BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21786_g2_i3 len=1193 path=[1730:0-159 3880:160-161 1890:162-311
143:312-1192]

Length=1193
                                                                      Score     E

ref|XP_009765295.1|  PREDICTED: putative serine/threonine-protein...    487   6e-168   
ref|XP_004232848.1|  PREDICTED: putative serine/threonine-protein...    484   8e-167   
ref|XP_010316730.1|  PREDICTED: putative serine/threonine-protein...    483   2e-166   
ref|XP_006347067.1|  PREDICTED: probable LRR receptor-like serine...    482   5e-166   
ref|XP_009597888.1|  PREDICTED: putative serine/threonine-protein...    477   4e-164   
ref|XP_011096248.1|  PREDICTED: putative serine/threonine-protein...    477   5e-164   
emb|CDO99571.1|  unnamed protein product                                471   2e-161   
ref|XP_006343244.1|  PREDICTED: probable LRR receptor-like serine...    467   6e-160   
ref|XP_006594324.1|  PREDICTED: probable LRR receptor-like serine...    466   2e-159   
ref|XP_009607272.1|  PREDICTED: putative serine/threonine-protein...    465   4e-159   
ref|XP_004234122.1|  PREDICTED: putative serine/threonine-protein...    462   3e-158   
ref|XP_009777261.1|  PREDICTED: putative serine/threonine-protein...    460   2e-157   
emb|CBI35687.3|  unnamed protein product                                462   5e-157   
gb|KHN07273.1|  Putative LRR receptor-like serine/threonine-prote...    459   6e-157   
ref|XP_003635271.2|  PREDICTED: putative serine/threonine-protein...    461   1e-156   
ref|XP_003529313.1|  PREDICTED: probable LRR receptor-like serine...    458   2e-156   
ref|XP_007025673.1|  Kinase superfamily protein isoform 1               458   2e-156   
ref|XP_009336056.1|  PREDICTED: putative serine/threonine-protein...    458   2e-156   
ref|XP_008383775.1|  PREDICTED: putative serine/threonine-protein...    457   4e-156   
ref|XP_008371344.1|  PREDICTED: putative serine/threonine-protein...    457   5e-156   
ref|XP_004293572.1|  PREDICTED: probable LRR receptor-like serine...    457   6e-156   
gb|EYU27924.1|  hypothetical protein MIMGU_mgv1a008435mg                456   7e-156   
gb|KHG22993.1|  hypothetical protein F383_06520                         453   1e-154   
ref|XP_010100551.1|  putative LRR receptor-like serine/threonine-...    450   2e-153   
ref|XP_007159309.1|  hypothetical protein PHAVU_002G227300g             450   3e-153   
ref|XP_007211458.1|  hypothetical protein PRUPE_ppa007355mg             449   4e-153   
ref|XP_011006889.1|  PREDICTED: putative serine/threonine-protein...    447   2e-152   
ref|XP_011006887.1|  PREDICTED: putative serine/threonine-protein...    447   4e-152   
ref|XP_002305688.2|  hypothetical protein POPTR_0004s04030g             447   5e-152   Populus trichocarpa [western balsam poplar]
ref|XP_011027878.1|  PREDICTED: putative serine/threonine-protein...    446   1e-151   
ref|XP_004505035.1|  PREDICTED: probable LRR receptor-like serine...    445   2e-151   
ref|XP_011006891.1|  PREDICTED: putative serine/threonine-protein...    445   2e-151   
ref|XP_006449305.1|  hypothetical protein CICLE_v10015669mg             439   5e-149   
ref|XP_006467832.1|  PREDICTED: probable LRR receptor-like serine...    438   9e-149   
ref|XP_006377327.1|  hypothetical protein POPTR_0011s04930g             435   8e-148   
ref|XP_010686542.1|  PREDICTED: putative serine/threonine-protein...    435   2e-147   
ref|XP_008802319.1|  PREDICTED: putative serine/threonine-protein...    433   1e-146   
ref|XP_002519034.1|  Serine/threonine-protein kinase PBS1, putative     432   2e-146   Ricinus communis
gb|KEH31096.1|  receptor-like kinase                                    432   3e-146   
ref|XP_010935639.1|  PREDICTED: putative serine/threonine-protein...    432   3e-146   
gb|KDP20943.1|  hypothetical protein JCGZ_21414                         432   3e-146   
ref|XP_010935637.1|  PREDICTED: putative serine/threonine-protein...    432   4e-146   
ref|XP_010052337.1|  PREDICTED: putative serine/threonine-protein...    431   9e-146   
ref|XP_008442328.1|  PREDICTED: putative serine/threonine-protein...    431   1e-145   
ref|XP_003637382.1|  hypothetical protein MTR_084s0004                  427   4e-144   
ref|XP_004146592.1|  PREDICTED: probable leucine-rich repeat rece...    426   1e-143   
ref|XP_010241991.1|  PREDICTED: putative serine/threonine-protein...    423   1e-142   
ref|XP_004485761.1|  PREDICTED: probable LRR receptor-like serine...    420   1e-141   
ref|XP_003593537.1|  Cysteine-rich receptor-like protein kinase         420   1e-141   
gb|AFK33937.1|  unknown                                                 417   1e-140   
gb|KHN08541.1|  Putative LRR receptor-like serine/threonine-prote...    417   2e-140   
ref|XP_003547141.1|  PREDICTED: probable LRR receptor-like serine...    416   3e-140   
ref|XP_008809403.1|  PREDICTED: putative serine/threonine-protein...    415   1e-139   
ref|XP_009382762.1|  PREDICTED: putative serine/threonine-protein...    414   7e-139   
ref|XP_009392252.1|  PREDICTED: putative serine/threonine-protein...    412   2e-138   
gb|EAZ32429.1|  hypothetical protein OsJ_16639                          409   7e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054279.1|  Os04g0679200                                       408   9e-137   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653882.1|  PREDICTED: probable LRR receptor-like serine...    409   1e-136   
emb|CAJ86254.1|  H0801D08.12                                            407   3e-136   Oryza sativa [red rice]
ref|XP_003580831.1|  PREDICTED: putative serine/threonine-protein...    405   2e-135   
ref|XP_009385996.1|  PREDICTED: putative serine/threonine-protein...    405   2e-135   
ref|XP_007148190.1|  hypothetical protein PHAVU_006G187700g             404   2e-135   
ref|XP_009765299.1|  PREDICTED: putative serine/threonine-protein...    401   4e-135   
ref|XP_002448782.1|  hypothetical protein SORBIDRAFT_06g033075          404   5e-135   Sorghum bicolor [broomcorn]
ref|XP_010918428.1|  PREDICTED: putative serine/threonine-protein...    403   7e-135   
dbj|BAJ93433.1|  predicted protein                                      403   8e-135   
ref|XP_006649796.1|  PREDICTED: probable leucine-rich repeat rece...    403   1e-134   
ref|XP_007026739.1|  Kinase superfamily protein isoform 2               402   2e-134   
ref|XP_010242968.1|  PREDICTED: putative serine/threonine-protein...    402   3e-134   
ref|XP_010262824.1|  PREDICTED: putative serine/threonine-protein...    401   4e-134   
ref|XP_010923071.1|  PREDICTED: putative serine/threonine-protein...    401   6e-134   
ref|XP_008785370.1|  PREDICTED: putative serine/threonine-protein...    402   7e-134   
ref|XP_006848186.1|  hypothetical protein AMTR_s00029p00237920          400   1e-133   
ref|XP_004505039.1|  PREDICTED: probable LRR receptor-like serine...    396   4e-133   
ref|XP_004984696.1|  PREDICTED: probable leucine-rich repeat rece...    399   4e-133   
ref|XP_004963376.1|  PREDICTED: probable LRR receptor-like serine...    401   5e-133   
ref|XP_004984693.1|  PREDICTED: probable leucine-rich repeat rece...    399   6e-133   
ref|NP_566341.1|  protein kinase                                        397   3e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827803.1|  hypothetical protein AMTR_s00009p00267490          396   3e-132   
ref|XP_010029675.1|  PREDICTED: putative serine/threonine-protein...    397   4e-132   
ref|NP_001142074.1|  uncharacterized LOC100274231                       397   4e-132   Zea mays [maize]
ref|XP_002468135.1|  hypothetical protein SORBIDRAFT_01g040190          396   6e-132   Sorghum bicolor [broomcorn]
ref|XP_010468254.1|  PREDICTED: putative serine/threonine-protein...    396   6e-132   
ref|XP_010464533.1|  PREDICTED: putative serine/threonine-protein...    396   7e-132   
gb|AAD56317.1|AC009326_4  putative receptor ser/thr protein kinase      395   8e-132   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151057.1|  LOC100284690                                       395   2e-131   Zea mays [maize]
ref|XP_011006892.1|  PREDICTED: probable LRR receptor-like serine...    391   3e-131   
ref|XP_008668089.1|  PREDICTED: LOC100284690 isoform X1                 394   4e-131   
ref|XP_003558291.1|  PREDICTED: putative serine/threonine-protein...    394   5e-131   
ref|XP_002882598.1|  kinase family protein                              394   6e-131   
tpg|DAA35328.1|  TPA: putative protein kinase superfamily protein       394   7e-131   
ref|XP_011047443.1|  PREDICTED: putative serine/threonine-protein...    393   8e-131   
ref|XP_009398440.1|  PREDICTED: putative serine/threonine-protein...    392   1e-130   
emb|CDY07897.1|  BnaC03g36260D                                          393   1e-130   
ref|XP_008356053.1|  PREDICTED: probable LRR receptor-like serine...    390   2e-130   
gb|KDP24465.1|  hypothetical protein JCGZ_25029                         392   3e-130   
ref|XP_009135076.1|  PREDICTED: putative serine/threonine-protein...    392   3e-130   
ref|XP_010486455.1|  PREDICTED: putative serine/threonine-protein...    392   4e-130   
emb|CDX73951.1|  BnaA03g30960D                                          392   4e-130   
ref|XP_002323571.1|  kinase family protein                              391   5e-130   Populus trichocarpa [western balsam poplar]
ref|XP_006481015.1|  PREDICTED: probable LRR receptor-like serine...    389   3e-129   
ref|XP_006429351.1|  hypothetical protein CICLE_v10011991mg             388   4e-129   
ref|XP_009769553.1|  PREDICTED: putative serine/threonine-protein...    388   5e-129   
ref|XP_010256572.1|  PREDICTED: putative serine/threonine-protein...    387   2e-128   
ref|XP_009772662.1|  PREDICTED: putative serine/threonine-protein...    386   3e-128   
ref|XP_006349462.1|  PREDICTED: probable LRR receptor-like serine...    386   5e-128   
ref|XP_010109622.1|  hypothetical protein L484_015577                   385   6e-128   
ref|XP_004249079.1|  PREDICTED: putative serine/threonine-protein...    385   6e-128   
gb|AAF07841.1|AC010871_17  putative protein kinase                      385   8e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156667.1|  PREDICTED: probable LRR receptor-like serine...    385   2e-127   
ref|XP_009612243.1|  PREDICTED: putative serine/threonine-protein...    384   2e-127   
ref|XP_008660308.1|  PREDICTED: putative serine/threonine-protein...    384   2e-127   
ref|XP_008442433.1|  PREDICTED: putative serine/threonine-protein...    384   2e-127   
ref|XP_011094993.1|  PREDICTED: putative serine/threonine-protein...    384   3e-127   
gb|ABK25075.1|  unknown                                                 385   3e-127   Picea sitchensis
ref|XP_010317443.1|  PREDICTED: probable LRR receptor-like serine...    380   4e-127   
ref|XP_009607275.1|  PREDICTED: putative serine/threonine-protein...    381   4e-127   
ref|XP_004137905.1|  PREDICTED: probable LRR receptor-like serine...    384   4e-127   
ref|NP_001241281.1|  receptor ser thr protein kinase                    396   4e-127   
ref|XP_006349463.1|  PREDICTED: probable LRR receptor-like serine...    383   6e-127   
ref|XP_010327728.1|  PREDICTED: putative serine/threonine-protein...    383   6e-127   
ref|XP_006449304.1|  hypothetical protein CICLE_v10015669mg             380   7e-127   
gb|KDO75883.1|  hypothetical protein CISIN_1g017503mg                   379   1e-126   
ref|XP_007026738.1|  Kinase superfamily protein isoform 1               383   2e-126   
ref|XP_009382770.1|  PREDICTED: putative serine/threonine-protein...    381   2e-126   
ref|XP_010558367.1|  PREDICTED: probable LRR receptor-like serine...    382   5e-126   
ref|XP_010558368.1|  PREDICTED: putative serine/threonine-protein...    380   6e-126   
gb|AAP06827.1|  putative receptor ser/thr protein                       380   9e-126   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011094994.1|  PREDICTED: putative serine/threonine-protein...    379   2e-125   
ref|XP_008442432.1|  PREDICTED: putative serine/threonine-protein...    379   2e-125   
ref|XP_010256574.1|  PREDICTED: putative serine/threonine-protein...    377   3e-125   
gb|EEE58749.1|  hypothetical protein OsJ_10239                          380   6e-125   Oryza sativa Japonica Group [Japonica rice]
gb|KFK38286.1|  hypothetical protein AALP_AA3G094700                    378   1e-124   
ref|XP_010553095.1|  PREDICTED: putative serine/threonine-protein...    377   2e-124   
gb|EEC74913.1|  hypothetical protein OsI_10854                          378   3e-124   Oryza sativa Indica Group [Indian rice]
ref|NP_001136520.1|  uncharacterized LOC100216635                       372   3e-123   Zea mays [maize]
gb|ACG41490.1|  hypothetical protein                                    372   4e-123   Zea mays [maize]
ref|XP_006407720.1|  hypothetical protein EUTSA_v10020896mg             373   5e-123   
ref|XP_008809404.1|  PREDICTED: putative serine/threonine-protein...    370   2e-122   
ref|XP_006297864.1|  hypothetical protein CARUB_v10013905mg             372   2e-122   
ref|XP_009626619.1|  PREDICTED: putative serine/threonine-protein...    370   6e-122   
ref|XP_006451719.1|  hypothetical protein CICLE_v10008583mg             369   2e-121   
ref|XP_006485660.1|  PREDICTED: probable LRR receptor-like serine...    369   2e-121   
ref|XP_007206230.1|  hypothetical protein PRUPE_ppa015440mg             369   3e-121   
gb|EAZ23941.1|  hypothetical protein OsJ_07669                          368   4e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010553099.1|  PREDICTED: putative serine/threonine-protein...    368   4e-121   
ref|XP_009123510.1|  PREDICTED: LOW QUALITY PROTEIN: putative ser...    368   5e-121   
ref|XP_002274657.1|  PREDICTED: putative serine/threonine-protein...    368   6e-121   Vitis vinifera
ref|XP_010553098.1|  PREDICTED: putative serine/threonine-protein...    367   6e-121   
gb|KDO48322.1|  hypothetical protein CISIN_1g044232mg                   369   6e-121   
gb|KDO47717.1|  hypothetical protein CISIN_1g020720mg                   365   6e-121   
ref|XP_010553092.1|  PREDICTED: putative serine/threonine-protein...    367   1e-120   
ref|XP_008243896.1|  PREDICTED: putative serine/threonine-protein...    367   1e-120   
ref|XP_010650918.1|  PREDICTED: putative serine/threonine-protein...    366   4e-120   
dbj|BAD25347.1|  receptor ser/thr protein kinase-like                   368   5e-120   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010326139.1|  PREDICTED: putative serine/threonine-protein...    363   3e-119   
gb|EMT16836.1|  Putative LRR receptor-like serine/threonine-prote...    362   4e-119   
ref|NP_001047537.1|  Os02g0639100                                       367   4e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008778927.1|  PREDICTED: putative serine/threonine-protein...    359   5e-119   
gb|KDP32521.1|  hypothetical protein JCGZ_14724                         365   6e-119   
