g020200 [Sorghum bicolor]
 gb|EES19520.1| hypothetical protein SORBIDRAFT_09g020200 [Sorghum bicolor]
Length=399

 Score =   453 bits (1166),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 240/326 (74%), Positives = 279/326 (86%), Gaps = 4/326 (1%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  12    SLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  71

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRP++T  +FLQIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTF++AVL R
Sbjct  72    KVRPRMTPWVFLQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFILAVLFR  131

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEKV++KK RC AKVVGT+VTV GAMLMTLYKG  V  +W+  +H     + P  + A +
Sbjct  132   MEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRVVEMVWTKHMH----LHGPHPADAAA  187

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              KDW  GSI LI+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ++ VTF ME +
Sbjct  188   DKDWFTGSIFLIIATLAWASLFILQAATLKRYDAPLSLTTLICFVGTLQAVVVTFVMERQ  247

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIVAIMGSFI
Sbjct  248   TSVWRIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQSRGPVFASAFSPLMMIIVAIMGSFI  307

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  308   LAENIYLGGIIGSVLIVAGLYSVLWG  333



>ref|NP_001239827.1| uncharacterized protein LOC100804390 [Glycine max]
 gb|ACU18044.1| unknown [Glycine max]
 gb|KHN37729.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=409

 Score =   454 bits (1167),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 250/357 (70%), Positives = 295/357 (83%), Gaps = 5/357 (1%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             E   GC   FF  +KPY+AMISLQFGYAGMNIITKVSLN+GMSHYVLVVYRHAFATA IA
Sbjct  4     EKLRGC-AKFFASSKPYLAMISLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATAVIA  62

Query  1282  pfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMT  1103
             PFA I ERK +PKITF +F+QIF+L LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMT
Sbjct  63    PFAFIFERKGQPKITFPVFMQIFILALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMT  122

Query  1102  FVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNV  923
             FVMAV CRMEK+DIKKVRC AK+VGT+VTV GAMLMTLY+G  V  +W+   HP +K+N 
Sbjct  123   FVMAVFCRMEKIDIKKVRCIAKIVGTLVTVAGAMLMTLYRGPIVEMVWAK--HPHNKTNA  180

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSI  746
               T++    KDW  G   LI+ATLAWAS F++QA  ++ Y   QLSL +LVCF+GTLQ+I
Sbjct  181   -TTTTGSLDKDWFLGCTFLIIATLAWASLFVLQAKAIQTYKNHQLSLTSLVCFIGTLQAI  239

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF +EH  SVW IGWD++LLAAAYAGIV+SSI+YYVQG+V++ +GPVF TAFSPLMMI
Sbjct  240   AVTFVVEHNPSVWRIGWDVSLLAAAYAGIVTSSISYYVQGLVIKMKGPVFATAFSPLMMI  299

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKDQN  395
             IVAIMGSFILAE+IY+GG++GA+LIV GLY+VLWGK+KE  E ++ + I  PVKD  
Sbjct  300   IVAIMGSFILAEQIYLGGVIGAILIVIGLYSVLWGKHKEQIESKVADEIPLPVKDSQ  356



>ref|XP_003545806.1| PREDICTED: WAT1-related protein At5g07050-like [Glycine max]
 gb|KHN11194.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=409

 Score =   452 bits (1164),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 249/355 (70%), Positives = 296/355 (83%), Gaps = 5/355 (1%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             E   GC  N F  +KPY+AMISLQFGYAGMNIITKVSLN+GMSHYVLVVYRHAFATA IA
Sbjct  4     EKLRGC-ANVFASSKPYLAMISLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATAVIA  62

Query  1282  pfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMT  1103
             PFA+I ERK +PKITF +F+QIF+L LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMT
Sbjct  63    PFAIIFERKGQPKITFPVFMQIFILALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMT  122

Query  1102  FVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNV  923
             FVMAV CRMEK++IKKVRC AK+VGT+VTV GAMLMTLY+G  V  +W+   HP +K+N 
Sbjct  123   FVMAVFCRMEKIEIKKVRCMAKIVGTLVTVAGAMLMTLYRGPIVEMVWAK--HPHNKTNA  180

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSI  746
               T++    KDW  G   LI+ATLAWAS F++QA  ++ Y   QLSL +LVCF+GTLQ+I
Sbjct  181   -TTTTESFDKDWFLGCTFLIIATLAWASLFVLQAKAIQTYKNHQLSLTSLVCFIGTLQAI  239

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVTF +EH  SVW IGWD++LLAAAYAGIV+SSI+YYVQG+V++ +GPVF TAFSPLMMI
Sbjct  240   AVTFVVEHNPSVWRIGWDVSLLAAAYAGIVTSSISYYVQGLVIKMKGPVFATAFSPLMMI  299

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKD  401
             IVAIMGSFILAE+IY+GG++GA+LIV GLY+VLWGK+KE  E ++ + I  PVKD
Sbjct  300   IVAIMGSFILAEQIYLGGVIGAILIVIGLYSVLWGKHKEQIESKVADEIPLPVKD  354



>ref|XP_002873292.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49551.1| hypothetical protein ARALYDRAFT_487525 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   452 bits (1163),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/341 (70%), Positives = 284/341 (83%), Gaps = 5/341 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  + C  +F   +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMEELSSC-ESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKITF+IF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKAQPKITFSIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTF++AVL RME +D+KK+ CQAK+ GTVVTVGGAM+MT+YKG  V   W+ ++H    
Sbjct  120   AMTFILAVLFRMEMLDVKKLWCQAKIGGTVVTVGGAMVMTIYKGPIVELFWTKYMHLQDS  179

Query  931   SNVPQTSS---ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFM  764
             S+   T+S   + S K+++KGSILLI ATLAWAS F++QA  L+ Y   QLSL  L+CF+
Sbjct  180   SHANHTTSSKNSSSDKEFLKGSILLIFATLAWASLFVLQAKILKTYAKHQLSLTTLICFI  239

Query  763   GTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAF  584
             GTLQ++AVTF MEH  SVW IGWDMNLLAAAY+GIV+SSI+YYVQGIVM+KRGPVF TAF
Sbjct  240   GTLQAVAVTFVMEHNPSVWRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAF  299

Query  583   SPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             SPLMM+IVA+ GSF+LAEKI++GG++GAVLIV GLYAVLWG
Sbjct  300   SPLMMVIVAVTGSFVLAEKIFLGGVIGAVLIVIGLYAVLWG  340



>ref|XP_008445949.1| PREDICTED: WAT1-related protein At5g07050 [Cucumis melo]
Length=388

 Score =   451 bits (1161),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 239/331 (72%), Positives = 281/331 (85%), Gaps = 7/331 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
              C   F + +KPY AMISLQFGYAGMNII+KVSL+RGMSHYVLVVYRHAFATA+IAPF L
Sbjct  9     NCCNGFLENSKPYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHAFATASIAPFVL  68

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
               ER+ +P++TF +F+QIFVL LLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMA
Sbjct  69    FFERRGQPRMTFKVFIQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMA  128

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+ RMEK+++KK+RCQAKV+GT+VTVGGAMLMTLYKG  +   WS   H T+      +S
Sbjct  129   VIFRMEKLEMKKLRCQAKVLGTLVTVGGAMLMTLYKGPPLQMPWSKNSHLTN------SS  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTF  734
              + + KDW KGSI LI+ATLAWAS F++Q   L+ Y   Q +L  LVCFMGTLQ+IAVT 
Sbjct  183   ESSNNKDWFKGSIFLIIATLAWASLFVLQNQVLKTYKNHQFTLTTLVCFMGTLQAIAVTL  242

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
               EH+ASVW IGWDMNLLAAAYAGIV+SSI+YYVQG+VM+KRGPVF TAFSPLMMIIVAI
Sbjct  243   VAEHKASVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVMKKRGPVFATAFSPLMMIIVAI  302

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFILAEKI++GGI+G++LIVFGLY+VLWG
Sbjct  303   MGSFILAEKIFLGGIIGSILIVFGLYSVLWG  333



>ref|XP_010067678.1| PREDICTED: WAT1-related protein At5g07050 [Eucalyptus grandis]
 gb|KCW65859.1| hypothetical protein EUGRSUZ_G03200 [Eucalyptus grandis]
Length=403

 Score =   452 bits (1162),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 249/336 (74%), Positives = 282/336 (84%), Gaps = 3/336 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             M+   GC   F + +KPY AMISLQFGYAGMNIITKVSLN GMSHYVLVVYRHAFATA I
Sbjct  1     MDKLKGC-NKFLETSKPYFAMISLQFGYAGMNIITKVSLNHGMSHYVLVVYRHAFATAVI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFALI ERK +PKITF +F+QIFVL LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAM
Sbjct  60    APFALIFERKKQPKITFPVFMQIFVLALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
             TFVMAV+ RMEK+DIKKV+CQAKV+GTVVTV GAMLMTLYKG  +  +W +  HP   S 
Sbjct  120   TFVMAVIFRMEKIDIKKVKCQAKVIGTVVTVAGAMLMTLYKGPIMEMVWPH-AHPRQSST  178

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQS  749
                 SS  S K+W  G ILLI+ATLAWAS F++Q   L  Y   QLSL +LVCF+GTLQ+
Sbjct  179   SGTGSSGTSDKEWFLGCILLIIATLAWASLFVLQTKALETYRNHQLSLTSLVCFVGTLQA  238

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
             IAVTF MEHR+ VW +GWDMNLLAAAYAGIV+SSI+YYVQG+V++KRGPVF TAFSPLMM
Sbjct  239   IAVTFVMEHRSGVWKVGWDMNLLAAAYAGIVTSSISYYVQGLVIKKRGPVFATAFSPLMM  298

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAI+GSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  299   IIVAILGSFILAEKIYLGGVLGAVLIVIGLYSVLWG  334



>emb|CDM84603.1| unnamed protein product [Triticum aestivum]
Length=387

 Score =   451 bits (1161),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 237/330 (72%), Positives = 282/330 (85%), Gaps = 3/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G  G+ F+KAKPYIAMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  2     GGYGDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             I ERKVRPK+T++ FLQIFVL LLGPVIDQNFYY GLK+T PTF+CA+SN+LPAMTFVMA
Sbjct  62    IFERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
              + RMEKVD++KVRCQAKV GTVVTV GAMLMTLYKG  +   W++   P    +    +
Sbjct  122   FIFRMEKVDLRKVRCQAKVAGTVVTVAGAMLMTLYKGPLIRMAWTSHGQPHGGED---PA  178

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
                +G++W  GS+ +I+ATLAWAS FI+QA TL++Y+A LSL  L+CF+GTLQ+I VT A
Sbjct  179   VDPTGREWFLGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTLA  238

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMI+VA+M
Sbjct  239   MEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAVM  298

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFIL+EKIY+GG++G+VLIV GLY+VLWG
Sbjct  299   GSFILSEKIYLGGVLGSVLIVIGLYSVLWG  328



>ref|XP_007148806.1| hypothetical protein PHAVU_005G015900g [Phaseolus vulgaris]
 gb|ESW20800.1| hypothetical protein PHAVU_005G015900g [Phaseolus vulgaris]
Length=382

 Score =   451 bits (1159),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 238/330 (72%), Positives = 280/330 (85%), Gaps = 5/330 (2%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
              NF + +K Y AMI+LQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPFA I E
Sbjct  10    ANFLENSKHYFAMIALQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFAFIFE  69

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK +P+ITF IF+QIF+L LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMTFVM+VLC
Sbjct  70    RKAQPRITFKIFMQIFILALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFVMSVLC  129

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI--HPTSKSNVPQTSS  908
             RMEK+++KKVRCQAKV+GT++TVGGAMLMTLYKG  V  +W+     H +  +N   T+ 
Sbjct  130   RMEKMNMKKVRCQAKVIGTLMTVGGAMLMTLYKGPQVEIVWTKHALNHQSQINNNSSTTP  189

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTLQSIAVTFA  731
             +D  KDW+ GSI LI+ATLAWAS F++QA  +  Y + QLSL  L+CF+GT+Q+ AVTF 
Sbjct  190   SD--KDWLIGSIFLIIATLAWASLFVLQAKAIETYKSHQLSLTTLICFIGTVQATAVTFV  247

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH  SVWTIGWDMNLLAAAYAGIV+SSI+YYVQG+V++KRGPVF TAFSPLMMIIVA M
Sbjct  248   MEHNPSVWTIGWDMNLLAAAYAGIVTSSISYYVQGLVIKKRGPVFATAFSPLMMIIVAFM  307

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAE I++GG++G +LIV GLY+VLWG
Sbjct  308   GSFILAEHIFLGGVLGGILIVIGLYSVLWG  337



>gb|EMS48876.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=389

 Score =   450 bits (1158),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 238/328 (73%), Positives = 280/328 (85%), Gaps = 1/328 (0%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F  KAKPYI+MISLQFGYAGMN++TKVSLN GMSHYVLVVYRHAFAT AIAPFAL LE
Sbjct  5     GGFMDKAKPYISMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALFLE  64

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRPK+T++IF QIFVL LLGPVIDQNFYY GLK+T PTF+CA+SN+LPAMTFVMAV+ 
Sbjct  65    RKVRPKMTWSIFFQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAVIF  124

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+++KKVRCQAK+ GTVVTV GAMLMTLYKG  ++  W+N     S       +  D
Sbjct  125   RMEKIELKKVRCQAKIFGTVVTVAGAMLMTLYKGPLMHLPWTNGHAQPSGGEASGAAGVD  184

Query  901   -SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
              + ++W  GS+ +I+ATLAWAS FI+Q  T+RKYTAQLSL  L+CF+GT+Q+IAVTF ME
Sbjct  185   PTAREWFLGSLFIIIATLAWASLFILQTHTIRKYTAQLSLTTLICFIGTIQAIAVTFVME  244

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              R SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA+MGS
Sbjct  245   RRVSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGS  304

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FIL+EKIY+G ++GAV+IV GLYAVLWG
Sbjct  305   FILSEKIYLGAVLGAVVIVVGLYAVLWG  332



>ref|XP_008655310.1| PREDICTED: uncharacterized protein LOC100384013 isoform X1 [Zea 
mays]
 gb|AFW81937.1| hypothetical protein ZEAMMB73_476289 [Zea mays]
Length=409

 Score =   450 bits (1158),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 242/326 (74%), Positives = 276/326 (85%), Gaps = 0/326 (0%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  10    SLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  69

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRP++T   FLQIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+AVL R
Sbjct  70    KVRPRMTLWAFLQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVLFR  129

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEKV++KK RC AKVVGT+VTV GAMLMTLYKG  V  +W+  IH          ++A +
Sbjct  130   MEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRVVELVWTKHIHLHGPHPDAAAAAAAA  189

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              KDW  GSI LI+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTF ME  
Sbjct  190   DKDWFTGSIFLIIATLAWASLFILQAATLKRYDAPLSLTTLICFVGTLQAIVVTFVMERE  249

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIVAIMGSFI
Sbjct  250   PSVWRIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQSRGPVFASAFSPLMMIIVAIMGSFI  309

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  310   LAENIYLGGIIGSVLIVAGLYSVLWG  335



>ref|XP_003568462.2| PREDICTED: WAT1-related protein At5g07050-like [Brachypodium 
distachyon]
Length=406

 Score =   449 bits (1156),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 241/341 (71%), Positives = 282/341 (83%), Gaps = 10/341 (3%)
 Frame = -2

Query  1474  QIEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafat  1295
             Q + EG +     + Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT
Sbjct  4     QPQTEGSS-----WMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFAT  58

Query  1294  aaiapfaliLER---KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALS  1124
              +IAPFAL LER   K RP ++  +FLQIFVL LLGPVIDQNFYYAGLK+TSPTFSCA+S
Sbjct  59    LSIAPFALFLERRNHKARPAMSLWVFLQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMS  118

Query  1123  NMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIH  944
             NMLPAMTFV+AV+ RMEKV++KK RC AKVVGT+VTV GAMLMTLYKG AV  +WS+  H
Sbjct  119   NMLPAMTFVLAVIFRMEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRAVEMIWSS--H  176

Query  943   PTSKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFM  764
              T     P   +A + KDW +GS+ LI+ATLAWAS FI+QA TL++Y A L+L  L+CF+
Sbjct  177   MTHLHAGPHQDAAAAAKDWFRGSVFLIIATLAWASLFILQAATLKRYNAPLTLTTLICFV  236

Query  763   GTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAF  584
             GTLQ+I VT AMEH+  VW IG+DMNLLAAAYAGIV+SSIAYYVQG+VMQ RGPVF +AF
Sbjct  237   GTLQAIVVTLAMEHKVDVWKIGFDMNLLAAAYAGIVTSSIAYYVQGLVMQSRGPVFASAF  296

Query  583   SPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             SPLMMI+VAIMGSFILAE IY+GGI+G+ LIV GLY+VLWG
Sbjct  297   SPLMMIVVAIMGSFILAENIYLGGILGSALIVAGLYSVLWG  337



>ref|XP_007010782.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY19592.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=437

 Score =   450 bits (1158),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 245/358 (68%), Positives = 279/358 (78%), Gaps = 33/358 (9%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G+F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPFALI E
Sbjct  7     GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPFALIFE  66

Query  1261  RKVR------------------------------PKITFTIFLQIFVLGLLGPVIDQNFY  1172
                                                KITF +F+QIF+L LLGPVIDQNFY
Sbjct  67    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKITFPVFMQIFILALLGPVIDQNFY  126

Query  1171  YAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMT  992
             YAGLK+TSPTFSCA+SNMLPAMTFVMAV+CRMEKVD+KKVRCQAK+VGT+VTV GAMLMT
Sbjct  127   YAGLKYTSPTFSCAMSNMLPAMTFVMAVMCRMEKVDVKKVRCQAKIVGTLVTVAGAMLMT  186

Query  991   LYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITL  812
             LYKG  V   W+  IHP   +      + D  KDWVKGSI LI+ATLAWAS F++QA  L
Sbjct  187   LYKGPIVELFWTKSIHPRQSNGTDSAGTTD--KDWVKGSIFLIIATLAWASLFVLQAKAL  244

Query  811   RKY-TAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYY  635
             + Y   QLSL +LVCF+GTLQ+I VTF ME + S W IGWDMNLLAAAYAGIV+SSI+YY
Sbjct  245   KTYKNHQLSLTSLVCFVGTLQAIVVTFVMERKTSAWQIGWDMNLLAAAYAGIVTSSISYY  304

Query  634   VQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VQG+V++KRGPVF TAFSPLMMIIVAIMGSFILAEKI++GG++GA+LIV GLY+VLWG
Sbjct  305   VQGMVIKKRGPVFATAFSPLMMIIVAIMGSFILAEKIFLGGVIGAILIVMGLYSVLWG  362



>ref|XP_011085946.1| PREDICTED: WAT1-related protein At5g07050 [Sesamum indicum]
Length=397

 Score =   449 bits (1155),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 240/330 (73%), Positives = 276/330 (84%), Gaps = 3/330 (1%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C  +F +  KPY+ MISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA IAPFA  
Sbjct  9     CCSSFLKNCKPYMGMISLQFGYAGMNIITKISLNGGMSHYVLVVYRHAIATAVIAPFAFF  68

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
              ERK +PKITF +F+QIFVLGLLGPVIDQNFYYAGLK TSPTFSCA+SNMLPA+TFVMA+
Sbjct  69    FERKAQPKITFPVFMQIFVLGLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPALTFVMAI  128

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEKVDIKKV  QAKVVGT++TVGGAMLMTLYKG  V  +WS   H  S +    ++ 
Sbjct  129   IFRMEKVDIKKVIYQAKVVGTIITVGGAMLMTLYKGPLVEMVWSK--HRQSHTGGGSSAG  186

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYT-AQLSLIALVCFMGTLQSIAVTFA  731
               S +DW  G ILLI+ATLAWAS FI+Q   L+ Y+  QLSL +LVCFMGT+Q+IAVTF 
Sbjct  187   ETSDRDWFIGCILLIIATLAWASLFILQKAALKTYSNHQLSLTSLVCFMGTIQAIAVTFV  246

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEH  SVW IGWDMNLLAAAYAGIV+SSI+YYVQG+VM+ +GPVF TAFSPLMMIIVAIM
Sbjct  247   MEHNTSVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVMKTKGPVFATAFSPLMMIIVAIM  306

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKIY+GG++G+V+IV GLY+VLWG
Sbjct  307   GSFILAEKIYLGGVIGSVIIVVGLYSVLWG  336



>ref|XP_004962102.1| PREDICTED: WAT1-related protein At5g07050-like [Setaria italica]
Length=401

 Score =   449 bits (1155),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 242/329 (74%), Positives = 279/329 (85%), Gaps = 7/329 (2%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  Q+ KPY+AM+SLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  10    SLMQRCKPYMAMVSLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  69

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRP++T  +FLQIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTF+MAVL R
Sbjct  70    KVRPRMTPWVFLQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFIMAVLFR  129

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEKV++KK RC AKVVGT+VTV GAMLMTLYKG  V  +W+  IH       PQ  +A +
Sbjct  130   MEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRVVEMVWTRHIHLHG----PQPGAAAA  185

Query  898   ---GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
                 KDW+ GSI LI+ATLAWAS F++QA TL++Y A LSL  L+CF+GTLQ+I VTF M
Sbjct  186   AAADKDWLTGSIFLIIATLAWASLFVLQAATLKRYDAPLSLTTLICFVGTLQAIVVTFVM  245

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E   SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIVAIMG
Sbjct  246   ERETSVWRIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQSRGPVFASAFSPLMMIIVAIMG  305

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             SFILAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  306   SFILAENIYLGGILGSVLIVAGLYSVLWG  334



>ref|XP_004144320.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
 ref|XP_004157980.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=441

 Score =   449 bits (1155),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 244/339 (72%), Positives = 292/339 (86%), Gaps = 5/339 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK   + NF + A+PYIAMISLQFGYAGMNIITKV+LNRGMSHYVLV YR AFAT  +
Sbjct  1     MEGKGSGIANFVEGAQPYIAMISLQFGYAGMNIITKVALNRGMSHYVLVTYRQAFATIVL  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA   ERKVRPKI+F + +QIF+LGLLGPVIDQNFYYAGLK TS TFSCA SNMLPAM
Sbjct  61    APFAFFFERKVRPKISFAMLMQIFLLGLLGPVIDQNFYYAGLKLTSTTFSCATSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWS----NFIHPT  938
             TF++A+LCRMEK+++KKVRCQAKVVGT+VTVGGA+LMTLYKG+ ++F WS    N++H +
Sbjct  121   TFILALLCRMEKLEMKKVRCQAKVVGTLVTVGGAILMTLYKGNVISFFWSHHNNNYLHSS  180

Query  937   SKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGT  758
             S S+   +  + + +DW+KGSILL+ A LAWA FFI+QA+TLR YTA LSL  LVCF GT
Sbjct  181   SASSNYYSFES-TYQDWLKGSILLLFANLAWALFFIVQAMTLRNYTAHLSLTTLVCFFGT  239

Query  757   LQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSP  578
             LQS+AVTF MEH+ASVW IGWDMNLLA+ YAGIVSSSIAYYVQG++MQKRGPVFVTAF+P
Sbjct  240   LQSMAVTFVMEHKASVWNIGWDMNLLASVYAGIVSSSIAYYVQGMIMQKRGPVFVTAFTP  299

Query  577   LMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ++MIIVAIMGSF+LAEKIY+G ++G +++V GLY+VLWG
Sbjct  300   MIMIIVAIMGSFMLAEKIYIGRVVGGIVMVVGLYSVLWG  338



>gb|ACR34989.1| unknown [Zea mays]
Length=406

 Score =   447 bits (1151),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 242/326 (74%), Positives = 277/326 (85%), Gaps = 1/326 (0%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  10    SLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  69

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRP++T   FLQIFVL LLGPVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+AVL R
Sbjct  70    KVRPRMTLWAFLQIFVLALLGPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVLFR  129

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEKV++KK RC AKVVGT+VTV GAMLMTLYKG  V  +W+  IH     +    ++A +
Sbjct  130   MEKVNLKKARCVAKVVGTLVTVAGAMLMTLYKGRVVELVWTKHIH-LHGPHPDAAAAAAA  188

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              KDW  GSI LI+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTF ME  
Sbjct  189   DKDWFTGSIFLIIATLAWASLFILQAATLKRYDAPLSLTTLICFVGTLQAIVVTFVMERE  248

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIVAIMGSFI
Sbjct  249   PSVWRIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQSRGPVFASAFSPLMMIIVAIMGSFI  308

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  309   LAENIYLGGIIGSVLIVAGLYSVLWG  334



>ref|XP_008455745.1| PREDICTED: WAT1-related protein At5g07050-like [Cucumis melo]
Length=444

 Score =   448 bits (1152),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 244/339 (72%), Positives = 290/339 (86%), Gaps = 4/339 (1%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEGK   + NF + A+PYIAMISLQFGYAGMNI+TKV+LNRGMSHYVLV YR AFAT A+
Sbjct  1     MEGKGSGIANFVEGAQPYIAMISLQFGYAGMNIVTKVALNRGMSHYVLVTYRQAFATIAL  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA  LERKVRPKI+FT+ +QIF+LG LGPVIDQNFYYAGLK TS TFSCA SNMLPAM
Sbjct  61    APFAFFLERKVRPKISFTMLMQIFLLGFLGPVIDQNFYYAGLKLTSTTFSCATSNMLPAM  120

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWS----NFIHPT  938
             TF++A+LCRMEK+++KKVRCQAKVVGT+VTVGGA+LMTLYKG+ ++F WS    N+   +
Sbjct  121   TFILALLCRMEKLEMKKVRCQAKVVGTLVTVGGAILMTLYKGNVISFFWSHHNNNYDLQS  180

Query  937   SKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGT  758
             S ++    S   + +DW+KGSILL+ A LAWA FFIIQAITLR YTA LSL  LVCF GT
Sbjct  181   SSASSNYYSFESTNQDWLKGSILLLFANLAWALFFIIQAITLRNYTAHLSLTTLVCFFGT  240

Query  757   LQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSP  578
             LQS+AVTF MEH+ SVW IGWDMNLLA+ YAGIVSSSIAYYVQG++M+KRGPVFVTAF+P
Sbjct  241   LQSMAVTFVMEHQTSVWNIGWDMNLLASVYAGIVSSSIAYYVQGMIMRKRGPVFVTAFTP  300

Query  577   LMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ++MIIVAIMGSF+LAEKIY+G ++G +++V GLY+VLWG
Sbjct  301   MIMIIVAIMGSFMLAEKIYIGRVVGGIVMVVGLYSVLWG  339



>gb|EMT31802.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=387

 Score =   445 bits (1144),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 236/331 (71%), Positives = 285/331 (86%), Gaps = 5/331 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G  G+ F+KAKPYIAMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  2     GGYGDLFEKAKPYIAMICLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATVSIAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERKVRPK+T++ FLQIFVL LLGPVIDQNFYY GLK+T PTF+CA+SN+LPAMTFVMA
Sbjct  62    ILERKVRPKMTWSSFLQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
              + RMEKVD++ +RCQAKV GTVVTV GAMLMTLYKG  +   W++      +++  +  
Sbjct  122   FIFRMEKVDLRNLRCQAKVAGTVVTVAGAMLMTLYKGPLMRRAWTSH----GQAHGGEAP  177

Query  910   SAD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             + D +G++W  GS+ +I+ATLAWAS FI+QA TL++Y+A LSL  L+CF+GTLQ+I VT 
Sbjct  178   AVDPTGREWFLGSLFIIIATLAWASLFILQAHTLKQYSAPLSLTTLICFVGTLQAIVVTL  237

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
             AMEHR SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMI+VA+
Sbjct  238   AMEHRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIVVAV  297

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MGSFIL+EKIY+GG++G+VLIV GLY+VLWG
Sbjct  298   MGSFILSEKIYLGGVLGSVLIVIGLYSVLWG  328



>ref|NP_196322.3| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
 sp|Q9FL41.1|WTR38_ARATH RecName: Full=WAT1-related protein At5g07050 [Arabidopsis thaliana]
 dbj|BAB11163.1| MtN21 nodulin protein-like [Arabidopsis thaliana]
 gb|AED91102.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=402

 Score =   444 bits (1142),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 236/340 (69%), Positives = 284/340 (84%), Gaps = 4/340 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  + C  +F   +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMEEISSC-ESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKITF+IF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKAQPKITFSIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIH--PT  938
             AMTF++AVL RME +D+KK+ CQAK+ GTVVTV GAMLMT+YKG  V   W+ ++H   +
Sbjct  120   AMTFILAVLFRMEMLDLKKLWCQAKIAGTVVTVAGAMLMTIYKGPIVELFWTKYMHIQDS  179

Query  937   SKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMG  761
             S +N   + ++ S K+++KGSILLI ATLAWAS F++QA  L+ Y   QLSL  L+CF+G
Sbjct  180   SHANTTSSKNSSSDKEFLKGSILLIFATLAWASLFVLQAKILKTYAKHQLSLTTLICFIG  239

Query  760   TLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFS  581
             TLQ++AVTF MEH  S W IGWDMNLLAAAY+GIV+SSI+YYVQGIVM+KRGPVF TAFS
Sbjct  240   TLQAVAVTFVMEHNPSAWRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFS  299

Query  580   PLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             PLMM+IVA+MGSF+LAEKI++GG++GAVLIV GLYAVLWG
Sbjct  300   PLMMVIVAVMGSFVLAEKIFLGGVIGAVLIVIGLYAVLWG  339



>ref|XP_004151540.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=391

 Score =   443 bits (1139),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 231/330 (70%), Positives = 280/330 (85%), Gaps = 6/330 (2%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C   F + +KPY AMISLQFGYAGMNII+KVSL+RGMSHYVLVVYRH FATA+IAPF L 
Sbjct  9     CCNGFLENSKPYFAMISLQFGYAGMNIISKVSLSRGMSHYVLVVYRHVFATASIAPFVLF  68

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
              ER+ +P+ITF IF+QIF+L LLGPV+DQNFYYAGLK+TSPTFSCA+SN+LPAMTFVMAV
Sbjct  69    FERRGQPRITFKIFIQIFMLALLGPVVDQNFYYAGLKYTSPTFSCAMSNILPAMTFVMAV  128

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+D+KK+RCQAKV+GT+VTVGGAMLMTLYKG  +   W+        S++  ++ 
Sbjct  129   IFRMEKLDMKKLRCQAKVLGTLVTVGGAMLMTLYKGPPLQMPWTK-----HNSHLTNSNE  183

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFA  731
             + + KDW KGSI LI+ATLAW+S F++Q   L+ Y   Q +L  L+CF+GTLQ+IAVT  
Sbjct  184   SSNDKDWFKGSIFLIIATLAWSSLFVLQNQALKTYENHQFTLTTLMCFVGTLQAIAVTLV  243

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
              EH+ASVW IGWDMNLLAAAYAGIV+SSI+YYVQG+VM+K+GPVF TAFSPLMMIIVAIM
Sbjct  244   AEHKASVWRIGWDMNLLAAAYAGIVTSSISYYVQGLVMKKKGPVFATAFSPLMMIIVAIM  303

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKI++GGI+G++LIVFGLY+VLWG
Sbjct  304   GSFILAEKIFLGGIIGSILIVFGLYSVLWG  333



>ref|XP_010423261.1| PREDICTED: WAT1-related protein At5g07050 [Camelina sativa]
Length=399

 Score =   443 bits (1140),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 239/338 (71%), Positives = 284/338 (84%), Gaps = 4/338 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  + C  +F   +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMEELSSC-ESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKITFTIF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTF++AVL RME +D+KK+ CQAK+ GTVVTVGGAM+MTLYKG  V   W+ ++H   +
Sbjct  120   AMTFILAVLFRMEMLDVKKLWCQAKIGGTVVTVGGAMVMTLYKGPIVELFWTKYMH--LQ  177

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTL  755
              N   +S + S KD++KGSILLILATLAWAS F++QA  L+ Y   QLSL  L+CF+GT+
Sbjct  178   DNETASSKSSSDKDFLKGSILLILATLAWASLFVLQARILKTYAKHQLSLTTLICFIGTI  237

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             Q++AVTF MEH  S W IGWDMNLLAAAY+GIV+SSI+YYVQGIVM+KRGPVF TAFSPL
Sbjct  238   QAVAVTFVMEHNPSAWRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPL  297

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MM+IVA+MGSF+LAEKI++GG++GAVLIV GLYAVLWG
Sbjct  298   MMVIVAVMGSFVLAEKIFLGGVIGAVLIVIGLYAVLWG  335



>ref|XP_003628011.1| Auxin-induced protein 5NG4 [Medicago truncatula]
 gb|AET02487.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=395

 Score =   442 bits (1138),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 234/327 (72%), Positives = 277/327 (85%), Gaps = 2/327 (1%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             N F+  K Y AMI LQFGYAGMNIITKVSLN+GMSHYVLVVYRHAFATA+IAPFA + ER
Sbjct  7     NSFENMKHYTAMICLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATASIAPFAFMFER  66