ref|XP_004302654.1|  PREDICTED: probable LRR receptor-like serine...    362   8e-119   
gb|KHG11617.1|  hypothetical protein F383_12148                         361   2e-118   
ref|XP_007021689.1|  Kinase superfamily protein isoform 1               361   4e-118   
ref|XP_007149257.1|  hypothetical protein PHAVU_005G055000g             360   4e-118   
ref|XP_007021692.1|  Kinase superfamily protein isoform 4               360   6e-118   
ref|XP_009619738.1|  PREDICTED: probable LRR receptor-like serine...    362   8e-118   
ref|XP_004488850.1|  PREDICTED: probable leucine-rich repeat rece...    359   2e-117   
ref|XP_010558369.1|  PREDICTED: putative serine/threonine-protein...    357   2e-117   
gb|EEC73672.1|  hypothetical protein OsI_08219                          358   2e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_006598182.1|  PREDICTED: probable LRR receptor-like serine...    358   3e-117   
gb|KHN26796.1|  Putative LRR receptor-like serine/threonine-prote...    358   3e-117   
ref|XP_006647582.1|  PREDICTED: probable LRR receptor-like serine...    357   3e-117   
ref|XP_009784604.1|  PREDICTED: putative serine/threonine-protein...    359   3e-117   
emb|CDP06496.1|  unnamed protein product                                358   3e-117   
gb|KFK43871.1|  hypothetical protein AALP_AA1G184900                    359   4e-117   
ref|XP_010537769.1|  PREDICTED: putative serine/threonine-protein...    358   5e-117   
ref|XP_004244262.1|  PREDICTED: putative serine/threonine-protein...    358   5e-117   
ref|XP_009766561.1|  PREDICTED: putative serine/threonine-protein...    358   5e-117   
ref|XP_011097664.1|  PREDICTED: putative serine/threonine-protein...    358   5e-117   
ref|XP_006348290.1|  PREDICTED: probable LRR receptor-like serine...    357   7e-117   
ref|XP_006441015.1|  hypothetical protein CICLE_v10020517mg             358   8e-117   
gb|KHN27752.1|  Putative LRR receptor-like serine/threonine-prote...    357   1e-116   
gb|KDO53434.1|  hypothetical protein CISIN_1g016347mg                   357   1e-116   
ref|XP_006416794.1|  hypothetical protein EUTSA_v10007825mg             357   2e-116   
ref|XP_008451823.1|  PREDICTED: putative serine/threonine-protein...    357   2e-116   
ref|XP_004147755.1|  PREDICTED: probable LRR receptor-like serine...    357   2e-116   
gb|AES66260.2|  receptor-like kinase                                    356   2e-116   
emb|CDX81773.1|  BnaC08g38280D                                          357   2e-116   
ref|XP_003596008.1|  Protein kinase catalytic domain-containing p...    357   2e-116   
ref|XP_009117750.1|  PREDICTED: putative serine/threonine-protein...    357   2e-116   
ref|XP_010650921.1|  PREDICTED: putative serine/threonine-protein...    356   3e-116   
gb|EYU33758.1|  hypothetical protein MIMGU_mgv1a007949mg                356   3e-116   
dbj|BAK04486.1|  predicted protein                                      356   3e-116   
ref|XP_007026740.1|  Kinase superfamily protein isoform 3               353   3e-116   
emb|CDY35110.1|  BnaA06g11200D                                          356   3e-116   
ref|XP_009407704.1|  PREDICTED: putative serine/threonine-protein...    356   4e-116   
ref|XP_006478006.1|  PREDICTED: probable LRR receptor-like serine...    355   4e-116   
gb|AFK44150.1|  unknown                                                 355   6e-116   
ref|XP_009149104.1|  PREDICTED: putative serine/threonine-protein...    355   6e-116   
ref|XP_004170048.1|  PREDICTED: probable LRR receptor-like serine...    355   7e-116   
emb|CBI15972.3|  unnamed protein product                                354   1e-115   
gb|EYU27526.1|  hypothetical protein MIMGU_mgv1a008049mg                354   1e-115   
ref|XP_009393313.1|  PREDICTED: putative serine/threonine-protein...    354   2e-115   
ref|XP_010923072.1|  PREDICTED: putative serine/threonine-protein...    352   2e-115   
ref|XP_010236833.1|  PREDICTED: probable LRR receptor-like serine...    357   2e-115   
ref|XP_004248347.1|  PREDICTED: putative serine/threonine-protein...    353   2e-115   
emb|CDY40041.1|  BnaC05g12740D                                          353   4e-115   
ref|XP_009627196.1|  PREDICTED: putative serine/threonine-protein...    353   5e-115   
ref|XP_006854496.1|  hypothetical protein AMTR_s00175p00044500          352   5e-115   
ref|XP_009344302.1|  PREDICTED: putative serine/threonine-protein...    353   7e-115   
ref|XP_010060678.1|  PREDICTED: putative serine/threonine-protein...    353   7e-115   
ref|XP_002285391.1|  PREDICTED: putative serine/threonine-protein...    352   1e-114   Vitis vinifera
ref|XP_008372847.1|  PREDICTED: putative serine/threonine-protein...    353   1e-114   
ref|XP_009377792.1|  PREDICTED: probable LRR receptor-like serine...    350   1e-114   
ref|XP_008372846.1|  PREDICTED: putative serine/threonine-protein...    352   1e-114   
ref|XP_006352577.1|  PREDICTED: probable leucine-rich repeat rece...    352   1e-114   
emb|CDP05995.1|  unnamed protein product                                352   1e-114   
ref|XP_008370070.1|  PREDICTED: probable LRR receptor-like serine...    351   2e-114   
ref|XP_009344303.1|  PREDICTED: putative serine/threonine-protein...    352   2e-114   
ref|XP_006304968.1|  hypothetical protein CARUB_v10012041mg             351   3e-114   
ref|XP_009377790.1|  PREDICTED: probable LRR receptor-like serine...    351   3e-114   
gb|KHG11618.1|  hypothetical protein F383_12148                         352   3e-114   
ref|XP_004294124.1|  PREDICTED: probable LRR receptor-like serine...    350   3e-114   
ref|XP_010926928.1|  PREDICTED: putative serine/threonine-protein...    350   5e-114   
ref|XP_008804702.1|  PREDICTED: putative serine/threonine-protein...    350   6e-114   
ref|XP_010539590.1|  PREDICTED: putative serine/threonine-protein...    350   6e-114   
ref|XP_008226283.1|  PREDICTED: putative serine/threonine-protein...    350   7e-114   
ref|XP_009417843.1|  PREDICTED: putative serine/threonine-protein...    350   7e-114   
ref|XP_009417850.1|  PREDICTED: putative serine/threonine-protein...    350   8e-114   
emb|CDX83948.1|  BnaC08g16970D                                          350   8e-114   
ref|XP_003530276.1|  PREDICTED: probable LRR receptor-like serine...    349   8e-114   
ref|XP_004294123.1|  PREDICTED: probable LRR receptor-like serine...    350   9e-114   
ref|XP_008383025.1|  PREDICTED: putative serine/threonine-protein...    350   1e-113   
ref|XP_002890180.1|  hypothetical protein ARALYDRAFT_471863             350   1e-113   
ref|XP_008383026.1|  PREDICTED: putative serine/threonine-protein...    350   1e-113   
gb|ACN36883.1|  unknown                                                 349   1e-113   Zea mays [maize]
ref|XP_007022315.1|  LRR receptor-like serine/threonine-protein k...    349   2e-113   
ref|NP_564003.1|  putative serine/threonine kinase                      349   2e-113   Arabidopsis thaliana [mouse-ear cress]
gb|EYU41879.1|  hypothetical protein MIMGU_mgv11b022476mg               348   2e-113   
ref|XP_004516018.1|  PREDICTED: probable LRR receptor-like serine...    348   2e-113   
gb|AAG10816.1|AC011808_4  Unknown protein                               348   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459208.1|  PREDICTED: putative serine/threonine-protein...    348   3e-113   
ref|XP_010459206.1|  PREDICTED: putative serine/threonine-protein...    348   3e-113   
ref|XP_003596009.1|  Protein kinase and PP2C-like domain-containi...    353   3e-113   
ref|XP_009340140.1|  PREDICTED: putative serine/threonine-protein...    348   3e-113   
ref|XP_006370174.1|  hypothetical protein POPTR_0001s40370g             348   4e-113   
ref|XP_008451770.1|  PREDICTED: putative serine/threonine-protein...    348   4e-113   
ref|XP_009110447.1|  PREDICTED: putative serine/threonine-protein...    348   4e-113   
ref|XP_006836383.1|  hypothetical protein AMTR_s00092p00128890          347   4e-113   
ref|XP_010497985.1|  PREDICTED: putative serine/threonine-protein...    348   4e-113   
ref|XP_011004868.1|  PREDICTED: putative serine/threonine-protein...    348   4e-113   
emb|CDP13621.1|  unnamed protein product                                348   4e-113   
ref|XP_011095671.1|  PREDICTED: putative serine/threonine-protein...    348   4e-113   
ref|XP_003540060.1|  PREDICTED: probable leucine-rich repeat rece...    348   4e-113   
ref|XP_006592542.1|  PREDICTED: probable leucine-rich repeat rece...    348   5e-113   
ref|XP_003623285.1|  hypothetical protein MTR_7g068190                  347   6e-113   
ref|XP_009340145.1|  PREDICTED: putative serine/threonine-protein...    348   6e-113   
ref|XP_006370175.1|  hypothetical protein POPTR_0001s40370g             347   8e-113   
ref|XP_006597981.1|  PREDICTED: probable LRR receptor-like serine...    347   9e-113   
gb|KHN11531.1|  Putative LRR receptor-like serine/threonine-prote...    347   1e-112   
ref|XP_006582132.1|  PREDICTED: probable LRR receptor-like serine...    347   1e-112   
ref|XP_010476779.1|  PREDICTED: putative serine/threonine-protein...    347   1e-112   
ref|XP_008451771.1|  PREDICTED: putative serine/threonine-protein...    346   1e-112   
ref|XP_010062713.1|  PREDICTED: putative serine/threonine-protein...    347   1e-112   
ref|XP_007133196.1|  hypothetical protein PHAVU_011G159700g             346   2e-112   
ref|NP_001053898.1|  Os04g0619400                                       346   2e-112   Oryza sativa Japonica Group [Japonica rice]
gb|KEH19488.1|  receptor-like kinase                                    346   2e-112   
emb|CDX96813.1|  BnaA08g23560D                                          352   2e-112   
ref|XP_006652835.1|  PREDICTED: probable leucine-rich repeat rece...    345   2e-112   
ref|XP_010258651.1|  PREDICTED: putative serine/threonine-protein...    346   2e-112   
ref|XP_010091126.1|  putative LRR receptor-like serine/threonine-...    347   2e-112   
gb|KHN45797.1|  Putative leucine-rich repeat receptor-like serine...    346   2e-112   
ref|XP_004137242.1|  PREDICTED: probable LRR receptor-like serine...    346   3e-112   
ref|XP_009380826.1|  PREDICTED: putative serine/threonine-protein...    345   3e-112   
dbj|BAK07460.1|  predicted protein                                      345   4e-112   
ref|XP_006370464.1|  kinase family protein                              345   4e-112   
ref|XP_009393310.1|  PREDICTED: putative serine/threonine-protein...    346   4e-112   
ref|XP_010093038.1|  putative LRR receptor-like serine/threonine-...    343   4e-112   
ref|XP_006582131.1|  PREDICTED: probable LRR receptor-like serine...    347   4e-112   
ref|XP_009380817.1|  PREDICTED: putative serine/threonine-protein...    345   4e-112   
gb|EEC69661.1|  hypothetical protein OsI_39081                          345   4e-112   
ref|XP_010907462.1|  PREDICTED: putative serine/threonine-protein...    346   4e-112   
ref|XP_002448547.1|  hypothetical protein SORBIDRAFT_06g028830          345   5e-112   
gb|KDP43401.1|  hypothetical protein JCGZ_26556                         345   5e-112   
ref|XP_009117753.1|  PREDICTED: putative serine/threonine-protein...    345   6e-112   
ref|XP_011006502.1|  PREDICTED: putative serine/threonine-protein...    345   6e-112   
ref|XP_009377791.1|  PREDICTED: putative serine/threonine-protein...    344   9e-112   
ref|XP_003575402.1|  PREDICTED: putative serine/threonine-protein...    344   1e-111   
ref|XP_003531815.1|  PREDICTED: probable LRR receptor-like serine...    344   1e-111   
ref|XP_004976838.1|  PREDICTED: probable leucine-rich repeat rece...    344   1e-111   
ref|NP_001146863.1|  serine/threonine-protein kinase receptor           344   1e-111   
ref|XP_002529950.1|  ATP binding protein, putative                      345   2e-111   
ref|XP_010694850.1|  PREDICTED: putative serine/threonine-protein...    343   2e-111   
ref|XP_009414523.1|  PREDICTED: putative serine/threonine-protein...    343   2e-111   
ref|XP_008806824.1|  PREDICTED: putative serine/threonine-protein...    343   2e-111   
ref|XP_009361746.1|  PREDICTED: putative serine/threonine-protein...    344   2e-111   
ref|XP_006646921.1|  PREDICTED: probable leucine-rich repeat rece...    343   3e-111   
emb|CDX81772.1|  BnaC08g38290D                                          343   3e-111   
ref|XP_009361745.1|  PREDICTED: putative serine/threonine-protein...    344   3e-111   
emb|CAJ86134.1|  H0313F03.21                                            344   3e-111   
gb|EAY95592.1|  hypothetical protein OsI_17443                          344   4e-111   
ref|XP_002317614.2|  hypothetical protein POPTR_0011s14530g             343   5e-111   
ref|XP_002524272.1|  ATP binding protein, putative                      342   5e-111   
gb|KEH19566.1|  receptor-like kinase                                    342   5e-111   
ref|XP_003563410.1|  PREDICTED: putative serine/threonine-protein...    342   5e-111   
ref|XP_003565479.1|  PREDICTED: putative serine/threonine-protein...    343   6e-111   
ref|XP_006853422.1|  hypothetical protein AMTR_s00032p00163130          349   6e-111   
ref|XP_004492426.1|  PREDICTED: probable leucine-rich repeat rece...    342   9e-111   
ref|XP_010240748.1|  PREDICTED: putative serine/threonine-protein...    342   1e-110   
emb|CAN65479.1|  hypothetical protein VITISV_011889                     344   1e-110   
ref|NP_001058352.1|  Os06g0676600                                       341   2e-110   
ref|XP_006656372.1|  PREDICTED: probable leucine-rich repeat rece...    341   2e-110   
ref|XP_002268737.1|  PREDICTED: putative serine/threonine-protein...    341   2e-110   
ref|XP_011030753.1|  PREDICTED: putative serine/threonine-protein...    341   2e-110   
dbj|BAJ93716.1|  predicted protein                                      340   3e-110   
ref|XP_010237040.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    342   3e-110   
ref|XP_010926923.1|  PREDICTED: putative serine/threonine-protein...    341   3e-110   
ref|XP_006602653.1|  PREDICTED: probable LRR receptor-like serine...    340   3e-110   
gb|EMT22885.1|  Putative LRR receptor-like serine/threonine-prote...    343   3e-110   
ref|XP_009406579.1|  PREDICTED: putative serine/threonine-protein...    340   3e-110   
ref|XP_008226520.1|  PREDICTED: putative serine/threonine-protein...    340   3e-110   
gb|EEC83067.1|  hypothetical protein OsI_28179                          340   4e-110   
ref|XP_007133318.1|  hypothetical protein PHAVU_011G169600g             340   5e-110   
ref|XP_008226521.1|  PREDICTED: putative serine/threonine-protein...    340   6e-110   
dbj|BAK03512.1|  predicted protein                                      339   9e-110   
ref|XP_007211406.1|  hypothetical protein PRUPE_ppa006890mg             339   1e-109   
ref|XP_004492425.1|  PREDICTED: probable leucine-rich repeat rece...    340   1e-109   
ref|XP_006366364.1|  PREDICTED: probable leucine-rich repeat rece...    337   1e-109   
ref|NP_001061212.1|  Os08g0200500                                       338   1e-109   