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             K +PKITF IFLQIFVL LLGPVIDQNFYYAGLK TSPTFSCA+SN+LPAMTFVMAVLCR
Sbjct  67    KGQPKITFRIFLQIFVLALLGPVIDQNFYYAGLKLTSPTFSCAMSNVLPAMTFVMAVLCR  126

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEK++IK+VRCQAK++GT++TV GAMLMTLYKG  V  +W+   HP ++++   T+ + S
Sbjct  127   MEKINIKQVRCQAKILGTILTVAGAMLMTLYKGPIVEMVWAKNRHPQNETHETSTTGS-S  185

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYT-AQLSLIALVCFMGTLQSIAVTFAMEH  722
              +DW+ G   LI+AT AWAS F++QA  +  Y   QLSL +LV F+GTLQ+IAVTF  EH
Sbjct  186   ERDWILGCTFLIIATFAWASLFVLQAKVIETYKHHQLSLTSLVVFIGTLQAIAVTFVAEH  245

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               SVW IGWDM+LLA+AYAGIV+SS+AYYVQG+V++K+GPVF TAFSPLMMIIVAIMGSF
Sbjct  246   DPSVWRIGWDMSLLASAYAGIVTSSLAYYVQGLVIRKKGPVFATAFSPLMMIIVAIMGSF  305

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAE+IY GG+MGA+LIV GLY+VLWG
Sbjct  306   ILAEQIYSGGVMGAILIVIGLYSVLWG  332



>dbj|BAK04850.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   442 bits (1137),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 234/328 (71%), Positives = 280/328 (85%), Gaps = 1/328 (0%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPYIAMISLQFGYAGMN++TKVSLN GMSHYVLVVYRHAFAT AIAPFALILE
Sbjct  5     GGFMEKAKPYIAMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATLAIAPFALILE  64

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRP++T++IF QIFVL LLGPVIDQNFYY GLK+T PTF+CA+SN+LPAMTFVMAV+ 
Sbjct  65    RKVRPQMTWSIFFQIFVLALLGPVIDQNFYYVGLKYTGPTFACAMSNILPAMTFVMAVIF  124

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+++ K+RCQAK+ GTVVTV GAMLMTLYKG  ++  W+N             +  D
Sbjct  125   RMEKIELTKLRCQAKIFGTVVTVAGAMLMTLYKGPLMHLPWTNSHAQPGGGEAAGAAGVD  184

Query  901   -SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
              + ++W  GS+ +I+ATLAWAS FI+Q  T++KYTAQLSL  L+CF+GT+Q++AVTF ME
Sbjct  185   PTAREWFLGSLFIIIATLAWASLFILQTHTIKKYTAQLSLTTLICFVGTIQAVAVTFVME  244

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              R SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA+MGS
Sbjct  245   RRVSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGS  304

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FIL+EKIY+G ++GAV+IV GLYAVLWG
Sbjct  305   FILSEKIYLGAVLGAVVIVVGLYAVLWG  332



>ref|XP_010456426.1| PREDICTED: WAT1-related protein At5g07050-like [Camelina sativa]
Length=399

 Score =   442 bits (1138),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 237/338 (70%), Positives = 284/338 (84%), Gaps = 3/338 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  + C  +F   +KPY+AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMEELSSC-ESFLTTSKPYLAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKITFTIF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKAQPKITFTIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTF++AVL RME +D+KK+ CQAK+ GTVVTVGGAM+MT+YKG  V   W+ ++H   +
Sbjct  120   AMTFILAVLFRMEMLDVKKLWCQAKIGGTVVTVGGAMVMTIYKGPIVELFWTKYMH-LQE  178

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTL  755
              N   +S + S KD++KGSILLILATLAWAS F++QA  L+ Y   QLSL  L+CF+GT+
Sbjct  179   DNETASSKSSSDKDFLKGSILLILATLAWASLFVLQARILKTYAKHQLSLTTLICFIGTI  238

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             Q++AVTF MEH  S W I WDMNLLAAAY+GIV+SSI+YYVQGIVM+KRGPVF TAFSPL
Sbjct  239   QAVAVTFVMEHNPSAWRISWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPL  298

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MM+IVA+MGSF+LAEKI++GG++GAVLIV GLYAVLWG
Sbjct  299   MMVIVAVMGSFVLAEKIFLGGVIGAVLIVIGLYAVLWG  336



>ref|XP_006654584.1| PREDICTED: WAT1-related protein At5g07050-like [Oryza brachyantha]
Length=407

 Score =   442 bits (1138),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 236/333 (71%), Positives = 279/333 (84%), Gaps = 4/333 (1%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C   F  +AKPY AMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFALI
Sbjct  4     CCSGFMDRAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALI  63

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRPK+T++IF QIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV
Sbjct  64    LERKVRPKMTWSIFFQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAV  123

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+D+KKVRCQAK+ GT+VTV GAMLMTLYKG  +   WS            +  +
Sbjct  124   IFRMEKLDLKKVRCQAKIAGTLVTVAGAMLMTLYKGPLMEMAWSRHAAGAVHGGAAEAPA  183

Query  907   AD----SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAV  740
             A     SG+DW  GS+ +I+ATLAWAS FI+Q  T+++Y+AQLSL  L+CF+GTLQ++ V
Sbjct  184   AAAADLSGRDWFLGSMFVIVATLAWASLFILQTHTIKQYSAQLSLTTLICFVGTLQAVVV  243

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF ME R SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q+ GPVF +AFSPLMMIIV
Sbjct  244   TFVMERRPSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQRTGPVFASAFSPLMMIIV  303

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             A+MGSFIL+E+IY+GG++GAVLIV GLY+VLWG
Sbjct  304   AVMGSFILSEQIYLGGVVGAVLIVVGLYSVLWG  336



>gb|EYU26922.1| hypothetical protein MIMGU_mgv1a007458mg [Erythranthe guttata]
Length=406

 Score =   442 bits (1137),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 239/333 (72%), Positives = 275/333 (83%), Gaps = 4/333 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             +T C  + F+  KPYI MISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA IAPF
Sbjct  6     QTCCSSSLFKSCKPYIGMISLQFGYAGMNIITKISLNGGMSHYVLVVYRHAIATAVIAPF  65

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A   ERK +PKITF +F+QIFVLGLLGPVIDQNFYYAGLK TSPTFSCA+SNMLPA+TFV
Sbjct  66    AFFFERKAQPKITFPVFMQIFVLGLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPALTFV  125

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MA++ RMEKVDIKKV  QAKVVGT++TVGGA+LMTLYKG  V   W+      +K   P 
Sbjct  126   MAIIFRMEKVDIKKVIYQAKVVGTIITVGGALLMTLYKGPLVEMAWTKHREAHTKGG-PA  184

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYT-AQLSLIALVCFMGTLQSIAV  740
               ++D   DW  G ILLI+ATLAWA+ FI+Q  TL  Y+  QLSL +LVCFMGT+Q+IAV
Sbjct  185   NETSD--HDWFIGCILLIIATLAWAALFILQKATLTTYSNHQLSLTSLVCFMGTMQAIAV  242

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF MEH  S W IGWDMNLLAAAYAGIV+SSI+YYVQG+VM+ +GPVF TAFSPLMMIIV
Sbjct  243   TFVMEHNTSAWRIGWDMNLLAAAYAGIVTSSISYYVQGLVMKVKGPVFATAFSPLMMIIV  302

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             A+MGSFILAEKIY+GG++G+V+IV GLYAVLWG
Sbjct  303   AVMGSFILAEKIYLGGVIGSVIIVVGLYAVLWG  335



>gb|EEC79453.1| hypothetical protein OsI_20446 [Oryza sativa Indica Group]
Length=404

 Score =   441 bits (1135),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/330 (71%), Positives = 280/330 (85%), Gaps = 1/330 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G F +KAKPY AMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFALI
Sbjct  4     CCGGFMEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALI  63

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRPK+T++IF QIF+L LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV
Sbjct  64    LERKVRPKMTWSIFFQIFILALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAV  123

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+++KKVRCQAK+ GT+VTV GAMLMTLYKG  +   WS      +       ++
Sbjct  124   IFRMEKLELKKVRCQAKIAGTLVTVAGAMLMTLYKGPLMEMAWSRHAGAGAAEAPAAAAA  183

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
             A SG+DW  GS+ +I+ATLAWAS FI+Q  T+++Y+AQLSL  L+C +GTLQ++ VTFAM
Sbjct  184   AISGRDWFLGSMFVIVATLAWASLFILQTHTIKQYSAQLSLTTLICLVGTLQAVVVTFAM  243

Query  727   E-HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             E  R SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q+ GPVF +AFSPLMMIIVA+M
Sbjct  244   ERRRPSVWAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQRTGPVFASAFSPLMMIIVAVM  303

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFIL+E+IY+GG++GA LIV GLY+VLWG
Sbjct  304   GSFILSEQIYLGGVVGAALIVVGLYSVLWG  333



>ref|NP_001055921.1| Os05g0493800 [Oryza sativa Japonica Group]
 gb|AAT69654.1| putative nodulin MtN21 protein [Oryza sativa Japonica Group]
 dbj|BAF17835.1| Os05g0493800 [Oryza sativa Japonica Group]
 gb|EEE64206.1| hypothetical protein OsJ_19039 [Oryza sativa Japonica Group]
Length=404

 Score =   441 bits (1135),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 234/330 (71%), Positives = 279/330 (85%), Gaps = 1/330 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G F +KAKPY AMI LQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFALI
Sbjct  4     CCGGFMEKAKPYFAMICLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATISIAPFALI  63

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRPK+T++IF QIF+L LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV
Sbjct  64    LERKVRPKMTWSIFFQIFILALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAV  123

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+++KKVRCQAK+ GT+VTV GAMLMTLYKG  +   WS              ++
Sbjct  124   IFRMEKLELKKVRCQAKIAGTLVTVAGAMLMTLYKGPLMEMAWSRHAGAGVAEAPAAAAA  183

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
             A SG+DW  GS+ +I+ATLAWAS FI+Q  T+++Y+AQLSL  L+C +GTLQ++ VTFAM
Sbjct  184   AISGRDWFLGSMFVIVATLAWASLFILQTHTIKQYSAQLSLTTLICLVGTLQAVVVTFAM  243

Query  727   E-HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             E  R SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q+ GPVF +AFSPLMMIIVA+M
Sbjct  244   ERRRPSVWAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQRTGPVFASAFSPLMMIIVAVM  303

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFIL+E+IY+GG++GA LIV GLY+VLWG
Sbjct  304   GSFILSEQIYLGGVVGAALIVVGLYSVLWG  333



>gb|AFW82369.1| hypothetical protein ZEAMMB73_445023 [Zea mays]
Length=392

 Score =   440 bits (1132),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 236/333 (71%), Positives = 286/333 (86%), Gaps = 5/333 (2%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G F +KAKPY+AMISLQFGYAGMN++TKVSLN+GMSHYVLVVYRHAFAT +IAPFAL+
Sbjct  4     CTG-FVEKAKPYVAMISLQFGYAGMNVLTKVSLNQGMSHYVLVVYRHAFATLSIAPFALV  62

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRPK+T+ IF QIFVL +LGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFV+AV
Sbjct  63    LERKVRPKMTWPIFWQIFVLAMLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVLAV  122

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+ ++KV CQAKV+GTV+TV GAMLMTLYKG  +   W+   H +S     +  +
Sbjct  123   IFRMEKLQMRKVTCQAKVLGTVLTVAGAMLMTLYKGPLMQLAWTTNRHASSSRAAAEAPA  182

Query  907   AD----SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAV  740
             A     SG+DW  GS+ +I+ATLAWAS F++Q  T+++Y+AQLSL  LVCF+GTLQ++ V
Sbjct  183   AAAAEISGRDWFLGSVFVIVATLAWASLFVLQTHTIKQYSAQLSLTTLVCFVGTLQAVVV  242

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TFAME RASVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIV
Sbjct  243   TFAMERRASVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIV  302

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             A+MGSFIL+EKIY+G ++GAV+IV GLY+VLWG
Sbjct  303   AVMGSFILSEKIYLGAVLGAVIIVAGLYSVLWG  335



>gb|EMT14666.1| Auxin-induced protein 5NG4 [Aegilops tauschii]
Length=406

 Score =   440 bits (1131),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 236/328 (72%), Positives = 271/328 (83%), Gaps = 6/328 (2%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
                Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL LER
Sbjct  14    TLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALFLER  73

Query  1258  -KVRP-KITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
              K RP ++T  +FL IF+L L+GPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMAV+
Sbjct  74    GKARPPRMTPLVFLNIFLLALMGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVI  133

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RMEKVD+KK RC AKV GT+VTV GAMLMTLYKG AV  +WS   H       P   +A
Sbjct  134   FRMEKVDLKKPRCMAKVAGTLVTVAGAMLMTLYKGRAVEMIWSRHAHLPG----PHQDAA  189

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
              + KDW KGSI LI+ATLAWAS FI+Q  TL +Y A L+L  L+CF+GTLQ+I VT AME
Sbjct  190   AAAKDWFKGSIFLIIATLAWASLFILQGPTLTRYNAPLTLTTLICFVGTLQAIVVTLAME  249

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             H   VW IG+DMNLLAAAYAGIV+SS+AYYVQG+V+Q RGPVF +AFSPLMMI+VAIMGS
Sbjct  250   HTTDVWKIGFDMNLLAAAYAGIVTSSLAYYVQGLVIQSRGPVFASAFSPLMMIVVAIMGS  309

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  310   FILAENIYLGGIIGSVLIVAGLYSVLWG  337



>ref|XP_006289728.1| hypothetical protein CARUB_v10003296mg [Capsella rubella]
 gb|EOA22626.1| hypothetical protein CARUB_v10003296mg [Capsella rubella]
Length=391

 Score =   437 bits (1123),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 237/338 (70%), Positives = 281/338 (83%), Gaps = 4/338 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  + C  +F   +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMEELSSC-ESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKIT +IF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKAQPKITISIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTFV+AVL RME +D+KK+ CQAK+ GTVVTVGGAM+MT+YKG  V   W+ ++H   +
Sbjct  120   AMTFVLAVLFRMEMLDVKKLWCQAKIGGTVVTVGGAMVMTIYKGPIVELFWTKYMH--LQ  177

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTL  755
              N   +S + S KD++KGSILLI ATLAWAS F++QA  L+ Y   QLSL  LVCF+GT+
Sbjct  178   DNEATSSKSSSDKDFLKGSILLIFATLAWASLFVLQARILKTYAKHQLSLTTLVCFIGTI  237

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             Q++AVTF MEH  S W IGWDMNLLAAAY+GIV+SSI+YYVQGIVM+KRGPVF TAFSPL
Sbjct  238   QAVAVTFVMEHNPSAWRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPL  297

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MMIIVA+MGSF+LAE I++GG++GAVLIV GLYAVLWG
Sbjct  298   MMIIVAVMGSFVLAENIFLGGVIGAVLIVIGLYAVLWG  335



>ref|XP_009790910.1| PREDICTED: WAT1-related protein At5g07050-like isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score =   434 bits (1115),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 258/354 (73%), Positives = 287/354 (81%), Gaps = 41/354 (12%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GCL +FFQ+AKPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFATAAI
Sbjct  1     MENKAGCLSSFFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLG                              
Sbjct  61    APFALVLERKLRPKMTFMMFLQIFVLGLLG------------------------------  90

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
                      MEKV IKK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN IH T+ SN
Sbjct  91    ---------MEKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIH-TNTSN  140

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ S+  + KDW+KGSILLILAT AWASFFI+Q +T+RKYTA LSL ALVCFMGTLQSI
Sbjct  141   VPE-SNEPTDKDWLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSI  199

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+AS W IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  200   AVTLVMEHKASAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMI  259

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             IVAIMGSFILAEKIY+GG++GAVLIV GLY+VLWGKYKEYKEKE+  AI EPVK
Sbjct  260   IVAIMGSFILAEKIYLGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVK  313



>ref|XP_009610630.1| PREDICTED: WAT1-related protein At5g07050-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score =   432 bits (1110),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 257/354 (73%), Positives = 286/354 (81%), Gaps = 41/354 (12%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GCL +FFQ+AKPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFATAAI
Sbjct  1     MENKAGCLSSFFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLG                              
Sbjct  61    APFALVLERKLRPKMTFMMFLQIFVLGLLG------------------------------  90

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
                      MEKV IKK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN IH T+ SN
Sbjct  91    ---------MEKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIH-TNTSN  140

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ + A + KDW+KGSILLILAT AWASFFI+Q +T+RKYTA LSL ALVCFMGTLQSI
Sbjct  141   VPEPNEA-TDKDWLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSI  199

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+ S W IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  200   AVTLVMEHKTSAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMI  259

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             IVAIMGSFILAEKIY+GG++GAVLIV GLY+VLWGKYKEYKEKE+  AI EPVK
Sbjct  260   IVAIMGSFILAEKIYLGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEGAIPEPVK  313



>ref|XP_010495095.1| PREDICTED: WAT1-related protein At5g07050-like [Camelina sativa]
Length=396

 Score =   433 bits (1113),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 235/338 (70%), Positives = 282/338 (83%), Gaps = 6/338 (2%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             + ME  + C  +F   +KPY AMISLQFGYAGMNIITK+SLN GMSHYVLVVYRHA ATA
Sbjct  1     MSMEELSSC-ESFLTSSKPYFAMISLQFGYAGMNIITKISLNTGMSHYVLVVYRHAIATA  59

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA   ERK +PKIT++IF+Q+F+LGLLGPVIDQNFYY GLK+TSPTFSCA+SNMLP
Sbjct  60    VIAPFAFFFERKSQPKITYSIFMQLFILGLLGPVIDQNFYYMGLKYTSPTFSCAMSNMLP  119

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             AMTF++AVL RME +D+KK+ CQAK+ GTVVTVGGAM+MTLYKG  V   W+ ++H   +
Sbjct  120   AMTFILAVLFRMEMLDVKKLWCQAKIGGTVVTVGGAMVMTLYKGPIVELFWTKYMH--LQ  177

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTL  755
              N   +S + S KD++KGSILLILATLAWAS F++Q   L+ Y   QLSL  L+CF+GT+
Sbjct  178   DNETASSKSSSDKDFLKGSILLILATLAWASLFVLQ--ILKTYAKHQLSLTTLICFIGTI  235

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             Q++AVTF MEH  S W IGWDMNLLAAAY+GIV+SSI+YYVQGIVM+KRGPVF TAFSPL
Sbjct  236   QAVAVTFVMEHNPSAWRIGWDMNLLAAAYSGIVASSISYYVQGIVMKKRGPVFATAFSPL  295

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MM+IVA+MGSF+LAE I++GG++GAVLIV GLYAVLWG
Sbjct  296   MMVIVAVMGSFVLAENIFLGGVIGAVLIVIGLYAVLWG  333



>ref|NP_001151393.1| nodulin-like protein [Zea mays]
 gb|ACG42670.1| nodulin-like protein [Zea mays]
Length=397

 Score =   432 bits (1110),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 233/329 (71%), Positives = 282/329 (86%), Gaps = 2/329 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPYIAMISLQFGYAGMN++TKVSLN+GMSHYVLVVYRHAFAT +IAPFAL+LE
Sbjct  7     GGFVEKAKPYIAMISLQFGYAGMNVLTKVSLNQGMSHYVLVVYRHAFATLSIAPFALVLE  66

Query  1261  RK-VRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             RK VRPK+T+ IF QIFVL +LGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFV+AV+
Sbjct  67    RKKVRPKMTWPIFWQIFVLAMLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVLAVI  126

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RMEK+ ++KVRCQAKV+GTVVTV GAMLMTLYKG  +    +   H ++ ++    +  
Sbjct  127   FRMEKLQMEKVRCQAKVLGTVVTVAGAMLMTLYKGPLMQLARTTSRHASASASASPAAEI  186

Query  904   D-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
               SG+DW  GS+ +++ATLAWAS F++QA T+++Y+AQLSL  LVCF+GTLQ++ VTF M
Sbjct  187   TISGRDWFLGSVFVVVATLAWASLFVLQAHTIKQYSAQLSLTTLVCFVGTLQAVVVTFVM  246

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E R SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA MG
Sbjct  247   ERRTSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKAGPVFASAFSPLMMIIVAAMG  306

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             S IL+EKIY+GG++GA LIV GLY+VLWG
Sbjct  307   SLILSEKIYLGGVLGAALIVAGLYSVLWG  335



>gb|AFW78503.1| nodulin-like protein [Zea mays]
Length=394

 Score =   430 bits (1106),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 233/328 (71%), Positives = 280/328 (85%), Gaps = 2/328 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPYIAMISLQFGYAGMN++TKVSLN+GMSHYVLVVYRHAFAT +IAPFAL+LE
Sbjct  7     GGFVEKAKPYIAMISLQFGYAGMNVLTKVSLNQGMSHYVLVVYRHAFATLSIAPFALVLE  66

Query  1261  RK-VRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             RK VRPK+T+ IF QIFVL +LGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFV+AV+
Sbjct  67    RKKVRPKMTWPIFWQIFVLAMLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVLAVI  126

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RMEK+ ++KVRCQAKV GTVVTV GAMLMTLYKG  +    +   H ++ ++       
Sbjct  127   FRMEKLQMEKVRCQAKVFGTVVTVAGAMLMTLYKGPLMQLARTTSRHASASASP-AAEII  185

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
              SG+DW  GS+ +++ATLAWAS F++QA T+++Y+AQLSL  LVCF+GTLQ++ VTF ME
Sbjct  186   ISGRDWFLGSVFVVVATLAWASLFVLQAHTIKQYSAQLSLTTLVCFVGTLQAVVVTFVME  245

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              R SVWTIG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA MGS
Sbjct  246   RRTSVWTIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKAGPVFASAFSPLMMIIVAAMGS  305

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              IL+EKIY+GG++GA LIV GLY+VLWG
Sbjct  306   LILSEKIYLGGVLGAALIVAGLYSVLWG  333



>ref|XP_004499808.1| PREDICTED: WAT1-related protein At5g07050-like [Cicer arietinum]
Length=398

 Score =   431 bits (1107),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 229/352 (65%), Positives = 285/352 (81%), Gaps = 2/352 (1%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K     +F  K+ PYIAMI LQFGYAG+NIITK+SLN GMSHYVLVVYRHAFAT AIAPF
Sbjct  5     KLKSFASFLDKSMPYIAMILLQFGYAGVNIITKLSLNGGMSHYVLVVYRHAFATIAIAPF  64

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             A+I ERK +PK+TF IF QIF+L +LGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMTF+
Sbjct  65    AIIFERKAQPKVTFQIFFQIFLLAVLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFL  124

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MAVLCRMEK+++KK+ CQAK+VGT++TV G MLM+ YKG  V  LW+  I   S SN   
Sbjct  125   MAVLCRMEKINMKKLICQAKLVGTILTVAGVMLMSFYKGPIVELLWTKDI-SHSNSNATN  183

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
              + + S  DW+ GSI L ++T+AWASFF++QA  L  Y   QL+L +L+CF+GTL + A 
Sbjct  184   NTRSSSKNDWLLGSIFLTISTIAWASFFVLQAKALETYKNHQLTLTSLICFIGTLLAFAT  243

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             T  MEH+ SVWTIGWDMNLLA+AY+GIVSSSI+YYVQG+V++K+GPVF T+FSPLMMIIV
Sbjct  244   TMVMEHKTSVWTIGWDMNLLASAYSGIVSSSISYYVQGLVIKKKGPVFATSFSPLMMIIV  303

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             AIMGSFILAEKI++G ++G++L+V GLY+VLWGK+KE     +++  + P+K
Sbjct  304   AIMGSFILAEKIFLGSVIGSILVVIGLYSVLWGKHKEQVNNRVVDDNSSPIK  355



>ref|XP_009621490.1| PREDICTED: WAT1-related protein At5g07050-like isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score =   427 bits (1099),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 255/354 (72%), Positives = 284/354 (80%), Gaps = 41/354 (12%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             ME K GCL +FFQ+AKPYIAMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFATAAI
Sbjct  1     MENKAGCLSSFFQRAKPYIAMISLQFGYAGMNVITKVSLNGGMSHYVLVVYRHAFATAAI  60

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFAL+LERK+RPK+TF +FLQIFVLGLLG                              
Sbjct  61    APFALVLERKLRPKMTFMMFLQIFVLGLLG------------------------------  90

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
                      MEKV IKK+RCQAKVVGT+VTV GAMLMTLYKGH +N +WSN IH T+ SN
Sbjct  91    ---------MEKVHIKKLRCQAKVVGTIVTVAGAMLMTLYKGHVINLVWSNNIH-TNTSN  140

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
             VP+ +   + KD +KGSILLILAT AWASFFI+Q +T+RKYTA LSL ALVCFMGTLQSI
Sbjct  141   VPEPNEV-TDKDLLKGSILLILATFAWASFFILQNVTMRKYTAPLSLTALVCFMGTLQSI  199

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             AVT  MEH+ S W IG+DMNLLAAAYAGIVSSS+AYYVQG+VM+KRGPVFVTAFSPLMMI
Sbjct  200   AVTLVMEHKTSAWAIGFDMNLLAAAYAGIVSSSLAYYVQGLVMEKRGPVFVTAFSPLMMI  259

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             IVAIMGSFILAEKIY+GG++GAVLIV GLY+VLWGKYKEYKEKE+  AI EPVK
Sbjct  260   IVAIMGSFILAEKIYIGGVLGAVLIVAGLYSVLWGKYKEYKEKEIEAAIPEPVK  313



>ref|NP_001170095.1| hypothetical protein [Zea mays]
 gb|ACN35775.1| unknown [Zea mays]
Length=449

 Score =   431 bits (1107),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 242/366 (66%), Positives = 276/366 (75%), Gaps = 40/366 (11%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  10    SLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  69

Query  1258  KVRPKITFTIFLQIFVLGLLG---------------------------------------  1196
             KVRP++T   FLQIFVL LLG                                       
Sbjct  70    KVRPRMTLWAFLQIFVLALLGCVHRGGLVLFRVIALLVSCLAKLCSDSDCMRLCESFRAH  129

Query  1195  -PVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvv  1019
              PVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+AVL RMEKV++KK RC AKVVGT+V
Sbjct  130   RPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVLFRMEKVNLKKARCVAKVVGTLV  189

Query  1018  tvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWAS  839
             TV GAMLMTLYKG  V  +W+  IH          ++A + KDW  GSI LI+ATLAWAS
Sbjct  190   TVAGAMLMTLYKGRVVELVWTKHIHLHGPHPDAAAAAAAADKDWFTGSIFLIIATLAWAS  249

Query  838   FFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGI  659
              FI+QA TL++Y A LSL  L+CF+GTLQ+I VTF ME   SVW IG+DMNLLAAAYAGI
Sbjct  250   LFILQAATLKRYDAPLSLTTLICFVGTLQAIVVTFVMEREPSVWRIGFDMNLLAAAYAGI  309

Query  658   VSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGL  479
             V+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIVAIMGSFILAE IY+GGI+G+VLIV GL
Sbjct  310   VTSSIAYYVQGLVIQSRGPVFASAFSPLMMIIVAIMGSFILAENIYLGGIIGSVLIVAGL  369

Query  478   YAVLWG  461
             Y+VLWG
Sbjct  370   YSVLWG  375



>gb|ABR16695.1| unknown [Picea sitchensis]
Length=406

 Score =   429 bits (1102),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 223/328 (68%), Positives = 269/328 (82%), Gaps = 2/328 (1%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             L + FQ +KPYIAMISLQFGYAGMNI+TKVSLNRGM+HYVLVVYRHA AT A+APFA   
Sbjct  9     LSHAFQISKPYIAMISLQFGYAGMNIMTKVSLNRGMNHYVLVVYRHAIATIAMAPFAFFF  68

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERKVRPK+TF  F  IF LGLLGPVIDQN YYAGLK T+PTFSCALSN LPAMTFVMA++
Sbjct  69    ERKVRPKLTFLTFCLIFALGLLGPVIDQNVYYAGLKLTTPTFSCALSNTLPAMTFVMAIV  128

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RME++ +K+VR QAK+VGT+++VGGAMLMTLYKG AV+  WS   H   K    +++SA
Sbjct  129   FRMERLSMKQVRSQAKIVGTLLSVGGAMLMTLYKGPAVHMFWSPHHHHHDK--YVKSASA  186

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
                KDW+KGS+L+I + LAWA FF++QA   +KY+AQLSL  L+CF+GTLQS A+T  +E
Sbjct  187   VPDKDWIKGSLLVIASCLAWAGFFVLQAFVAKKYSAQLSLTTLICFLGTLQSAALTLVIE  246

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             H+ SVW IGWDMNLL A Y+G+++S IAYYVQ + M+ +GPVF TAFSPLMMIIVA+MGS
Sbjct  247   HKPSVWAIGWDMNLLTAVYSGVIASGIAYYVQSLCMELKGPVFATAFSPLMMIIVAVMGS  306

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              ILAE IY+G ++GA+LIV GLYAVLWG
Sbjct  307   IILAETIYLGSVLGAILIVVGLYAVLWG  334



>gb|KGN54680.1| hypothetical protein Csa_4G420210 [Cucumis sativus]
Length=421

 Score =   427 bits (1097),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 233/319 (73%), Positives = 278/319 (87%), Gaps = 5/319 (2%)
 Frame = -2

Query  1405  MISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRPKITFTIF  1226
             MISLQFGYAGMNIITKV+LNRGMSHYVLV YR AFAT  +APFA   ERKVRPKI+F + 
Sbjct  1     MISLQFGYAGMNIITKVALNRGMSHYVLVTYRQAFATIVLAPFAFFFERKVRPKISFAML  60

Query  1225  LQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRC  1046
             +QIF+LGLLGPVIDQNFYYAGLK TS TFSCA SNMLPAMTF++A+LCRMEK+++KKVRC
Sbjct  61    MQIFLLGLLGPVIDQNFYYAGLKLTSTTFSCATSNMLPAMTFILALLCRMEKLEMKKVRC  120

Query  1045  QAKvvgtvvtvgGAMLMTLYKGHAVNFLWS----NFIHPTSKSNVPQTSSADSGKDWVKG  878
             QAKVVGT+VTVGGA+LMTLYKG+ ++F WS    N++H +S S+   +  + + +DW+KG
Sbjct  121   QAKVVGTLVTVGGAILMTLYKGNVISFFWSHHNNNYLHSSSASSNYYSFES-TYQDWLKG  179

Query  877   SILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIG  698
             SILL+ A LAWA FFI+QA+TLR YTA LSL  LVCF GTLQS+AVTF MEH+ASVW IG
Sbjct  180   SILLLFANLAWALFFIVQAMTLRNYTAHLSLTTLVCFFGTLQSMAVTFVMEHKASVWNIG  239

Query  697   WDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYV  518
             WDMNLLA+ YAGIVSSSIAYYVQG++MQKRGPVFVTAF+P++MIIVAIMGSF+LAEKIY+
Sbjct  240   WDMNLLASVYAGIVSSSIAYYVQGMIMQKRGPVFVTAFTPMIMIIVAIMGSFMLAEKIYI  299

Query  517   GGIMGAVLIVFGLYAVLWG  461
             G ++G +++V GLY+VLWG
Sbjct  300   GRVVGGIVMVVGLYSVLWG  318



>emb|CAA75575.1| MtN21 [Medicago truncatula]
 gb|KEH32985.1| nodulin MtN21/EamA-like transporter family protein [Medicago 
truncatula]
Length=394

 Score =   426 bits (1094),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 279/335 (83%), Gaps = 6/335 (2%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             E    C   +F+ +KPY AMI LQFGYAGMNIITK+SLN GMSHYVLVVYRHAFAT AIA
Sbjct  4     EKPRSC-ATYFENSKPYFAMILLQFGYAGMNIITKLSLNGGMSHYVLVVYRHAFATIAIA  62

Query  1282  pfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMT  1103
             PFA+I E K +PKITF++F+QI +L LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAMT
Sbjct  63    PFAIIFEWKDQPKITFSVFMQILLLALLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMT  122

Query  1102  FVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNV  923
             FVMAVLCRME V++KK+RCQAKV+GT++TV GAMLMTLYKG  +  +W+ +I P S +N+
Sbjct  123   FVMAVLCRMEIVNLKKLRCQAKVIGTILTVAGAMLMTLYKGPVLELMWTKYI-PHSNANI  181

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSI  746
               +SS D   +W  GSILLI+ATLAW+S F++QA  +  Y   QL+L +L+CF GT+ + 
Sbjct  182   TSSSSKD---NWFLGSILLIIATLAWSSLFVLQAKAIETYKNHQLTLTSLICFFGTILAF  238

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
             A T  ME++ SVWTIGWDMNLLAAAYAGIV+SSI+YY+QG+V++K+GPVF T+FSPLMMI
Sbjct  239   ATTLIMENKDSVWTIGWDMNLLAAAYAGIVTSSISYYIQGLVIKKKGPVFATSFSPLMMI  298