gb|KCW71361.1|  hypothetical protein EUGRSUZ_F04443                     348   1e-109   
ref|XP_004976837.1|  PREDICTED: probable leucine-rich repeat rece...    339   2e-109   
ref|NP_001045995.1|  Os02g0165100                                       338   2e-109   
gb|EEC81173.1|  hypothetical protein OsI_24148                          339   2e-109   
ref|XP_010275933.1|  PREDICTED: putative serine/threonine-protein...    338   3e-109   
ref|XP_010675415.1|  PREDICTED: putative serine/threonine-protein...    338   3e-109   
ref|XP_010675411.1|  PREDICTED: putative serine/threonine-protein...    338   4e-109   
ref|XP_006664184.1|  PREDICTED: probable LRR receptor-like serine...    337   6e-109   
ref|XP_011029553.1|  PREDICTED: putative serine/threonine-protein...    337   6e-109   
gb|KDO75884.1|  hypothetical protein CISIN_1g017503mg                   333   6e-109   
ref|XP_006482774.1|  PREDICTED: probable LRR receptor-like serine...    337   7e-109   
gb|EMT13186.1|  Putative LRR receptor-like serine/threonine-prote...    340   9e-109   
ref|XP_002316869.2|  hypothetical protein POPTR_0011s11330g             337   9e-109   
ref|XP_008667536.1|  PREDICTED: uncharacterized LOC100273687 isof...    336   1e-108   
ref|XP_010062805.1|  PREDICTED: putative serine/threonine-protein...    336   2e-108   
ref|XP_009335190.1|  PREDICTED: putative serine/threonine-protein...    335   3e-108   
gb|ACG44735.1|  serine/threonine-protein kinase receptor precursor      335   3e-108   
ref|XP_003575401.1|  PREDICTED: putative serine/threonine-protein...    336   4e-108   
ref|XP_004307394.1|  PREDICTED: probable LRR receptor-like serine...    335   4e-108   
gb|KGN53558.1|  hypothetical protein Csa_4G082350                       335   4e-108   
gb|EMT30893.1|  Putative LRR receptor-like serine/threonine-prote...    337   5e-108   
ref|XP_009335189.1|  PREDICTED: putative serine/threonine-protein...    335   5e-108   
ref|XP_010264701.1|  PREDICTED: putative serine/threonine-protein...    334   5e-108   
gb|AEF30546.1|  serine/threonine protein kinase Stpk-V                  335   8e-108   
gb|AFQ32886.1|  serine/threonine protein kinase Stpk-v2                 335   9e-108   
ref|XP_006646918.1|  PREDICTED: probable leucine-rich repeat rece...    335   1e-107   
ref|XP_008806819.1|  PREDICTED: putative serine/threonine-protein...    334   1e-107   
ref|XP_009342290.1|  PREDICTED: putative serine/threonine-protein...    333   2e-107   
ref|XP_004294202.1|  PREDICTED: probable LRR receptor-like serine...    334   2e-107   
ref|XP_009412033.1|  PREDICTED: putative serine/threonine-protein...    333   4e-107   
ref|XP_010253640.1|  PREDICTED: putative serine/threonine-protein...    332   5e-107   
ref|XP_010064054.1|  PREDICTED: probable LRR receptor-like serine...    350   5e-107   
ref|XP_004951875.1|  PREDICTED: probable leucine-rich repeat rece...    333   5e-107   
gb|KCW88110.1|  hypothetical protein EUGRSUZ_A00508                     329   5e-107   
dbj|BAJ93188.1|  predicted protein                                      333   5e-107   
ref|XP_002438847.1|  hypothetical protein SORBIDRAFT_10g027140          332   9e-107   
gb|KCW71355.1|  hypothetical protein EUGRSUZ_F04436                     347   9e-107   
gb|AHI10999.1|  serine/threonine protein kinase                         332   1e-106   
gb|AEF30550.1|  serine/threonine protein kinase Stpk-B                  332   1e-106   
gb|ACN35770.1|  unknown                                                 331   1e-106   
ref|NP_001148145.1|  serine/threonine-protein kinase receptor           331   1e-106   
ref|XP_002443536.1|  hypothetical protein SORBIDRAFT_08g021170          331   1e-106   
ref|XP_008382072.1|  PREDICTED: putative serine/threonine-protein...    331   2e-106   
gb|AHI10998.1|  serine/threonine protein kinase                         331   2e-106   
ref|XP_010234443.1|  PREDICTED: putative serine/threonine-protein...    330   2e-106   
ref|XP_010064059.1|  PREDICTED: probable LRR receptor-like serine...    348   2e-106   
ref|XP_002316361.1|  hypothetical protein POPTR_0010s22820g             329   2e-106   
gb|EEE56371.1|  hypothetical protein OsJ_05508                          330   4e-106   
ref|XP_011026778.1|  PREDICTED: probable LRR receptor-like serine...    348   4e-106   
ref|XP_010234442.1|  PREDICTED: putative serine/threonine-protein...    330   4e-106   
gb|EMT05008.1|  Putative LRR receptor-like serine/threonine-prote...    332   6e-106   
ref|XP_010064058.1|  PREDICTED: probable LRR receptor-like serine...    347   7e-106   
ref|XP_002445187.1|  hypothetical protein SORBIDRAFT_07g005620          328   2e-105   
gb|AEF30549.1|  serine/threonine protein kinase Stpk-D                  329   2e-105   
ref|XP_008369292.1|  PREDICTED: probable LRR receptor-like serine...    328   2e-105   
ref|XP_011029554.1|  PREDICTED: putative serine/threonine-protein...    327   3e-105   
gb|EPS61742.1|  hypothetical protein M569_13052                         329   3e-105   
ref|XP_002297945.2|  hypothetical protein POPTR_0001s11460g             344   3e-105   
ref|XP_006583645.1|  PREDICTED: probable LRR receptor-like serine...    327   3e-105   
gb|KCW71209.1|  hypothetical protein EUGRSUZ_F04301                     335   6e-105   
gb|KCW68790.1|  hypothetical protein EUGRSUZ_F023912                    343   6e-105   
ref|XP_010064741.1|  PREDICTED: probable LRR receptor-like serine...    344   8e-105   
ref|XP_008369309.1|  PREDICTED: putative serine/threonine-protein...    326   9e-105   
ref|XP_010064057.1|  PREDICTED: probable LRR receptor-like serine...    341   1e-104   
ref|XP_006659207.1|  PREDICTED: probable LRR receptor-like serine...    325   1e-104   
ref|XP_011069399.1|  PREDICTED: probable LRR receptor-like serine...    335   1e-104   
ref|XP_008371856.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    333   1e-104   
ref|XP_004963158.1|  PREDICTED: probable LRR receptor-like serine...    326   1e-104   
emb|CAN66040.1|  hypothetical protein VITISV_035756                     333   2e-104   
ref|XP_007220777.1|  hypothetical protein PRUPE_ppa026641mg             325   2e-104   
ref|XP_010064056.1|  PREDICTED: probable LRR receptor-like serine...    342   3e-104   
ref|XP_010274147.1|  PREDICTED: probable LRR receptor-like serine...    331   3e-104   
ref|XP_010064055.1|  PREDICTED: probable LRR receptor-like serine...    342   4e-104   
gb|EEC72555.1|  hypothetical protein OsI_05981                          324   4e-104   
ref|XP_002983367.1|  hypothetical protein SELMODRAFT_180094             331   5e-104   
ref|XP_001761477.1|  predicted protein                                  322   6e-104   
gb|KCW71354.1|  hypothetical protein EUGRSUZ_F04434                     341   7e-104   
emb|CAN73906.1|  hypothetical protein VITISV_029158                     333   7e-104   
ref|XP_009774249.1|  PREDICTED: putative serine/threonine-protein...    323   9e-104   
ref|XP_007214789.1|  hypothetical protein PRUPE_ppa015982mg             336   9e-104   
ref|XP_002303698.2|  hypothetical protein POPTR_0003s14780g             339   9e-104   
gb|EMT28879.1|  Putative LRR receptor-like serine/threonine-prote...    328   1e-103   
ref|XP_008233459.1|  PREDICTED: putative serine/threonine-protein...    323   1e-103   
ref|XP_009378144.1|  PREDICTED: putative serine/threonine-protein...    323   2e-103   
ref|XP_008355565.1|  PREDICTED: probable LRR receptor-like serine...    328   2e-103   
ref|XP_010040869.1|  PREDICTED: probable LRR receptor-like serine...    341   2e-103   
ref|XP_010645959.1|  PREDICTED: probable LRR receptor-like serine...    337   2e-103   
ref|NP_001151196.1|  serine/threonine-protein kinase receptor           323   2e-103   
ref|XP_004951873.1|  PREDICTED: probable leucine-rich repeat rece...    324   2e-103   
ref|XP_009774244.1|  PREDICTED: putative serine/threonine-protein...    322   2e-103   
ref|XP_010098477.1|  putative LRR receptor-like serine/threonine-...    338   2e-103   
gb|KHM98861.1|  Putative LRR receptor-like serine/threonine-prote...    330   3e-103   
gb|AFW72511.1|  putative protein kinase superfamily protein             320   3e-103   
ref|XP_008676647.1|  PREDICTED: uncharacterized LOC100194403 isof...    323   3e-103   
emb|CAN64306.1|  hypothetical protein VITISV_024862                     323   3e-103   
ref|XP_008679090.1|  PREDICTED: serine/threonine-protein kinase r...    322   3e-103   
ref|XP_010658415.1|  PREDICTED: putative serine/threonine-protein...    322   4e-103   
ref|XP_006448778.1|  hypothetical protein CICLE_v10014641mg             329   5e-103   
gb|KDP35216.1|  hypothetical protein JCGZ_09375                         338   5e-103   
ref|XP_010655872.1|  PREDICTED: probable LRR receptor-like serine...    335   7e-103   
ref|XP_008677456.1|  PREDICTED: uncharacterized protein LOC100304...    321   9e-103   
ref|XP_002513383.1|  ATP binding protein, putative                      338   1e-102   
emb|CDP20736.1|  unnamed protein product                                338   1e-102   
dbj|BAK03391.1|  predicted protein                                      320   1e-102   
ref|XP_011022401.1|  PREDICTED: probable LRR receptor-like serine...    337   1e-102   
ref|XP_006448777.1|  hypothetical protein CICLE_v10018038mg             337   1e-102   
ref|XP_010645958.1|  PREDICTED: probable LRR receptor-like serine...    337   1e-102   
ref|XP_007211340.1|  hypothetical protein PRUPE_ppa001152mg             335   1e-102   
ref|XP_011069383.1|  PREDICTED: probable LRR receptor-like serine...    338   1e-102   
ref|XP_002529290.1|  ATP binding protein, putative                      328   1e-102   
ref|XP_008677461.1|  PREDICTED: uncharacterized protein LOC100304...    321   2e-102   
gb|AAF02839.1|AC009894_10  Similar to serine/threonine kinases          335   2e-102   
ref|XP_006448781.1|  hypothetical protein CICLE_v10018029mg             337   2e-102   
ref|XP_011097808.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    339   2e-102   
ref|XP_006468410.1|  PREDICTED: probable LRR receptor-like serine...    335   2e-102   
ref|XP_007211341.1|  hypothetical protein PRUPE_ppa001211mg             334   2e-102   
gb|KCW44835.1|  hypothetical protein EUGRSUZ_L01594                     335   2e-102   
emb|CBI20538.3|  unnamed protein product                                335   2e-102   
ref|XP_010645957.1|  PREDICTED: probable LRR receptor-like serine...    337   3e-102   
ref|XP_002271607.3|  PREDICTED: probable LRR receptor-like serine...    337   3e-102   
emb|CBI20535.3|  unnamed protein product                                337   3e-102   
ref|XP_010655871.1|  PREDICTED: probable LRR receptor-like serine...    337   3e-102   
ref|XP_007133315.1|  hypothetical protein PHAVU_011G169300g             337   3e-102   
ref|XP_002281059.1|  PREDICTED: putative serine/threonine-protein...    320   3e-102   
ref|XP_006468413.1|  PREDICTED: probable LRR receptor-like serine...    337   4e-102   
ref|XP_011006995.1|  PREDICTED: probable LRR receptor-like serine...    337   4e-102   
ref|XP_011022400.1|  PREDICTED: probable LRR receptor-like serine...    338   4e-102   
ref|XP_010942352.1|  PREDICTED: probable LRR receptor-like serine...    337   4e-102   
ref|XP_010093040.1|  putative LRR receptor-like serine/threonine-...    338   5e-102   
ref|XP_010657566.1|  PREDICTED: probable LRR receptor-like serine...    333   5e-102   
ref|XP_010678919.1|  PREDICTED: probable LRR receptor-like serine...    336   5e-102   
ref|XP_010065123.1|  PREDICTED: probable LRR receptor-like serine...    336   6e-102   
ref|XP_008225767.1|  PREDICTED: probable LRR receptor-like serine...    330   6e-102   
ref|XP_006468414.1|  PREDICTED: probable LRR receptor-like serine...    336   7e-102   
ref|XP_004143242.1|  PREDICTED: putative serine/threonine-protein...    318   7e-102   
ref|XP_008449259.1|  PREDICTED: putative serine/threonine-protein...    318   8e-102   
emb|CBI32727.3|  unnamed protein product                                320   9e-102   
ref|XP_008447120.1|  PREDICTED: probable LRR receptor-like serine...    336   9e-102   
ref|XP_007009814.1|  LRR receptor-like serine/threonine-protein k...    318   1e-101   
ref|XP_010274130.1|  PREDICTED: probable LRR receptor-like serine...    336   1e-101   
ref|NP_564710.1|  leucine-rich repeat transmembrane protein kinase      335   1e-101   
gb|KDP25093.1|  hypothetical protein JCGZ_22628                         335   1e-101   
ref|XP_002272816.2|  PREDICTED: probable LRR receptor-like serine...    335   1e-101   
gb|KHF97788.1|  hypothetical protein F383_13818                         325   2e-101   
ref|XP_010098478.1|  putative LRR receptor-like serine/threonine-...    334   2e-101   
ref|XP_006468409.1|  PREDICTED: probable LRR receptor-like serine...    335   3e-101   
gb|EYU33781.1|  hypothetical protein MIMGU_mgv1a000612mg                335   3e-101   
gb|KHG01148.1|  hypothetical protein F383_22594                         334   3e-101   
ref|XP_002310677.1|  leucine-rich repeat family protein                 334   3e-101   
ref|XP_002529567.1|  ATP binding protein, putative                      317   4e-101   
ref|XP_009128532.1|  PREDICTED: probable LRR receptor-like serine...    327   4e-101   
gb|AEF30548.1|  serine/threonine protein kinase Stpk-A                  318   4e-101   
ref|XP_006448775.1|  hypothetical protein CICLE_v10014117mg             334   4e-101   
ref|XP_011031811.1|  PREDICTED: putative serine/threonine-protein...    317   4e-101   
ref|XP_010645976.1|  PREDICTED: probable LRR receptor-like serine...    335   4e-101   
emb|CAN73140.1|  hypothetical protein VITISV_019010                     330   4e-101   
gb|KGN53521.1|  hypothetical protein Csa_4G064040                       315   6e-101   
ref|XP_009341191.1|  PREDICTED: probable LRR receptor-like serine...    331   6e-101   
gb|EMT15408.1|  Putative LRR receptor-like serine/threonine-prote...    316   6e-101   
emb|CBI39037.3|  unnamed protein product                                333   6e-101   
ref|XP_003633055.2|  PREDICTED: probable LRR receptor-like serine...    333   6e-101   
gb|KCW45029.1|  hypothetical protein EUGRSUZ_L013821                    316   7e-101   
ref|XP_010657565.1|  PREDICTED: probable LRR receptor-like serine...    333   7e-101   
gb|KGN44274.1|  hypothetical protein Csa_7G237890                       333   8e-101   
ref|XP_004972634.1|  PREDICTED: probable LRR receptor-like serine...    315   9e-101   
gb|KDO48414.1|  hypothetical protein CISIN_1g0182632mg                  314   9e-101   
ref|XP_009342816.1|  PREDICTED: putative serine/threonine-protein...    316   9e-101   
ref|XP_007027313.1|  LRR receptor-like serine/threonine-protein k...    318   1e-100   
ref|XP_002267129.1|  PREDICTED: probable LRR receptor-like serine...    333   1e-100   
ref|XP_010244456.1|  PREDICTED: probable LRR receptor-like serine...    329   1e-100   
ref|XP_010243682.1|  PREDICTED: probable LRR receptor-like serine...    332   1e-100   