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IVAIMG FILAE++++G ++G++L+V GLY+VLWG
Sbjct  299   IVAIMGFFILAEQLFLGSVIGSILVVIGLYSVLWG  333



>ref|XP_011091919.1| PREDICTED: WAT1-related protein At5g07050-like [Sesamum indicum]
Length=388

 Score =   425 bits (1092),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 269/319 (84%), Gaps = 4/319 (1%)
 Frame = -2

Query  1411  IAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRPKITFT  1232
             + MISLQFGYAGMNIITK+SLN GMSHYVLVVYRHAFATA IAPFA   ERK +P+ITF 
Sbjct  1     MGMISLQFGYAGMNIITKISLNGGMSHYVLVVYRHAFATAVIAPFAFFFERKAQPRITFR  60

Query  1231  IFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKV  1052
             +F+Q+F+LGLLGPVIDQNFYYAGLK TSPTFSCA+SNMLPA+TFV+A++CRMEKV++KKV
Sbjct  61    VFVQVFILGLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPALTFVLAIICRMEKVEMKKV  120

Query  1051  RCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD-SGKDWVKGS  875
               QAKVVGT++TV GAMLMTLYKG  V   WS   H  S++    +++ + S +DWV G 
Sbjct  121   IYQAKVVGTIITVAGAMLMTLYKGPLVEMAWSK--HRQSQTAATSSAATETSERDWVIGC  178

Query  874   ILLILATLAWASFFIIQAITLRKYTA-QLSLIALVCFMGTLQSIAVTFAMEHRASVWTIG  698
             ILLI+ATLAWA+ FI+Q   L+ Y+  QLSL  LVCF GTLQ+I VTF ME R SVW IG
Sbjct  179   ILLIIATLAWAALFILQKAALKTYSNHQLSLTTLVCFTGTLQAIVVTFVMERRTSVWRIG  238

Query  697   WDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYV  518
             WDMNLLAAAYAGIV+SSI+YYVQG+VM+ +GPVF TAFSPLMMIIVAIMGSFILAE+IY+
Sbjct  239   WDMNLLAAAYAGIVTSSISYYVQGLVMKSKGPVFATAFSPLMMIIVAIMGSFILAERIYL  298

Query  517   GGIMGAVLIVFGLYAVLWG  461
             GG++GAV+I+ GLY+ LWG
Sbjct  299   GGMIGAVIIIVGLYSFLWG  317



>ref|XP_004511088.1| PREDICTED: WAT1-related protein At5g07050-like [Cicer arietinum]
Length=403

 Score =   425 bits (1092),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 233/346 (67%), Positives = 284/346 (82%), Gaps = 2/346 (1%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             NFF+K K +IAMI LQFGYAGMNIITKVSLN+GMSHYVLVVYRHAFATA+I PFA ILER
Sbjct  7     NFFEKTKHHIAMICLQFGYAGMNIITKVSLNQGMSHYVLVVYRHAFATASIVPFAFILER  66

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             K +PKITF IF+ +F+L LLGPV+DQNFYYAGLK TSPTF+CA+SN+LPAMTFVMAVLCR
Sbjct  67    KGQPKITFRIFMILFILALLGPVVDQNFYYAGLKLTSPTFACAMSNVLPAMTFVMAVLCR  126

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEK++IKK+ CQAKV GT++TV GAM MTLYKG  +  LW+   HP +++    T++  S
Sbjct  127   MEKLNIKKLSCQAKVFGTLLTVAGAMSMTLYKGPIMELLWARHRHPQNETQT-TTTTGSS  185

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAMEH  722
              +DW+ G   LI+AT AWA  F++Q   L  Y   Q SL  L+CF+GT+Q+ AVTF  EH
Sbjct  186   ERDWILGCTFLIIATFAWACLFVLQTKALETYKDHQFSLTTLMCFIGTIQAAAVTFVAEH  245

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               SVW IGWDM+LLAAAYAGIV+SS+ YYVQG+V++K+GPVF TAFSPLMMIIVAIMGSF
Sbjct  246   DPSVWRIGWDMSLLAAAYAGIVTSSLTYYVQGLVIRKKGPVFATAFSPLMMIIVAIMGSF  305

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVK  404
             ILAE+IY+GG++GA+LIV GLY+VLWGK+KE  EK++ + I  P+K
Sbjct  306   ILAEQIYLGGVIGAILIVIGLYSVLWGKHKEQNEKKVEDDIPLPIK  351



>gb|ABR18253.1| unknown [Picea sitchensis]
Length=429

 Score =   426 bits (1094),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 230/334 (69%), Positives = 264/334 (79%), Gaps = 5/334 (1%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             E     L   F+++KPYIAMISLQFGYAGMNIITKVSL  GMSHYVLVVYRHA ATA IA
Sbjct  6     ESPKSRLSRAFERSKPYIAMISLQFGYAGMNIITKVSLTNGMSHYVLVVYRHAVATAVIA  65

Query  1282  pfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMT  1103
             PFA  +ERKVRPK+TF++F QIF LGLLGPVIDQNFYYAGLK+TSPTF+CA+SN+LPAMT
Sbjct  66    PFAFFVERKVRPKLTFSVFCQIFALGLLGPVIDQNFYYAGLKYTSPTFACAMSNVLPAMT  125

Query  1102  FVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNV  923
             FVMA L RMEKVDIKKVR Q K+ GTVV V GAMLMTLYKG  V             S+ 
Sbjct  126   FVMAALFRMEKVDIKKVRSQTKIAGTVVCVAGAMLMTLYKGPIVPIFGQ-----AHHSHF  180

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIA  743
                SS  S KDW KGS+LL+ A LAWA+FFI+QA  L++Y+AQLSL  L+CFMGTLQSI 
Sbjct  181   SSPSSVHSDKDWTKGSVLLVAACLAWAAFFILQAAVLKQYSAQLSLTTLICFMGTLQSIT  240

Query  742   VTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMII  563
             +T  +E   S+W +GW+MNLL A Y+GIV+S IAYYVQG+ M+ +GPVF TAFSPLMMII
Sbjct  241   ITLVIERDPSLWALGWNMNLLTAVYSGIVASGIAYYVQGLCMKLKGPVFATAFSPLMMII  300

Query  562   VAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VAIMGS ILAE IY+G ++G VLIV GLYAVLWG
Sbjct  301   VAIMGSIILAESIYLGSVVGGVLIVLGLYAVLWG  334



>ref|XP_008443232.1| PREDICTED: WAT1-related protein At5g07050-like [Cucumis melo]
Length=384

 Score =   424 bits (1089),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 276/332 (83%), Gaps = 5/332 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G  G+FFQ A PYIA+ISLQFGYAG+NI++ ++LN GMSHYVLVVYR  FAT  +APFAL
Sbjct  2     GSFGHFFQNAMPYIAVISLQFGYAGLNILSAIALNGGMSHYVLVVYRQVFATVIMAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERK RPKITF IF+QIFVL LLGP++DQN YY GLK TSPT +CA+ NMLP++TF MA
Sbjct  62    ILERKFRPKITFKIFIQIFVLALLGPLLDQNLYYMGLKMTSPTIACAIVNMLPSVTFAMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+C++EK+D+K+VRC+AK++GT+VT+GGAMLMT YKG+AVNFL +       + N P T+
Sbjct  122   VICKIEKLDLKRVRCRAKLLGTIVTLGGAMLMTFYKGNAVNFLGTKH---GRQPNTPSTA  178

Query  910   --SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVT  737
               +  +  +++KGSILLI++TLAWA+FFI+Q ITLRKYTA LSL  LVCF+GTLQ+   T
Sbjct  179   VLNHHNQGEYIKGSILLIISTLAWAAFFILQTITLRKYTAHLSLTTLVCFLGTLQATVAT  238

Query  736   FAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVA  557
             FA+E R S W IGWD NLLA+AYAGIVSS +AYYVQG+VM+ RGPVFVTAF P++++IVA
Sbjct  239   FAIERRLSAWAIGWDWNLLASAYAGIVSSGVAYYVQGLVMKTRGPVFVTAFGPMVVVIVA  298

Query  556   IMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              MG FILAE+IYVGG++G+V+I+ GLY VLWG
Sbjct  299   FMGHFILAEEIYVGGVIGSVVIIIGLYFVLWG  330



>gb|KGN59420.1| hypothetical protein Csa_3G819280 [Cucumis sativus]
Length=386

 Score =   423 bits (1087),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 219/329 (67%), Positives = 275/329 (84%), Gaps = 5/329 (2%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G+FFQ A PYIA+I LQFGYAG+NI++ ++LN G+SHYVLVVYRH FATA + PFALILE
Sbjct  6     GHFFQNAMPYIAVIFLQFGYAGLNILSAIALNGGISHYVLVVYRHVFATAIMVPFALILE  65

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK RPKIT  IF+Q+FVL LLGP++DQN YY GLK TSPT +CA+ NMLP+MTF MAV+C
Sbjct  66    RKFRPKITVKIFIQMFVLALLGPLLDQNLYYMGLKLTSPTIACAIGNMLPSMTFAMAVIC  125

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS--S  908
             ++EK+D+K+VRC+AK++GT+VT+GGAMLMT YKG  VNFL +       + N+P T+   
Sbjct  126   KIEKLDLKRVRCRAKLLGTIVTLGGAMLMTFYKGSVVNFLGTKH---GPQPNIPSTAVLK  182

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
               +  +++KGSILLI++ LAWA+FF++QAITLRKYTA LSL ALVCF+GTLQ+I  T AM
Sbjct  183   HHNKGEYIKGSILLIISNLAWAAFFVLQAITLRKYTAHLSLTALVCFLGTLQAIVATLAM  242

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E R SVWTIGWD NLLA+AYAGIV++ +AYYVQG+VM++RGPVFVTAF P++++IVA MG
Sbjct  243   ERRLSVWTIGWDWNLLASAYAGIVTTGVAYYVQGLVMKRRGPVFVTAFGPMVVVIVAFMG  302

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              FILAE+IYVGGI+G V+IV GLY VLWG
Sbjct  303   HFILAEEIYVGGIIGTVVIVIGLYFVLWG  331



>gb|ADN33888.1| nodulin-like protein [Cucumis melo subsp. melo]
Length=374

 Score =   422 bits (1086),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 220/332 (66%), Positives = 276/332 (83%), Gaps = 5/332 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G  G+FFQ A PYIA+ISLQFGYAG+NI++ ++LN GMSHYVLVVYR  FAT  +APFAL
Sbjct  2     GSFGHFFQNAMPYIAVISLQFGYAGLNILSAIALNGGMSHYVLVVYRQVFATVIMAPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             ILERK RPKITF IF+QIFVL LLGP++DQN YY GLK TSPT +CA+ NMLP++TF MA
Sbjct  62    ILERKFRPKITFKIFIQIFVLALLGPLLDQNLYYMGLKMTSPTIACAIVNMLPSVTFAMA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+C++EK+D+K+VRC+AK++GT+VT+GGAMLMT YKG+AVNFL +       + N P T+
Sbjct  122   VICKIEKLDLKRVRCRAKLLGTIVTLGGAMLMTFYKGNAVNFLGTKH---GRQPNTPSTA  178

Query  910   --SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVT  737
               +  +  +++KGSILLI++TLAWA+FFI+Q ITLRKYTA LSL  LVCF+GTLQ+   T
Sbjct  179   VLNHHNQGEYIKGSILLIISTLAWAAFFILQTITLRKYTAHLSLTTLVCFLGTLQATVAT  238

Query  736   FAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVA  557
             FA+E R S W IGWD NLLA+AYAGIVSS +AYYVQG+VM+ RGPVFVTAF P++++IVA
Sbjct  239   FAIERRLSAWAIGWDWNLLASAYAGIVSSGVAYYVQGLVMKTRGPVFVTAFGPMVVVIVA  298

Query  556   IMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              MG FILAE+IYVGG++G+V+I+ GLY VLWG
Sbjct  299   FMGHFILAEEIYVGGVIGSVVIIIGLYFVLWG  330



>ref|XP_004136770.1| PREDICTED: auxin-induced protein 5NG4-like [Cucumis sativus]
Length=346

 Score =   418 bits (1074),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 218/329 (66%), Positives = 274/329 (83%), Gaps = 5/329 (2%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G+FFQ A PYIA+I LQFGYAG+NI++ ++LN G+SHYVLVVYRH FATA + PFALILE
Sbjct  6     GHFFQNAMPYIAVIFLQFGYAGLNILSAIALNGGISHYVLVVYRHVFATAIMVPFALILE  65

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK RPKIT  IF+Q+FVL LLGP++DQN YY GLK TSPT +CA+ NMLP+MTF MAV+C
Sbjct  66    RKFRPKITVKIFIQMFVLALLGPLLDQNLYYMGLKLTSPTIACAIGNMLPSMTFAMAVIC  125

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS--S  908
             ++EK+D+K+V C+AK++GT+VT+GGAMLMT YKG  VNFL +       + N+P T+   
Sbjct  126   KIEKLDMKRVGCRAKLLGTIVTLGGAMLMTFYKGSVVNFLGTKH---GPQPNIPSTAVLK  182

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
               +  +++KGSILLI++ LAWA+FF++QAITLRKYTA LSL ALVCF+GTLQ+I  T AM
Sbjct  183   HHNKGEYIKGSILLIISNLAWAAFFVLQAITLRKYTAHLSLTALVCFLGTLQAIVATLAM  242

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E R SVWTIGWD NLLA+AYAGIV++ +AYYVQG+VM++RGPVFVTAF P++++IVA MG
Sbjct  243   ERRLSVWTIGWDWNLLASAYAGIVTTGVAYYVQGLVMKRRGPVFVTAFGPMVVVIVAFMG  302

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              FILAE+IYVGGI+G V+IV GLY VLWG
Sbjct  303   HFILAEEIYVGGIIGTVVIVIGLYFVLWG  331



>gb|ABK25095.1| unknown [Picea sitchensis]
Length=392

 Score =   416 bits (1068),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 217/327 (66%), Positives = 267/327 (82%), Gaps = 8/327 (2%)
 Frame = -2

Query  1435  FFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERK  1256
               +++KPY+AMISLQFGYAGMNIITKVSLNRGM+H+VLVVYRHA AT  +APFA  +ERK
Sbjct  4     LIERSKPYVAMISLQFGYAGMNIITKVSLNRGMNHFVLVVYRHAAATVVLAPFAFFIERK  63

Query  1255  VRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRM  1076
             VRPK+TF+IF QIFVLGLLGPVIDQNFYY GLK TSPT++CALSN+LPAMTFV+A+L RM
Sbjct  64    VRPKLTFSIFCQIFVLGLLGPVIDQNFYYLGLKLTSPTYACALSNVLPAMTFVIALLFRM  123

Query  1075  EKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS-  899
             E V+IKK+R QAK+VGT+V VGGAMLMTLYKG  V  +WS      +    PQTS+A + 
Sbjct  124   ENVNIKKLRSQAKIVGTIVCVGGAMLMTLYKGPIVKMVWS------AHHQSPQTSAAAAI  177

Query  898   -GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH  722
               K+W+ GS+L+I ATLAW+  FI+QA  L+KY+AQLSL  L+CF+GTLQ+  ++ A+  
Sbjct  178   DNKNWIIGSVLIIAATLAWSGLFILQAAVLKKYSAQLSLATLICFLGTLQATVLSLAVVR  237

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               S W +GWD+NLL A Y+G+V+S+IAYYVQG+ M+ +GPVF TAFSPLMMIIVAIM S 
Sbjct  238   DPSQWALGWDLNLLTAVYSGVVASAIAYYVQGLCMRVKGPVFATAFSPLMMIIVAIMASI  297

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAE I++G ++G VLIV GLYAVLWG
Sbjct  298   ILAENIFLGSVLGGVLIVIGLYAVLWG  324



>gb|AFW81938.1| hypothetical protein ZEAMMB73_476289 [Zea mays]
Length=476

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 242/393 (62%), Positives = 276/393 (70%), Gaps = 67/393 (17%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +  Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFAL+LER
Sbjct  10    SLMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIAPFALVLER  69

Query  1258  KVRPKITFTIFLQIFVLGLLG---------------------------------------  1196
             KVRP++T   FLQIFVL LLG                                       
Sbjct  70    KVRPRMTLWAFLQIFVLALLGCVHRGGLVLFRVIALLVSCLAKLCSDSDCMRLCESFRAH  129

Query  1195  -PVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvv  1019
              PVIDQNFYYAGLKFTSPTFSCA+SNMLPAMTFV+AVL RMEKV++KK RC AKVVGT+V
Sbjct  130   RPVIDQNFYYAGLKFTSPTFSCAMSNMLPAMTFVLAVLFRMEKVNLKKARCVAKVVGTLV  189

Query  1018  tvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWAS  839
             TV GAMLMTLYKG  V  +W+  IH          ++A + KDW  GSI LI+ATLAWAS
Sbjct  190   TVAGAMLMTLYKGRVVELVWTKHIHLHGPHPDAAAAAAAADKDWFTGSIFLIIATLAWAS  249

Query  838   FFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYA--  665
              FI+QA TL++Y A LSL  L+CF+GTLQ+I VTF ME   SVW IG+DMNLLAAAYA  
Sbjct  250   LFILQAATLKRYDAPLSLTTLICFVGTLQAIVVTFVMEREPSVWRIGFDMNLLAAAYAVS  309

Query  664   -------------------------GIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
                                      GIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMIIV
Sbjct  310   ITNQTVSAALRPAKKHIMRVLSHDDGIVTSSIAYYVQGLVIQSRGPVFASAFSPLMMIIV  369

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFILAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  370   AIMGSFILAENIYLGGIIGSVLIVAGLYSVLWG  402



>ref|XP_007133643.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
 gb|ESW05637.1| hypothetical protein PHAVU_011G196800g [Phaseolus vulgaris]
Length=391

 Score =   411 bits (1056),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 224/331 (68%), Positives = 269/331 (81%), Gaps = 10/331 (3%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC   FF+ +KPY+AMISLQFGYAGM IITK+SLN+GMSHYVLVVYRHAFAT AIAPFA 
Sbjct  5     GC-SKFFRSSKPYLAMISLQFGYAGMTIITKISLNQGMSHYVLVVYRHAFATIAIAPFAF  63

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             I ERK +PKITF IF+QIF+L LLGPVIDQN +YAGLK TSPTFSCA+SNMLPAMTFV+A
Sbjct  64    IFERKHQPKITFPIFMQIFILALLGPVIDQNLFYAGLKLTSPTFSCAMSNMLPAMTFVIA  123

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             + CRMEK++IK+V   AK+VGT+VTV GAMLMTLY+G  V  +W  F H   K+N     
Sbjct  124   LFCRMEKINIKEVSSIAKIVGTLVTVAGAMLMTLYRGPTVETVW--FKHAHYKAN----E  177

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTF  734
             S D  KDW+ G   LI++T AWAS FI+QA  ++ Y   QL+L +LVC +GT+Q+  VT 
Sbjct  178   SLD--KDWLLGCFFLIISTFAWASLFILQAKAIQTYKNHQLTLTSLVCLIGTVQATVVTC  235

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
              +EH  SVW IGWD+NLL AAY+GIVSSSI+YYVQG+V++K+GPVF T+FSPLMMII AI
Sbjct  236   VLEHNPSVWKIGWDINLLTAAYSGIVSSSISYYVQGLVIKKKGPVFATSFSPLMMIISAI  295

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MG FILAEKIY+GG++GA+LIV GLY+VLWG
Sbjct  296   MGYFILAEKIYLGGVIGAILIVIGLYSVLWG  326



>ref|XP_003566095.1| PREDICTED: WAT1-related protein At5g07050-like [Brachypodium 
distachyon]
Length=388

 Score =   410 bits (1055),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 228/327 (70%), Positives = 275/327 (84%), Gaps = 0/327 (0%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G F +KAKPYIAMISLQFGYAGMN++TKVSLN GMSHYVLVVYRHAFAT AIAP ALILE
Sbjct  5     GGFLEKAKPYIAMISLQFGYAGMNVLTKVSLNGGMSHYVLVVYRHAFATVAIAPLALILE  64

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RKVRPK+T +IF QIFVL LLGPVIDQNFYY GLK+T PTF+CA+SN+LPAMTFVMAV+ 
Sbjct  65    RKVRPKMTRSIFFQIFVLALLGPVIDQNFYYLGLKYTGPTFACAMSNILPAMTFVMAVIF  124

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+++KKVRCQAK++GTVVTV GAMLMTLYKG  +   W+N       +     ++A 
Sbjct  125   RMEKIELKKVRCQAKILGTVVTVAGAMLMTLYKGPLMELAWTNRHGSGGAAAADAPAAAV  184

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH  722
               K+W  GS+ +I+ATLAWA  FI+Q  T+++Y+AQLSL  L+CF+G LQ++ VT  M+ 
Sbjct  185   DAKEWFLGSVFVIIATLAWAGLFILQTHTIKQYSAQLSLTTLICFVGALQAVVVTLVMDR  244

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
             R S+W IG+DMNLLAAAYAGIV+SS+AYYVQG+V+QK GPVF +AFSPLMMIIVA+MGSF
Sbjct  245   RPSIWAIGFDMNLLAAAYAGIVTSSLAYYVQGLVIQKTGPVFASAFSPLMMIIVAVMGSF  304

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IL+EKIY+GG++G V+IV GLYAVLWG
Sbjct  305   ILSEKIYLGGVLGGVVIVVGLYAVLWG  331



>ref|XP_004170561.1| PREDICTED: LOW QUALITY PROTEIN: auxin-induced protein 5NG4-like 
[Cucumis sativus]
Length=394

 Score =   410 bits (1054),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 215/329 (65%), Positives = 272/329 (83%), Gaps = 5/329 (2%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G+FFQ A PYIA+I LQFGYAG+NI++ ++L+ G+SHYVLVVYR  FATA +APFALILE
Sbjct  6     GHFFQNAMPYIAVIFLQFGYAGLNILSAIALSGGISHYVLVVYRQVFATAIMAPFALILE  65

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK RPKIT  IF+Q+FVL LLGP++DQN YY GLK TSPT +CA+ NMLP+MTF MAV+C
Sbjct  66    RKFRPKITVKIFIQMFVLALLGPLLDQNLYYMGLKLTSPTIACAIGNMLPSMTFAMAVIC  125

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS--S  908
             ++EK+D+K+V C+AK++GT+VT+ GAMLMT YKG  VNFL +       + N+P T+  +
Sbjct  126   KIEKLDMKRVGCRAKLLGTIVTLCGAMLMTFYKGSIVNFLGTKH---GRQPNIPSTAVHN  182

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
               +  +++KGSILLI++  AWA+FF++QAITLRKYTA LSL ALVCF+GTLQ+I  T AM
Sbjct  183   HHNKGEYIKGSILLIISVFAWAAFFVLQAITLRKYTAHLSLTALVCFLGTLQAIVATLAM  242

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E R SVWTIGWD NLLA+AYAGIV++ +AYYVQG+VM+ RGPVFVTAF P++++IVA MG
Sbjct  243   ERRLSVWTIGWDWNLLASAYAGIVTTGVAYYVQGLVMKXRGPVFVTAFGPMVVVIVAFMG  302

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              FILAE+IYVGGI+G V+IV GLY VLWG
Sbjct  303   HFILAEEIYVGGIIGTVVIVIGLYFVLWG  331



>gb|KHN12183.1| Auxin-induced protein 5NG4 [Glycine soja]
Length=360

 Score =   408 bits (1049),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 232/336 (69%), Positives = 268/336 (80%), Gaps = 37/336 (11%)
 Frame = -2

Query  1465  MEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataai  1286
             MEG   C G+FFQ+ KPYIAM+SLQFG+AGMNIITKVSLNRGMSHYVLVVYRHAFATAAI
Sbjct  1     MEGDGYC-GSFFQRCKPYIAMVSLQFGFAGMNIITKVSLNRGMSHYVLVVYRHAFATAAI  59

Query  1285  apfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             APFA++LERKVRPKITF +F+QIFVLGLLGPVIDQN YYAGLKFTSPT+SCA+SNMLPAM
Sbjct  60    APFAIVLERKVRPKITFLMFMQIFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNMLPAM  119

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI-HPTSKS  929
             TFVMA + RMEK++++KVRCQAKV+GTVVTV GAMLMTLYKG  ++FL S ++ HPT  +
Sbjct  120   TFVMAAIFRMEKLNVRKVRCQAKVIGTVVTVAGAMLMTLYKGQVISFLGSKYMHHPT--N  177

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
              VP+ ++    KDW KGS+LL+LATL+WASFFI+QA+TLRKY AQLSL ALVC +GTL  
Sbjct  178   YVPENNTDSGEKDWFKGSVLLVLATLSWASFFILQAMTLRKYPAQLSLTALVCALGTLCC  237

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
                                               I YYVQGIVMQK+GPVFVTAFSPLMM
Sbjct  238   SL------------------------------CCITYYVQGIVMQKKGPVFVTAFSPLMM  267

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIVAIMG+FILAEKIY+G   GA+LIV GL++VLWG
Sbjct  268   IIVAIMGAFILAEKIYLG---GAILIVMGLHSVLWG  300



>ref|XP_002440000.1| hypothetical protein SORBIDRAFT_09g024200 [Sorghum bicolor]
 gb|EES18430.1| hypothetical protein SORBIDRAFT_09g024200 [Sorghum bicolor]
Length=379

 Score =   406 bits (1044),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 227/333 (68%), Positives = 272/333 (82%), Gaps = 20/333 (6%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             GC G F +KAKPYIAMISLQFGYAGMN++TKVSLN GMSHYVLVVYRHAFAT +IAPFAL
Sbjct  4     GC-GGFVEKAKPYIAMISLQFGYAGMNVLTKVSLNNGMSHYVLVVYRHAFATLSIAPFAL  62

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERKVRPK+T+ IF QIFVL +LGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFV+A
Sbjct  63    VLERKVRPKMTWPIFWQIFVLAMLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVLA  122

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSN--FIHPTSKSNVPQ  917
             V+ RMEK+ +KKVRCQAKV+GTVVTV GAMLMTLYKG  +   W+    +H +S +    
Sbjct  123   VIFRMEKLQMKKVRCQAKVLGTVVTVAGAMLMTLYKGPLMQLPWTTTRHVHASSSAAEAP  182

Query  916   TSSAD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAV  740
              + A+ SG+DW  GS+ +I+ATLAWAS F++Q  T+++Y+AQLSL  LVCF+GTLQ+I V
Sbjct  183   AAGAEISGRDWFLGSVFVIVATLAWASLFVLQTHTIKQYSAQLSLTTLVCFIGTLQAIVV  242

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
             TF ME R S                GIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIV
Sbjct  243   TFVMERRTS----------------GIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIV  286

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             A+MGSFIL+EKIY+GG++GAVLIV GLY+VLWG
Sbjct  287   AVMGSFILSEKIYLGGVLGAVLIVAGLYSVLWG  319



>emb|CBI35062.3| unnamed protein product [Vitis vinifera]
Length=362

 Score =   405 bits (1042),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 219/294 (74%), Positives = 255/294 (87%), Gaps = 4/294 (1%)
 Frame = -2

Query  1339  MSHYVLVVYRHafataaiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGL  1160
             MSHYVLVVYRHAFATA IAPFA+ LERK +PKITF +F+QIFVL LLGPVIDQNFYYAGL
Sbjct  1     MSHYVLVVYRHAFATAVIAPFAIFLERKAQPKITFRVFMQIFVLALLGPVIDQNFYYAGL  60

Query  1159  KFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKG  980
             K TSPTFSCA+SNMLPAMTFVMAV+ RMEK+D+K+VRCQAKVVGT+VTV GAM+MTLYKG
Sbjct  61    KLTSPTFSCAMSNMLPAMTFVMAVIFRMEKIDMKRVRCQAKVVGTIVTVAGAMVMTLYKG  120

Query  979   HAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYT  800
               +  +W+  +H TSKS    T+S D  KDW  GSI +I+ATLAWAS F++QA  L+ Y 
Sbjct  121   PIMEMVWTKHMH-TSKSVGSGTTSTD--KDWFMGSIFVIIATLAWASLFVLQAHALKTYK  177

Query  799   A-QLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGI  623
               QLSL  L+CF+GTLQ+IAVTF MEH+ SVWTIGWDMNLLAAAYAGIV+SSI+YYVQG+
Sbjct  178   HHQLSLTTLICFIGTLQAIAVTFVMEHKTSVWTIGWDMNLLAAAYAGIVTSSISYYVQGL  237

Query  622   VMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             V++ RGPVF TAFSPLMMIIVAIMGSFILAEKI++GG++GA+LIV GLY+VLWG
Sbjct  238   VIKSRGPVFATAFSPLMMIIVAIMGSFILAEKIFLGGVLGAILIVAGLYSVLWG  291



>ref|XP_004493328.1| PREDICTED: WAT1-related protein At5g07050-like isoform X2 [Cicer 
arietinum]
Length=317

 Score =   392 bits (1007),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/257 (75%), Positives = 228/257 (89%), Gaps = 1/257 (0%)
 Frame = -2

Query  1231  IFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKV  1052
             +F+Q+FVLGLLGPVIDQN YYAGLKFTSPT+SCA+SN+LPAMTFVMAVL RMEK+DI+K+
Sbjct  1     MFMQMFVLGLLGPVIDQNLYYAGLKFTSPTYSCAISNILPAMTFVMAVLFRMEKLDIRKL  60

Query  1051  RCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSI  872
             RCQ KV+GTV+TV GAMLMTLYKG  +N L S ++H   K+  P+ ++    KDW KGSI
Sbjct  61    RCQVKVIGTVITVAGAMLMTLYKGEVINILGSQYMH-HPKNYSPENNTDSGEKDWFKGSI  119

Query  871   LLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWD  692
             LL++AT AWASFFI+QA+TLRKY+AQLSL A+VCF+GTLQSIAVT+ MEHR SVW IGWD
Sbjct  120   LLLIATFAWASFFILQAVTLRKYSAQLSLTAIVCFLGTLQSIAVTYVMEHRPSVWNIGWD  179

Query  691   MNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGG  512
             MNLLAAAYAGI+SS + YYVQGIVMQK+GPVFVTAFSPLMMIIVAIMG+FILAEK+Y+GG
Sbjct  180   MNLLAAAYAGIISSGLTYYVQGIVMQKKGPVFVTAFSPLMMIIVAIMGTFILAEKLYLGG  239

Query  511   IMGAVLIVFGLYAVLWG  461
             I+GA LIV GLY+VLWG
Sbjct  240   IIGATLIVIGLYSVLWG  256



>ref|XP_008231618.1| PREDICTED: WAT1-related protein At5g07050, partial [Prunus mume]
Length=327

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 195/268 (73%), Positives = 227/268 (85%), Gaps = 3/268 (1%)
 Frame = -2

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK +PKIT  IF+QIFVL LLGPVIDQNFYYAGLK+TSPTFSCA+SNMLPAMTFVMAV+C
Sbjct  2     RKAQPKITLPIFMQIFVLALLGPVIDQNFYYAGLKYTSPTFSCAMSNMLPAMTFVMAVIC  61

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+D+KK+RCQAK+VGTV+TV GAMLMTLYKG  V  LWS +IHP        T + D
Sbjct  62    RMEKLDMKKLRCQAKIVGTVLTVAGAMLMTLYKGPIVEMLWSKYIHPRKSYVTDTTGTGD  121

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAME  725
               K W  GSILL +ATLAWAS F++Q   L+ Y   QLSL ++VCF+GTLQ+IAVTF ME
Sbjct  122   --KHWFLGSILLTIATLAWASLFVLQNKALQTYRNHQLSLTSMVCFIGTLQAIAVTFVME  179

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             H+ SVW IG+DMNLLAAAYAGIV+SSI+YYVQG+VM+ RGPVF TAFSPLMMIIVAIMGS
Sbjct  180   HKPSVWKIGFDMNLLAAAYAGIVTSSISYYVQGLVMKTRGPVFATAFSPLMMIIVAIMGS  239

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FILAE+I++G ++GAVLIVFGLY+VLWG
Sbjct  240   FILAEQIFLGSVLGAVLIVFGLYSVLWG  267



>emb|CDX79964.1| BnaA05g01920D [Brassica napus]
Length=394

 Score =   383 bits (984),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 205/323 (63%), Positives = 264/323 (82%), Gaps = 7/323 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLLTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GL+ TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLRLTSPTFSSAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V++KKVRCQ KVVGT+VTV G++LM LYKG  +NF  S   H T+ +    T+S+    D
Sbjct  127   VEMKKVRCQVKVVGTLVTVAGSILMILYKGPFINFFRS---HLTTTA----TASSPLAGD  179

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             + K ++ L+LA+L+WASFFI+QA TL+KY A LSL  +VCFMGTLQS+A+ F MEH  S 
Sbjct  180   YFKAAVFLLLASLSWASFFILQAWTLKKYAAHLSLSTMVCFMGTLQSLALAFVMEHNPSA  239

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               I +DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  240   LNISFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  299

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V+++ G+YAVLWG
Sbjct  300   GIYLGGVIGLVVLMVGVYAVLWG  322