>ref|XP_009765295.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765296.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765297.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765298.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nicotiana sylvestris]
Length=373

 Score =   487 bits (1254),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 235/319 (74%), Positives = 267/319 (84%), Gaps = 2/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C+CFGAS+VR+ R  +   +++ D G  S A+TRNFSY ELR ATNNF Q NKIGRGG
Sbjct  1    MNCSCFGASTVRQKRGVDHVHKDTPDTGGCSTAKTRNFSYSELRIATNNFHQSNKIGRGG  60

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK G +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIGCC+  +NRI
Sbjct  61   FGTVYKGTLKRGVEVAVKTLSAESRQGLREFLTEIETISDVRHPNLVELIGCCLEGSNRI  120

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+ENRSLDR LFG S   VKLEW TRAAIC+GTARGLAYLHEE+ PHIVHRDIKAS
Sbjct  121  LVYEYVENRSLDRALFGSSARNVKLEWDTRAAICLGTARGLAYLHEELVPHIVHRDIKAS  180

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKDY PKIGDFGLAKLFPDNITHI+TQI GT GYLAPEYV+  QLT KADVYSFGV
Sbjct  181  NILLDKDYKPKIGDFGLAKLFPDNITHITTQIKGTTGYLAPEYVIGRQLTSKADVYSFGV  240

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE VSGRSS S  W G QK LLE AW LY+EG +LELVD E+  FP++EV+KY+KVAL
Sbjct  241  LILETVSGRSSGSGTWKG-QKLLLELAWQLYEEGKLLELVDPELRDFPEKEVVKYIKVAL  299

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ + +RRP MSQV+DM
Sbjct  300  FCTQENTNRRPMMSQVLDM  318



>ref|XP_004232848.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Solanum lycopersicum]
Length=366