>ref|XP_009142715.1| PREDICTED: WAT1-related protein At2g40900-like [Brassica rapa]
Length=394

 Score =   381 bits (978),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 264/323 (82%), Gaps = 7/323 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLLTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V++KKVRCQ KVVGT+VTV G++LM LYKG  +NF  S   H T+ +    T+S+    D
Sbjct  127   VEMKKVRCQVKVVGTLVTVVGSILMILYKGPFINFFRS---HLTTTA----TASSPLAGD  179

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             + K ++ L+LA+L+WASFFI+QA TL+KY A LSL  +VCFMGTLQS+A+ F MEH  S 
Sbjct  180   YFKAAVFLLLASLSWASFFILQAWTLKKYAAHLSLSTMVCFMGTLQSLALAFVMEHNPSA  239

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               I +DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  240   LNISFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  299

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V+++ G+YAVLWG
Sbjct  300   GIYLGGVIGLVVLMVGVYAVLWG  322



>ref|XP_006411357.1| hypothetical protein EUTSA_v10016763mg [Eutrema salsugineum]
 gb|ESQ52810.1| hypothetical protein EUTSA_v10016763mg [Eutrema salsugineum]
Length=393

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 202/325 (62%), Positives = 264/325 (81%), Gaps = 12/325 (4%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFPIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS--G  896
             V+++KVRCQ KVVGT+VTV G++LM  +KG  +NF  S+            T++A S   
Sbjct  127   VEMRKVRCQVKVVGTIVTVVGSILMIFFKGPFINFFQSHL----------ATTAASSPLA  176

Query  895   KDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRA  716
              D++K ++ L+LA+L+WASFF++QA TL+KY+A LSL ++VCFMGTLQS+A+TF MEH  
Sbjct  177   GDYLKATVFLLLASLSWASFFVLQASTLKKYSAHLSLSSMVCFMGTLQSLALTFVMEHNP  236

Query  715   SVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFIL  536
             S   IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GP+FVTAF+PL+++IV+IM  F+L
Sbjct  237   SALNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPLFVTAFNPLVVVIVSIMSFFVL  296

Query  535   AEKIYVGGIMGAVLIVFGLYAVLWG  461
              + IY+GG++G V++  G+YAVLWG
Sbjct  297   GQGIYLGGVIGVVVLTVGVYAVLWG  321



>emb|CDY53669.1| BnaC04g52190D [Brassica napus]
Length=394

 Score =   380 bits (975),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 204/323 (63%), Positives = 264/323 (82%), Gaps = 7/323 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLLTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V++KKVRCQ KVVGT+VTV G++LM LYKG  +NF  S   H T+ +    T+S+    D
Sbjct  127   VEMKKVRCQVKVVGTLVTVVGSILMILYKGPFINFFRS---HLTTTA----TASSPLAGD  179

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             + K ++ L+LA+L+WA+FFI+QA TL+KY A LSL  +VCFMGTLQS+A+ F MEH  S 
Sbjct  180   YFKAAVFLLLASLSWATFFILQAWTLKKYAAHLSLSTMVCFMGTLQSLALAFVMEHNPSA  239

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               I +DMNLLA+AYAGI+SSS+AYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  240   LNISFDMNLLASAYAGIMSSSVAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  299

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V+++ G+YAVLWG
Sbjct  300   GIYLGGVIGVVVLMVGVYAVLWG  322



>ref|XP_006402969.1| hypothetical protein EUTSA_v10006038mg [Eutrema salsugineum]
 gb|ESQ44422.1| hypothetical protein EUTSA_v10006038mg [Eutrema salsugineum]
Length=377

 Score =   379 bits (973),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 194/323 (60%), Positives = 265/323 (82%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+ FA AAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNGFAMAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGP IDQN YYAGLK TSPTF+ A++N++PA+TF+++++CRMEK
Sbjct  67    PKMTFPIFMQIFVLALLGPTIDQNLYYAGLKLTSPTFAGAVTNIVPALTFIISIICRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K H + FL         +S++   +S+ +G D
Sbjct  127   VELRKVRFQAKVVGTLVIVVGAMLMILFKSHLIMFL---------RSHLNGDASSPAGDD  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +I L++A+ +WASFF++QA TL++Y++QLSL  +VCFMGTLQS A+TF ME   S 
Sbjct  178   YLKATIFLLIASFSWASFFVLQAATLKRYSSQLSLSTMVCFMGTLQSTALTFVMEPNLSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+AYAG++SSSIAYYVQG + +++G VFVT+F+PL++II +I+G  IL +
Sbjct  238   WNIGFDMNLLASAYAGVMSSSIAYYVQGSMTKQKGVVFVTSFNPLIVIIGSIIGFLILGQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             ++Y+GG++G  +++ G+YAVLWG
Sbjct  298   RLYLGGVLGMAILMVGVYAVLWG  320



>ref|NP_181622.2| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|F4IJ08.1|WTR15_ARATH RecName: Full=WAT1-related protein At2g40900 [Arabidopsis thaliana]
 gb|AEC09894.1| nodulin MtN21 /EamA-like transporter family protein [Arabidopsis 
thaliana]
Length=394

 Score =   379 bits (972),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 263/323 (81%), Gaps = 10/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++PA+T ++A L RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITIILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRC  KV+GT+VTV G++LM  YKG  +NF  S   H T+ S+ P         D
Sbjct  127   VEMRKVRCLVKVMGTLVTVVGSILMIFYKGPFINFFRS---HLTAASSPPTA-------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L+LA+L+WASFF++QA TL+KY+A LS+  +VCFMGTLQS+A+ F MEH  S 
Sbjct  177   YLKAAVFLLLASLSWASFFVLQAATLKKYSAHLSMSTMVCFMGTLQSLALAFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLIVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V+++ G+YAVLWG
Sbjct  297   GIYLGGVIGVVVLMVGVYAVLWG  319



>ref|XP_010525433.1| PREDICTED: WAT1-related protein At2g40900 [Tarenaya hassleriana]
Length=399

 Score =   377 bits (968),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 206/323 (64%), Positives = 262/323 (81%), Gaps = 7/323 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             +  KPY AM+ LQFGYAGMN+ITKV L+RGMSHYVLVVYR+AFATAA+APFA++ ERKVR
Sbjct  8     ESVKPYFAMVCLQFGYAGMNLITKVVLDRGMSHYVLVVYRNAFATAALAPFAILSERKVR  67

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIF L LLGPVIDQN YYAGLK TSPTFS A++N+LPA+TF++A+L RMEK
Sbjct  68    PKLTFPIFMQIFALSLLGPVIDQNLYYAGLKLTSPTFSSAVNNILPAVTFILAILFRMEK  127

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V++KKVRC+AKVVGTVVTV G ++M LYKG  + F  S   HP        T +A +G D
Sbjct  128   VEMKKVRCKAKVVGTVVTVVGGVVMVLYKGPLIIFFTS---HPPPAL---ATVTASAG-D  180

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             W++ S+ L+LA+L+WA FFI+Q  TL++Y+A +SL A+VCF+GTL S AVTF ME   S 
Sbjct  181   WLRASVFLVLASLSWACFFILQTATLKRYSAHMSLSAMVCFLGTLNSAAVTFLMERNQSA  240

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DM+ LA+AYAGIVSS IAYYVQG++ Q++GPVFVTAF+PL++IIV+++GSFIL  
Sbjct  241   WNIGFDMSFLASAYAGIVSSGIAYYVQGMMTQRKGPVFVTAFNPLVVIIVSVLGSFILGY  300

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             + Y+GG +G VL++ GL  VLWG
Sbjct  301   RTYLGGALGMVLLMAGLSTVLWG  323



>ref|XP_006294359.1| hypothetical protein CARUB_v10023376mg [Capsella rubella]
 gb|EOA27257.1| hypothetical protein CARUB_v10023376mg [Capsella rubella]
Length=393

 Score =   377 bits (967),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 263/323 (81%), Gaps = 10/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKAVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++PA+T ++A + RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPALTIILATIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRC  KV+GT+VTV G++LM  YKG  +N   S   H T+ S+ P T       D
Sbjct  127   VEMRKVRCLVKVMGTLVTVVGSILMIFYKGPFINIFRS---HLTTVSSPPTT-------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+L+WASFF++QA TL++Y+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  177   YLKAAVFLLIASLSWASFFVLQAATLKQYSAHLSLSTMVCFMGTLQSLALTFIMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GGI+G V++  G+YAVLWG
Sbjct  297   GIYLGGIIGVVVLTVGVYAVLWG  319



>ref|NP_001044551.1| Os01g0803300 [Oryza sativa Japonica Group]
 dbj|BAF06465.1| Os01g0803300, partial [Oryza sativa Japonica Group]
Length=331

 Score =   374 bits (960),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 192/270 (71%), Positives = 229/270 (85%), Gaps = 4/270 (1%)
 Frame = -2

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRPK+T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV+ R
Sbjct  1     KVRPKMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAVIFR  60

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI---HPTSKSNVPQTSS  908
             MEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W++ +   H          ++
Sbjct  61    MEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMQMAWTSHVQAPHGHGAEAPAAAAA  120

Query  907   AD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              D SG++W  GS+ +I+ATLAWAS FI+QA TL+KY+A LSL  L+CF+GTLQ+I VTFA
Sbjct  121   VDPSGREWFLGSLFVIIATLAWASLFILQAHTLKKYSAPLSLTTLICFVGTLQAIVVTFA  180

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             MEHR SVW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+QK GPVF +AFSPLMMIIVA M
Sbjct  181   MEHRPSVWAIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQKTGPVFASAFSPLMMIIVAGM  240

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GSFILAEKIY+GG++GAVLIV GLY+VLWG
Sbjct  241   GSFILAEKIYLGGVLGAVLIVVGLYSVLWG  270



>ref|XP_010508790.1| PREDICTED: WAT1-related protein At2g40900-like [Camelina sativa]
Length=394

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 202/323 (63%), Positives = 265/323 (82%), Gaps = 10/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKAVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++PA+T ++A + RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPALTIILATIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             VD++KVRC  KV+GT+VTVGG++LM  YKG  +N   S   H T+ S+ P T+      D
Sbjct  127   VDMRKVRCLVKVMGTLVTVGGSILMIFYKGPFINIFRS---HLTTVSS-PLTT------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L+LA+++WASFF++QA TL+KY+A LSL  +VCF+GTLQS+A+TF MEH  S 
Sbjct  177   YLKAAVFLLLASISWASFFVLQAATLKKYSAHLSLSTMVCFVGTLQSLALTFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GGI+G V++  G+YAVLWG
Sbjct  297   GIYLGGIIGVVVLTVGVYAVLWG  319



>emb|CDY06954.1| BnaA04g23610D [Brassica napus]
Length=387

 Score =   373 bits (957),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 258/322 (80%), Gaps = 10/322 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             VD++KVRCQ KVVGT+VTV G+MLM LYKG  ++   S             T+S+    D
Sbjct  127   VDMRKVRCQVKVVGTLVTVVGSMLMILYKGPFISSFRSQL----------TTASSPLAGD  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +I L++A+L+WASFFI+QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  177   YLKATIFLLIASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSP  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYY+QG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYIQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLW  464
               Y+GG +G V++  G+Y VLW
Sbjct  297   GTYLGGGIGVVVLTVGVYTVLW  318



>ref|XP_009141949.1| PREDICTED: WAT1-related protein At2g40900-like [Brassica rapa]
Length=387

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 203/322 (63%), Positives = 263/322 (82%), Gaps = 10/322 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             VD++KVRCQ KVVGT+VTV G++LM L+KG  +    S+F     +S +   SS  +G D
Sbjct  127   VDMRKVRCQVKVVGTLVTVVGSILMILHKGPFI----SSF-----RSQLTTASSPLAG-D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +I L++A+L+WASFFI+QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH +S 
Sbjct  177   YLKATIFLLIASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNSSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYY+QG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYIQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLW  464
               Y+GG +G V++  G+Y VLW
Sbjct  297   GTYLGGGIGVVVLTVGVYTVLW  318



>gb|AAB86450.1| putative integral membrane protein nodulin [Arabidopsis thaliana]
Length=400

 Score =   372 bits (955),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 263/329 (80%), Gaps = 16/329 (5%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++PA+T ++A L RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITIILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRC  KV+GT+VTV G++LM  YKG  +NF  S   H T+ S+ P         D
Sbjct  127   VEMRKVRCLVKVMGTLVTVVGSILMIFYKGPFINFFRS---HLTAASSPPTA-------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L+LA+L+WASFF++QA TL+KY+A LS+  +VCFMGTLQS+A+ F MEH  S 
Sbjct  177   YLKAAVFLLLASLSWASFFVLQAATLKKYSAHLSMSTMVCFMGTLQSLALAFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLIVVIVSIMSFFVLGQ  296

Query  529   KIYVGG------IMGAVLIVFGLYAVLWG  461
              IY+GG      ++G V+++ G+YAVLWG
Sbjct  297   GIYLGGYVNNNRVIGVVVLMVGVYAVLWG  325



>ref|XP_002881745.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58004.1| nodulin MtN21 family protein [Arabidopsis lyrata subsp. lyrata]
Length=401

 Score =   372 bits (954),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 201/329 (61%), Positives = 261/329 (79%), Gaps = 16/329 (5%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKAVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++PA+T ++A L RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPALTIILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRC  KV+GT+VTV G++LM  YKG  +NF  S   H T  S+ P         D
Sbjct  127   VEMRKVRCLVKVMGTLVTVVGSILMIFYKGPFINFFRS---HLTPASSPPTA-------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+L+WASFF++QA TL+KY+A LSL  +VCFMGTLQS+A+ F MEH  S 
Sbjct  177   YLKAAVFLLIASLSWASFFVLQAATLKKYSAHLSLSTMVCFMGTLQSLALAFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGK  296

Query  529   KIYVGG------IMGAVLIVFGLYAVLWG  461
              IY+GG      ++G V++  G+YAVLWG
Sbjct  297   GIYLGGYVNNNRVIGVVVLTVGVYAVLWG  325



>ref|XP_010517531.1| PREDICTED: WAT1-related protein At2g40900 [Camelina sativa]
Length=395

 Score =   371 bits (952),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 263/323 (81%), Gaps = 10/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKAVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++P +T + A + RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPTLTIIFATIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             ++++KVRC  KV+GT+VTVGG++LM  YKG  +N   S   H T+ S+ P T+      D
Sbjct  127   IEMRKVRCLVKVMGTLVTVGGSILMIFYKGPFINIFRS---HLTTVSS-PLTT------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L+LA+++WASFF++QA TL+KY+A LSL  +VCF+GTLQS+A+TF MEH  S 
Sbjct  177   YLKAAVFLLLASISWASFFVLQAATLKKYSAHLSLSTMVCFVGTLQSLALTFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GGI+G V++  G+YAVLWG
Sbjct  297   GIYLGGIIGVVVLTVGVYAVLWG  319



>ref|XP_003566093.1| PREDICTED: uncharacterized protein LOC100824174 [Brachypodium 
distachyon]
Length=774

 Score =   382 bits (982),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 261/326 (80%), Gaps = 3/326 (1%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +F +KA PYIAMI+L+FGYAG++II+K+SLN GMSHYVLVVYRHAFAT A+APFALILER
Sbjct  6     SFLEKASPYIAMITLRFGYAGLSIISKLSLNSGMSHYVLVVYRHAFATLAMAPFALILER  65

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRPK+T +IF +IF+L LLGPVID NFYY GLK+T   F  AL N+LPA TFVMAV+ R
Sbjct  66    KVRPKMTLSIFSKIFLLALLGPVIDHNFYYLGLKYTGAAFLGALINILPATTFVMAVIFR  125

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             MEK++++KV+CQAK+ GTVVT  GAMLMTLYKG  +   W+   H      V   +   +
Sbjct  126   MEKIELRKVKCQAKIAGTVVTGAGAMLMTLYKGPLMGMAWTRQAH---AGGVAPLAVGPT  182

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
              ++   GS+ +++ATLAW++ FI+Q  T+++Y+AQLSL  LVCF GTLQ++ VTF ME R
Sbjct  183   SREMFLGSMFIVIATLAWSALFILQTHTIKQYSAQLSLTTLVCFTGTLQAVVVTFVMERR  242

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVWTIG+DMNL AAAYAG+V+S IAYYVQG+V++KRGPVF +AF+PL +I+VA+M SF 
Sbjct  243   VSVWTIGFDMNLFAAAYAGVVASGIAYYVQGLVIEKRGPVFASAFTPLGLIVVAVMSSFF  302

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             L EKIY+GG++G ++IV GL AVLWG
Sbjct  303   LGEKIYLGGVLGGLVIVVGLCAVLWG  328



>ref|XP_010312165.1| PREDICTED: WAT1-related protein At5g07050-like isoform X2 [Solanum 
lycopersicum]
Length=270

 Score =   363 bits (932),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 197/248 (79%), Positives = 218/248 (88%), Gaps = 4/248 (2%)
 Frame = -2

Query  1405  MISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRPKITFTIF  1226
             MISLQFGYAGMNIITKVSLN+GMSHYVLVVYR+AFAT  IAPFALILERK+RPK+T  +F
Sbjct  1     MISLQFGYAGMNIITKVSLNKGMSHYVLVVYRNAFATLVIAPFALILERKIRPKMTLMMF  60

Query  1225  LQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRC  1046
             LQIFVL LLGPVIDQNFYYAGLK TSPTFSCA+SNMLPAM FVMAVLCRMEKVDIKK+RC
Sbjct  61    LQIFVLSLLGPVIDQNFYYAGLKLTSPTFSCAMSNMLPAMIFVMAVLCRMEKVDIKKIRC  120

Query  1045  QAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDWVKGSILL  866
             QAKV+GT+VT+GGAMLMTLYKGH VN +WSN I+P    NV Q ++ +  KDWVKGSILL
Sbjct  121   QAKVLGTIVTMGGAMLMTLYKGHVVNLIWSNNINP----NVTQITNENYDKDWVKGSILL  176

Query  865   ILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMN  686
             I AT AWASFFI+Q I +RKYTA +SL ALVCFMGTLQSIAVTF MEH+ S+WTIG+DMN
Sbjct  177   IFATFAWASFFILQYIIMRKYTAPISLTALVCFMGTLQSIAVTFVMEHKNSIWTIGFDMN  236

Query  685   LLAAAYAG  662
              LA AYA 
Sbjct  237   FLAVAYAN  244



>ref|XP_002878097.1| hypothetical protein ARALYDRAFT_486104 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54356.1| hypothetical protein ARALYDRAFT_486104 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 196/323 (61%), Positives = 262/323 (81%), Gaps = 10/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
               AKPY AMI LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     DSAKPYFAMICLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIF L LLGP+IDQN YYAGLK TSPTF+ A++N++PA+T++++++CRMEK
Sbjct  67    PKMTFPIFMQIFALALLGPLIDQNLYYAGLKLTSPTFAGAVTNIVPALTYIISIICRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+I+KVR QAKVVGT+V V GAMLM L+K   +NFL S   H T         S+ +G+D
Sbjct  127   VEIRKVRFQAKVVGTLVIVVGAMLMILFKIPFINFLRS---HLTG-------DSSPAGED  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+TF ME   S 
Sbjct  177   YLKATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALTFVMEPNLSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+AYAGI+SSSIAYYVQG++ +++  VFVTAF+PL++II +I+G  IL +
Sbjct  237   WNIGFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLVVIIGSIIGFLILGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              +Y+GG++G  +++ G+ AVLWG
Sbjct  297   NLYLGGVLGMAILLVGVCAVLWG  319



>emb|CDY14752.1| BnaC04g47490D [Brassica napus]
Length=387

 Score =   364 bits (935),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 257/322 (80%), Gaps = 10/322 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++  L RME+
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPAITFILDTLFRMER  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRCQ KVVGT+VTV G++LM L+KG  ++   S             T+S+    D
Sbjct  127   VEMRKVRCQVKVVGTLVTVVGSILMILHKGPFISSFRSQL----------TTASSPLAGD  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +I L++A+L+WASFFI+QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  177   YLKATIFLLIASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSP  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYY+QG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYIQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLW  464
               Y+GG +G V++  G+Y VLW
Sbjct  297   GTYLGGGIGVVVLTVGVYTVLW  318



>emb|CDY68060.1| BnaCnng57410D [Brassica napus]
Length=387

 Score =   363 bits (933),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 199/322 (62%), Positives = 260/322 (81%), Gaps = 10/322 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF+IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++  L RME+
Sbjct  67    SKMTFSIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPAITFILDTLFRMER  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRCQ KVVGT+VTV G++LM L+KG  +    S+F     +S +   SS  +G D
Sbjct  127   VEMRKVRCQVKVVGTLVTVVGSILMILHKGPFI----SSF-----RSQLTTASSPLAG-D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +I L++A+L+WASFFI+QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  177   YLKATIFLLIASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+ YAGI+SSSIAYY+QG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASVYAGIMSSSIAYYIQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLW  464
               Y+GG +G V++  G+Y VLW
Sbjct  297   GTYLGGGIGVVVLTVGVYTVLW  318



>emb|CDY35431.1| BnaA03g19290D [Brassica napus]
Length=393

 Score =   363 bits (933),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 262/323 (81%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKAVLDRGMSHYVLVSYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              KITF IF+ IFVL LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKITFPIFMHIFVLALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++K RCQ KVVGT+VT+ G++L+ LYKG  +NF          +S++  T+S+    +
Sbjct  127   VEMRKARCQVKVVGTLVTLVGSILVILYKGPFINFF---------RSHLSTTTSSPLAGN  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +  L++A+L+WASFFI+QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  178   YLKATAFLLVASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
              +IG DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+ +IV+IM  F+L +
Sbjct  238   LSIGLDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVFVIVSIMSFFVLEQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V++  G+YAVLWG
Sbjct  298   GIYLGGVLGVVVLTVGVYAVLWG  320



>gb|EMS55812.1| Auxin-induced protein 5NG4 [Triticum urartu]
Length=367

 Score =   362 bits (930),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 209/335 (62%), Positives = 240/335 (72%), Gaps = 46/335 (14%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             EG+T       Q+ KPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IA
Sbjct  9     EGET-----LMQRCKPYVAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATLSIA  63

Query  1282  pfaliLER-KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAM  1106
             PFAL LER K RP++T  + L IF+L L+GPVIDQNFYYAGLK                 
Sbjct  64    PFALFLERGKARPRMTPLVLLNIFLLALMGPVIDQNFYYAGLK-----------------  106

Query  1105  TFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSN  926
                                C AKV GT+VTV GAMLMTLYKG AV  +WS   H      
Sbjct  107   -------------------CMAKVAGTLVTVAGAMLMTLYKGRAVEMIWSRHAHLPG---  144

Query  925   VPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSI  746
              P   +A + KDW KGSI LI+ATLAWAS FI+Q  TL +Y A L+L  L+CF+GTLQ+I
Sbjct  145   -PHQDAAAAAKDWFKGSIFLIIATLAWASLFILQGPTLTRYNAPLTLTTLICFVGTLQAI  203

Query  745   AVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMI  566
              VT AMEH   VW IG+DMNLLAAAYAGIV+SSIAYYVQG+V+Q RGPVF +AFSPLMMI
Sbjct  204   VVTLAMEHTTDVWKIGFDMNLLAAAYAGIVTSSIAYYVQGLVIQSRGPVFASAFSPLMMI  263

Query  565   IVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +VAIMGSFILAE IY+GGI+G+VLIV GLY+VLWG
Sbjct  264   VVAIMGSFILAENIYLGGIIGSVLIVAGLYSVLWG  298



>ref|NP_191221.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
 sp|Q9LXX8.1|WTR27_ARATH RecName: Full=WAT1-related protein At3g56620 [Arabidopsis thaliana]
 emb|CAB88065.1| nodulin-like protein [Arabidopsis thaliana]
 gb|AEE79545.1| nodulin MtN21-like transporter family protein [Arabidopsis thaliana]
Length=377

 Score =   362 bits (928),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 261/323 (81%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGP+IDQN YYAGLK TSPTF+ A++N++PA+TF+++++CRMEK
Sbjct  67    PKMTFPIFMQIFVLALLGPLIDQNLYYAGLKLTSPTFAGAVTNIVPALTFIISIICRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K   + FL S   H T  +  P      +G+D
Sbjct  127   VEMRKVRFQAKVVGTLVIVVGAMLMILFKIPLITFLRS---HLTGHALSP------AGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+TF ME   S 
Sbjct  178   YLKATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALTFVMEPNLSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+AYAGI+SSSIAYYVQG++ +++  +FVTAF+PL++II +I+G  IL +
Sbjct  238   WNIGFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVIFVTAFNPLVVIIGSIIGFLILNQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              + +GG++G  ++V G+  VLWG
Sbjct  298   TLNLGGVLGMAILVVGVCTVLWG  320



>ref|XP_010427495.1| PREDICTED: WAT1-related protein At3g56620 isoform X1 [Camelina 
sativa]
Length=376

 Score =   361 bits (927),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 260/323 (80%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAA+APFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAMAPFALLFERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGP+IDQN YYAGLK TSPTF+ A++N++PA+TF+++++CRMEK
Sbjct  67    PKMTFPIFMQIFVLALLGPLIDQNLYYAGLKLTSPTFAGAVTNIVPALTFIISIICRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K    N L S+ I   S   +P      +G+D
Sbjct  127   VEMRKVRFQAKVVGTLVIVVGAMLMILFKTPLFNNLRSHLIGDIS---LP------AGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+ +WAS+F++QA TL+KY++ LSL  +VCFMGTLQS A+TF ME   S 
Sbjct  178   YLKATVFLLVASFSWASYFVLQAATLKKYSSHLSLSTMVCFMGTLQSTALTFVMEPNLSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+ YAGI+SSSIAYYVQG++  ++  VFVTAF+PL++II +I+G  IL +
Sbjct  238   WNIGFDMNLLASVYAGIISSSIAYYVQGMMTMQKSTVFVTAFNPLVVIIGSIIGFLILGQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              +Y+GG++G  +++ G+  VLWG
Sbjct  298   NLYLGGVLGMAILLVGVCVVLWG  320



>ref|XP_009133465.1| PREDICTED: WAT1-related protein At2g40900-like [Brassica rapa]
Length=393

 Score =   361 bits (926),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 200/323 (62%), Positives = 261/323 (81%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA + ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKAVLDRGMSHYVLVSYRNAFATAAIAPFAFLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              KITF IF+ IFVL LLGPVIDQN YY GLK T PTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKITFPIFMHIFVLALLGPVIDQNLYYIGLKLTFPTFSSAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++K RCQ KVVGT+VT+ G++L+ LYKG  +NF          +S++  T+S+    +
Sbjct  127   VEMRKARCQVKVVGTLVTLVGSILVILYKGPFINFF---------RSHLSTTTSSPLAGN  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +  L++A+L+WASFFI+QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  178   YLKATAFLLVASLSWASFFILQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
              +IG DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+ +IV+IM  F+L +
Sbjct  238   LSIGLDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVFVIVSIMSFFVLEQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V++  G+YAVLWG
Sbjct  298   GIYLGGVLGVVVLTVGVYAVLWG  320



>emb|CDX76001.1| BnaA04g02650D [Brassica napus]
Length=372

 Score =   360 bits (923),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 262/323 (81%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN+ITKV LN GM+H+VLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  3     ELAKPYFAMVCLQFGYAGMNLITKVVLNGGMNHFVLVAYRNAFATAAIAPFALLSERKVR  62

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIF+L +LGPVIDQN YYAGL+ TSPTF+ A+++++PA+TF+++++ RMEK
Sbjct  63    PKMTFPIFMQIFLLAVLGPVIDQNMYYAGLRLTSPTFAGAVTSIVPALTFIISIIFRMEK  122

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K   +NFL S+ I   S S         +G+D
Sbjct  123   VELRKVRFQAKVVGTLVIVVGAMLMILFKSPLINFLRSHLIREASSS---------AGED  173

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             +++ ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+ F ME   S 
Sbjct  174   YLRATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALAFVMEPNLSA  233

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W I +DMNLLA+AYAGI+SSSIAYYVQG++ +++  VFVTAF+PL++IIV+I+   IL +
Sbjct  234   WNIAFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLIVIIVSIINFLILGQ  293

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             ++Y+GGI+G V+++ G+ AVLWG
Sbjct  294   RLYLGGILGMVILMLGVCAVLWG  316



>gb|AAM64766.1| nodulin-like protein [Arabidopsis thaliana]
Length=373

 Score =   358 bits (919),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 260/323 (80%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  3     ESAKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  62

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGP+IDQN YYA LK TSPTF+ A++N++PA+TF+++++CRMEK
Sbjct  63    PKMTFPIFMQIFVLALLGPLIDQNLYYACLKLTSPTFAGAVTNIVPALTFIISIICRMEK  122

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K   + FL S   H T  +  P      +G+D
Sbjct  123   VEMRKVRFQAKVVGTLVIVVGAMLMILFKIPLITFLRS---HLTGHALSP------AGED  173

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+TF ME   S 
Sbjct  174   YLKATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALTFVMEPNLSA  233

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+AYAGI+SSSIAYYVQG++ +++  +FVTAF+PL++II +I+G  IL +
Sbjct  234   WNIGFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVIFVTAFNPLVVIIGSIIGFLILNQ  293

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              + +GG++G  ++V G+  VLWG
Sbjct  294   TLNLGGVLGMAILVVGVCTVLWG  316



>ref|XP_010516269.1| PREDICTED: WAT1-related protein At3g56620-like [Camelina sativa]
Length=376

 Score =   358 bits (919),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 259/323 (80%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             +  KPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAA+APFAL+ ERKVR
Sbjct  7     ESTKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAMAPFALLFERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGP+IDQN YYAGLK TSPTF+ A++N++PA+TF+++++CRMEK
Sbjct  67    PKMTFPIFMQIFVLALLGPLIDQNLYYAGLKLTSPTFAGAVTNIVPALTFIISIICRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K H  N L S+ I   S   VP      +G+D
Sbjct  127   VEMRKVRFQAKVVGTLVIVVGAMLMILFKTHLFNNLRSHLIGDIS---VP------AGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+ +WAS+F++QA  L++Y++ LSL  +VCFMGTLQS A+TF M    + 
Sbjct  178   YLKATVFLLIASFSWASYFVLQAAMLKRYSSHLSLSTMVCFMGTLQSTALTFVMVPNLAA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+ YAGI+SSSIAYYVQG++  ++  VFVTAF+PL++II +I+G  IL +
Sbjct  238   WNIGFDMNLLASVYAGIISSSIAYYVQGMMTMQKSVVFVTAFNPLVVIIGSIIGFLILGQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              +Y+GG++G  +++ G+ AVLWG
Sbjct  298   NLYLGGVLGMTILLVGVCAVLWG  320



>ref|XP_010504569.1| PREDICTED: WAT1-related protein At3g56620-like [Camelina sativa]
Length=377

 Score =   357 bits (917),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 258/326 (79%), Gaps = 9/326 (3%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             N  + AKPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAA+APFAL+ ER
Sbjct  4     NMSESAKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAMAPFALLSER  63

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRPK+TF IF+QIFVL LLGP+IDQN YYAGLK TSPTF+ A++N++PA+TF+++++CR
Sbjct  64    KVRPKMTFPIFMQIFVLALLGPLIDQNLYYAGLKLTSPTFAGAVTNIVPALTFIISIICR  123

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             M+KV+++KVR QAKVVGT+V V GA+L  L+K    NFL S+     S S         +
Sbjct  124   MDKVEMRKVRFQAKVVGTLVIVVGALLTILFKTPLFNFLRSHLTGEVSSS---------A  174

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
             G+D++K ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+TF M   
Sbjct  175   GEDYLKATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALTFVMVPN  234

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              S W IG+DMNLLA+ YAGI+SSSIA YVQG++  ++  VFVTAF+PL++II +I+G  I
Sbjct  235   LSAWNIGFDMNLLASVYAGIISSSIACYVQGMMTMQKSVVFVTAFNPLVVIIGSIIGFLI  294

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             L++ +Y+GG++G   ++ G+ AVLWG
Sbjct  295   LSQNLYLGGVLGMATLLVGVCAVLWG  320



>ref|XP_009139089.1| PREDICTED: WAT1-related protein At3g56620-like [Brassica rapa]
Length=376

 Score =   357 bits (917),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 188/323 (58%), Positives = 262/323 (81%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV LN GM+H+VLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ELAKPYFAMVCLQFGYAGMNLVTKVVLNGGMNHFVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIF+L +LGPVIDQN YYAGL+ TSPTF+ A+++++PA+TF+++++ RMEK
Sbjct  67    PKMTFPIFMQIFLLAVLGPVIDQNMYYAGLRLTSPTFAGAVTSIVPALTFIISIIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L+K   +NFL S+ I   S S         +G+D
Sbjct  127   VELRKVRFQAKVVGTLVIVVGAMLMILFKSPLINFLRSHLIREASSS---------AGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             +++ ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+ F ME   S 
Sbjct  178   YLRATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALAFVMEPNLSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W I +DMNLLA+AYAGI+SSSIAYYVQG++ +++  VFVTAF+PL++IIV+I+   IL +
Sbjct  238   WNIAFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLIVIIVSIINFLILGQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             ++Y+GGI+G ++++ G+ AVLWG
Sbjct  298   RLYLGGILGMMILMVGVCAVLWG  320