 Score =   484 bits (1246),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 265/318 (83%), Gaps = 4/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC  FG     R +  +L   ++ DAG +SIA T+NFS++ELR ATNNF Q+NKIGRGG
Sbjct  1    MSCCFFGD----RKKGHDLVHHDTRDAGGDSIASTKNFSFNELRLATNNFHQINKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK G+ VAVK L+A+S+QG+REFLTEIET+SN +H NLVE+IGCC   NNRI
Sbjct  57   FGTVYKGTLKQGKDVAVKTLAAESRQGLREFLTEIETISNVKHPNLVEIIGCCADGNNRI  116

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYLENRSLDR LFG   ++KLEW  R  IC+GTARGLAYLHEE+ PHIVHRDIKASN
Sbjct  117  LVYEYLENRSLDRALFGSRTSIKLEWEKRTTICLGTARGLAYLHEELVPHIVHRDIKASN  176

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKDYTPKIGDFGLAKLFPDNITHIST+IAGT GYLAPEYVL GQLTMKADVYSFGVL
Sbjct  177  ILLDKDYTPKIGDFGLAKLFPDNITHISTKIAGTTGYLAPEYVLGGQLTMKADVYSFGVL  236

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            ILE VSG+SSSS  W G +++LLE +W LY E  +LELVD E++ FP+ EV++Y+K AL 
Sbjct  237  ILEAVSGKSSSSRIWQGDKRSLLEWSWRLYQEEKLLELVDEELDEFPEREVVRYIKTALF  296

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+A+RRP MSQVI+M
Sbjct  297  CTQANANRRPMMSQVIEM  314



>ref|XP_010316730.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Solanum lycopersicum]
Length=353

 Score =   483 bits (1242),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 265/318 (83%), Gaps = 4/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC  FG     R +  +L   ++ DAG +SIA T+NFS++ELR ATNNF Q+NKIGRGG
Sbjct  1    MSCCFFGD----RKKGHDLVHHDTRDAGGDSIASTKNFSFNELRLATNNFHQINKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK G+ VAVK L+A+S+QG+REFLTEIET+SN +H NLVE+IGCC   NNRI
Sbjct  57   FGTVYKGTLKQGKDVAVKTLAAESRQGLREFLTEIETISNVKHPNLVEIIGCCADGNNRI  116

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYLENRSLDR LFG   ++KLEW  R  IC+GTARGLAYLHEE+ PHIVHRDIKASN
Sbjct  117  LVYEYLENRSLDRALFGSRTSIKLEWEKRTTICLGTARGLAYLHEELVPHIVHRDIKASN  176

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKDYTPKIGDFGLAKLFPDNITHIST+IAGT GYLAPEYVL GQLTMKADVYSFGVL
Sbjct  177  ILLDKDYTPKIGDFGLAKLFPDNITHISTKIAGTTGYLAPEYVLGGQLTMKADVYSFGVL  236

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            ILE VSG+SSSS  W G +++LLE +W LY E  +LELVD E++ FP+ EV++Y+K AL 
Sbjct  237  ILEAVSGKSSSSRIWQGDKRSLLEWSWRLYQEEKLLELVDEELDEFPEREVVRYIKTALF  296

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+A+RRP MSQVI+M
Sbjct  297  CTQANANRRPMMSQVIEM  314



>ref|XP_006347067.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Solanum tuberosum]
Length=366

 Score =   482 bits (1241),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 225/318 (71%), Positives = 265/318 (83%), Gaps = 4/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGA    R +  +L   ++ D G +SIA T+NFS++ELR ATNNF Q+NKIGRGG
Sbjct  1    MSCCCFGA----RKKGNDLVHHDTRDTGGDSIASTKNFSFNELRLATNNFHQINKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL  G++VAVK L+A+S+QG+REFLTEIET+SN +H NLVE+IGCC   NNRI
Sbjct  57   FGTVYKGTLTQGKEVAVKTLAAESRQGLREFLTEIETISNVKHPNLVEIIGCCADGNNRI  116

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYLENRSLD+ LFG   ++KLEW  R  IC+GTARGLAYLHEE+ PHIVHRDIKASN
Sbjct  117  LVYEYLENRSLDQALFGSRTSIKLEWEKRTTICLGTARGLAYLHEELVPHIVHRDIKASN  176

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKDYTPKIGDFGLAKLFPDNITHIST+IAGT GYLAPEYVL GQLTMKADVYSFGVL
Sbjct  177  ILLDKDYTPKIGDFGLAKLFPDNITHISTKIAGTTGYLAPEYVLGGQLTMKADVYSFGVL  236

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            ILE VSG+SSSS  W   +++LLE +W LY E  +LELVD E++ FP++EV++Y+K AL 
Sbjct  237  ILEAVSGKSSSSRIWQSDKRSLLEWSWRLYQEEKLLELVDEELDDFPEKEVIRYIKTALF  296

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+A+RRP M QVI+M
Sbjct  297  CTQANANRRPMMGQVIEM  314



>ref|XP_009597888.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Nicotiana tomentosiformis]
Length=366

 Score =   477 bits (1228),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 230/318 (72%), Positives = 268/318 (84%), Gaps = 4/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC  FGA    R +  +L   ++ D G  ++A T+NFS+ ELR ATNNF Q NKIGRGG
Sbjct  1    MSCCFFGA----RKKGDDLVHHDTRDTGGRAVASTKNFSFSELRIATNNFHQTNKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLKNG+++AVK L+A+SKQG+REFLTEIET+SN RH NLVE+IGCCV  NNRI
Sbjct  57   FGTVYKGTLKNGKEIAVKTLAAESKQGLREFLTEIETISNVRHPNLVEIIGCCVDGNNRI  116

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYL NRSLD+ LFG    +KLEW  RAAIC+GTA+GLAYLHEE+ PHIVHRDIKASN
Sbjct  117  LVYEYLVNRSLDQALFGSRINIKLEWDKRAAICLGTAQGLAYLHEELVPHIVHRDIKASN  176

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKDYTPKIGDFGLAKLFPDNITHIST+IAGT GYLAPEYVL GQLTMKADVYSFGVL
Sbjct  177  ILLDKDYTPKIGDFGLAKLFPDNITHISTKIAGTTGYLAPEYVLGGQLTMKADVYSFGVL  236

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            ILE VSGRSSSS  W G +K+LL  AW LY++  +LELVD+E++ FP++EV++Y+KVAL 
Sbjct  237  ILETVSGRSSSSSIWQGDKKSLLGWAWQLYEDRKLLELVDAELDDFPEKEVVRYIKVALF  296

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+A+RRP MSQVI+M
Sbjct  297  CTQANANRRPMMSQVIEM  314



>ref|XP_011096248.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
 ref|XP_011096249.1| PREDICTED: putative serine/threonine-protein kinase [Sesamum 
indicum]
Length=373

 Score =   477 bits (1228),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 265/318 (83%), Gaps = 0/318 (0%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFGAS+VR+ R+   A Q          A+T++FSY+ELR ATNNF + NKIGRGG
Sbjct  1    MGCSCFGASTVRQKRSDRQAHQPKQVEEGALSAKTKSFSYNELRAATNNFHRSNKIGRGG  60

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG L NG +VAVK LSA+SKQG+REFLTEI+T+SN +H NLVEL+GCCVH  N+I
Sbjct  61   FGTVYKGILGNGTEVAVKTLSAESKQGVREFLTEIDTISNVKHPNLVELLGCCVHGPNQI  120

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYLEN S+DR L G   ++KL+W  R+ IC+GTARGLAYLHEE+ PHIVHRDIKASN
Sbjct  121  LVYEYLENNSIDRALLGSKRSIKLDWKQRSVICMGTARGLAYLHEELVPHIVHRDIKASN  180

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKD+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEYVL GQLTMKADVYSFGVL
Sbjct  181  ILLDKDFQPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYVLGGQLTMKADVYSFGVL  240

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
             LE+VSG+SS++ N+GG QK L+E AW LY+EG +L+LVD E+E F ++EVL+YMKVAL 
Sbjct  241  TLEIVSGKSSANTNYGGGQKLLVEWAWELYEEGKLLDLVDPELEDFREDEVLRYMKVALF  300

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+ASRRP MSQVI M
Sbjct  301  CTQANASRRPAMSQVIQM  318



>emb|CDO99571.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   471 bits (1211),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 224/318 (70%), Positives = 262/318 (82%), Gaps = 0/318 (0%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFGASS ++NR    ++ ++ DA    + +T+NFS +EL  AT+NF Q NKIGRGG
Sbjct  1    MGCCCFGASSTKQNRANYYSRPDTGDAEGILLGKTKNFSINELNAATDNFHQSNKIGRGG  60

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG LK+G  VAVK LSA SKQG+REFLTEIET+SN +H NLV +IGCCVH  +RI
Sbjct  61   FGTVYKGKLKSGTPVAVKKLSAFSKQGVREFLTEIETISNVQHPNLVRMIGCCVHGPDRI  120

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYLEN+SLD  L G+S  V LEW+ R AIC+GTARGLAYLHEE+ PHIVHRDIKASN
Sbjct  121  LVYEYLENKSLDNALLGRSRVVNLEWNKRTAICMGTARGLAYLHEELVPHIVHRDIKASN  180

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKD+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLTMKAD+YSFGV+
Sbjct  181  ILLDKDFAPKIGDFGLAKLFPDDITHISTKIAGTTGYLAPEYALGGQLTMKADIYSFGVV  240

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            +LEVVSG+SSSS  WGG +K LLE AW  Y+EG +LELVD E++ FP++EVL+YMKVAL 
Sbjct  241  VLEVVSGKSSSSSFWGGARKLLLEEAWQFYEEGKLLELVDPELKEFPEQEVLRYMKVALF  300

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA A RRP MSQVI+M
Sbjct  301  CTQAKAHRRPLMSQVIEM  318



>ref|XP_006343244.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Solanum tuberosum]
 ref|XP_006343245.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Solanum tuberosum]
Length=370

 Score =   467 bits (1201),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 227/319 (71%), Positives = 260/319 (82%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C+CFGAS+ R+ R  +L  Q   D    S A+T+N SY ELR ATNNF Q NKIGRGG
Sbjct  1    MNCSCFGASTQRQKRGVDLVHQ---DTAGCSTAKTKNISYSELRRATNNFHQSNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKGTL+NG +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIG C+   NRI
Sbjct  58   FGIVYKGTLRNGMEVAVKTLSAESRQGLREFLTEIETISDIRHPNLVELIGYCLDGTNRI  117

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN+SLDR LFG S + VKL+W TRAAIC+GT  GLA+LHEE+ PHIVHRDIKAS
Sbjct  118  LVYEYLENKSLDRALFGSSTSNVKLDWDTRAAICLGTGTGLAFLHEELVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKDY PKIGDFGLAKLFPDNITHI+TQI GT GYLAPEYV+  QLT KADVYSFGV
Sbjct  178  NILLDKDYKPKIGDFGLAKLFPDNITHITTQIKGTTGYLAPEYVMGRQLTSKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE VSGRSS S  W G QK+LLE AW  Y+EG +LELVD E+  FP++EVLKY+KVAL
Sbjct  238  LLLETVSGRSSGSGTWQG-QKSLLESAWEFYEEGKLLELVDPEMGDFPEKEVLKYIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ  A+RRP MSQV+DM
Sbjct  297  FCTQEKANRRPIMSQVLDM  315



>ref|XP_006594324.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Glycine max]
 gb|KHN10020.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=367

 Score =   466 bits (1198),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 217/319 (68%), Positives = 261/319 (82%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGAS+++R R  +    E        +   +NFS  +LR AT+N+    K+GRGG
Sbjct  1    MSCGCFGASTLKRKRNPSRTPNE---IDGFPLDNVKNFSDKDLRLATDNYNPSKKLGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVY+GTLKNG+QVAVK LSA SKQG+REFLTEI+T+SN +H NLVEL+GCCV E NRI
Sbjct  58   FGTVYQGTLKNGQQVAVKTLSAGSKQGVREFLTEIKTISNVKHPNLVELVGCCVQEPNRI  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G +S  ++L+W  R+AIC+GTARGLA+LHEE+ PHIVHRDIKAS
Sbjct  118  LVYEYVENNSLDRALLGPRSSNIRLDWRKRSAICMGTARGLAFLHEELVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFGV
Sbjct  178  NILLDRDFKPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SG+SS+  NWGG  K LLE AWNLY+EG +LELVD ++  FP+EEV++YMKVA 
Sbjct  238  LILEIISGKSSARTNWGGSNKFLLEWAWNLYEEGKLLELVDPDMVEFPEEEVIRYMKVAF  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+ASRRP MSQV+DM
Sbjct  298  FCTQAAASRRPMMSQVVDM  316



>ref|XP_009607272.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607273.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607274.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Nicotiana 
tomentosiformis]
Length=373