>ref|XP_010664224.1| PREDICTED: WAT1-related protein At1g21890 [Vitis vinifera]
 emb|CBI19037.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   357 bits (916),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 250/324 (77%), Gaps = 5/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
             F K K Y+ ++SLQFGYAGM IIT VSL  GM+HYVLVVYRHA AT  IAPFAL+LERKV
Sbjct  14    FSKVKAYLGIVSLQFGYAGMYIITMVSLKHGMNHYVLVVYRHAVATLVIAPFALVLERKV  73

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T + FL+I VLG L PV+DQN YY G+K+TS TF+ A  N+LPA+TF++A++ R+E
Sbjct  74    RPKMTLSTFLKIMVLGFLEPVLDQNLYYVGMKYTSATFASATVNVLPAITFILAIIFRLE  133

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             K++IKK+  QAKV+GT++TV GAM+MTLYKG  ++F     IH    S+   +S   +G+
Sbjct  134   KINIKKIPSQAKVIGTLITVTGAMVMTLYKGPIIDF-----IHTRGISHHESSSDPSAGQ  188

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
             +W  G+++L+ +   W+ FFI+Q+ TL++Y A+LSL AL+CFMGT+Q  AV   ME   +
Sbjct  189   NWATGTLMLLGSCFGWSGFFILQSFTLKQYPAELSLTALICFMGTVQGAAVALVMERDKA  248

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W +G+D  +LAAAY+G+V S IAYYVQ +V+++RGPVFVTAFSPL MII A +GSFILA
Sbjct  249   AWAVGFDSRILAAAYSGVVCSGIAYYVQSLVIKERGPVFVTAFSPLCMIITAALGSFILA  308

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             EK+++G I+GA +IV GLY+V+WG
Sbjct  309   EKLHLGSILGAAVIVVGLYSVVWG  332



>gb|KFK34904.1| hypothetical protein AALP_AA5G208800 [Arabis alpina]
Length=375

 Score =   355 bits (912),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 260/323 (80%), Gaps = 8/323 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKVVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF +F+QIFVL LLGP+IDQN YYAGLK TSP F+ A++N++PA+TF++ ++ RMEK
Sbjct  67    PKMTFPVFMQIFVLALLGPLIDQNLYYAGLKLTSPVFAGAVTNIVPALTFIITMIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+I+KVR QAKVVGT+V V GA+LM L+K   ++FL S+FI           +S+ +G+D
Sbjct  127   VEIRKVRFQAKVVGTLVIVVGALLMILFKTPLISFLRSHFIG--------GDASSLAGED  178

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K +  L++A+ +WASFF++QA TL++Y++ LSL  +VCFMGTLQS A+TF ME     
Sbjct  179   YLKATAFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALTFVMEPNLYA  238

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W +G+DMNLLA+ YAGI+SSSIAYYVQG++ +++  VFVTAF+PL++II +I+G  IL +
Sbjct  239   WNVGFDMNLLASVYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLVVIIGSIIGFLILGQ  298

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              +Y+GG++G  +++ G+ AVLWG
Sbjct  299   SLYLGGVLGMAILMVGVCAVLWG  321



>emb|CDY56779.1| BnaAnng14440D [Brassica napus]
Length=377

 Score =   355 bits (910),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 258/324 (80%), Gaps = 10/324 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGY GMN+++KV L+RGMSH+VLV YR+ FATAA+APFAL+ ERK R
Sbjct  7     ESAKPYFAMVCLQFGYVGMNLVSKVVLDRGMSHFVLVAYRNVFATAALAPFALLSERKGR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGPVIDQN YYAGLK TSP F+ A++++LPA+TF+++++ RMEK
Sbjct  67    PKMTFPIFMQIFVLALLGPVIDQNLYYAGLKLTSPIFAGAVTSILPALTFIISIIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V  +KVR QAKVVGT+V V GA+LM L+K     FL S+ IH          +S+ +G+D
Sbjct  127   VKTRKVRFQAKVVGTLVIVVGAILMILFKSPLTIFLRSHLIH---------DASSLAGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+L+WASFF++QA TL+ Y++ LSL  +VCFMGTLQS A+TF ME   S 
Sbjct  178   YLKATVFLLIASLSWASFFVLQAATLKTYSSHLSLSTMVCFMGTLQSTALTFVMEPSLSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQK-RGPVFVTAFSPLMMIIVAIMGSFILA  533
             W +G+DMNLLA+AYAGI++SSIAYYVQG++M K + PVFVTAF+PL++I  +I+G  +L 
Sbjct  238   WNVGFDMNLLASAYAGIMTSSIAYYVQGMMMAKQKSPVFVTAFNPLIVIFGSIIGFLVLG  297

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             +++Y+GG++G V++  G+ AVLWG
Sbjct  298   QRLYLGGVLGMVILTMGVCAVLWG  321



>ref|XP_010063373.1| PREDICTED: WAT1-related protein At4g08300-like [Eucalyptus grandis]
 gb|KCW70588.1| hypothetical protein EUGRSUZ_F03778 [Eucalyptus grandis]
Length=372

 Score =   354 bits (909),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 251/334 (75%), Gaps = 4/334 (1%)
 Frame = -2

Query  1459  GKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiap  1280
             G++G   +  +K KPY+AM+SLQFGYAGM IIT VSLN GM+HYVL VYRH  AT  IAP
Sbjct  2     GQSGAFWSGLKKVKPYLAMVSLQFGYAGMYIITLVSLNHGMNHYVLAVYRHVVATLLIAP  61

Query  1279  faliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTF  1100
             FA +LERK+RPK+T  IFL+I  LG L PV+DQN YY G+K TS TF+ A  N+LPA+TF
Sbjct  62    FAFVLERKIRPKLTLPIFLRIMALGFLEPVLDQNLYYVGMKSTSATFASATVNILPAITF  121

Query  1099  VMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI-HPTSKSNV  923
             +MA+  R+EKV++KK++  +KV+GT VTVGGAM+MTLYKG  V+F+ S    HP +  + 
Sbjct  122   IMALAFRLEKVNVKKIQSLSKVIGTAVTVGGAMVMTLYKGPIVDFMRSGGTGHPHAGGDG  181

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIA  743
             P  S+    + WV G+++L+ +   W+ FFI+Q+ TL+KY A+LSL AL+C MG+++  A
Sbjct  182   PHQST---NQHWVTGTLMLLASCCGWSGFFILQSFTLKKYPAELSLTALICLMGSVEGAA  238

Query  742   VTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMII  563
             VT  ME   +VW IGWD  LLAA Y+G+V S IAYYVQG+V+++RGPVF+T+FSPL MII
Sbjct  239   VTLVMERNMNVWRIGWDSRLLAAVYSGVVCSGIAYYVQGVVIKERGPVFITSFSPLCMII  298

Query  562   VAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              A +G+ +LAE I++G I+GA+ IV GLY V+WG
Sbjct  299   TAALGAIVLAETIHLGSIIGAIFIVCGLYIVVWG  332



>ref|XP_010505847.1| PREDICTED: WAT1-related protein At2g40900-like [Camelina sativa]
Length=372

 Score =   354 bits (909),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 201/323 (62%), Positives = 264/323 (82%), Gaps = 10/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKAVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF++IF+L LLGPVIDQN YY GLK TSPTFS A+SN++PA+T ++A + RMEK
Sbjct  67    SKMTFPIFMRIFLLALLGPVIDQNLYYIGLKLTSPTFSTAVSNIVPALTIILATIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRC  KV+GT+VTVGG++LM  YKG  +N   S   H T+ S+ P T+      D
Sbjct  127   VEMRKVRCLVKVMGTLVTVGGSILMIFYKGPFINIFRS---HLTTVSS-PLTT------D  176

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L+LA+++WASFF++QA TL+KY+A LSL  +VCF+GTLQS+A+TF MEH  S 
Sbjct  177   YLKAAVFLLLASISWASFFVLQAATLKKYSAHLSLSTMVCFVGTLQSLALTFVMEHNPSA  236

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               IG+DMNLLA+AYAGI+SSSIAYYVQG++MQ++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  237   LNIGFDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  296

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GGI+G V++  G+Y VLWG
Sbjct  297   GIYLGGIIGVVVLTVGVYVVLWG  319



>ref|XP_007010783.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY19593.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=364

 Score =   351 bits (901),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 208/333 (62%), Positives = 244/333 (73%), Gaps = 47/333 (14%)
 Frame = -2

Query  1456  KTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapf  1277
             K  C G+F + +KPY AMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATA IAPF
Sbjct  3     KLRC-GSFLESSKPYFAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHAFATAVIAPF  61

Query  1276  aliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFV  1097
             ALI ER+ + KITF +F+QIF+L LLG                        N+LPAMTFV
Sbjct  62    ALIFERRGQSKITFPVFMQIFILALLG------------------------NILPAMTFV  97

Query  1096  MAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQ  917
             MAV+CRMEK+D+KKVRCQAK+VGT+VTV GAMLMTL KG  V   W+  IHP  + +   
Sbjct  98    MAVMCRMEKIDVKKVRCQAKIVGTLVTVAGAMLMTLNKGPIVELFWTKSIHP--RQSTGT  155

Query  916   TSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAV  740
              ++  + KDWVKGSILLI+ATLAWAS F++QA  L+ Y    LSL +L            
Sbjct  156   DTAGTTDKDWVKGSILLIIATLAWASLFVLQAKALKTYKNHHLSLTSLT-----------  204

Query  739   TFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIV  560
                     S W IGWDMNLLAAAYAGIV+SSI+YYVQG+V++KRGPVF TAFSPLMMIIV
Sbjct  205   --------SAWQIGWDMNLLAAAYAGIVTSSISYYVQGMVIKKRGPVFATAFSPLMMIIV  256

Query  559   AIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             AIMGSFILAEKI++GG++GA+ IV GLY+VLWG
Sbjct  257   AIMGSFILAEKIFLGGVIGAIWIVIGLYSVLWG  289



>ref|XP_009116364.1| PREDICTED: WAT1-related protein At3g56620 [Brassica rapa]
Length=377

 Score =   351 bits (900),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 257/324 (79%), Gaps = 10/324 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGY GMN++TKV L+RGMSH+VLV YR+ FATAA+APFAL+ ERK R
Sbjct  7     ESAKPYSAMVCLQFGYVGMNLVTKVVLDRGMSHFVLVAYRNVFATAALAPFALLSERKGR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVL LLGPVIDQN YYAGLK TSP F+ A++++LPA+TF+++++ RMEK
Sbjct  67    PKMTFPIFMQIFVLALLGPVIDQNLYYAGLKLTSPIFAGAVTSILPALTFIISIIFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V  +KVR QAKVVGT+V V GA+LM L+K     FL S+ IH          +S+ +G+D
Sbjct  127   VKTRKVRFQAKVVGTLVIVVGAILMILFKSPLTIFLRSHLIH---------DASSLAGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L++A+L+WASFF++QA TL+ Y++ LSL  +VCFMGTLQS A+TF ME   S 
Sbjct  178   YLKATVFLLIASLSWASFFVLQAATLKTYSSHLSLSTMVCFMGTLQSTALTFVMEPSLSA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQK-RGPVFVTAFSPLMMIIVAIMGSFILA  533
               +G+DMNLLA+AYAGI++SSIAYYVQG++M K + PVFVTAF+PL++I  +I+G  +L 
Sbjct  238   LHVGFDMNLLASAYAGIMTSSIAYYVQGMMMAKQKSPVFVTAFNPLIVIFGSIIGFLVLG  297

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             +++Y+GG++G V++  G+ AVLWG
Sbjct  298   QRLYLGGVLGMVILTMGVCAVLWG  321



>ref|XP_010274315.1| PREDICTED: WAT1-related protein At1g21890 [Nelumbo nucifera]
Length=385

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 254/334 (76%), Gaps = 6/334 (2%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             +G  G L N F KAKP++AM+SLQFG+AGM IIT + L RG++HYVLVVYR+  AT AIA
Sbjct  4     QGPIGLLCNIFYKAKPFVAMVSLQFGFAGMYIITMLCLKRGLNHYVLVVYRNGTATLAIA  63

Query  1282  pfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMT  1103
             PFAL  ERK+RPK+T ++FL+I VLG L PV+DQN YY G+++TS TFS A+ N+LPA+T
Sbjct  64    PFALYFERKIRPKMTLSVFLKIMVLGFLEPVLDQNLYYVGMRYTSATFSSAMFNVLPAIT  123

Query  1102  FVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNV  923
             F+MA++ R+EKV IK +  QAK++GTVVT+ GAM MTLYKG  +N   S         + 
Sbjct  124   FIMAIIFRLEKVKIKNLHSQAKIIGTVVTLAGAMAMTLYKGPILNLGLSR------GGSH  177

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIA  743
              + SS+ SG+ WV G+++L+ +   WASFFI+Q+ TL++Y A+LSL +L+CFMGT+Q  A
Sbjct  178   HEDSSSSSGQHWVVGTLMLLGSCTGWASFFILQSFTLKQYPAELSLTSLICFMGTMQGAA  237

Query  742   VTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMII  563
             V   ME   + W +GWD  LLAA Y G++ S +AYYVQG+V+++RGPVFVTAF+PL MII
Sbjct  238   VALVMERNPAAWAVGWDSRLLAAVYTGVICSGVAYYVQGVVIKERGPVFVTAFNPLCMII  297

Query  562   VAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VA +GS IL E++++G ++GA++IV GLY+V+WG
Sbjct  298   VAALGSLILGEQLHLGSVIGALVIVIGLYSVVWG  331



>emb|CDX72122.1| BnaC08g27520D [Brassica napus]
Length=375

 Score =   350 bits (898),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 258/324 (80%), Gaps = 9/324 (3%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
              + AKPY AM+ LQFGY GMN++TKV L+RGMSH+VLV YR+ FATAA+APFAL+ ERK 
Sbjct  6     LESAKPYFAMVCLQFGYVGMNLVTKVVLDRGMSHFVLVAYRNVFATAALAPFALLSERKA  65

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+TF IF+QIFVL LLGPVIDQN YYAGLK TSPTF+ A+++++PA+TF++++  RME
Sbjct  66    RPKMTFPIFMQIFVLALLGPVIDQNLYYAGLKLTSPTFAGAITSIVPALTFIISITLRME  125

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             KV  +KVR QAKVVGT+V V GA+L+  +K   + +L S+ IH          +S+ +G+
Sbjct  126   KVKTRKVRFQAKVVGTLVIVVGAILVISFKSPLIIYLRSHIIH---------VASSLAGE  176

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
             D++K ++ L++A+L+WA+FF++QA TL+ Y++ LSL  +VCFMGTLQS A+TF ME    
Sbjct  177   DYLKAAVFLLIASLSWAAFFVLQAATLKTYSSHLSLSTMVCFMGTLQSTALTFVMEPSLL  236

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+DMNLLA+AYAGI++SSIAYYVQG++ +++  VFVTAF+PL++II +I+G  IL 
Sbjct  237   AWNIGFDMNLLASAYAGIMTSSIAYYVQGMMTKQKSTVFVTAFNPLIVIIGSIIGFVILG  296

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             +++Y+GG++G V+++ G+ AVLWG
Sbjct  297   QRLYLGGVLGMVILMMGVCAVLWG  320



>gb|KDP32785.1| hypothetical protein JCGZ_12077 [Jatropha curcas]
Length=375

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 186/322 (58%), Positives = 244/322 (76%), Gaps = 3/322 (1%)
 Frame = -2

Query  1426  KAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRP  1247
             KAKP++AM+SLQFGYAGM I+T VS   GMSHY+L +YRH  AT  IAPFAL+LERK+RP
Sbjct  16    KAKPFLAMVSLQFGYAGMYIVTMVSFKHGMSHYILALYRHIVATLVIAPFALVLERKIRP  75

Query  1246  KITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKV  1067
             K+T  IFL+I VLG L PV+DQN YY G+K TS TF+ A  N+LPA+TF++A++ R+EKV
Sbjct  76    KMTLPIFLRITVLGFLEPVLDQNLYYVGMKSTSATFASASVNVLPAITFILAIIFRLEKV  135

Query  1066  DIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDW  887
             +IK+V   AK++GT VTV GAM+MTLYKG  +NFL S   H     +   TS+  + + W
Sbjct  136   NIKRVHDIAKIMGTCVTVAGAMVMTLYKGPILNFLTS---HGAGSHHGSTTSTEPNDQHW  192

Query  886   VKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVW  707
             V G+++L+ +   WASFFI+Q+ TL+KY A+LSL AL+C MG +Q  AV+  ME   S W
Sbjct  193   VTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALICLMGAVQGAAVSLVMERDMSAW  252

Query  706   TIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEK  527
              IG+D   LAAAY+GIV S +AYYVQG+V+++RGPVFVT+FSPL MII A +G+ ILAE+
Sbjct  253   KIGFDSRFLAAAYSGIVCSGVAYYVQGMVIKERGPVFVTSFSPLCMIITAALGTIILAEQ  312

Query  526   IYVGGIMGAVLIVFGLYAVLWG  461
             + +G I+GA+LIV GLY V+WG
Sbjct  313   LRLGSIIGAILIVIGLYTVVWG  334



>ref|XP_010272782.1| PREDICTED: WAT1-related protein At1g21890-like [Nelumbo nucifera]
Length=386

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 183/330 (55%), Positives = 245/330 (74%), Gaps = 6/330 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G L   F K KP++AM+SLQFGYAGM I+T + L RGMSHYVL VYRHA AT AIAPFAL
Sbjct  9     GLLCTIFNKVKPFMAMVSLQFGYAGMYIVTMLCLRRGMSHYVLAVYRHAAATLAIAPFAL  68

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
               ERK+RPK+T ++FL+I VL  L PV+DQN YY G+K TS TFS A+ N+LP +TF+MA
Sbjct  69    FFERKIRPKMTVSVFLKIMVLAFLEPVLDQNLYYVGMKSTSATFSSAIFNVLPGITFIMA  128

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             ++ R+E V IKK+  QAK++GT+VT  GAM MTLYKG  +N   S            + S
Sbjct  129   IIFRLEHVKIKKIHSQAKIIGTIVTFAGAMAMTLYKGPILNLGLSR------GGAHHEAS  182

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             S+ +G+ WV G+++L+ +   W+ FFI+Q+ TL++Y A+LSL +L+CFMG +Q  AV   
Sbjct  183   SSAAGQHWVAGTLMLLASCTGWSCFFILQSFTLKQYPAELSLTSLICFMGMVQGAAVALV  242

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             ME +   W++GWD  LLAA Y+G+V S I YYVQGIV+++RGPVFVTAF+PL M+IVA +
Sbjct  243   MERKPGAWSLGWDSRLLAAVYSGVVCSGITYYVQGIVIKERGPVFVTAFNPLCMVIVAAL  302

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             GS ILAE+I++G ++GA++IV GLY+V+WG
Sbjct  303   GSLILAEQIHLGSVIGAIVIVIGLYSVVWG  332



>ref|XP_002302243.2| nodulin MtN21 family protein [Populus trichocarpa]
 gb|EEE81516.2| nodulin MtN21 family protein [Populus trichocarpa]
Length=383

 Score =   348 bits (892),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 244/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
              +K KPY+AM+SLQFGYAGM IIT VSL  GMSHY+L VYRH  AT  IAPFAL+LERK+
Sbjct  14    LKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATIVIAPFALVLERKI  73

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T  IFL+I  LG L PV+DQN YY G+K+TS TF+ A  N LPA+TF+MA++ R+E
Sbjct  74    RPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALPAITFIMALIFRLE  133

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
              V+ KK+   AKVVGTV+TV GAM+MTLYKG  ++F+ S        ++   TS+A   +
Sbjct  134   TVNFKKLHSAAKVVGTVITVTGAMVMTLYKGPIIDFIRSQ-----GAAHRGTTSNASGNQ  188

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
              W+ G+++L+ +   WASFFI+Q+ TL+KY A+LSL AL+C  G ++  AV+  ME   S
Sbjct  189   HWLTGTLMLLASCCGWASFFILQSFTLKKYPAELSLTALICMTGMVEGAAVSLVMERDMS  248

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+D  LLAAAY+G+V S IAYYVQG+V++K+GPVFVT+FSPL MII A +GS +L+
Sbjct  249   AWKIGFDSRLLAAAYSGVVCSGIAYYVQGVVIRKKGPVFVTSFSPLCMIITAALGSVVLS  308

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E+I +G I+GAVLIVFGLY V+WG
Sbjct  309   EQIRLGSIIGAVLIVFGLYTVVWG  332



>ref|XP_009104012.1| PREDICTED: WAT1-related protein At3g56620-like [Brassica rapa]
 emb|CDY68855.1| BnaAnng28570D [Brassica napus]
Length=375

 Score =   347 bits (891),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 193/323 (60%), Positives = 258/323 (80%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AMI LQFGYAGMN++TKV L+RG+SH+VLV YR+AFATAAIAPFAL+ ERKVR
Sbjct  7     ESAKPYFAMICLQFGYAGMNLVTKVVLDRGISHFVLVAYRNAFATAAIAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIFVLGLLGPVIDQN YYAGLK TSPTF+ A++N++PA+TF+++++CRMEK
Sbjct  67    PKMTFPIFMQIFVLGLLGPVIDQNLYYAGLKLTSPTFAGAVTNIMPALTFIISIICRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR QAKVVGT+V V GAMLM L K   +N L S+ I   S S          G+D
Sbjct  127   VEMRKVRFQAKVVGTLVIVVGAMLMILIKSPFINLLRSHLIGDASLS---------VGED  177

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++  ++A+ +WASFF++QA TL++Y++  SL  +VCFMGTLQS A+TF ME     
Sbjct  178   YLKATVFFLIASFSWASFFVLQAATLKRYSSHGSLSTMVCFMGTLQSTALTFVMEPNLYA  237

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DMNLLA+ YAGI+SSSIAYYVQG++ +++  VFVTAF+PL +II +I+G  IL +
Sbjct  238   WNIGFDMNLLASVYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLSVIIGSIIGLLILGQ  297

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             ++Y+GG++G  +I+ G+ AVLWG
Sbjct  298   RLYLGGVLGMAMIMVGVCAVLWG  320



>gb|KHG29332.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   344 bits (882),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 244/324 (75%), Gaps = 6/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
               KAKPY++MISLQFG+AGM +IT VSL  GM+HYVL VYRH  AT  IAPFAL+LERK+
Sbjct  7     LNKAKPYLSMISLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVLERKI  66

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T  I L+I VLG L PV+DQN YY G+K+T+ T + A  N++PA+TFVMA++ R+E
Sbjct  67    RPKLTLPILLRILVLGFLEPVVDQNLYYLGMKYTTATLASATVNVIPAITFVMALIFRLE  126

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             KV +KKV   AK++GTV+ V GA++MT+YKG A+NF     I     SN   T+ A++ K
Sbjct  127   KVKLKKVHSIAKIIGTVIMVPGAIIMTMYKGPAINF-----IKLQGGSNHNATNEAEA-K  180

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
              WV G+++L+     W+ F+I+Q+ TL+ Y A+LSL AL+CF+GT+   AV+F ME   +
Sbjct  181   HWVAGTLMLLARCWGWSGFYILQSFTLKMYPAELSLTALICFVGTIGGAAVSFVMERDMN  240

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG D +LLAA Y+G+V S IAYY QG+V+++RGPVFVTAFSPL MII A +GSFILA
Sbjct  241   AWKIGCDSSLLAAVYSGVVCSGIAYYAQGVVIRERGPVFVTAFSPLCMIITAALGSFILA  300

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             EK+++G I+G V+I+FGLY VLWG
Sbjct  301   EKVHLGSIIGTVIIIFGLYTVLWG  324



>ref|XP_011027560.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=391

 Score =   343 bits (880),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 243/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
              +K KPY+AM+SLQFGYAGM IIT VSL  GMSHY+L VYRH  AT  IAPFA +LERK+
Sbjct  14    LKKVKPYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATIVIAPFAFVLERKI  73

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T  IFL+I  LG L PV+DQN YY G+K+TS TF+ A  N LPA+TF+MA++ R+E
Sbjct  74    RPKLTLPIFLRIMALGFLEPVLDQNLYYLGMKYTSATFASATVNALPAITFIMALIFRLE  133

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
              V+ KK+   AKVVGTV+TV GAM MTLYKG  ++F+ S+       ++   TS+A   +
Sbjct  134   TVNFKKLHSAAKVVGTVITVTGAMAMTLYKGPIIDFIRSH-----GAAHRGTTSNASGNQ  188

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
              W+ G+++L+ +   WA FFI+Q+ TL+KY A+LSL AL+C  G ++  AV+  ME   +
Sbjct  189   HWLTGTLMLLGSCCGWAGFFILQSFTLKKYPAELSLTALICMTGMVEGAAVSLVMERDMN  248

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W +G+D  LLAAAY+G+V S IAYYVQG+V++K+GPVFVT+FSPL MII A +GS +L+
Sbjct  249   AWKLGFDSRLLAAAYSGVVCSGIAYYVQGVVIRKKGPVFVTSFSPLCMIITAALGSIVLS  308

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E+I++G I+GA+LIVFGLY V+WG
Sbjct  309   EQIHLGSIIGAILIVFGLYTVVWG  332



>gb|KHG16518.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=385

 Score =   343 bits (879),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 249/336 (74%), Gaps = 6/336 (2%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             +       L +   KA+PY+A+ISLQFGYAGM I++ + +  GMS+++L  YRH  AT  
Sbjct  3     DQTSSASALSDVLNKARPYLAIISLQFGYAGMYILSTICMKHGMSNFILATYRHVAATIV  62

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             IAPFA +LERK+RPK+T  IFL+I VLG L PV+DQN YY G+KFT+ T+S A  NMLPA
Sbjct  63    IAPFAFVLERKIRPKMTLPIFLRIVVLGFLEPVLDQNLYYLGMKFTTATYSSAFVNMLPA  122

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             +TF+MA++ R+EK+++KK+   AKVVGT +TVGGAM+MTLYKG  ++F+ S      +  
Sbjct  123   VTFIMAMIFRLEKINLKKIHSIAKVVGTAITVGGAMVMTLYKGPIIDFVKSG----GATH  178

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             +   T SAD  + WV G+I+L+ +   W+SFFI+Q+ TL+KY A+LSL A +CFMGT+Q 
Sbjct  179   HGTNTESAD--QHWVSGTIMLLGSIAGWSSFFILQSFTLKKYPAELSLTAWICFMGTVQD  236

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
               ++F M    S W IG+D  LLAA+Y+GIV S IAYYVQGIV+++RGPVFVTAFSPL M
Sbjct  237   AGLSFIMVRDLSAWKIGFDSRLLAASYSGIVCSGIAYYVQGIVIRQRGPVFVTAFSPLCM  296

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             II A +G+ ILAEKI++G I+GA++IV GLY V+WG
Sbjct  297   IITAALGTIILAEKIHLGSILGAIIIVSGLYTVVWG  332



>gb|ABS52574.1| nodulin family protein [Gossypium hirsutum]
Length=385

 Score =   342 bits (878),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 248/336 (74%), Gaps = 6/336 (2%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             +       L +   KAKPY+A+ISLQFGYAGM I++ + +  GMS+++L  YRH  AT  
Sbjct  3     DQTSSASALSDVLNKAKPYLAIISLQFGYAGMYILSTICMKHGMSNFILATYRHVVATIV  62

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             IAPFA +LERK+RPK+T  IFL+I VLG L PV+DQN YY G+KFT+ T+S A  NMLPA
Sbjct  63    IAPFAFVLERKIRPKMTLPIFLRIVVLGFLEPVLDQNLYYLGMKFTTATYSSAFVNMLPA  122

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             +TF+MA++ R+EK+++KK+   AKVVGT +TVGGAM+MTLYKG  ++F+ S      +  
Sbjct  123   VTFIMAMIFRLEKINLKKIHSIAKVVGTAITVGGAMVMTLYKGPIIDFVKSG----GATH  178

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             +   T SAD  + WV G+I+L+ +   W+SFFI+Q+ TL+KY A+LSL A +CFMGT+Q 
Sbjct  179   HSTNTESAD--QHWVSGTIMLLGSIAGWSSFFILQSFTLKKYPAELSLTAWICFMGTVQD  236

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
               ++F M    S W IG+D  LLAA+Y+GIV S IAYYVQGIV+ +RGPVFVTAFSPL M
Sbjct  237   AGLSFIMVRDLSAWKIGFDSRLLAASYSGIVCSGIAYYVQGIVIWQRGPVFVTAFSPLCM  296

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             II A +G+ ILAEKI++G I+GA++IV GLY V+WG
Sbjct  297   IITAALGTVILAEKIHLGSILGAIIIVSGLYTVVWG  332



>ref|XP_007133644.1| hypothetical protein PHAVU_011G1969001g, partial [Phaseolus vulgaris]
 gb|ESW05638.1| hypothetical protein PHAVU_011G1969001g, partial [Phaseolus vulgaris]
Length=311

 Score =   339 bits (870),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 175/247 (71%), Positives = 208/247 (84%), Gaps = 6/247 (2%)
 Frame = -2

Query  1195  PVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvt  1016
             PVIDQNFYYAGLK TSPTFSCA+SNMLPAMTFVMAV CRMEK+++K+VRC AKVVGT+VT
Sbjct  1     PVIDQNFYYAGLKLTSPTFSCAMSNMLPAMTFVMAVFCRMEKINMKQVRCIAKVVGTLVT  60

Query  1015  vgGAMLMTLYKGHAVNFLWSNFIHPTSKSN-VPQTSSADSGKDWVKGSILLILATLAWAS  839
             V GAMLMTLY+G  V  +W+   HP +K N    T S D  KDW  G I LI+ATLAWAS
Sbjct  61    VAGAMLMTLYRGPIVEMVWAK--HPQNKGNGTSTTGSLD--KDWFLGCIFLIIATLAWAS  116

Query  838   FFIIQAITLRKY-TAQLSLIALVCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAG  662
              F++QA  ++ Y   QLSL +LVCF+GT+Q+IAVTF +EH  SVW IGWDMNLLAAAYAG
Sbjct  117   LFVLQAKAIQTYKNHQLSLTSLVCFIGTIQAIAVTFVVEHNPSVWRIGWDMNLLAAAYAG  176

Query  661   IVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFG  482
             IV+SSI+YYVQG+V++K+GPVF TAFSPLMMIIVAIMGSF+LAE+IY+GG++GA+LIV G
Sbjct  177   IVTSSISYYVQGLVIKKKGPVFATAFSPLMMIIVAIMGSFLLAEQIYLGGVIGAILIVIG  236

Query  481   LYAVLWG  461
             LY+VLWG
Sbjct  237   LYSVLWG  243



>gb|KHG29659.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=377

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 245/325 (75%), Gaps = 8/325 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
               KAKPY+ M SLQFG+AGM +IT VSL  GM+HYVL VYRH  AT  IAPFAL+LERK+
Sbjct  9     LNKAKPYLTMTSLQFGFAGMYVITMVSLQHGMNHYVLAVYRHLVATIVIAPFALVLERKI  68

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T  IFL+I VLG L PVIDQN YY G+K+T+ T + A  N++PA+TFV+A++ R+E
Sbjct  69    RPKLTVPIFLRILVLGFLEPVIDQNLYYLGMKYTTATLASATVNVIPAITFVLALIFRLE  128

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFL-WSNFIHPTSKSNVPQTSSADSG  896
             KV++KKV   AK++GT + V GA++MTLYKG +++F  +    H T+ +NV +       
Sbjct  129   KVNLKKVHSIAKIIGTTIMVPGAVIMTLYKGPSISFTKFGGGAHQTA-TNVAEA------  181

Query  895   KDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRA  716
             K WV G+++L+     W+ F+I+Q+ TL+ Y A+LSL AL+CF+GT+   AV+FAME   
Sbjct  182   KHWVVGTLMLLGRCWGWSGFYILQSFTLKMYPAELSLTALICFIGTIGGAAVSFAMERDL  241

Query  715   SVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFIL  536
             + W IGWD +LLAA Y+G+V S IAYY QG+V++++GPVFVTAFSPL MII A++GS IL
Sbjct  242   NAWKIGWDSSLLAAVYSGVVCSGIAYYAQGVVIREQGPVFVTAFSPLCMIITAVLGSMIL  301

Query  535   AEKIYVGGIMGAVLIVFGLYAVLWG  461
             AEKI++G I+G VLI+FGLY VLWG
Sbjct  302   AEKIHLGSIIGTVLIIFGLYTVLWG  326