 Score =   465 bits (1196),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 234/319 (73%), Positives = 267/319 (84%), Gaps = 2/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C+CFGAS+VR+ R  +   +++ D G  S A+T+NFSY ELR ATNNF Q NKIGRGG
Sbjct  1    MNCSCFGASTVRQKRGVDHVHRDTPDTGGCSTAKTKNFSYSELRIATNNFHQSNKIGRGG  60

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK G +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIGCC+  +NRI
Sbjct  61   FGTVYKGTLKRGVEVAVKTLSAESRQGLREFLTEIETISDVRHPNLVELIGCCLEGSNRI  120

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLENRSLDR LFG S   VKLEW TRAAIC+GTARGLAYLHEE+ PHIVHRDIKAS
Sbjct  121  LVYEYLENRSLDRALFGSSTRNVKLEWDTRAAICLGTARGLAYLHEELVPHIVHRDIKAS  180

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKDY PKIGDFGLAKLFPDNITHI+TQI GT GYLAPEYV+  QLT KADVYSFGV
Sbjct  181  NILLDKDYKPKIGDFGLAKLFPDNITHITTQIKGTTGYLAPEYVIGRQLTSKADVYSFGV  240

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE VSGRSS S  W G QK LLE AW LY+E  +LELVD E+  FP++EV+KY+KVAL
Sbjct  241  LILETVSGRSSGSGTWQG-QKLLLELAWQLYEEEKLLELVDPELGDFPEKEVVKYIKVAL  299

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ +A+RRP MSQV++M
Sbjct  300  FCTQENANRRPMMSQVLEM  318



>ref|XP_004234122.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Solanum lycopersicum]
 ref|XP_004234123.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Solanum lycopersicum]
Length=370

 Score =   462 bits (1190),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 226/319 (71%), Positives = 259/319 (81%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C+CFGAS+ R+ +  +L  Q   D    S A+T N SY ELR ATNNF Q NKIGRGG
Sbjct  1    MNCSCFGASTQRQKKGVDLVHQ---DTAGCSTAKTENISYSELRRATNNFHQSNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKGTL+NG +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIG C+  +NRI
Sbjct  58   FGIVYKGTLRNGMEVAVKTLSAESRQGLREFLTEIETISDIRHPNLVELIGYCLDGHNRI  117

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN+SLDR LFG S + VKL+W TRAAIC+GTA GLA+LHEE+ PHIVHRDIKAS
Sbjct  118  LVYEYLENKSLDRALFGSSTSNVKLDWETRAAICLGTATGLAFLHEELVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKDY PKIGDFGLAKLFPDNITHI+TQI GT GYLAPEYV   QLT KADVYSFGV
Sbjct  178  NILLDKDYKPKIGDFGLAKLFPDNITHITTQIKGTTGYLAPEYVRGRQLTSKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE VSGRSS S  W G QK LLE AW  Y+EG +LELVD E+  FP+++VLKY+KVAL
Sbjct  238  LLLETVSGRSSGSGTWQG-QKLLLESAWEFYEEGKLLELVDPEMGDFPEKQVLKYIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ  A+RRP MSQV+DM
Sbjct  297  FCTQEKANRRPMMSQVLDM  315



>ref|XP_009777261.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
Length=366

 Score =   460 bits (1183),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 228/318 (72%), Positives = 268/318 (84%), Gaps = 4/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC  FGA    R + G+L   ++ D  D ++A T+NFS+ ELR ATNNF Q NKIGRGG
Sbjct  1    MSCCLFGA----RKKGGDLVHHDTRDTEDRAVASTKNFSFSELRIATNNFHQTNKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLKNG+++AVK L+A+SKQG+REFLTEIET+SN RH NLVE+IGCC   NNRI
Sbjct  57   FGTVYKGTLKNGKEIAVKTLAAESKQGLREFLTEIETISNVRHPNLVEIIGCCADGNNRI  116

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYL NRSLD+ LFG   ++KLEW  RAAIC+GTA+GLAYLHEE+ PHIVHRDIKASN
Sbjct  117  LVYEYLVNRSLDQALFGSRISIKLEWDKRAAICLGTAQGLAYLHEELVPHIVHRDIKASN  176

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKDYTPKIGDFGLAKLFPDNITHIST+IAGT GYLAPEYVL GQLTMKADVYSFGVL
Sbjct  177  ILLDKDYTPKIGDFGLAKLFPDNITHISTKIAGTTGYLAPEYVLGGQLTMKADVYSFGVL  236

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            ILE +SGRSSSS  W G +K+LL  AW LY++  +LELVD+E++ F ++EV++Y+KVAL 
Sbjct  237  ILETISGRSSSSSIWRGDKKSLLGWAWQLYEDRKLLELVDAELDDFLEKEVVRYIKVALF  296

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+A+RRP MSQVI+M
Sbjct  297  CTQANANRRPMMSQVIEM  314



>emb|CBI35687.3| unnamed protein product [Vitis vinifera]
Length=441

 Score =   462 bits (1189),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 265/334 (79%), Gaps = 5/334 (1%)
 Frame = -1

Query  1004  VECVIRIGSFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELR  825
             V C+I   +      VMSC+CFG S+      GN A Q+      N + +T+  S++EL+
Sbjct  62    VLCLIFPATSGILQTVMSCSCFGVSTADSKGKGNRASQK---IDGNLLEKTKQISFNELK  118

Query  824   TATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHS  645
              AT+NF   +KIGRGGFGTVYKGTLKNGR+VAVK LS  SKQG+REFLTEI T+SN RH 
Sbjct  119   KATDNFHPSSKIGRGGFGTVYKGTLKNGREVAVKMLSTSSKQGLREFLTEINTISNVRHP  178

Query  644   NLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLH  465
             NLVELIGCCVH NN+ILVYEY+EN S+D+VL G    + L+W  R+AIC+GTARGLA+LH
Sbjct  179   NLVELIGCCVHGNNKILVYEYVENNSIDQVLLGHK--IILDWGKRSAICMGTARGLAFLH  236

Query  464   EEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVL  285
             EE+ PHIVHRDIKASNILL+KD++PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L
Sbjct  237   EELVPHIVHRDIKASNILLEKDFSPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAL  296

Query  284   AGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE  105
              GQLTMKADVYSFGVL+LE++SG++SS  N+GG QK LLE AW L+ EG  LELVD E+ 
Sbjct  297   GGQLTMKADVYSFGVLVLEIISGKTSSQANFGGSQKFLLEWAWQLHIEGRFLELVDPELV  356

Query  104   RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
              FP+EEV++Y KVA  CTQA+ASRRP MSQV+DM
Sbjct  357   EFPEEEVMRYAKVAFFCTQAAASRRPLMSQVVDM  390



>gb|KHN07273.1| Putative LRR receptor-like serine/threonine-protein kinase, partial 
[Glycine soja]
Length=374

 Score =   459 bits (1181),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 259/320 (81%), Gaps = 4/320 (1%)
 Frame = -1

Query  959  VMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            +MSC CFGAS++++ R  +    E        +   +NFS  +LR AT+N+    K+GRG
Sbjct  7    IMSCGCFGASTLKKKRNPSDTPNE---IDGFPLDNVKNFSDKDLRLATDNYNPSKKLGRG  63

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VY+GTLKNGRQVAVK LSA SKQG+REFLTEI+T+SN +H NLVEL+GCCV E NR
Sbjct  64   GFGIVYQGTLKNGRQVAVKTLSAGSKQGVREFLTEIKTISNVKHPNLVELVGCCVQEPNR  123

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYE++EN SLDR L G  G+ ++L+W  R+AIC+GTARGLA+LHEE  PHIVHRDIKA
Sbjct  124  ILVYEFVENNSLDRALLGSRGSNIRLDWRKRSAICMGTARGLAFLHEEHVPHIVHRDIKA  183

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFG
Sbjct  184  SNILLDRDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFG  243

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE++SG+SS+  NWGG  K LLE AW LY+EG +LELVD ++  FP++EV++YMKVA
Sbjct  244  VLILEIISGKSSARTNWGGSNKFLLEWAWQLYEEGKLLELVDPDMVEFPEKEVIRYMKVA  303

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQA+ASRRP MSQV+DM
Sbjct  304  FFCTQAAASRRPMMSQVVDM  323



>ref|XP_003635271.2| PREDICTED: putative serine/threonine-protein kinase [Vitis vinifera]
Length=428

 Score =   461 bits (1185),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 221/334 (66%), Positives = 265/334 (79%), Gaps = 5/334 (1%)
 Frame = -1

Query  1004  VECVIRIGSFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELR  825
             V C+I   +      VMSC+CFG S+      GN A Q+      N + +T+  S++EL+
Sbjct  49    VLCLIFPATSGILQTVMSCSCFGVSTADSKGKGNRASQK---IDGNLLEKTKQISFNELK  105

Query  824   TATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHS  645
              AT+NF   +KIGRGGFGTVYKGTLKNGR+VAVK LS  SKQG+REFLTEI T+SN RH 
Sbjct  106   KATDNFHPSSKIGRGGFGTVYKGTLKNGREVAVKMLSTSSKQGLREFLTEINTISNVRHP  165

Query  644   NLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLH  465
             NLVELIGCCVH NN+ILVYEY+EN S+D+VL G    + L+W  R+AIC+GTARGLA+LH
Sbjct  166   NLVELIGCCVHGNNKILVYEYVENNSIDQVLLGHK--IILDWGKRSAICMGTARGLAFLH  223

Query  464   EEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVL  285
             EE+ PHIVHRDIKASNILL+KD++PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L
Sbjct  224   EELVPHIVHRDIKASNILLEKDFSPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAL  283

Query  284   AGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE  105
              GQLTMKADVYSFGVL+LE++SG++SS  N+GG QK LLE AW L+ EG  LELVD E+ 
Sbjct  284   GGQLTMKADVYSFGVLVLEIISGKTSSQANFGGSQKFLLEWAWQLHIEGRFLELVDPELV  343

Query  104   RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
              FP+EEV++Y KVA  CTQA+ASRRP MSQV+DM
Sbjct  344   EFPEEEVMRYAKVAFFCTQAAASRRPLMSQVVDM  377



>ref|XP_003529313.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Glycine max]
Length=367

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 258/319 (81%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGAS++++ R  +    E        +   +NFS  +LR AT+N+    K+GRGG
Sbjct  1    MSCGCFGASTLKKKRNPSDTPNE---IDGFPLDNVKNFSDKDLRLATDNYNPSKKLGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VY+GTLKNGRQVAVK LSA SKQG+REFLTEI+T+SN +H NLVEL+GCCV E NRI
Sbjct  58   FGIVYQGTLKNGRQVAVKTLSAGSKQGVREFLTEIKTISNVKHPNLVELVGCCVQEPNRI  117

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYE++EN SLDR L G  G+ ++L+W  R+AIC+GTARGLA+LHEE  PHIVHRDIKAS
Sbjct  118  LVYEFVENNSLDRALLGSRGSNIRLDWRKRSAICMGTARGLAFLHEEHVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFGV
Sbjct  178  NILLDRDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SG+SS+  NWGG  K LLE AW LY+EG +LELVD ++  FP++EV++YMKVA 
Sbjct  238  LILEIISGKSSARTNWGGSNKFLLEWAWQLYEEGKLLELVDPDMVEFPEKEVIRYMKVAF  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+ASRRP MSQV+DM
Sbjct  298  FCTQAAASRRPMMSQVVDM  316



>ref|XP_007025673.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007025674.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007025675.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007025676.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY28295.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY28296.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY28297.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY28298.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=370

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 219/319 (69%), Positives = 254/319 (80%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CF  S V R R      Q +    +  + R  + SY +LR+AT++F   NKIGRGG
Sbjct  1    MSCGCFRGSFVNRRRN---TAQATGGIDEQLLGRVNHISYSQLRSATDDFHSSNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG LKNG +VAVK LSAQSKQG+REFLTEI T+SN +H NLVELIGCCV   NRI
Sbjct  58   FGTVYKGVLKNGTEVAVKTLSAQSKQGVREFLTEINTISNVKHPNLVELIGCCVEGTNRI  117

Query  596  LVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN+SLD++L  Q S  +KLEW  R+AIC+G ARGL +LHEE+ PHIVHRDIK+S
Sbjct  118  LVYEYVENKSLDKILLDQRSTNIKLEWSKRSAICLGIARGLTFLHEELVPHIVHRDIKSS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKD  PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFGV
Sbjct  178  NILLDKDLNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS  NWGG +K LLE AW LY+ G ++ELVD E+  FP EEVL+YMKVAL
Sbjct  238  LVLEIISGRSSSKANWGGMEKLLLEWAWQLYEGGKLVELVDPELGEFPGEEVLRYMKVAL  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA++SRRP MSQVI+M
Sbjct  298  FCTQAASSRRPLMSQVIEM  316



>ref|XP_009336056.1| PREDICTED: putative serine/threonine-protein kinase [Pyrus x 
bretschneideri]
 ref|XP_009336113.1| PREDICTED: putative serine/threonine-protein kinase [Pyrus x 
bretschneideri]
Length=372

 Score =   458 bits (1178),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 215/319 (67%), Positives = 255/319 (80%), Gaps = 2/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFGAS   R R    + Q   D  +N +   + FSY+ELR+AT+NF   NKIGRGG
Sbjct  1    MRCSCFGASVAERKRKSG-SGQFGHDLDENVLENIKAFSYNELRSATDNFHPSNKIGRGG  59

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL +G+ VAVK L+AQSKQG+REFL EI T+SN RH NLVELIGCCV E +R+
Sbjct  60   FGTVYKGTLTSGKHVAVKTLAAQSKQGVREFLNEINTISNVRHPNLVELIGCCVQEADRV  119

Query  596  LVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN+SLD  L G  S  +KL+W  R+AIC+GTARGL YLHEE+ PHIVHRDIKAS
Sbjct  120  LVYEYVENKSLDHALLGPTSNTIKLDWEKRSAICLGTARGLTYLHEELVPHIVHRDIKAS  179

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT+KADVYSFG+
Sbjct  180  NILLDTDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFGI  239

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+V GR S+  +WGG +K LLE AW L++EG +LEL D E+  FP+EEVL+YMKVA 
Sbjct  240  LILEIVCGRGSAKGDWGGTEKFLLEWAWQLHEEGRLLELADPEMGEFPEEEVLRYMKVAF  299

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A+RRP MSQV+DM
Sbjct  300  FCTQAAANRRPKMSQVLDM  318



>ref|XP_008383775.1| PREDICTED: putative serine/threonine-protein kinase [Malus domestica]
Length=372

 Score =   457 bits (1176),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 216/319 (68%), Positives = 258/319 (81%), Gaps = 2/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC+CFGAS+  R R G+ + +   D  +N +  T+ FSYDELR AT+NF   NKIG GG
Sbjct  1    MSCSCFGASAAFRKR-GSGSGRFGRDHDENLLENTKAFSYDELRLATDNFHSSNKIGIGG  59

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG LK+G+ VA+K L+A+S+QG+REFL EI  +SN RH NLVELIGCCV   +R+
Sbjct  60   FGTVYKGVLKSGKHVAIKTLAARSRQGVREFLNEINAISNVRHPNLVELIGCCVQGADRV  119

Query  596  LVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+ N+SLD  L G  S  ++L+W  R+AIC+GTARGL YLHEE+ PHIVHRDIKAS
Sbjct  120  LVYEYVXNKSLDHALLGPTSRTIQLDWEKRSAICLGTARGLTYLHEELVPHIVHRDIKAS  179

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLT+KADVYSFGV
Sbjct  180  NILLDRDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFGV  239

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+VSGRSS+  NWGG +K LLE AW L++EG +LEL D E+  FP+EEVL+YMKVA 
Sbjct  240  LILEIVSGRSSAKENWGGTEKLLLEWAWQLHEEGRLLELADPEMGEFPEEEVLRYMKVAF  299

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+ASRRP MSQV+DM
Sbjct  300  FCTQAAASRRPKMSQVVDM  318



>ref|XP_008371344.1| PREDICTED: putative serine/threonine-protein kinase [Malus domestica]
 ref|XP_008371345.1| PREDICTED: putative serine/threonine-protein kinase [Malus domestica]
 ref|XP_008371346.1| PREDICTED: putative serine/threonine-protein kinase [Malus domestica]
Length=373

 Score =   457 bits (1176),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 258/319 (81%), Gaps = 1/319 (0%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFGAS   + +  + + Q   D  +N +   + FSY+ELR+AT+NF   NKIGRGG
Sbjct  1    MRCSCFGASVAEKRKRKSGSGQFGHDLDENVLENIKAFSYNELRSATDNFHPSNKIGRGG  60

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL +G+ VAVK L+AQSKQG+REFL EI T+SN RH NLVELIGCCV E +R+
Sbjct  61   FGTVYKGTLTSGKHVAVKTLAAQSKQGVREFLNEINTISNVRHPNLVELIGCCVQEADRV  120

Query  596  LVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN+SLD  L G  S  +KL+W  R+AIC+GTARGL YLHEE+ PHIVHRDIKAS
Sbjct  121  LVYEYVENKSLDHALLGPTSRTIKLDWEKRSAICLGTARGLTYLHEELVPHIVHRDIKAS  180

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD+++ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT+KADVYSFGV
Sbjct  181  NLLLDREFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFGV  240

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE+V GRSS+  +WGG +K LLE AW L++EG +LEL D E+  FP+EEVL+YMKVA 
Sbjct  241  LVLEIVCGRSSAKGDWGGAEKFLLEWAWQLHEEGRLLELADPEMGEFPEEEVLRYMKVAF  300

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A+RRP MSQV+DM
Sbjct  301  FCTQAAANRRPKMSQVLDM  319



>ref|XP_004293572.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g07650-like [Fragaria vesca subsp. vesca]
Length=372

 Score =   457 bits (1175),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 254/319 (80%), Gaps = 3/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFG + + R R+ +      FD   N     R+FSY+ELR+ATNNF   NKIGRGG
Sbjct  1    MSCKCFGGAILDRKRSSSGQTSHGFDG--NLPENVRSFSYNELRSATNNFHASNKIGRGG  58

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKGTLKNG QVAVK LSA+SKQG+REFL EI T+SN RH NLVELIGCCV   +RI
Sbjct  59   FGIVYKGTLKNGTQVAVKTLSARSKQGVREFLNEINTISNVRHPNLVELIGCCVQGADRI  118

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G ++  +KL+W  R AIC+G AR L +LHEE++PHIVHRDIKAS
Sbjct  119  LVYEYVENNSLDRALLGARNETIKLDWEKRKAICLGVARALTFLHEELQPHIVHRDIKAS  178

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D   KIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFGV
Sbjct  179  NILLDRDLNAKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFGV  238

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+V GR S+  NWGG +K LLE AW L++EG +LELVD E+E +P+EEVL+YMKVA 
Sbjct  239  LILEIVGGRGSAKENWGGTEKFLLEWAWQLHEEGRLLELVDPELEDYPEEEVLRYMKVAF  298

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA++SRRP MSQV++M
Sbjct  299  FCTQAASSRRPLMSQVLEM  317



>gb|EYU27924.1| hypothetical protein MIMGU_mgv1a008435mg [Erythranthe guttata]
Length=374

 Score =   456 bits (1174),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 220/318 (69%), Positives = 263/318 (83%), Gaps = 0/318 (0%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC+CFGA++V + +     +Q   D    SIA+T+NFSY+ELR ATNNF + NKIGRGG
Sbjct  1    MSCSCFGATTVLQKKRDKHVRQPPQDEEGASIAKTKNFSYNELRVATNNFHRSNKIGRGG  60

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG LKNG +VAVK LSAQSKQG REFLTEI+T+SN  H NLVEL+GCCVH  NRI
Sbjct  61   FGTVYKGILKNGTEVAVKMLSAQSKQGEREFLTEIDTISNVVHPNLVELLGCCVHGPNRI  120

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYE+LEN S+D  L G   +VKL W  R+AIC+GTARGLAYLHEE+ PHIVHRDIKASN
Sbjct  121  LVYEFLENSSIDHALLGAKRSVKLNWKRRSAICMGTARGLAYLHEELTPHIVHRDIKASN  180

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDK++ PKIGDFGLAKLFPD+ITHIST++AGT GYLAPEYV+ G+LTMKADVYSFG+L
Sbjct  181  ILLDKNFQPKIGDFGLAKLFPDDITHISTKLAGTTGYLAPEYVIGGRLTMKADVYSFGIL  240

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
             LEVVSGRSS++ N+ G  K L+E AW LY+EG +++LVD E+E F + EV++YMKVAL 
Sbjct  241  TLEVVSGRSSANTNYRGAHKLLVEWAWELYEEGKLVDLVDPELEEFEENEVVRYMKVALF  300

Query  56   CTQASASRRPTMSQVIDM  3
            CTQA+ASRRP MSQV++M
Sbjct  301  CTQANASRRPLMSQVLEM  318



>gb|KHG22993.1| hypothetical protein F383_06520 [Gossypium arboreum]
Length=369

 Score =   453 bits (1166),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 216/320 (68%), Positives = 258/320 (81%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN-FSYDELRTATNNFGQVNKIGRG  780
            MSC CFG S V+R ++   A        D  + RT N FSYD+L+ AT++F   NKIGRG
Sbjct  1    MSCGCFGGSVVKRRQSTARAT----GGIDEQLIRTVNHFSYDQLKLATDDFHSSNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKG LK+G +VAVK L+AQSKQG REFLTEI T+SN +H NLVELIGCC+   NR
Sbjct  57   GFGTVYKGILKDGTEVAVKTLAAQSKQGAREFLTEINTISNVKHPNLVELIGCCIQGANR  116

Query  599  ILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN+SLD++L  Q S  ++L+W  R+AIC+G ARGLA+LHEE+ P IVHRDIK+
Sbjct  117  ILVYEYVENKSLDKILLDQRSTNIQLDWSKRSAICMGIARGLAFLHEELVPRIVHRDIKS  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFG
Sbjct  177  SNILLDKDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS  NWGG  K LLE AW L++EG ++ELVD E+  FP+EEVL+YMK+A
Sbjct  237  VLVLEIISGRSSSKTNWGGTMKLLLEWAWQLHEEGKLIELVDPELGEFPEEEVLRYMKIA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQA+A+RRP MSQVI+M
Sbjct  297  FFCTQAAANRRPLMSQVIEM  316



>ref|XP_010100551.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB82794.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=367

 Score =   450 bits (1158),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/320 (67%), Positives = 259/320 (81%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASS-VRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC+CFG+S+ V++ R+G    Q   D   + +   ++FSY+ELR AT++F   NK+GRG
Sbjct  1    MSCSCFGSSALVKKRRSG----QAHDDIDGDLLESIKHFSYNELRAATDDFHTRNKLGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVY GTLK G QVAVK LSAQSKQG+REFLTEI+T+SN RH NLVELIGCC+   NR
Sbjct  57   GFGTVYMGTLKKGVQVAVKTLSAQSKQGVREFLTEIKTISNVRHPNLVELIGCCIDGANR  116

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SL+R L   +S  + L+W  R+ IC+G ARGLAYLHEE+EPHIVHRDIKA
Sbjct  117  ILVYEYLENNSLERALLSSRSTCIMLDWGKRSTICLGVARGLAYLHEELEPHIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD D  PKIGDFGLA+LFPDNITHIST+IAGT GYLAPEY + GQLT+KADVYSFG
Sbjct  177  SNILLDTDLNPKIGDFGLARLFPDNITHISTKIAGTTGYLAPEYAMGGQLTLKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE++SGRSSS  NWGG Q+ L+E AW L++EG +LELVD ++  FP EEVL+++KVA
Sbjct  237  VLILEIISGRSSSKENWGGTQQLLVEYAWQLHEEGRLLELVDPQMAEFPNEEVLRFIKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQA+++RRP MSQV++M
Sbjct  297  FFCTQAASNRRPLMSQVVNM  316



>ref|XP_007159309.1| hypothetical protein PHAVU_002G227300g [Phaseolus vulgaris]
 ref|XP_007159310.1| hypothetical protein PHAVU_002G227300g [Phaseolus vulgaris]
 gb|ESW31303.1| hypothetical protein PHAVU_002G227300g [Phaseolus vulgaris]
 gb|ESW31304.1| hypothetical protein PHAVU_002G227300g [Phaseolus vulgaris]
Length=367

 Score =   450 bits (1157),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 257/319 (81%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGAS++++ R+ +    E        +   +NFS  +LR AT+N+    K+GRGG
Sbjct  1    MSCGCFGASTLKKKRSPSHTHNE---IDGFPLDNVKNFSDKDLRLATDNYHPSKKLGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVY+GTLK+GRQVAVK LSA SKQG+REF++EI+T+SN +H NLVEL+GCCV E NRI
Sbjct  58   FGTVYQGTLKDGRQVAVKTLSAGSKQGVREFISEIKTISNVKHPNLVELVGCCVQETNRI  117

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY++N SLDR L G  G+ + L+W  R+ IC+GTARGLA+LHEE+ PHIVHRDIKAS
Sbjct  118  LVYEYVQNNSLDRALLGARGSNIILDWRKRSGICMGTARGLAFLHEELVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+ + PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLT+KADVYSFGV
Sbjct  178  NILLDRHFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTLKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SG+SS+  NWGG  K LLE AW LY+EG +LELVD ++  FP+EEV++Y KVA 
Sbjct  238  LILEIISGKSSARTNWGGSNKYLLEWAWQLYEEGKLLELVDPDMGEFPEEEVIRYAKVAF  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+ASRRP MSQV+DM
Sbjct  298  FCTQAAASRRPMMSQVVDM  316