>gb|KHG18008.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=387

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 246/327 (75%), Gaps = 8/327 (2%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             N     KPY+AM+SLQFGYAGM I++ V L  GMS+++L  YRH  AT  IAPFA++LER
Sbjct  12    NGLNTMKPYLAMVSLQFGYAGMYIVSMVCLKHGMSNFILATYRHVVATIVIAPFAIVLER  71

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             K+RPK+T  +FL+I  LG L PV+DQNFYY G+K T+ T+S A  NMLPA+TF++A++ R
Sbjct  72    KIRPKMTLPVFLRIVALGFLEPVLDQNFYYLGMKLTTATYSSAFVNMLPAVTFILAMIFR  131

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSN-FIHPTSKSNVPQTSSAD  902
             +EKV++KK+R  AK++GT +TV GAM+MTLYKG  ++F+ S   +H  +      T SAD
Sbjct  132   LEKVNVKKIRSFAKIIGTAITVIGAMVMTLYKGPIIDFIKSGGAVHQGT-----ATESAD  186

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH  722
               K WV G+ILL+ +  +WA FFI+Q+ TL+KY A+LSL A +CFMG ++   V+  M  
Sbjct  187   --KHWVTGTILLLGSICSWAGFFILQSFTLKKYPAELSLTAWICFMGMIEDAIVSLIMVR  244

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               S W IGWD  LLAA+Y+GIV+S IAYYVQG+V+++RGPVFVT+FSPL MII AI+G+ 
Sbjct  245   DLSAWKIGWDSRLLAASYSGIVNSGIAYYVQGVVIRQRGPVFVTSFSPLCMIITAILGAI  304

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAEKI++G I+GA++IV GLY V+WG
Sbjct  305   ILAEKIHLGSILGAIIIVTGLYTVVWG  331



>tpg|DAA57218.1| TPA: hypothetical protein ZEAMMB73_947627 [Zea mays]
Length=283

 Score =   338 bits (866),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 185/257 (72%), Positives = 217/257 (84%), Gaps = 1/257 (0%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             C G+FF KAKPY+AMISLQFGYAGMN+ITKVSLN GMSHYVLVVYRHAFAT +IAPFALI
Sbjct  6     CYGDFFDKAKPYLAMISLQFGYAGMNVITKVSLNHGMSHYVLVVYRHAFATVSIAPFALI  65

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERKVRP +T+++FLQIFVL LLGPVIDQNFYYAGLKFT PTF+CA+SN+LPAMTFVMAV
Sbjct  66    LERKVRPNMTWSVFLQIFVLALLGPVIDQNFYYAGLKFTGPTFACAMSNILPAMTFVMAV  125

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEKVD+KKVRCQAKV GT+VTV GAM+MTLYKG  +   W++  H        + + 
Sbjct  126   IFRMEKVDLKKVRCQAKVAGTLVTVAGAMMMTLYKGPLMKMAWTSSGHAHGGGGGAEAAV  185

Query  907   AD-SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              D SG++W  GS+ +I+ATLAWAS FI+QA TL++Y A LSL  L+CF+GTLQ+I VTFA
Sbjct  186   IDPSGREWFLGSLFVIVATLAWASLFILQAHTLKQYAAPLSLTTLICFVGTLQAIVVTFA  245

Query  730   MEHRASVWTIGWDMNLL  680
             MEHR SVWTIG+DMNLL
Sbjct  246   MEHRPSVWTIGFDMNLL  262



>ref|XP_002306626.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
 gb|EEE93622.2| hypothetical protein POPTR_0005s15810g [Populus trichocarpa]
Length=387

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 186/329 (57%), Positives = 244/329 (74%), Gaps = 8/329 (2%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             CLG   +K K Y+AM+SLQFGYAGM IIT VSL  GMSHY+L VYRH  AT  IAPFA +
Sbjct  11    CLG--LKKVKHYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVATLVIAPFAFV  68

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERK+RPK+T +IFL+I VLG L PV+DQN YY G+K+TS TFS A +N LPA+TF+MA+
Sbjct  69    LERKIRPKLTLSIFLRIMVLGFLEPVLDQNLYYLGMKYTSATFSSATTNALPAITFLMAL  128

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
               R+E V+ KK+   AK +GTV+TV GAM+MTLYKG  ++F+ S   H  +      TS+
Sbjct  129   CFRLETVNFKKLHSAAKAIGTVITVTGAMVMTLYKGPVIDFIRS---HGAAHHG---TSN  182

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
                 +  + G+++L+ +  AWA FFI+Q+ TL+KY A+LSL AL+C MG ++  AV+  M
Sbjct  183   ESGNQHRLTGTLMLLGSCCAWAGFFILQSFTLKKYPAELSLTALICVMGVVEGAAVSLVM  242

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E     W IG+D  LLAAAY+G+V S IAYYVQG+V+++RGPVFVT+FSPL MI  A +G
Sbjct  243   ERDMGAWKIGFDSRLLAAAYSGVVCSGIAYYVQGVVIRERGPVFVTSFSPLCMITTAALG  302

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             S +LAE+I++G I+GAVLIV+GLY V+WG
Sbjct  303   SLVLAEQIHLGSIIGAVLIVWGLYTVVWG  331



>ref|XP_011074856.1| PREDICTED: WAT1-related protein At1g44800-like [Sesamum indicum]
Length=389

 Score =   341 bits (875),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 245/324 (76%), Gaps = 5/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
             F K KPY+AMISLQFGYAGM I+T VS   G SH++ VVYRHA AT   APFA  LE+K+
Sbjct  15    FNKMKPYLAMISLQFGYAGMYIVTLVSFKHGFSHWIFVVYRHAIATLVFAPFAYFLEKKI  74

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RP++T ++F +I VL  L PV+DQN Y  G+++TS TF+    N+LPA+TF+MAV+ R+E
Sbjct  75    RPQMTKSVFFKIMVLAFLEPVLDQNLYGVGIQYTSATFAAVSLNVLPAVTFIMAVIFRLE  134

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             KV++KKV   AKV+GTV+TV GAM MTLYKG AVN LW  + H +S  +    +S+ +G+
Sbjct  135   KVNLKKVHSLAKVIGTVITVAGAMTMTLYKGPAVNILW--YTHGSSHQD---AASSSAGQ  189

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
              WV G+++L+L+ + WA+FFI+Q  TL +Y A LSL ALVC MGT++   V   MEHR S
Sbjct  190   HWVAGTVMLLLSIVGWAAFFILQNKTLNEYPAPLSLTALVCLMGTVEGGVVAAIMEHRKS  249

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+D  LLAAAY+GI+ S +AYY+Q +V + RGPVFVTAFSPL MII A++G+ IL+
Sbjct  250   AWAIGFDSRLLAAAYSGIICSGLAYYMQSVVNKVRGPVFVTAFSPLTMIITAVLGAIILS  309

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E++++G ++GA++IVFGLY+V+WG
Sbjct  310   EQVHLGSLIGALIIVFGLYSVVWG  333



>gb|KHG23400.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=385

 Score =   341 bits (874),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 178/336 (53%), Positives = 247/336 (74%), Gaps = 6/336 (2%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             +       L +   KA+PY+A+ISLQFGYAGM I++ + +  GMS+++L  YRH  AT  
Sbjct  3     DQTSSASALSDVLNKARPYLAIISLQFGYAGMYILSTICMKHGMSNFILATYRHVAATIV  62

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             IAPFA +LERK+RPK+T  IFL+I VLG L PV+DQN YY G+KFT+ T+S A  NMLPA
Sbjct  63    IAPFAFVLERKIRPKMTLPIFLRIVVLGFLEPVLDQNLYYLGMKFTTATYSSAFVNMLPA  122

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             +TF+MA++ R+EK+++KK++  AK+ GT +TVGGAM+MTLYKG  ++F+ S        +
Sbjct  123   VTFIMAMIFRLEKINLKKIQSVAKLAGTAITVGGAMVMTLYKGPIIDFVKSG------GA  176

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
                 T++  +G+ WV G++ L+ + + W+SFFI+Q+ TL+KY A+LSL A +CFMGT+Q 
Sbjct  177   THHGTTTESAGQHWVSGTVALLGSIVGWSSFFILQSFTLKKYPAELSLTAWICFMGTVQD  236

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
               ++F M    S W IG+D  LLAA+Y+GIV S IAYYVQGIV + RGPVFVTAFSPL M
Sbjct  237   AGLSFIMVRDLSAWKIGFDSRLLAASYSGIVCSGIAYYVQGIVSRTRGPVFVTAFSPLCM  296

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             II A +G+F+L EK+++G I+GA++IV GLY V+WG
Sbjct  297   IITAALGAFVLNEKVHLGSILGAIIIVAGLYTVVWG  332



>ref|XP_007019027.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
 gb|EOY16252.1| Nodulin MtN21 /EamA-like transporter family protein [Theobroma 
cacao]
Length=386

 Score =   341 bits (874),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 248/337 (74%), Gaps = 8/337 (2%)
 Frame = -2

Query  1465  MEGKTGC--LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             M  +T C  L N   K KPY+AM+SLQFGYAGM II+ VSL  GMS+++L  YRH  AT 
Sbjct  1     MGDQTPCAALSNTLNKVKPYLAMVSLQFGYAGMYIISMVSLKHGMSNFILATYRHVVATI  60

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA +LERK+RPK+T  IFL+I +LG L PV+DQN YY G+K+T+ T++ A  NMLP
Sbjct  61    VIAPFAFVLERKIRPKMTLPIFLRIVLLGFLEPVLDQNLYYLGMKYTTATYASAFVNMLP  120

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             A+TF++A++ R+EK+++KK+R  AKVVGT +TV GAM+MTLYKG  ++F+ S      + 
Sbjct  121   AVTFILAMIFRLEKINVKKIRSLAKVVGTAITVVGAMVMTLYKGPIIDFIKSG----GAT  176

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQ  752
              +   T SAD  + WV G+I+L+ +   W+SFFI+Q+ TL+KY A+LSL A +CFMG ++
Sbjct  177   HSGTTTESAD--RHWVTGTIMLLGSIFGWSSFFILQSFTLKKYPAELSLTAWICFMGMVE  234

Query  751   SIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLM  572
                V+  M    S W +GWD  LLAA+Y+GIV S IAYYVQG+V+++RGPVFVT+FSPL 
Sbjct  235   GTGVSLIMVRDFSAWKVGWDSRLLAASYSGIVCSGIAYYVQGVVIRERGPVFVTSFSPLC  294

Query  571   MIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MII A +G  +LAEKI+ G I+GA++IV GLY V+WG
Sbjct  295   MIITAALGVVVLAEKIHFGSILGAIIIVSGLYIVVWG  331



>emb|CDX94896.1| BnaC05g07750D [Brassica napus]
Length=370

 Score =   339 bits (869),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 184/323 (57%), Positives = 260/323 (80%), Gaps = 9/323 (3%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TKV L+ GM+H+VLV YR+AFATAAIAPFAL+ +RKVR
Sbjct  3     ESAKPYFAMVCLQFGYAGMNLVTKVVLDGGMNHFVLVAYRNAFATAAIAPFALLSKRKVR  62

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF IF+QIF+L LLGPVIDQN YYAGL+ TSPTF+ A+++++PA+TF+++++ R EK
Sbjct  63    PKMTFPIFMQIFLLALLGPVIDQNLYYAGLRLTSPTFAGAVTSIVPALTFIISIIFRTEK  122

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVR  AKVVGT+V V GAMLM L+K   +NFL S+ I   S S         +G+D
Sbjct  123   VELRKVRFHAKVVGTLVIVVGAMLMILFKSPLINFLRSHLIREASSS---------AGED  173

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             +++ ++ L++A+ +WASFF++QA TL++Y++ LSL  +VCF+GTLQS ++ F ME   S 
Sbjct  174   YLRATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFLGTLQSTSLAFVMEPNLSA  233

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W I +DMNLLA+AYAGI+SSSIAYYVQG++ +++  VFVTAF+PL++IIV+I+   IL +
Sbjct  234   WNIAFDMNLLASAYAGIMSSSIAYYVQGMMTKQKSVVFVTAFNPLIVIIVSIINFIILGQ  293

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             ++Y+GGI+G V+++ G+ AVLWG
Sbjct  294   RLYLGGILGMVILMVGVCAVLWG  316



>ref|XP_010260186.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=390

 Score =   339 bits (870),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 244/327 (75%), Gaps = 6/327 (2%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
               F KAKP++A+I LQ G AGM II K++L+ G++HY  VVYR+  AT  I+PFA+ LER
Sbjct  12    RLFSKAKPFLAVIFLQLGLAGMAIIAKLALDEGLNHYTFVVYRNFIATCVISPFAITLER  71

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRPK+TFTIF +I +LGLL PVIDQN YY+G++ TS TF+ A+ N+LPA+TF+MA +CR
Sbjct  72    KVRPKMTFTIFAKIALLGLLEPVIDQNLYYSGMRITSATFTTAMCNILPALTFLMAFICR  131

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             +EKV IKKVR QAKVVGT+VTVGGAMLMTL KG  +N  W+       + N     +   
Sbjct  132   LEKVKIKKVRSQAKVVGTLVTVGGAMLMTLIKGPVINLPWTK-----GRVNNHGNQTTPI  186

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME-H  722
              +D +KGS+++      W+ F I+QAITLR+Y A+L+L AL+C MG  +   V  A++  
Sbjct  187   HQDPIKGSLMIAAGCFCWSCFIILQAITLREYPAELTLTALICLMGAAEGAVVALALQWG  246

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
             ++S+W+I WD   LAA Y GIV S ++YY+Q ++++KRGPVFVTAFSPL MIIVAI+GSF
Sbjct  247   KSSIWSIHWDAKFLAALYGGIVCSGVSYYIQAVIIKKRGPVFVTAFSPLCMIIVAILGSF  306

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAE+++VG ++GA++IV GLY V+WG
Sbjct  307   ILAEQMFVGSVIGAIVIVVGLYLVVWG  333



>gb|KGN54575.1| hypothetical protein Csa_4G365050 [Cucumis sativus]
Length=374

 Score =   338 bits (867),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 239/323 (74%), Gaps = 4/323 (1%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             QK KPY+AM+SLQFGYAGM IIT + L +GM+HYVL VYRH  AT  I PFA++LERK+R
Sbjct  15    QKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATIVITPFAIVLERKIR  74

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+T  IF ++ +LG L PV+DQN YY GLK TS TF+    N+LPA+TF+MA++ R+E 
Sbjct  75    PKMTLGIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILPAVTFIMALIFRLES  134

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+ KK+R  AKV GT+VT+GGAM+MTLYKG  V+    +  H    S    +SS  + + 
Sbjct  135   VNFKKIRSIAKVAGTLVTIGGAMVMTLYKGPIVDIFHGHGRHAAHNS----SSSESADQH  190

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             WV G+++L+ + + W+ FFI+Q+ TLRKY A+LSL AL+C  G ++   VT  ME   +V
Sbjct  191   WVLGTLMLLGSIVGWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIVTLIMERDFTV  250

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IGWD  LLAA Y G++ S +AYY+QG+V+++RGPVFVT+F+PL MII AI+GS +LAE
Sbjct  251   WVIGWDSRLLAAVYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMIITAILGSIVLAE  310

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             +I++G I+GA+ IV GLY V+WG
Sbjct  311   QIHLGSIIGAIFIVMGLYLVVWG  333



>ref|XP_003566085.1| PREDICTED: WAT1-related protein At5g07050-like [Brachypodium 
distachyon]
Length=408

 Score =   339 bits (870),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 221/268 (82%), Gaps = 6/268 (2%)
 Frame = -2

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
              VRPK+T++IF QIF+L LLGPV+DQNFYY GLK+T PTF+CA+SN+LPAMTFVMA++ R
Sbjct  86    NVRPKMTWSIFFQIFILALLGPVMDQNFYYLGLKYTGPTFACAMSNILPAMTFVMAMIFR  145

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA-D  902
             MEK++++KVRCQAK++GTVVTV GAMLMTLYKG  +    +N         +P+  +A D
Sbjct  146   MEKIELEKVRCQAKILGTVVTVAGAMLMTLYKGPLMELGRTN----RHGGAIPEAPAAVD  201

Query  901   S-GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
             +  ++W  GS+ LI+AT AW+S FI+Q  T+++Y+AQLSL  L+CF+GTLQ+  VTF M+
Sbjct  202   AIAREWFLGSMFLIIATFAWSSLFILQTHTIKQYSAQLSLTTLICFVGTLQATVVTFVMD  261

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              R S+W IG+DMNLLAAAYAG V+SS+AYYVQG+VMQK+GPVF +AF+PL MIIVA+MG+
Sbjct  262   RRPSIWAIGFDMNLLAAAYAGTVTSSLAYYVQGLVMQKKGPVFASAFNPLTMIIVAVMGT  321

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             FIL+EKIY+GG++G ++IV GLYAVLWG
Sbjct  322   FILSEKIYLGGVLGGLVIVIGLYAVLWG  349



>ref|XP_007223359.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
 gb|EMJ24558.1| hypothetical protein PRUPE_ppa007464mg [Prunus persica]
Length=367

 Score =   338 bits (866),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 243/323 (75%), Gaps = 8/323 (2%)
 Frame = -2

Query  1426  KAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRP  1247
             K KPY+AM+SLQFGYAGM II+ VS   GMS++VL VYRH  A   IAPFA +LERK+RP
Sbjct  17    KIKPYLAMVSLQFGYAGMYIISMVSFKHGMSNFVLSVYRHVVAFCVIAPFAFVLERKIRP  76

Query  1246  KITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKV  1067
             ++T  IFL+I +LG L PV+DQN Y+ G+K+TS TF+ A+ N+LPA+TF+MAV  R+E V
Sbjct  77    RMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMAVFFRLESV  136

Query  1066  DIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS-GKD  890
             ++KK+   AKVVGTV+TVGGAM+MTLYKG  V+ +     H  S      TS+ DS  + 
Sbjct  137   NVKKLHSLAKVVGTVITVGGAMVMTLYKGPIVDIIRG---HAHSHG----TSTTDSTNQH  189

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             WV G ++L+ +   WASFFI+Q+ TL+KY A+LSL A +C MG L+   +TFA+E + SV
Sbjct  190   WVAGPLMLLASCGGWASFFIVQSFTLKKYPAELSLTAWICIMGVLEGGVITFAVERKMSV  249

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IGWD  LLA+ Y+GIV S +AYYVQG+V ++RGPVFVTAFSPL MII A +G+ +LAE
Sbjct  250   WVIGWDSRLLASVYSGIVCSGLAYYVQGVVSRERGPVFVTAFSPLCMIITAALGAIVLAE  309

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             K+++G I+GA+ IVFGLY V+WG
Sbjct  310   KVHLGSIIGAIFIVFGLYTVVWG  332



>ref|XP_009344114.1| PREDICTED: WAT1-related protein At4g08300-like [Pyrus x bretschneideri]
Length=363

 Score =   337 bits (865),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 184/350 (53%), Positives = 257/350 (73%), Gaps = 12/350 (3%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             L  F  K KPY+AM+SLQFGY+GM II+ VS   GMSH+VL VYRH  A   IAPFA +L
Sbjct  6     LSLFLIKIKPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAPFAFVL  65

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERK+RP++T  IFL+I +LG L PV+DQN Y+ G+K+TS TF+ A+ N+LPA+TF+MA+ 
Sbjct  66    ERKIRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALC  125

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              R+E V++KK+   AKV+GTV+TVGGAM+MTLYKG  V+ +     H  S ++   +++ 
Sbjct  126   FRLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRG---HSQSHNS---STTE  179

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
              S + W+ G ++L+ +   WASFFI+Q+ TL+KY A+LSL A +C MG L+   +TFA+E
Sbjct  180   SSEQHWIAGPLMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVE  239

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              + SVW IGWD  LLA+ Y+G+V S +AYYVQG+V+++RGPVFVTAFSPL MII A +G+
Sbjct  240   RKLSVWVIGWDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIIPAALGA  299

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKDQN  395
              +LAE++++G I+GA+ IVFGLY V+WG      + +   A + P+KD+N
Sbjct  300   IVLAEQVHLGSIIGAICIVFGLYTVVWG------KSKDPLASSAPLKDEN  343



>ref|XP_008782344.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=406

 Score =   338 bits (868),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 241/327 (74%), Gaps = 4/327 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G  + + KPY+AM+ LQFGYAGM +I+  +L +GMSHYVLVVYR+A A A IAPFAL  E
Sbjct  4     GGVWSRVKPYLAMVFLQFGYAGMYVISVATLKQGMSHYVLVVYRNAIAAAFIAPFALWFE  63

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK RPK+T   FL+I  L LL PV+DQNFYY G K T+ +FS A  N+LPAMTFV AVL 
Sbjct  64    RKARPKMTLCNFLKIMALALLEPVLDQNFYYMGTKNTNASFSSAFYNILPAMTFVNAVLL  123

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             RMEK+DIKK R QAK+ GT+VT+ GA+LM LYKG  V+F+W+       +S+    +   
Sbjct  124   RMEKIDIKKRRSQAKIAGTLVTLVGALLMILYKGPVVDFVWTE----GRRSHHNNNTGNQ  179

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH  722
               K W++G  +L+ +   W++FF++Q+ TL+ Y A+LSL A +C MG +QS AV   MEH
Sbjct  180   DDKHWLEGVFMLLWSCFCWSAFFLLQSHTLKSYPAELSLTAWICVMGMVQSGAVGLVMEH  239

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
              A  W IG+D+ LL AAY+GI+ S IAY+VQGIVM++RGPVFVTAF+PL MIIVAI+GS 
Sbjct  240   TAKPWLIGFDLRLLTAAYSGIMCSGIAYFVQGIVMKERGPVFVTAFNPLCMIIVAILGSI  299

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAE+I +G ++GA +IV GLY+++WG
Sbjct  300   ILAEEITLGRVVGATIIVIGLYSLIWG  326



>ref|XP_010091381.1| Auxin-induced protein 5NG4 [Morus notabilis]
 gb|EXB44371.1| Auxin-induced protein 5NG4 [Morus notabilis]
Length=368

 Score =   336 bits (862),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 241/321 (75%), Gaps = 8/321 (2%)
 Frame = -2

Query  1420  KPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRPKI  1241
             KPY+AM+SLQFGYAGM II+ VS   GMSH+VL VYRH  A   +APFA++LERK+RPK+
Sbjct  2     KPYLAMVSLQFGYAGMYIISMVSFKHGMSHFVLSVYRHVVAFLIMAPFAIVLERKIRPKM  61

Query  1240  TFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKVDI  1061
             T  IFL+I VLG L PV+DQN Y  G+K+TS TF  A+ N+LPA+TF+MA++ R+E V++
Sbjct  62    TLPIFLRIMVLGFLEPVLDQNLYNLGMKYTSATFGAAIVNVLPAITFIMALIFRLETVNV  121

Query  1060  KKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD-WV  884
             KK+   AKV+GTV+TV GAM+MTLYKG  ++       H    SN  +TS+A++ +  WV
Sbjct  122   KKISSLAKVIGTVITVSGAMVMTLYKGPILDIF-----HNHGHSN--ETSTAEASQHHWV  174

Query  883   KGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVWT  704
              G+++LI +   W+SFFI+Q+ TL+KY A+LSL A +C MG L+   VTF  EH   VW 
Sbjct  175   TGTLMLIGSCAGWSSFFIVQSFTLKKYPAELSLTAWICLMGVLEGGIVTFVFEHDMHVWV  234

Query  703   IGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEKI  524
             +GWD  LLAA Y+G++ S IAYYVQG+V+++RGPVFVT+FSPL MII   +G+ +LAE++
Sbjct  235   LGWDSRLLAAVYSGVICSGIAYYVQGMVIRERGPVFVTSFSPLCMIITFALGAIVLAEQV  294

Query  523   YVGGIMGAVLIVFGLYAVLWG  461
             ++G I+GA+ IVFGLY V+WG
Sbjct  295   HLGSIVGAIFIVFGLYTVVWG  315



>ref|XP_008391905.1| PREDICTED: LOW QUALITY PROTEIN: WAT1-related protein At4g08300-like 
[Malus domestica]
 ref|XP_008351484.1| PREDICTED: WAT1-related protein At4g08300-like [Malus domestica]
Length=363

 Score =   336 bits (861),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 179/328 (55%), Positives = 246/328 (75%), Gaps = 6/328 (2%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             L  F  K KPY+AM+SLQFGY+GM II+ VS   GMSH+VL VYRH  A   IAPFA +L
Sbjct  6     LSLFLIKIKPYLAMVSLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAPFAFVL  65

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERKVRP++T  IFL+I +LG L PV+DQN Y+ G+K+TS TF+ A+ N+LPA+TF+MA+ 
Sbjct  66    ERKVRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALC  125

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              R+E V++KK+   AKV+GTV+TVGGAM+MTLYKG  V+ +  +    +   N   T S+
Sbjct  126   FRLETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGH----SHSHNSSTTESS  181

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
             +  + W+ G ++L+ +   WASFFI+Q+ TL+KY A+LSL A +C MG L+   +TFA+E
Sbjct  182   E--QHWIAGPLMLLGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVE  239

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
              + SVW IGWD  LLA+ Y+G+V S +AYYVQG+V+++RGPVFVTAFSPL MII A +G+
Sbjct  240   RKLSVWVIGWDSRLLASVYSGVVCSGMAYYVQGVVIRERGPVFVTAFSPLCMIITAALGA  299

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              +LAE++++G ++GA+ IVFGLY V+WG
Sbjct  300   IVLAEQVHLGSVIGAICIVFGLYTVVWG  327



>gb|KFK42327.1| hypothetical protein AALP_AA2G241800 [Arabis alpina]
Length=390

 Score =   336 bits (862),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 197/323 (61%), Positives = 259/323 (80%), Gaps = 12/323 (4%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM+ LQFGYAGMN++TK  L+RGMSHYVLV YR+AFATAAIAPFA   ERKVR
Sbjct  7     ESAKPYFAMVCLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFAFFSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
              K+TF IF+QI +L LLGPVIDQN YY GLK TSPTFS A+SN++PA+TF++A L RMEK
Sbjct  67    SKMTFPIFMQICLLALLGPVIDQNLYYVGLKLTSPTFSTAVSNIVPAITFILATLFRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+++KVRCQ KVVGT+VTV G++LM  YKG  +NF  S+            T++A +G D
Sbjct  127   VELRKVRCQVKVVGTLVTVVGSILMIFYKGPFINFFQSHL-----------TTTA-TGGD  174

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             ++K ++ L+LA+L+WA +F++QA TL+KY+A LSL  +VCFMGTLQS+A+TF MEH  S 
Sbjct  175   YLKAAVFLLLASLSWALYFVLQASTLKKYSAHLSLSTMVCFMGTLQSLALTFVMEHNPSA  234

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
               I +D NL A+AYAGI+SSSIAYYVQG+++Q++GPVFVTAF+PL+++IV+IM  F+L +
Sbjct  235   LNISFDTNLFASAYAGIMSSSIAYYVQGLMIQRKGPVFVTAFNPLVVVIVSIMSFFVLGQ  294

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
              IY+GG++G V++  G+YAVLWG
Sbjct  295   GIYLGGVVGVVVLTVGVYAVLWG  317



>ref|XP_010253282.1| PREDICTED: WAT1-related protein At2g39510-like [Nelumbo nucifera]
Length=382

 Score =   335 bits (859),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 247/327 (76%), Gaps = 8/327 (2%)
 Frame = -2

Query  1435  FFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERK  1256
              F KAKP++A+I LQ G AGM II K++L++G+SHY  VVYR+A AT  IAPFA+ LERK
Sbjct  14    LFNKAKPFLAVIFLQLGLAGMAIIAKIALDQGLSHYTFVVYRNAVATCVIAPFAITLERK  73

Query  1255  VRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRM  1076
             VRPK+T+++F +I +LGLL PVIDQN YYAG+ +T+ TF+ A+ N+LPA+TF++A + R+
Sbjct  74    VRPKMTYSVFAKIALLGLLEPVIDQNLYYAGMSYTTATFTAAMCNILPALTFLLAFVLRL  133

Query  1075  EKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWS-NFIHPTSKSNVPQTSSADS  899
             EKV+IK VR QAKVVGT+VTVGGAMLMTL KG  ++  W+   ++ TS++  P       
Sbjct  134   EKVNIKNVRSQAKVVGTLVTVGGAMLMTLIKGPTMDLPWTKGTVNNTSQTGHPVQ-----  188

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME-H  722
              +D +KG++++      W+ F I+QAITL+ Y A LSL AL+CFMGT++  AV  AM+  
Sbjct  189   -QDPIKGALMIATGCFCWSCFIILQAITLKAYPAGLSLTALLCFMGTIEGAAVALAMQWG  247

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               S W I WD   LAA Y GI+ S +AYYVQG++M++RGPVFVTAFSPL MIIVAI+GSF
Sbjct  248   NTSSWAIHWDAKFLAAVYGGIMCSGVAYYVQGVIMKERGPVFVTAFSPLCMIIVAILGSF  307

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             ILAE++Y+G ++GA +IV GLY V+WG
Sbjct  308   ILAEEMYLGSVIGATVIVVGLYLVVWG  334



>ref|XP_009340894.1| PREDICTED: WAT1-related protein At1g21890-like [Pyrus x bretschneideri]
Length=363

 Score =   334 bits (857),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 244/326 (75%), Gaps = 8/326 (2%)
 Frame = -2

Query  1435  FFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERK  1256
             F  K KPY+AMISLQFGY+GM II+ VS   GMSH+VL VYRH  A   IAPFA  LERK
Sbjct  9     FLIKIKPYLAMISLQFGYSGMYIISMVSFKHGMSHFVLSVYRHVVAFCVIAPFAFFLERK  68

Query  1255  VRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRM  1076
             +RP++T  IFL+I +LG L PV+DQN Y+ G+K+TS TF+ A+ N+LPA+TF+MA+   +
Sbjct  69    IRPRMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMALCFGL  128

Query  1075  EKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSG  896
             E V++KK+   AKV+GTV+TVGGAM+MTLYKG  V+ +  +       S+   +S+  SG
Sbjct  129   ETVNVKKLHSLAKVIGTVITVGGAMIMTLYKGPIVDIIRGH-------SHSHNSSTTGSG  181

Query  895   KD-WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHR  719
             +  W+ G ++LI +   WASFFI+Q+ TL+KY A+LSL A +C MG L+   +TFA+E +
Sbjct  182   EQHWIAGPLMLIGSCGGWASFFILQSFTLKKYPAELSLTAWICLMGMLEGGVITFAVERK  241

Query  718   ASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFI  539
              SVW IGWD  LLA+ Y+G+V S IAYYVQG+V+++RGPVFVTAFSPL MII A +G+ +
Sbjct  242   LSVWVIGWDSRLLASVYSGVVCSGIAYYVQGVVIRERGPVFVTAFSPLCMIITAGLGAIV  301

Query  538   LAEKIYVGGIMGAVLIVFGLYAVLWG  461
             LAE++++G I+GA+ IVFGLY V+WG
Sbjct  302   LAEQVHLGSIIGAICIVFGLYTVVWG  327



>ref|XP_010534673.1| PREDICTED: WAT1-related protein At1g21890 isoform X1 [Tarenaya 
hassleriana]
Length=414

 Score =   336 bits (861),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 176/329 (53%), Positives = 244/329 (74%), Gaps = 5/329 (2%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
              F ++ KPY+AM+S+QFGYAGM IIT VSL  GM+HYVL VYRHA AT  IAPFAL+ ER
Sbjct  31    GFIKRVKPYVAMVSMQFGYAGMYIITMVSLKHGMNHYVLAVYRHAIATLVIAPFALLYER  90

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             K+RPK+T  +FL+I +LG + PV+DQN YY G+ +TS TF+ A +N+LPA+TF+MA++ R
Sbjct  91    KIRPKMTVGVFLRIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFIMALIFR  150

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS---  908
             +E V++KKVR  AKVVGT +TV GA+ MTLYKG  ++F+  NF          +  +   
Sbjct  151   LESVNMKKVRSIAKVVGTAITVSGALFMTLYKGPIIDFI--NFGSGHGGGRGGEGGNHRG  208

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
             A   K W+ G+++L+  T  W++FFI+Q++TL+KY A+LSL AL+C MGTL+  AV+  M
Sbjct  209   AAVDKHWIPGTLMLLGRTFGWSAFFILQSLTLKKYPAELSLTALICLMGTLEGAAVSLVM  268

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E   S W IG+D NL+AAAY+G+V S +AYYVQG+VM++RGPVFV  F+PL ++I A +G
Sbjct  269   ERDLSAWKIGFDTNLVAAAYSGVVCSGVAYYVQGVVMKERGPVFVATFNPLCVVITAALG  328

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              F+L+E I++G ++G V I+ GLY V+WG
Sbjct  329   VFVLSESIHLGSVIGTVFIIVGLYTVVWG  357



>ref|XP_011069552.1| PREDICTED: WAT1-related protein At1g21890-like [Sesamum indicum]
Length=384

 Score =   335 bits (858),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 243/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
             F K KPY+AM++LQFGYAGM IIT VSL RG SH++LVVYRHA AT   APFA  LE+K+
Sbjct  14    FNKLKPYLAMVALQFGYAGMYIITLVSLKRGFSHWILVVYRHAVATLVFAPFAYFLEKKI  73

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T +IFL+I VL  L PV+DQN YY G+++TS TF+ A+ N+LPA+TF+MAV+ R+E
Sbjct  74    RPKMTKSIFLKIVVLAFLEPVLDQNLYYVGMQYTSATFASAMVNVLPAITFIMAVIFRLE  133

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
              +++KK+   AKVVGT++TV GAMLMTLYKG  VN LW  + H  S       ++ D  +
Sbjct  134   TINLKKISSIAKVVGTLITVTGAMLMTLYKGPVVNILW--YSHAGSHHKAAAAAATD--Q  189

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
               V G+I+LI   + W++FFI+Q  TL++Y A+LSL +L+C MG ++   V   ME R S
Sbjct  190   HLVTGTIMLISCIVGWSAFFILQNKTLKEYPAELSLTSLICLMGFVEGGIVGVIMERRKS  249

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+D  LLAAAY+GIV S IAYY+Q IV + RGPVFVTAFSPL MII A++G+ +LA
Sbjct  250   AWAIGFDSRLLAAAYSGIVCSGIAYYMQSIVNKSRGPVFVTAFSPLSMIITAVLGAIVLA  309

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E++++G ++GAV+IV GLY+V+WG
Sbjct  310   EQVHLGSLIGAVIIVSGLYSVVWG  333



>ref|XP_008369847.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
 ref|XP_008369848.1| PREDICTED: WAT1-related protein At2g37460-like [Malus domestica]
Length=363

 Score =   334 bits (856),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 249/324 (77%), Gaps = 7/324 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKP+ A++ LQFG AGM+I++K +LN+GMS+YVLVVYRH  ATA +APFA+IL++KVR
Sbjct  8     KAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVILDKKVR  67

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+T +IF++I +L LL PV+DQN Y+ G+K+T+ TF+ A+ N+LPA+TFVMA + R+EK
Sbjct  68    PKMTLSIFIKIMLLALLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAWVLRLEK  127

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V++K +R Q+K+VGTV TV GAM+MTL KG  ++  W      T  S+   TS+A S +D
Sbjct  128   VNLKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFW------TRASHEQHTSAATSLQD  181

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH-RAS  713
              +KGS+++ +    WA F I+QAITL+ Y A+LSL A +C +GTL+  AV   ME   A+
Sbjct  182   SIKGSLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAVALVMERGNAA  241

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
             VW+I WD  LLAA+Y+GI  S +AYY+QG+VM+ RGPVFVTAFSPL M+IVA+M SFIL 
Sbjct  242   VWSIKWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILR  301

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E++++G ++GAV+I+ GLY V+WG
Sbjct  302   EQMFLGRLLGAVVIIAGLYLVVWG  325



>ref|XP_009623147.1| PREDICTED: WAT1-related protein At4g08300 isoform X2 [Nicotiana 
tomentosiformis]
Length=394

 Score =   335 bits (858),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 250/345 (72%), Gaps = 8/345 (2%)
 Frame = -2

Query  1489  ERSE*QIEMEGK--TGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVV  1316
             ER E  +EM  +  +G  G+F  K KPY+AM+SLQFGYAGM I+T +   RGMSH++LVV
Sbjct  2     ERREGDLEMADQMFSGAFGSFLNKVKPYLAMVSLQFGYAGMYIVTMMCFKRGMSHWILVV  61

Query  1315  YRHafataaiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFS  1136
             YRHAFAT A+APFA++LERK+RPK+T  +F++I  LG L PVIDQN YY GLK T+ T++
Sbjct  62    YRHAFATVAVAPFAIVLERKIRPKMTLRVFIKILALGFLEPVIDQNLYYVGLKSTTATYA  121

Query  1135  CALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWS  956
              A  N+LPA+TF++AV+ R+EKV++KK    AKV+GT +TV GAM+MTLYKG   N +  
Sbjct  122   SAFVNLLPAVTFILAVIFRIEKVNLKKKSSMAKVIGTAITVVGAMVMTLYKGPMFNLV--  179

Query  955   NFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIAL  776
                 P S+      ++A + ++WV G+I LI   + W+ FFI+Q++TL++Y A+LSL A 
Sbjct  180   ----PHSRGGSHPAAAAATPENWVAGTIELISCIVGWSGFFIVQSMTLKEYPAELSLAAW  235

Query  775   VCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVF  596
             VC MG ++   V   ME   + W IG+D  LLAAAY+GIV S IAYYVQ IV + +GPVF
Sbjct  236   VCVMGIVEGGIVALIMERDWNAWKIGFDARLLAAAYSGIVCSGIAYYVQSIVNKVKGPVF  295

Query  595   VTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VTAFSPL M+I +++ + ILAE +++G  +GA++IV GLY+V+WG
Sbjct  296   VTAFSPLSMVITSVLAAIILAESVHLGSCIGAIIIVMGLYSVVWG  340



>ref|XP_008802062.1| PREDICTED: WAT1-related protein At1g21890-like [Phoenix dactylifera]
Length=373

 Score =   333 bits (855),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 179/329 (54%), Positives = 243/329 (74%), Gaps = 5/329 (2%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
              LG  + +AKPY+AM+ LQFG++GM +I+  +L RGMSHYVLVVYR+A A A I PFAL 
Sbjct  2     ALGGVWTRAKPYMAMVFLQFGFSGMYVISVATLKRGMSHYVLVVYRNAIAAAVILPFALW  61

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
              ERKVRPK+T + FL+I  LGLL PV+DQN YY G K T+ +FS AL N+LPA+TF+ A+
Sbjct  62    FERKVRPKMTVSNFLKIMALGLLEPVLDQNLYYMGAKNTNASFSSALYNVLPAVTFLSAI  121

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + RMEK+++KK R QAK++GT+VTV GA+LM LYKG  V F+W+       +S+   T+ 
Sbjct  122   VLRMEKINVKKRRSQAKIIGTLVTVVGALLMILYKGPVVEFIWTK-----GRSHHNNTAG  176

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
             +     W+ G  +L+ +  +W++FFI+Q+ TL+ Y A+LSL   +CFMG  QS AV   M
Sbjct  177   SQDDSHWLAGVFMLLGSCFSWSAFFILQSNTLKSYPAELSLTVWICFMGAAQSGAVALVM  236

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E     W IG+DM LL AAY+G++ S IAYYVQG VM++RGPVFVTAF+PL MIIVA++G
Sbjct  237   ERSVKPWLIGFDMRLLTAAYSGVMCSGIAYYVQGKVMKERGPVFVTAFNPLCMIIVAVLG  296

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             S ILAE+I +G ++GA++IV GLY+++WG
Sbjct  297   SIILAEEITLGRLIGAIIIVIGLYSLIWG  325



>ref|XP_004290852.1| PREDICTED: auxin-induced protein 5NG4-like [Fragaria vesca subsp. 
vesca]
Length=368

 Score =   333 bits (854),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 244/325 (75%), Gaps = 6/325 (2%)
 Frame = -2

Query  1435  FFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERK  1256
             F +K KPY+AM+SLQFGYAGM II+ VS   GMSH+VL VYRH  A   IAPFAL+LERK
Sbjct  14    FLKKIKPYLAMVSLQFGYAGMYIISMVSFKHGMSHFVLSVYRHVVALCVIAPFALVLERK  73

Query  1255  VRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRM  1076
             +RP++T  IFL+I +LG L PV+DQN Y+ G+K+TS TF+ A+ N+LPA+TF++A+  R+
Sbjct  74    IRPRMTLPIFLRIMLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFILALCFRL  133

Query  1075  EKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSG  896
             E V++KK+   AKV+GTVVT+ GAM+MTLYKG  ++ +  +       ++   +S+  S 
Sbjct  134   ETVNVKKLHSLAKVIGTVVTLSGAMIMTLYKGPIIDIVRGH------SNSAQSSSTESSD  187

Query  895   KDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRA  716
             + W+ G ++LI +   WASFFI+Q+ TL+KY AQLSL A +C MG L+   VT  ME   
Sbjct  188   QHWIAGPLMLIASCGGWASFFILQSFTLKKYPAQLSLTAWICVMGVLEGGVVTLVMERNM  247

Query  715   SVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFIL  536
             SVW IGWD  LLA+ Y+G++ S +AYYVQG+V ++RGPVFVT+FSPL MII A++G+ +L
Sbjct  248   SVWVIGWDSRLLASVYSGVICSGLAYYVQGVVNRERGPVFVTSFSPLCMIITAVLGAIVL  307

Query  535   AEKIYVGGIMGAVLIVFGLYAVLWG  461
             AE++++G I+GA+LIVFGLY V+WG
Sbjct  308   AEQVHLGSILGAILIVFGLYTVVWG  332



>ref|XP_007019030.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
 gb|EOY16255.1| Nodulin MtN21 /EamA-like transporter family protein, putative 
[Theobroma cacao]
Length=383

 Score =   333 bits (855),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 244/322 (76%), Gaps = 6/322 (2%)
 Frame = -2

Query  1426  KAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRP  1247
             +AK Y AMI LQFG+AGM +IT  SL +GM+HY+L VYRH  AT  IAPFAL+LERK+RP
Sbjct  16    RAKSYSAMIFLQFGFAGMYVITMFSLQQGMNHYILAVYRHLVATIVIAPFALVLERKIRP  75

Query  1246  KITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKV  1067
             K+T  +FL+I VLG L PVIDQN YY G+K+T+ T + A  N+LPA+TFVMA++ R+E+V
Sbjct  76    KLTLPVFLRILVLGFLEPVIDQNVYYLGMKYTTATLASATVNVLPAITFVMALIFRLERV  135

Query  1066  DIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDW  887
             ++KKV   AK++GTV+ V GA++MTLYKG A+NF     I      +   T++A++ K W
Sbjct  136   NLKKVHSIAKIIGTVIMVPGAVIMTLYKGPAINF-----IKLQGGGHHGATNAAEA-KHW  189

Query  886   VKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVW  707
             V G+++L+     W+ F+I+Q+ TLR Y A+LSL AL+CF+GT+   AV+FA+E   + W
Sbjct  190   VAGTLMLLARCWGWSGFYILQSFTLRMYPAELSLTALICFIGTIGGAAVSFAVERDMNAW  249

Query  706   TIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEK  527
              IGWD +LLAA Y+G+V S IAYY QG+V++++GPVFVTAFSPL MII A +GSF+LAEK
Sbjct  250   KIGWDASLLAAVYSGVVCSGIAYYAQGVVLREQGPVFVTAFSPLCMIITAALGSFLLAEK  309

Query  526   IYVGGIMGAVLIVFGLYAVLWG  461
             +++G I+G V+I+ GLY VLWG
Sbjct  310   VHLGSIIGTVIIICGLYTVLWG  331



>gb|KHG10291.1| Auxin-induced 5NG4 [Gossypium arboreum]
Length=384

 Score =   333 bits (853),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 178/330 (54%), Positives = 249/330 (75%), Gaps = 10/330 (3%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             L N + K KP++A+ISLQFGYAGM II+ VSL  GMS+++L  YRH  AT  IAPFA +L
Sbjct  10    LSNVWNKVKPFLAIISLQFGYAGMYIISLVSLKHGMSNFILCTYRHVVATIIIAPFAFVL  69

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERK+RPK+T  IFL+I VLGLL PV+DQN YY G+  T+ T+S A  NMLPA+TF++A++
Sbjct  70    ERKIRPKMTLPIFLRIVVLGLLEPVLDQNLYYLGMMKTTATYSSAFVNMLPAVTFILAMI  129

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI--HPTSKSNVPQTS  911
              R+EK+++KK+   AK++GT +TV GAM+MTLYKG  V+F+ S  +  H T+      T 
Sbjct  130   FRLEKINLKKIYSVAKIIGTAITVIGAMVMTLYKGPIVDFIKSGGVAHHGTT------TE  183

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             SAD  K WV G+I+L+ + L+W+S+FI+Q+ TL+ Y A+LSL A +C MGT+++   +  
Sbjct  184   SAD--KHWVTGTIMLLASILSWSSYFILQSFTLKMYPAELSLTAWICLMGTIENAVASLI  241

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             M    S W +GWD  LLAA+Y+GIV S IAYYVQG+V+++RGPVF+T+FSPL MII A +
Sbjct  242   MVRGISAWKLGWDSRLLAASYSGIVCSGIAYYVQGVVIRERGPVFLTSFSPLCMIITAAL  301

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             G+F+L+E++++G I+GA++IV GLY V+WG
Sbjct  302   GTFVLSEQVHLGSILGAIIIVSGLYTVVWG  331



>ref|XP_009377106.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
 ref|XP_009377107.1| PREDICTED: WAT1-related protein At2g37460-like [Pyrus x bretschneideri]
Length=363

 Score =   332 bits (851),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 247/324 (76%), Gaps = 7/324 (2%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKP+ A++ LQFG AGM+I++K +LN+GMS+YVLVVYRH  ATA +APFA+IL++KVR
Sbjct  8     KAAKPFFAVVFLQFGLAGMDILSKAALNQGMSNYVLVVYRHVVATAVVAPFAVILDKKVR  67

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+T +IF++I +LGLL PV+DQN Y+ G+K+T+ TF+ A+ N+LPA+TFVMA + R+EK
Sbjct  68    PKMTLSIFIKIMLLGLLEPVLDQNLYFMGMKYTTATFAAAMCNILPALTFVMAWVLRLEK  127

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V +K +R Q+K+VGTV TV GAM+MTL KG  ++  W+   H         TS+A S +D
Sbjct  128   VKLKSIRSQSKLVGTVATVAGAMIMTLVKGPLLHLFWTRPGHEQ------HTSAATSLQD  181

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH-RAS  713
              +KGS+++ +    WA F I+QAITL+ Y A+LSL A +C +GTL+  A    ME   A+
Sbjct  182   SIKGSLMITVGCFCWACFMILQAITLKTYPAELSLSAWICALGTLEGTAAALVMERGNAA  241

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
             VW+I WD  LLAA+Y+GI  S +AYY+QG+VM+ RGPVFVTAFSPL M+IVA+M SFIL 
Sbjct  242   VWSIKWDTKLLAASYSGIFCSGLAYYIQGVVMKYRGPVFVTAFSPLSMVIVAVMSSFILR  301

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E++++G ++GAV+I+ GLY V+WG
Sbjct  302   EQMFLGRLLGAVVIIAGLYLVVWG  325



>emb|CDY00403.1| BnaC07g14230D [Brassica napus]
Length=379

 Score =   332 bits (851),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 238/327 (73%), Gaps = 7/327 (2%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G    + KPY+AMIS+QFGYAGM IIT VSL  GM+HY+L VYRHA AT  IAPFAL  E
Sbjct  8     GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPFALFHE  67

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK RPK+TF IFLQI +LG + PV+DQN YY G+ +TS TF+ A +N+LPA+TFV+A++ 
Sbjct  68    RKTRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIF  127

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSAD  902
             R+E V+ KKVR  AKV+GTV+TV GA+LMTLYKG  ++F+   F  P   +     +SA 
Sbjct  128   RLESVNFKKVRSIAKVIGTVITVSGALLMTLYKGPIIDFI--KFGGPHGGA-----ASAA  180

Query  901   SGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH  722
               K WV G+++L+  T  WA FFI+Q+ TL++Y A+LSL AL+C MGTL+  AV+     
Sbjct  181   LDKHWVPGTLMLLGRTFGWAGFFILQSFTLKEYPAELSLTALICLMGTLEGTAVSLVTVR  240

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               S W IG+D NL AAAY+G++ S +AYYVQG+VM++RGPVFV  F+PL ++I A +G  
Sbjct  241   DLSAWKIGFDSNLFAAAYSGVICSGVAYYVQGVVMRERGPVFVATFNPLCVVITAALGVV  300

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +L+E I++G ++G + I+ GLY V+WG
Sbjct  301   VLSESIHLGSVIGTIFIIVGLYTVVWG  327



>ref|XP_009623146.1| PREDICTED: WAT1-related protein At4g08300 isoform X1 [Nicotiana 
tomentosiformis]
Length=406

 Score =   333 bits (853),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 189/365 (52%), Positives = 259/365 (71%), Gaps = 8/365 (2%)
 Frame = -2

Query  1489  ERSE*QIEMEGK--TGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVV  1316
             +R E  +EM  +  +G  G+F  K KPY+AM+SLQFGYAGM I+T +   RGMSH++LVV
Sbjct  14    KRREGDLEMADQMFSGAFGSFLNKVKPYLAMVSLQFGYAGMYIVTMMCFKRGMSHWILVV  73

Query  1315  YRHafataaiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFS  1136
             YRHAFAT A+APFA++LERK+RPK+T  +F++I  LG L PVIDQN YY GLK T+ T++
Sbjct  74    YRHAFATVAVAPFAIVLERKIRPKMTLRVFIKILALGFLEPVIDQNLYYVGLKSTTATYA  133

Query  1135  CALSNMLPAMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWS  956
              A  N+LPA+TF++AV+ R+EKV++KK    AKV+GT +TV GAM+MTLYKG   N +  
Sbjct  134   SAFVNLLPAVTFILAVIFRIEKVNLKKKSSMAKVIGTAITVVGAMVMTLYKGPMFNLV--  191

Query  955   NFIHPTSKSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIAL  776
                 P S+      ++A + ++WV G+I LI   + W+ FFI+Q++TL++Y A+LSL A 
Sbjct  192   ----PHSRGGSHPAAAAATPENWVAGTIELISCIVGWSGFFIVQSMTLKEYPAELSLAAW  247

Query  775   VCFMGTLQSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVF  596
             VC MG ++   V   ME   + W IG+D  LLAAAY+GIV S IAYYVQ IV + +GPVF
Sbjct  248   VCVMGIVEGGIVALIMERDWNAWKIGFDARLLAAAYSGIVCSGIAYYVQSIVNKVKGPVF  307

Query  595   VTAFSPLMMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaia  416
             VTAFSPL M+I +++ + ILAE +++G  +GA++IV GLY+V+WGK KE K  E  +   
Sbjct  308   VTAFSPLSMVITSVLAAIILAESVHLGSCIGAIIIVMGLYSVVWGKSKEGKGNETGKDQE  367

Query  415   EPVKD  401
              PV D
Sbjct  368   LPVVD  372



>ref|XP_008219662.1| PREDICTED: WAT1-related protein At1g21890-like [Prunus mume]
Length=381

 Score =   332 bits (850),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 180/330 (55%), Positives = 235/330 (71%), Gaps = 6/330 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G L  F  K KPY+AMISLQFGYAGM II+ V L RGM+H+VL VYRH  A   IAPFAL
Sbjct  8     GKLALFLYKIKPYLAMISLQFGYAGMYIISMVGLKRGMNHFVLAVYRHLIAVVVIAPFAL  67

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERK+RPK+T  IFL+I VLG L PV  QN Y+ G+ +TS TF+ A +N+LPA+TF+ A
Sbjct  68    VLERKIRPKLTLPIFLRIMVLGFLEPVFAQNLYFVGMTYTSATFASATANILPAITFIFA  127

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             +L R+EK++ KK+   AKV+GTV+TV GAM+MT YKG  V  +               T+
Sbjct  128   LLFRLEKINFKKIPSVAKVIGTVITVMGAMVMTWYKGPIVEIIKGQ------TQGHHNTT  181

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             +  + + W+ G+ +L+     W+ FFI+Q+ TL+ Y A+LSL AL+C MG L+    TF 
Sbjct  182   ALSAEQHWITGTFMLLARCCGWSGFFILQSFTLKLYPAELSLTALICLMGALEGAVATFI  241

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             +EH  SVW IGWD  L+AA Y+G+V S IAYYVQGIVM+++GPVFVTAFSPL MII A +
Sbjct  242   LEHNMSVWVIGWDSRLIAAGYSGVVCSGIAYYVQGIVMKEQGPVFVTAFSPLAMIITAAL  301

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              + ILAE+I++G I+G +LIV GLYAV+WG
Sbjct  302   AAVILAEQIHLGSILGTILIVIGLYAVVWG  331



>ref|XP_008444144.1| PREDICTED: WAT1-related protein At1g44800-like [Cucumis melo]
Length=374

 Score =   331 bits (848),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 239/323 (74%), Gaps = 4/323 (1%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             QK KPY+AM+SLQFGYAGM IIT + L +GM+HYVL VYRH  AT  I PFA++LERK+R
Sbjct  15    QKIKPYLAMVSLQFGYAGMYIITMLCLKKGMNHYVLAVYRHVVATIVIVPFAIVLERKIR  74

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+T  IF ++ +LG L PV+DQN YY GLK TS TF+    N+LPA+TF+MA++ R+E 
Sbjct  75    PKMTLAIFARVLLLGFLEPVLDQNLYYVGLKLTSATFTSVTINILPAVTFIMALIFRLES  134

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V+ KK+R  AKVVGT+VT+GGAM+MTLYKG  V+     F      +    +SS  + + 
Sbjct  135   VNFKKIRSIAKVVGTLVTIGGAMVMTLYKGPIVDI----FHGHGRHAAHHSSSSESADQH  190

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
             WV G+++L+ + + W+ FFI+Q+ TLRKY A+LSL AL+C  G ++   VT  ME   SV
Sbjct  191   WVLGTLMLLGSIVGWSGFFILQSFTLRKYPAELSLTALICVAGAVEGSIVTLIMERDFSV  250

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IGWD  LLAA Y G++ S +AYY+QG+V+++RGPVFVT+F+PL MII AI+GS +LAE
Sbjct  251   WVIGWDSRLLAAVYTGVICSGLAYYIQGVVIRERGPVFVTSFTPLCMIITAILGSIVLAE  310

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             +I++G I+GA+ IV GLY V+WG
Sbjct  311   QIHLGSIIGAIFIVMGLYLVVWG  333



>gb|ACD56621.1| putative nodulin-like protein [Gossypioides kirkii]
Length=382

 Score =   331 bits (849),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 246/337 (73%), Gaps = 8/337 (2%)
 Frame = -2

Query  1465  MEGKT--GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             M G+T    L N   K KPY++M+SLQFGYAGM II+ VSL  GMS+++L  YRH  AT 
Sbjct  1     MGGQTPYAALRNMLNKVKPYLSMVSLQFGYAGMYIISMVSLKHGMSNFILATYRHVAATV  60

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              IAPFA +LERKVRPK+T  +FL+I +LG + PV+DQN Y+ G+K+TS T++ A  N++P
Sbjct  61    VIAPFAFVLERKVRPKMTLPVFLRIVILGFIEPVLDQNLYFLGMKYTSATYASAFLNIVP  120

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             A+TF+MA++ R+EK+++KK+R  AK++GT VTV GAM+MTLYKG  ++F+ S      + 
Sbjct  121   AVTFIMAMIFRLEKINVKKIRSVAKIIGTAVTVMGAMVMTLYKGPIIDFVKSG----GAT  176

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQ  752
              +   T SAD  K  V G+I+L+ +   W+SFFI+Q+ TL+KY A+LSL A +CFMG L+
Sbjct  177   HHGTTTESAD--KHRVAGTIMLLGSVFCWSSFFILQSFTLKKYPAELSLTAWICFMGMLE  234

Query  751   SIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLM  572
                V+  M      W IGW+  LLAA Y+G+V S I YYVQG+V+++RGPVFVT+FSPL 
Sbjct  235   GAGVSLIMVRDLRAWKIGWNSRLLAATYSGVVCSGITYYVQGVVIRERGPVFVTSFSPLC  294

Query  571   MIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MII A +G+ ILAEK+++G I+GA++IV GLY V+WG
Sbjct  295   MIITAALGAIILAEKLHLGSILGAIIIVLGLYTVVWG  331



>ref|XP_006661686.1| PREDICTED: WAT1-related protein At4g08290-like [Oryza brachyantha]
Length=364

 Score =   330 bits (847),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/337 (54%), Positives = 246/337 (73%), Gaps = 12/337 (4%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             +E+ GK       ++KA PY+AM+ LQFG+AG+ +I+  SL +GMSHYVLVVYR+A A  
Sbjct  1     MELTGK-------WRKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAV  53

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              +APFAL  ERK RPK+T ++F +I  LGLL PV+DQNF+Y G K TS +FS AL+N+LP
Sbjct  54    VMAPFALWFERKTRPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILP  113

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             A+TFV A++ RME++ IK+ R QAK+VGT+VTVGGAMLM L+KG  +NF W+      + 
Sbjct  114   AVTFVNAIILRMERISIKERRSQAKIVGTLVTVGGAMLMILFKGPVINFPWTK----NAN  169

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQ  752
              NV   S  +SG  W+ G  +++L+   W++FFI+Q+ TLR Y A+LSL  L+C MG  Q
Sbjct  170   YNVADNSGQNSGH-WLMGIFMILLSCFCWSAFFILQSYTLRNYPAELSLTTLICAMGVAQ  228

Query  751   SIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLM  572
             S A+   ME     W IG+DM L  A Y+GI+ S +AYYVQG+V+++RGPVFVTAFSPL 
Sbjct  229   SGAIALVMERDMKAWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLC  288

Query  571   MIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MIIV I+GSFIL+E + +G ++GA++IV GLYA++WG
Sbjct  289   MIIVTILGSFILSEVVTLGRVIGAIIIVVGLYALIWG  325



>ref|XP_010999364.1| PREDICTED: WAT1-related protein At4g08300-like [Populus euphratica]
Length=387

 Score =   331 bits (849),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/329 (56%), Positives = 239/329 (73%), Gaps = 8/329 (2%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             CLG   +K K Y+AM+SLQFGYAGM IIT VSL  GMSHY+L VYRH  A   IAPFA +
Sbjct  11    CLG--LKKVKHYLAMVSLQFGYAGMYIITMVSLKHGMSHYILAVYRHVVAALVIAPFAFV  68

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERK+RPK+T +IFL+I VLG L PV+DQN YY G+K+TS TFS A +N LPA+TF+MA+
Sbjct  69    LERKIRPKMTLSIFLRIMVLGFLEPVLDQNLYYLGMKYTSATFSSATTNALPAITFLMAL  128

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
               R+E V+ KK+   AK +GTV+TV GAM+MTLYKG  ++F+ S   H  +      TS+
Sbjct  129   CFRLETVNFKKLHSAAKAIGTVITVTGAMVMTLYKGPIIDFIRS---HGAAHHG---TSN  182

Query  907   ADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAM  728
                 +  + G+++L+ +  AWA FFI+Q+ TL+KY A+LSL AL+C MG ++  AV+  M
Sbjct  183   ESGNQHRLTGTLMLLGSCCAWAGFFILQSFTLKKYPAELSLTALICVMGVVEGAAVSLVM  242

Query  727   EHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMG  548
             E     W IG+D  LLAAAY+G+V S IAYYVQG V ++RG VFVT+FSPL MI  A +G
Sbjct  243   ERDMDAWKIGFDSRLLAAAYSGVVCSGIAYYVQGEVKRERGLVFVTSFSPLCMITTAALG  302

Query  547   SFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             S +LAE+I++G I+GA LIV+GLY V+WG
Sbjct  303   SIVLAEQIHLGSIIGAFLIVWGLYTVVWG  331



>gb|EEC66707.1| hypothetical protein OsI_33030 [Oryza sativa Indica Group]
Length=364

 Score =   330 bits (846),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 241/324 (74%), Gaps = 5/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
             ++KA PY+AM+ LQFG+AG+ +I+  SL +GMSHYVLVVYR+A A   +APFAL  ERK 
Sbjct  7     WRKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKT  66

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T ++F +I  LGLL PV+DQNF+Y G K TS +FS AL+N+LPA+TFV A++ RME
Sbjct  67    RPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILRME  126

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             ++ IK+ R QAK+ GT++TVGGAMLM L+KG  +NF W+      +  N+  +S  ++G+
Sbjct  127   RISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTK----NANQNISDSSDHNNGR  182

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
              W+ G  +++L+   W++FFI+Q+ TLR Y A+LSL  L+C MG  QS AV   ME    
Sbjct  183   -WLMGIFMILLSCFCWSAFFILQSYTLRSYPAELSLTTLICAMGVAQSGAVALVMERDIK  241

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+DM L  A Y+GI+ S +AYYVQG+V+++RGPVFVTAFSPL MIIV I+GSFIL 
Sbjct  242   AWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILC  301

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E + +G ++GA++IV GLYA++WG
Sbjct  302   EVVTLGRVIGAIIIVVGLYALIWG  325



>ref|XP_010544709.1| PREDICTED: WAT1-related protein At4g08290 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010544717.1| PREDICTED: WAT1-related protein At4g08290 isoform X2 [Tarenaya 
hassleriana]
Length=389

 Score =   330 bits (847),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 239/330 (72%), Gaps = 3/330 (1%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G L   F+K KPY+ MI LQFG AGM II   +L+RG + YVL+ YR+A A   ++PFAL
Sbjct  2     GGLSEIFEKWKPYVLMICLQFGGAGMYIILMATLSRGQNRYVLIFYRNAVAALVLSPFAL  61

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
               ERKVRPK+TFT+FLQI  LG L P++DQ F Y G+K TS +++ A+ N LP++TFV+A
Sbjct  62    FFERKVRPKMTFTVFLQIMALGFLEPILDQGFGYLGMKLTSASYTSAIMNALPSITFVIA  121

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             ++ R EKV+IK+VR QAKV+GT+VT+GGA+ MTLYKG  V   WS+        N   T+
Sbjct  122   LVLRQEKVNIKEVRSQAKVIGTLVTLGGALAMTLYKGPVVPLPWSDQNLDGHNGN---TN  178

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
                    W+ G++L++L  +AW+ F+++Q+IT++KY A+LSL AL+CF G  QS+AV   
Sbjct  179   DTQDHAHWIAGTMLILLGCVAWSGFYVLQSITIKKYPAELSLSALICFAGAAQSLAVALV  238

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             ME R+S W +GWD  L A  Y GI+SS + YYVQG+VM+ RGPVFVTAF+PL M++VA++
Sbjct  239   MERRSSGWAVGWDARLFAPLYTGIISSGLTYYVQGMVMKTRGPVFVTAFNPLCMVLVAVL  298

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              SFIL E+I++G ++G V+I  GLY+V+WG
Sbjct  299   ASFILHEQIHLGSVIGGVVIAVGLYSVVWG  328



>ref|XP_010926422.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=374

 Score =   330 bits (845),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 177/328 (54%), Positives = 239/328 (73%), Gaps = 6/328 (2%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G  + + KPY+AM+ LQFG+AGM +I+  +L +GMSHYVLVVYR+A ATA +APFAL  E
Sbjct  4     GGVWSRVKPYLAMVFLQFGFAGMYVISVATLKQGMSHYVLVVYRNAIATAVVAPFALWFE  63

Query  1261  -RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
              RK RPK+T + FL+I  L LL PV+DQNFYY G K T+ +F+ AL N+LPAMTFV AV+
Sbjct  64    NRKARPKMTLSNFLKIMALALLEPVLDQNFYYMGAKNTNASFASALYNVLPAMTFVNAVI  123

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RMEK+DIKK   QAK+ GT+VT+ GA+LM LYKG  V F+W+       +++    + +
Sbjct  124   LRMEKIDIKKRHSQAKIAGTLVTLVGALLMILYKGQVVEFIWTK-----GRNHYNNNAGS  178

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
                  W++G  +L+ +   W++FF++Q+ TL+ Y A+LSL   +CFMG +QS AV   ME
Sbjct  179   QDDSHWLEGVFMLLFSCFCWSAFFLLQSHTLKSYPAELSLTTWICFMGAVQSGAVALVME  238

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
             H A  W IG+D+ LL AAY+GI+ S I YY+QG VM++RGPVFVTAF+PL MIIV IMGS
Sbjct  239   HEAKPWLIGFDLRLLTAAYSGIMCSGITYYIQGKVMKERGPVFVTAFNPLCMIIVTIMGS  298

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              ILAE+I +G ++GA +IV GLY+++WG
Sbjct  299   IILAEEITLGRVVGATIIVIGLYSLIWG  326



>ref|XP_004983289.1| PREDICTED: WAT1-related protein At4g08290-like [Setaria italica]
Length=364

 Score =   329 bits (843),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 241/328 (73%), Gaps = 5/328 (2%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             L   ++K KPY+AM+ LQFG+AGM +I+  SL +GMSHYVLVVYR+A A   +APFAL  
Sbjct  3     LAGTWRKVKPYMAMVFLQFGFAGMFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWF  62

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERK RPK+T +IF +I  LGLL PV+DQNF Y G+  TS +FS AL+N+LPA+TFV A++
Sbjct  63    ERKTRPKMTLSIFFKILALGLLEPVLDQNFIYMGVNNTSASFSSALTNILPAVTFVNAII  122

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RME+++IK+ R QAK+ GT +TVGGA+LM L+KG  VNF W+  +     S+    S A
Sbjct  123   LRMERINIKERRSQAKIAGTAITVGGALLMILFKGPIVNFPWTKDV-----SHAVSDSGA  177

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
              +G  W+ G+ +++L+   W++FFI+Q+ TLR Y ++LSL  L+C +G  +S AV   ME
Sbjct  178   HNGGHWLMGTFMILLSCFCWSAFFILQSYTLRSYPSELSLTTLICALGATESGAVALVME  237

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
                  W+IG+DM L  A Y+GI+ S +AYYVQGIV+++RGPVFVTAFSPL MIIV ++GS
Sbjct  238   RDTKTWSIGFDMRLFTAIYSGIMCSGVAYYVQGIVIKERGPVFVTAFSPLCMIIVTLLGS  297

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              IL+E + +G ++GA +IVFGLYA++WG
Sbjct  298   IILSEVVTLGRLIGATVIVFGLYALIWG  325



>ref|XP_009340891.1| PREDICTED: WAT1-related protein At4g08290-like [Pyrus x bretschneideri]
Length=394

 Score =   330 bits (845),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 245/336 (73%), Gaps = 3/336 (1%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             E     G  G   +K KPY+ ++SLQFG AGM II+  +LN GM+ YVL+VYR+A A   
Sbjct  5     EQNNSGGRFGVMMKKLKPYLLVVSLQFGSAGMYIISMATLNHGMNRYVLIVYRNATAALV  64

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             +APFAL+LERK RPK+T + FL I VLG L PVIDQ F Y G+K+TS +F+ A+ N +P+
Sbjct  65    LAPFALVLERKTRPKMTISTFLHIMVLGFLEPVIDQGFTYLGMKYTSASFASAIMNAVPS  124

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             +TFV+AV+ R+E V IK+VR QAKV+GT+VT  GA+LMTLYKG  ++ LWS+      +S
Sbjct  125   VTFVIAVIFRVETVKIKEVRSQAKVIGTLVTFAGALLMTLYKGPVIDLLWSHKTSSHHES  184

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
                 +++ +S + W+ G++ ++L ++AW+ F+++Q+IT++KY A +SL   +C  G LQ 
Sbjct  185   ---SSTTINSNQHWIAGTLFILLGSVAWSCFYVLQSITVKKYPANISLSCFICLAGALQG  241

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
              AV F +E R S W +GWD  LLA  Y GI+SS I YYVQG+VM+ RGPVFVTAF+PL M
Sbjct  242   SAVAFTVERRPSAWAVGWDSRLLAPLYTGIISSGITYYVQGLVMKTRGPVFVTAFNPLCM  301

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             IIV+I+GS ILAEK+++G I+G ++I FGLY+V+WG
Sbjct  302   IIVSILGSIILAEKLHLGSIIGGMVIAFGLYSVVWG  337



>ref|XP_007141061.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
 gb|ESW13055.1| hypothetical protein PHAVU_008G164000g [Phaseolus vulgaris]
Length=385

 Score =   329 bits (844),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 176/337 (52%), Positives = 241/337 (72%), Gaps = 5/337 (1%)
 Frame = -2

Query  1471  IEMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafata  1292
             +E E  +   G  F KAKPY+AM+SLQFGY+GM IIT VS   GMSH+VL VYRH  AT 
Sbjct  1     MENENASSGFGKGFNKAKPYLAMVSLQFGYSGMYIITMVSFKHGMSHWVLSVYRHIVATL  60

Query  1291  aiapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLP  1112
              +APFA  LERK+RPK+T  +FL++  LG L PV+DQN Y  G+K TS TF+ A  N+LP
Sbjct  61    IMAPFAFFLERKIRPKMTLPVFLRLAALGFLEPVLDQNLYNMGMKNTSTTFASATVNVLP  120

Query  1111  AMTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSK  932
             A+TF+MA++ R+E V+++K+   AKV+GT VTV GAM+MTLYKG A+ F+     H  S 
Sbjct  121   AITFIMALIFRLETVNLRKIHSVAKVIGTAVTVTGAMVMTLYKGSALQFVKGQANHQESG  180

Query  931   SNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQ  752
             S     ++  S ++WV G+++L+ +   WASFFI+Q+ TL+ Y A+LS+ A +CF+G  +
Sbjct  181   S-----TTQPSEQNWVLGTVMLLASCGGWASFFILQSFTLKMYPAELSVTAWICFLGIFE  235

Query  751   SIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLM  572
                 +F  E   SVW+IG D  LLA  Y+G+V S +AYYVQG+V ++RGPVFVT+FSPL 
Sbjct  236   GSIASFIFERDMSVWSIGIDSRLLACVYSGVVCSGMAYYVQGVVTRERGPVFVTSFSPLC  295

Query  571   MIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             MII A +GS +LAE++Y+G ++GA++IV GLY V+WG
Sbjct  296   MIITAALGSIVLAEQVYMGSVIGAIIIVSGLYTVVWG  332



>ref|XP_003544681.1| PREDICTED: WAT1-related protein At1g44800-like [Glycine max]
Length=387

 Score =   329 bits (844),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 240/338 (71%), Gaps = 8/338 (2%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             +    +  LG  F+K KPY+AM+SLQFGY+GM IIT VS   GMSH+VL VYRH  AT  
Sbjct  3     DQNASSSGLGKVFRKVKPYLAMMSLQFGYSGMYIITMVSFKHGMSHWVLSVYRHVVATLI  62

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             +APFA +LERK+RPK+T  +FL++ VLG L PV+DQN Y  G+K TS TF+ A  N++PA
Sbjct  63    MAPFAFVLERKIRPKMTLPVFLRLAVLGFLEPVLDQNLYNMGMKNTSTTFASATVNVMPA  122

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFI--HPTS  935
             +TF+MA++CR+E V+++K+   AKVVGT VTV GAM+MTLYKG A+ F+       H + 
Sbjct  123   ITFIMALICRLETVNLRKIHSVAKVVGTAVTVSGAMVMTLYKGPALQFIKGQAATHHESG  182

Query  934   KSNVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTL  755
              S  P      S ++WV G++ LI +   WASFFI+Q+ TL+ Y A+LS+ A +CF+G  
Sbjct  183   SSTQP------SEQNWVLGTVELIASCGGWASFFILQSFTLKMYPAELSVTAWICFLGIF  236

Query  754   QSIAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPL  575
             +    T   E   SVW+IG D  LLA  Y+G+V S +AYYVQG+V ++RGPVFVT+FSPL
Sbjct  237   EGAIATLIFERDMSVWSIGMDSRLLACVYSGVVCSGMAYYVQGVVTRERGPVFVTSFSPL  296

Query  574   MMIIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              MII A +GS +LAE++Y+G ++GA++IV GLY V+WG
Sbjct  297   CMIITAALGSIVLAEQVYLGSVIGAIIIVSGLYTVVWG  334



>ref|NP_001064323.1| Os10g0210500 [Oryza sativa Japonica Group]
 gb|ABB47053.1| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABB47054.2| nodulin MtN21 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26237.1| Os10g0210500 [Oryza sativa Japonica Group]
 dbj|BAG90481.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE50726.1| hypothetical protein OsJ_31032 [Oryza sativa Japonica Group]
Length=364

 Score =   328 bits (841),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 240/324 (74%), Gaps = 5/324 (2%)
 Frame = -2

Query  1432  FQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKV  1253
             ++KA PY+AM+ LQFG+AG+ +I+  SL +GMSHYVLVVYR+A A   +APFAL  ERK 
Sbjct  7     WRKAMPYMAMVFLQFGFAGLFLISVASLRQGMSHYVLVVYRNAVAAVVMAPFALWFERKT  66

Query  1252  RPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRME  1073
             RPK+T ++F +I  LGLL PV+DQNF+Y G K TS +FS AL+N+LPA+TFV A++ RME
Sbjct  67    RPKMTLSVFFKIMALGLLEPVLDQNFFYMGAKNTSASFSSALTNILPAVTFVNAIILRME  126

Query  1072  KVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGK  893
             ++ IK+ R QAK+ GT++TVGGAMLM L+KG  +NF W+      +  N+  +S  ++G 
Sbjct  127   RISIKERRSQAKIAGTLITVGGAMLMILFKGPVINFPWTK----NANHNISDSSDHNNGH  182

Query  892   DWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRAS  713
              W+ G  +++L+   W++FFI+Q+ TLR Y A+LSL  L+C MG  QS AV   ME    
Sbjct  183   -WLMGIFMILLSCFCWSAFFILQSYTLRGYPAELSLTTLICAMGVAQSGAVALVMERDIK  241

Query  712   VWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILA  533
              W IG+DM L  A Y+GI+ S +AYYVQG+V+++RGPVFVTAFSPL MIIV I+GSFIL 
Sbjct  242   AWLIGFDMRLFTAVYSGIMCSGVAYYVQGMVIKERGPVFVTAFSPLCMIIVTILGSFILC  301

Query  532   EKIYVGGIMGAVLIVFGLYAVLWG  461
             E + +G ++GA++IV GLYA++WG
Sbjct  302   EVVTLGRVIGAIIIVVGLYALIWG  325



>ref|XP_006472756.1| PREDICTED: WAT1-related protein At1g21890-like [Citrus sinensis]
 gb|KDO80699.1| hypothetical protein CISIN_1g016580mg [Citrus sinensis]
Length=387

 Score =   328 bits (842),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 238/330 (72%), Gaps = 10/330 (3%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             CL     K KPY+A+ISLQFGYAGM IIT VSL  GMSHYVL VYRH  AT  +APFA +
Sbjct  11    CLA--LSKFKPYLAIISLQFGYAGMYIITMVSLKHGMSHYVLAVYRHVVATIVLAPFAFV  68

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERK+RPK+T  +FL+I  LG L PV+DQN YY G+K+T+ TF+ A  N+LPA+TF++A+
Sbjct  69    LERKIRPKLTLPVFLRIMALGFLEPVLDQNLYYLGMKYTTATFASATVNILPAVTFILAI  128

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + R+E V++++++  AKV+GT VTV GAM+MTLYKG  +NF        +  +     SS
Sbjct  129   IFRLETVNVRRLQSLAKVIGTAVTVAGAMVMTLYKGPIINF-------TSGGAGSHHGSS  181

Query  907   ADSGKD-WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              DS    +  G+++LI +   WA FFI+Q+ TL+KY A+LSL  L+C MG ++  AV+  
Sbjct  182   VDSSDSHFFTGTLMLIGSCFGWAGFFILQSFTLKKYPAELSLSTLICLMGVVEGAAVSLI  241

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             ME   S W IG+D  LLAAAY+G+V S IAYYVQG V +++GPVFVT+FSPL MII + +
Sbjct  242   MERDMSAWKIGFDSRLLAAAYSGVVCSGIAYYVQGFVSKQKGPVFVTSFSPLCMIITSAL  301

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             G  ILAE +++G I+GA+LIVFGLY V+WG
Sbjct  302   GVIILAELVHLGSILGAILIVFGLYTVVWG  331



>ref|XP_010554740.1| PREDICTED: WAT1-related protein At2g40900-like [Tarenaya hassleriana]
Length=366

 Score =   328 bits (840),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 196/323 (61%), Positives = 255/323 (79%), Gaps = 20/323 (6%)
 Frame = -2

Query  1429  QKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVR  1250
             + AKPY AM  LQFGYAGMN+ITK  L+RGMSHYVLVVYR AFATA +APFAL+ ERKVR
Sbjct  7     ESAKPYFAMACLQFGYAGMNLITKAVLDRGMSHYVLVVYRQAFATAVLAPFALLSERKVR  66

Query  1249  PKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEK  1070
             PK+TF +F+QIFVL LLGPVIDQN YYAGLK TSPTFSCA+++++P +TF++A+LCRMEK
Sbjct  67    PKMTFPVFIQIFVLSLLGPVIDQNLYYAGLKLTSPTFSCAVTSIVPVVTFILAILCRMEK  126

Query  1069  VDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKD  890
             V++KKVRCQAKVVGTVVTV GAM+  LYKG  +NFL +   HP      P T+       
Sbjct  127   VEMKKVRCQAKVVGTVVTVVGAMMTVLYKGPFINFLHT---HP------PLTA-------  170

Query  889   WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASV  710
                  + L++++L+++SFFI+QA TL++Y+A +SL A+VCF+GTL S AVTF ME   S 
Sbjct  171   ----IVFLLISSLSFSSFFILQAATLKRYSAHMSLSAMVCFLGTLNSAAVTFVMERDQSA  226

Query  709   WTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAE  530
             W IG+DM  LA+AYAG++SSSIAYYVQG++ +++GP FV +F+PL++IIV++MG FI  E
Sbjct  227   WNIGFDMKFLASAYAGVISSSIAYYVQGLMTKQKGPAFVASFNPLVVIIVSVMGIFIFGE  286

Query  529   KIYVGGIMGAVLIVFGLYAVLWG  461
             +IY+ G++G VL++ GL   LWG
Sbjct  287   RIYLLGVLGMVLLMVGLCTSLWG  309



>ref|XP_006434165.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
 gb|ESR47405.1| hypothetical protein CICLE_v10001460mg [Citrus clementina]
Length=387

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 238/330 (72%), Gaps = 10/330 (3%)
 Frame = -2

Query  1447  CLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfali  1268
             CL     K KPY+A+ISLQFGYAGM IIT VSL  GMSHYVL VYRH  AT  +APFA +
Sbjct  11    CLA--LSKFKPYLAIISLQFGYAGMYIITMVSLKHGMSHYVLAVYRHVVATIVLAPFAFV  68

Query  1267  LERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAV  1088
             LERK+RPK+T  +FL+I  LG L PV+DQN YY G+K+T+ TF+ A  N+LPA+TF++A+
Sbjct  69    LERKIRPKLTLPVFLRIMALGFLEPVLDQNLYYLGMKYTTATFASATVNILPAVTFILAI  128

Query  1087  LCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSS  908
             + R+E V++++++  AKV+GT VTV GAM+MTLYKG  +NF        +  +     SS
Sbjct  129   IFRLETVNVRRLQSLAKVIGTAVTVAGAMVMTLYKGPIINF-------TSGGAGSHHGSS  181

Query  907   ADSGKD-WVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
              DS    +  G+++LI +   WA FFI+Q+ TL+KY A+LSL  L+C MG ++  AV+  
Sbjct  182   VDSSDSHFFTGTLMLIGSCFGWAGFFILQSFTLKKYPAELSLSTLICLMGVVEGAAVSLI  241

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             ME   S W IG+D  LLAAAY+G+V S IAYYVQG V +++GPVFVT+FSPL MII + +
Sbjct  242   MERDMSAWKIGFDSRLLAAAYSGVVCSGIAYYVQGFVSKQKGPVFVTSFSPLCMIITSAL  301

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             G  ILAE +++G I+GA+LIVFGLY V+WG
Sbjct  302   GVIILAELVHLGSILGAILIVFGLYTVVWG  331



>gb|KFK44291.1| hypothetical protein AALP_AA1G239100 [Arabis alpina]
Length=391

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/331 (53%), Positives = 238/331 (72%), Gaps = 3/331 (1%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             LG    + KPY+AMIS+QFGYAGM IIT VSL  GM+HY+L VYRHA AT  IAPFAL  
Sbjct  7     LGGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATLVIAPFALYY  66

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERK RPK+TF IFLQI +LG + PV+DQN YY G+ +TS TF+ A +N+LPA+TFV+A++
Sbjct  67    ERKTRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAII  126

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFL---WSNFIHPTSKSNVPQT  914
              R+E V+ KKVR  AKVVGTV+TV GA+LMTLYKG  V+F+    S      +  +    
Sbjct  127   FRLESVNFKKVRSIAKVVGTVITVSGALLMTLYKGPIVDFIKFGGSGGGSDGAGGSHGGA  186

Query  913   SSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             ++ +  K W+ G+++L+  T  WA FFI+Q+ TL+KY A+LSL  L+C MGTL+  AV+ 
Sbjct  187   AATELDKHWIPGTLMLLGRTFGWAGFFILQSFTLKKYPAELSLTTLICLMGTLEGTAVSL  246

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
                   S W IG+D NL AAAY+G++ S +AYYVQG+VM++RGPVFV  F+PL ++I A 
Sbjct  247   VTVRDMSAWKIGFDSNLFAAAYSGVICSGVAYYVQGVVMRERGPVFVATFNPLCVVITAA  306

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +G  +L+E I++G ++G + I+ GLY V+WG
Sbjct  307   LGVLVLSESIHLGSVIGTIFIIVGLYTVVWG  337



>ref|XP_009767374.1| PREDICTED: WAT1-related protein At4g08300-like [Nicotiana sylvestris]
Length=385

 Score =   328 bits (841),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 186/350 (53%), Positives = 250/350 (71%), Gaps = 6/350 (2%)
 Frame = -2

Query  1450  GCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfal  1271
             G  G F  K KPY+AM+SLQFGYAGM I+T +   RGMSH++LVVYRHAFAT A+APFA+
Sbjct  8     GAFGPFLNKVKPYLAMVSLQFGYAGMYIVTMMCFKRGMSHWILVVYRHAFATLAVAPFAI  67

Query  1270  iLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMA  1091
             +LERK+RPK+T  +F++I  LG L PVIDQN YY GLK T+ T++ A  N+LPA+TF++A
Sbjct  68    VLERKIRPKMTLRVFIKILALGFLEPVIDQNLYYVGLKSTTATYASAFVNLLPAVTFILA  127

Query  1090  VLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTS  911
             V+ R+EKV++KK    AKV+GT +TV GAM+MTLYKG   N +      P S+      +
Sbjct  128   VIFRIEKVNLKKKSSMAKVIGTAITVAGAMVMTLYKGPMFNLV------PHSRGGSHTAA  181

Query  910   SADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFA  731
             +A + ++WV G+I LI   + W+ FFI+Q++TL++Y A+LSL A VC MG ++   V   
Sbjct  182   AASTPENWVAGTIELISCIVGWSGFFIVQSMTLKEYPAELSLAAWVCVMGIVEGGIVALI  241

Query  730   MEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIM  551
             ME   + W IG+D  LLAAAY+GIV S IAYYVQ IV + +GPVFVTAFSPL M+I +++
Sbjct  242   MERDWNAWKIGFDARLLAAAYSGIVCSGIAYYVQSIVNKVKGPVFVTAFSPLSMVITSVL  301

Query  550   GSFILAEKIYVGGIMGAVLIVFGLYAVLWGkykeykekemieaiaEPVKD  401
              + ILAE +++G  +GAV+IV GLY+V+WGK KE K  E  +    PV D
Sbjct  302   AAIILAESVHLGSCIGAVIIVMGLYSVVWGKSKEGKGNETGKDQELPVVD  351



>ref|XP_010916579.1| PREDICTED: WAT1-related protein At1g21890-like [Elaeis guineensis]
Length=376

 Score =   328 bits (840),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 238/328 (73%), Gaps = 5/328 (2%)
 Frame = -2

Query  1444  LGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliL  1265
             LG  + + KPY+AM+ LQFGYAGM +I+  +L +GMSHYVLVVYR+A A A I PFAL  
Sbjct  3     LGGVWSRVKPYLAMVFLQFGYAGMYLISVATLKQGMSHYVLVVYRNAIAAAVIFPFALWF  62

Query  1264  ERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVL  1085
             ERK RPK+T + FL+I  L LL PV+DQNFYY G K T+ +F+ AL N+LPA+TF+ A+L
Sbjct  63    ERKARPKMTVSNFLKIMALALLEPVLDQNFYYMGAKNTNASFASALYNVLPAVTFMNAIL  122

Query  1084  CRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSA  905
              RMEK++IKK R QAK++G +VTV GA+LM LYKG  V F+W+       +++   T+ +
Sbjct  123   LRMEKIEIKKRRSQAKIIGALVTVVGALLMILYKGPVVEFIWTK-----GRNHHNNTAGS  177

Query  904   DSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAME  725
                  W+ G  +L+L+   W++FF++Q+ TL+ Y A+LSL   +C MG +QS AV   ME
Sbjct  178   QDDGHWLAGVFMLLLSCFCWSAFFVLQSHTLKSYPAELSLTTWICSMGAVQSGAVALVME  237

Query  724   HRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGS  545
               A  W IG+DM  L AAY+GI+ S IAYYVQ IVM++RGPVFVTAF+PL MIIVA++GS
Sbjct  238   RSAKPWLIGFDMRFLTAAYSGIMCSGIAYYVQAIVMKERGPVFVTAFNPLCMIIVAVLGS  297

Query  544   FILAEKIYVGGIMGAVLIVFGLYAVLWG  461
              +L E+I VG ++GA +IV GLY+++WG
Sbjct  298   IVLGEEITVGRVIGASIIVIGLYSLIWG  325



>emb|CDY04680.1| BnaC05g17180D [Brassica napus]
Length=396

 Score =   328 bits (842),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/331 (53%), Positives = 239/331 (72%), Gaps = 4/331 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G+   + KPY+AMIS+QFGYAGM IIT VSL  GM+HY+L VYRHA AT  IAPFAL  E
Sbjct  8     GSLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATVVIAPFALFHE  67

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK+RPK+TF IFLQI +LG + PV+DQN YY G+ +TS TF+ A +N+LPA+TFV+A++ 
Sbjct  68    RKIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIF  127

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFL----WSNFIHPTSKSNVPQT  914
             R+E V+ KKVR  AKVVGTV+TV GA+LMTLYKG  ++F+               +    
Sbjct  128   RLESVNFKKVRSIAKVVGTVITVSGALLMTLYKGPIIDFIKFGSGGGGDDGAGGGSHGGA  187

Query  913   SSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
             +SAD  K W+ G+++L+  T  WA FFI+Q+ TL+KY A+LSL AL+C MGTL+  AV+ 
Sbjct  188   ASADLDKHWIPGTLMLLGRTFGWAGFFILQSFTLKKYPAELSLTALICLMGTLEGTAVSL  247

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
                   S W IG+D NL AAAY+G++ S +AYYVQG+VM++RGPVFV  F+PL ++I A 
Sbjct  248   VTVRDLSAWKIGFDSNLFAAAYSGVICSGVAYYVQGVVMRERGPVFVATFNPLCVVITAA  307

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +G  +L+E I++G ++G + I+ GLY V+WG
Sbjct  308   LGVVVLSESIHLGSVIGTIFIIAGLYTVVWG  338



>emb|CDP15800.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   328 bits (840),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 177/336 (53%), Positives = 238/336 (71%), Gaps = 5/336 (1%)
 Frame = -2

Query  1468  EMEGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataa  1289
             +  G    L  FF KAK Y+AM+SLQFGYAGM II  V+  RGMSH+VLVVYRHA AT  
Sbjct  3     DQSGLCRALSVFFDKAKCYLAMVSLQFGYAGMYIICMVAFKRGMSHWVLVVYRHAVATVV  62

Query  1288  iapfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPA  1109
             +APFA  +ERK+RPK+T  +FL+I  LGLL PV+DQN YY G+K TS TF+ A  N+LPA
Sbjct  63    MAPFAYFVERKIRPKLTLRVFLKILALGLLEPVLDQNLYYVGMKSTSATFASAFVNVLPA  122

Query  1108  MTFVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKS  929
             +TFVMA+  R+E V++KK+   AKV+GT +TV GAM+MTLYKG  +N L+++        
Sbjct  123   VTFVMAIAFRLETVNLKKIHSLAKVIGTAITVSGAMVMTLYKGPIINILFTH-----GGG  177

Query  928   NVPQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQS  749
             +   T+++   + WV G I LI     W+ FFI+Q++TL++Y A+LSL ALVC MG ++S
Sbjct  178   HHSSTNASSEPQHWVTGIITLISCIFGWSGFFILQSMTLKEYPAELSLTALVCLMGMIES  237

Query  748   IAVTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMM  569
               V    E   S W IG+D   LAA Y+G+V S IAYY+Q +V + RGPVFVTAFSPL M
Sbjct  238   GIVALIFERNMSAWVIGFDSRFLAAVYSGVVCSGIAYYMQSVVNKIRGPVFVTAFSPLSM  297

Query  568   IIVAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +I A++G+ +LAE+ ++G ++GA +IV GLY+V+WG
Sbjct  298   VITAVLGAIVLAEQTHLGSLIGATVIVIGLYSVIWG  333



>ref|XP_002528467.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
 gb|EEF33950.1| Auxin-induced protein 5NG4, putative [Ricinus communis]
Length=381

 Score =   328 bits (840),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 246/327 (75%), Gaps = 6/327 (2%)
 Frame = -2

Query  1438  NFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLER  1259
             +F+ KAKP++A+I LQFGYAG++II+K +LN+GMS +VLVVYRHA AT  I PFA++ +R
Sbjct  8     DFYGKAKPFLAVILLQFGYAGLSIISKFALNQGMSQHVLVVYRHAVATIVITPFAILFDR  67

Query  1258  KVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCR  1079
             KVRPK+T +IFL+I ++GLL P IDQN YY G+K+T+ TF+  + N+LPA  F+MA + R
Sbjct  68    KVRPKMTISIFLKILMMGLLEPTIDQNLYYTGMKYTTATFAATMCNILPAFAFIMAWILR  127

Query  1078  MEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADS  899
             +EKV++K+V  QAK++GT+VTVGGAM+MTL KG  +N  W+        +++  +SSA +
Sbjct  128   LEKVNLKRVHSQAKLLGTIVTVGGAMIMTLVKGAKLNLPWTE-----GYNDIQGSSSAPT  182

Query  898   GKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEH-  722
              +D +KG+ L+ +  + W++F I+QAITL+ Y A+LSL A +C MGT++       ME  
Sbjct  183   MQDTIKGASLIGVGCICWSAFIILQAITLKTYPAELSLTAFICLMGTIEGTIFAVIMERG  242

Query  721   RASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSF  542
               S W+I +D  LLA  Y+G++ S +AYYVQG++M+ +GPVFVTAF+PL MIIV I+GSF
Sbjct  243   NPSAWSIHFDTKLLACVYSGVICSGVAYYVQGVIMKSKGPVFVTAFNPLCMIIVTILGSF  302

Query  541   ILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +L+E +Y G ++GA++IV GLY VLWG
Sbjct  303   VLSEIVYFGRVLGALVIVIGLYLVLWG  329



>ref|XP_010459911.1| PREDICTED: WAT1-related protein At1g21890 [Camelina sativa]
Length=393

 Score =   328 bits (840),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/331 (54%), Positives = 238/331 (72%), Gaps = 4/331 (1%)
 Frame = -2

Query  1441  GNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLE  1262
             G    + KPY+AMIS+QFGYAGM IIT VSL  GM+HY+L VYRHA ATA IAPFAL  E
Sbjct  8     GGLMNRVKPYLAMISMQFGYAGMYIITMVSLKHGMNHYILAVYRHAIATAVIAPFALFHE  67

Query  1261  RKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLC  1082
             RK+RPK+TF IFLQI +LG + PV+DQN YY G+ +TS TF+ A +N+LPA+TFV+A++ 
Sbjct  68    RKIRPKMTFRIFLQIALLGFIEPVLDQNLYYVGMTYTSATFASATANVLPAITFVLAIIF  127

Query  1081  RMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFL----WSNFIHPTSKSNVPQT  914
             R+E V+ KKVR  AKVVGTV+TV GA+LMTLYKG  V+F+              S+    
Sbjct  128   RLESVNFKKVRSIAKVVGTVITVSGALLMTLYKGPIVDFIRFGGGGGGGSDGDGSSHGGA  187

Query  913   SSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTF  734
              +A   K W+ G+++L+  T  WA FFI+Q++TL+KY A LSL AL+C MGTL+  AV+ 
Sbjct  188   GAAAMDKHWIPGTLMLLGRTFGWAGFFILQSLTLKKYPAPLSLTALICLMGTLEGTAVSL  247

Query  733   AMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAI  554
                   S W IG+D NL AAAY+G++ S +AYYVQG+VM++RGPVFV  F+PL ++I A 
Sbjct  248   VTVRDLSAWKIGFDSNLFAAAYSGVICSGVAYYVQGVVMRERGPVFVATFNPLCVVITAA  307

Query  553   MGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             +G  +L+E I++G ++G + I+ GLY V+WG
Sbjct  308   LGVVVLSESIHLGSVIGTLFIIVGLYTVVWG  338



>ref|XP_008219763.1| PREDICTED: WAT1-related protein At4g08300 [Prunus mume]
Length=367

 Score =   327 bits (837),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 177/322 (55%), Positives = 240/322 (75%), Gaps = 6/322 (2%)
 Frame = -2

Query  1426  KAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaiapfaliLERKVRP  1247
             K KPY+AM+SLQFGYAGM II+ VS   GMS++VL VYRH  A   IAPFA +LERK+RP
Sbjct  17    KIKPYLAMVSLQFGYAGMYIISMVSFKHGMSNFVLSVYRHVVAFCVIAPFAFVLERKIRP  76

Query  1246  KITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMTFVMAVLCRMEKV  1067
             ++T  IFL+I +LG L PV+DQN Y+ G+K+TS TF+ A+ N+LPA+TF+MAV  R+E V
Sbjct  77    RMTLPIFLRIVLLGFLEPVLDQNLYFLGMKYTSATFASAVVNVLPAITFIMAVFFRLESV  136

Query  1066  DIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNVPQTSSADSGKDW  887
             ++KK+   AKVVGTV+TVGGAM+MTLYKG  V+ +           +   +++  + + W
Sbjct  137   NVKKLHSLAKVVGTVITVGGAMVMTLYKGPIVDIIRG------HTHSHSTSTTDSTNQHW  190

Query  886   VKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIAVTFAMEHRASVW  707
             V G ++L+ +   WASFFI+Q+ TL+KY A+LSL A +C MG L+   +T A+E + SVW
Sbjct  191   VAGPLMLLASCGGWASFFIVQSFTLKKYPAELSLTAWICIMGVLEGGVITLAVERKLSVW  250

Query  706   TIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMIIVAIMGSFILAEK  527
              IGWD  LLA+ Y+GIV S +AYYVQG+V ++RGPVFVTAFSPL MII A +G+ +LAE+
Sbjct  251   VIGWDSRLLASVYSGIVCSGLAYYVQGVVSRERGPVFVTAFSPLCMIITAALGAIVLAER  310

Query  526   IYVGGIMGAVLIVFGLYAVLWG  461
             +++G I+GA+ IVFGLY V+WG
Sbjct  311   VHLGSIIGAIFIVFGLYTVVWG  332



>ref|XP_002306625.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
 gb|EEE93621.2| hypothetical protein POPTR_0005s15820g [Populus trichocarpa]
Length=363

 Score =   327 bits (837),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 243/334 (73%), Gaps = 6/334 (2%)
 Frame = -2

Query  1462  EGKTGCLGNFFQKAKPYIAMISLQFGYAGMNIITKVSLNRGMSHYVLVVYRHafataaia  1283
             +   G L   F K  PYI M+ +QFG AG  I++ +SLNRGM+ YVL+VYR+  A   +A
Sbjct  4     QTSAGKLTVVFNKMTPYILMVCVQFGSAGNYILSMISLNRGMNRYVLIVYRNGVAALVLA  63

Query  1282  pfaliLERKVRPKITFTIFLQIFVLGLLGPVIDQNFYYAGLKFTSPTFSCALSNMLPAMT  1103
             PFAL+LERK RPKIT+ IFL+I  LG L P++DQ F Y G+++TS TF+ A+ N +P++T
Sbjct  64    PFALLLERKTRPKITWPIFLRIMALGFLEPILDQGFSYLGMQYTSATFTSAIMNAVPSVT  123

Query  1102  FVMAVLCRMEKVDIKKVRCQAKvvgtvvtvgGAMLMTLYKGHAVNFLWSNFIHPTSKSNV  923
             FV+A++ R+E+V IK++R QAKVVGT+VT+ GA+LMT+YKG  +   WS       K++ 
Sbjct  124   FVIALIFRLERVRIKEIRSQAKVVGTLVTLAGALLMTVYKGPVIGLPWSQ------KTSQ  177

Query  922   PQTSSADSGKDWVKGSILLILATLAWASFFIIQAITLRKYTAQLSLIALVCFMGTLQSIA  743
               +++A S K WV G++LL++  ++W++F+++Q  TL+KY A+LSL +L+C  G++QS+A
Sbjct  178   HGSTAASSDKHWVTGTLLLLVGCVSWSAFYVLQMETLKKYPAELSLASLICLAGSMQSLA  237

Query  742   VTFAMEHRASVWTIGWDMNLLAAAYAGIVSSSIAYYVQGIVMQKRGPVFVTAFSPLMMII  563
             +   + H  S W +GWD  L    Y GIV+S I YYVQG+VM+ RGPVFVTAF+PL MII
Sbjct  238   IALVVAHHPSSWAVGWDARLFTPLYTGIVASGITYYVQGLVMKTRGPVFVTAFNPLCMII  297

Query  562   VAIMGSFILAEKIYVGGIMGAVLIVFGLYAVLWG  461
             VA +GS ILAEK+++G ++G ++I  GLY+V+WG
Sbjct  298   VAALGSLILAEKLHLGSVLGGIIIAIGLYSVVWG  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4637730747328