>ref|XP_007211458.1| hypothetical protein PRUPE_ppa007355mg [Prunus persica]
 ref|XP_008225047.1| PREDICTED: putative serine/threonine-protein kinase [Prunus mume]
 ref|XP_008225049.1| PREDICTED: putative serine/threonine-protein kinase [Prunus mume]
 ref|XP_008225050.1| PREDICTED: putative serine/threonine-protein kinase [Prunus mume]
 gb|EMJ12657.1| hypothetical protein PRUPE_ppa007355mg [Prunus persica]
Length=371

 Score =   449 bits (1156),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 255/320 (80%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSV-RRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M C+CFG S   R+ R+G+       D   N +   + FSY+ELR+AT++F   NKIGRG
Sbjct  1    MGCSCFGTSVADRKRRSGHFGH----DLDGNLLENIKTFSYNELRSATDDFHSSNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTLK+G+QVAVK LSA+SKQG+REFL EI  +SN RH NLVELIGCCV   +R
Sbjct  57   GFGTVYKGTLKSGKQVAVKTLSARSKQGVREFLNEIIAISNVRHPNLVELIGCCVEGADR  116

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            +LVYEY EN SLDR L G +S  + L W  R+AIC+GTARGL +LHEE+ PHIVHRDIKA
Sbjct  117  VLVYEYAENNSLDRALLGSKSKNIILNWEKRSAICLGTARGLMFLHEELMPHIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+D+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLT KADVYSFG
Sbjct  177  SNILLDRDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE+VSGRSS+  NWGG +K LLE AW L++EG +LELVD E+  FP+EE+L+YMKVA
Sbjct  237  VLVLEIVSGRSSAKENWGGTEKFLLEWAWQLHEEGRLLELVDPEMGEFPEEELLRYMKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQA+ASRRP MS V++M
Sbjct  297  FFCTQAAASRRPMMSVVVEM  316



>ref|XP_011006889.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Populus euphratica]
Length=372

 Score =   447 bits (1151),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 211/318 (66%), Positives = 252/318 (79%), Gaps = 2/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFG  SV R +          D   + +    + SY+ELR+AT+NF   NKIGRGG
Sbjct  1    MRCSCFGGPSVDRKKGTAAGTLHGMDG--DLLQDINHLSYNELRSATDNFHASNKIGRGG  58

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK+G QVAVK LSAQSKQG++EFL EI+T+S  +H NLVELIGCC    NRI
Sbjct  59   FGTVYKGTLKSGTQVAVKTLSAQSKQGVQEFLNEIKTISKVKHPNLVELIGCCAQGTNRI  118

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEY+EN SLDR L  +S  +KL+W  R+AIC+G ARGL +LH+EV PHIVHRDIKASN
Sbjct  119  LVYEYVENSSLDRALGSRSTDIKLDWGRRSAICLGIARGLDFLHKEVVPHIVHRDIKASN  178

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKD+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFGVL
Sbjct  179  ILLDKDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFGVL  238

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            ILE++SGRS++  +WGG QK LLE AW L++EG  LELVD E+  FP+EEV++Y+KVA  
Sbjct  239  ILEIISGRSNTKPSWGGTQKLLLEWAWQLHEEGKHLELVDPEMGEFPEEEVIRYIKVAFF  298

Query  56   CTQASASRRPTMSQVIDM  3
            CTQ++A+RRP M+QV+DM
Sbjct  299  CTQSAANRRPLMTQVVDM  316



>ref|XP_011006887.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Populus euphratica]
 ref|XP_011006888.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Populus euphratica]
Length=373

 Score =   447 bits (1150),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 253/319 (79%), Gaps = 3/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFG  SV R +          D   + +    + SY+ELR+AT+NF   NKIGRGG
Sbjct  1    MRCSCFGGPSVDRKKGTAAGTLHGMDG--DLLQDINHLSYNELRSATDNFHASNKIGRGG  58

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK+G QVAVK LSAQSKQG++EFL EI+T+S  +H NLVELIGCC    NRI
Sbjct  59   FGTVYKGTLKSGTQVAVKTLSAQSKQGVQEFLNEIKTISKVKHPNLVELIGCCAQGTNRI  118

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G +S  +KL+W  R+AIC+G ARGL +LH+EV PHIVHRDIKAS
Sbjct  119  LVYEYVENSSLDRALLGSRSTDIKLDWGRRSAICLGIARGLDFLHKEVVPHIVHRDIKAS  178

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKD+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFGV
Sbjct  179  NILLDKDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFGV  238

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SGRS++  +WGG QK LLE AW L++EG  LELVD E+  FP+EEV++Y+KVA 
Sbjct  239  LILEIISGRSNTKPSWGGTQKLLLEWAWQLHEEGKHLELVDPEMGEFPEEEVIRYIKVAF  298

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ++A+RRP M+QV+DM
Sbjct  299  FCTQSAANRRPLMTQVVDM  317



>ref|XP_002305688.2| hypothetical protein POPTR_0004s04030g [Populus trichocarpa]
 gb|EEE86199.2| hypothetical protein POPTR_0004s04030g [Populus trichocarpa]
Length=373

 Score =   447 bits (1149),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 217/320 (68%), Positives = 258/320 (81%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN-FSYDELRTATNNFGQVNKIGRG  780
            M C+CFG  SV + R G+ A  E+    D  + +  N  SY+ELR+AT+NF   NKIGRG
Sbjct  1    MRCSCFGGPSVDKKR-GSAA--ETLHGIDGDLLQDVNHISYNELRSATDNFHSSNKIGRG  57

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKGTL++G QVAVK LSAQSKQG+REFL EI+T+SN RH NLVELIGCCV   NR
Sbjct  58   GFGDVYKGTLRSGIQVAVKTLSAQSKQGVREFLNEIKTISNVRHPNLVELIGCCVQGANR  117

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLDR L G +S  ++L+W  R+AIC+G ARGLA+LHEE+ PHIVHRDIKA
Sbjct  118  ILVYEYLENNSLDRALLGSRSTNIRLDWGRRSAICLGIARGLAFLHEELVPHIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD  PKIGDFGLAKLFP+NITHIST+IAGT GYLAPEY L GQLTMKADVYSFG
Sbjct  178  SNILLDKDLNPKIGDFGLAKLFPENITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE++SGR+S+  +WGG +K LLE AW L++EG  LELVD E+  FP+EEV++Y+KVA
Sbjct  238  VLILEIISGRNSTKPSWGGMEKLLLEWAWQLHEEGRPLELVDPEMGEFPEEEVIRYIKVA  297

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQ++A+RRP  SQV+DM
Sbjct  298  FFCTQSAANRRPLTSQVVDM  317



>ref|XP_011027878.1| PREDICTED: putative serine/threonine-protein kinase [Populus 
euphratica]
 ref|XP_011027879.1| PREDICTED: putative serine/threonine-protein kinase [Populus 
euphratica]
 ref|XP_011027880.1| PREDICTED: putative serine/threonine-protein kinase [Populus 
euphratica]
Length=373

 Score =   446 bits (1147),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 215/320 (67%), Positives = 254/320 (79%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN-FSYDELRTATNNFGQVNKIGRG  780
            M C+CFG  SV + R    +  E+    D  + +  N  SYDELR+AT+NF   NKIGRG
Sbjct  1    MRCSCFGGPSVDKKRA---SAAETLHGIDGDLLQDVNHISYDELRSATDNFHSSNKIGRG  57

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKGTL++G QVAVK LSAQSKQG+REFL EI+T+SN RH NLVELIGCCV   NR
Sbjct  58   GFGDVYKGTLRSGIQVAVKTLSAQSKQGVREFLNEIKTISNIRHPNLVELIGCCVQGANR  117

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLDR L G +S  ++L+W  R+AIC+G ARGLA+LHEE+ P IVHRDIKA
Sbjct  118  ILVYEYLENNSLDRALLGSRSTNIRLDWGRRSAICLGIARGLAFLHEELVPRIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD  PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLT+KADVYSFG
Sbjct  178  SNILLDKDLNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE++SGR+S+  +WGG +K LLE AW L++EG  LELVD E+  FP EEV++Y+KVA
Sbjct  238  VLILEIISGRNSTKPSWGGMEKLLLEWAWQLHEEGRPLELVDPEMGEFPDEEVIRYIKVA  297

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQ++A+RRP M QV+DM
Sbjct  298  FFCTQSAANRRPLMGQVVDM  317



>ref|XP_004505035.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Cicer arietinum]
 ref|XP_004505036.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Cicer arietinum]
 ref|XP_004505037.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X3 [Cicer arietinum]
 ref|XP_004505038.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X4 [Cicer arietinum]
Length=367

 Score =   445 bits (1145),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 254/319 (80%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGAS+ ++ RT      E        +    +FS  +LR AT+N+    KIGRGG
Sbjct  1    MSCGCFGASTNKKKRTPPHTPAE---IDGYPLDNIMHFSEKDLRFATDNYHPSKKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVY+GTLK+GRQVAVK LS  SKQG+REFLTEI+T+S+ +H NLVEL+GCCV E+NR 
Sbjct  58   FGTVYQGTLKDGRQVAVKNLSVGSKQGVREFLTEIKTISHIKHPNLVELVGCCVQESNRT  117

Query  596  LVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G+ S  ++L+W  R+ IC GTARGLA+LHEEV PHIVHRDIKAS
Sbjct  118  LVYEYVENNSLDRALLGKRSTNLELDWGKRSNICRGTARGLAFLHEEVVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFGV
Sbjct  178  NILLDRDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SG+SS   NWGG  K LLE AW L++EG +LELVD E+  FP+EEV++YMKVA 
Sbjct  238  LILEIISGKSSVRTNWGGSNKFLLEWAWQLHEEGKLLELVDPEMVEFPEEEVIRYMKVAF  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+ASRRP MSQV+DM
Sbjct  298  FCTQAAASRRPLMSQVVDM  316



>ref|XP_011006891.1| PREDICTED: putative serine/threonine-protein kinase isoform X3 
[Populus euphratica]
Length=370

 Score =   445 bits (1145),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 214/319 (67%), Positives = 254/319 (80%), Gaps = 6/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFG  SV R + G  A     D     +    + SY+ELR+AT+NF   NKIGRGG
Sbjct  1    MRCSCFGGPSVDRKK-GTAAGTLHGDL----LQDINHLSYNELRSATDNFHASNKIGRGG  55

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK+G QVAVK LSAQSKQG++EFL EI+T+S  +H NLVELIGCC    NRI
Sbjct  56   FGTVYKGTLKSGTQVAVKTLSAQSKQGVQEFLNEIKTISKVKHPNLVELIGCCAQGTNRI  115

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G +S  +KL+W  R+AIC+G ARGL +LH+EV PHIVHRDIKAS
Sbjct  116  LVYEYVENSSLDRALLGSRSTDIKLDWGRRSAICLGIARGLDFLHKEVVPHIVHRDIKAS  175

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKD+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFGV
Sbjct  176  NILLDKDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFGV  235

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SGRS++  +WGG QK LLE AW L++EG  LELVD E+  FP+EEV++Y+KVA 
Sbjct  236  LILEIISGRSNTKPSWGGTQKLLLEWAWQLHEEGKHLELVDPEMGEFPEEEVIRYIKVAF  295

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ++A+RRP M+QV+DM
Sbjct  296  FCTQSAANRRPLMTQVVDM  314



>ref|XP_006449305.1| hypothetical protein CICLE_v10015669mg [Citrus clementina]
 gb|ESR62545.1| hypothetical protein CICLE_v10015669mg [Citrus clementina]
Length=370

 Score =   439 bits (1129),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 211/320 (66%), Positives = 250/320 (78%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN-FSYDELRTATNNFGQVNKIGRG  780
            MSC CFG S     ++   A++E+    D  + R  N FSY ELR+AT++F   NKIGRG
Sbjct  1    MSCRCFGGSRFHSKKS---AEREAPQGVDGELLRNVNHFSYTELRSATDDFHLSNKIGRG  57

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL NGR +AVK LSA+SKQG+REF+TEI+T+SN RH NLVELIGCCV    R
Sbjct  58   GFGTVYKGTLTNGRHIAVKPLSAESKQGVREFITEIKTLSNVRHPNLVELIGCCVQGTRR  117

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN SLDRVL G + A +KL W  R+ ICVG A+GLA+LHEE+ PHIVHRDIKA
Sbjct  118  ILVYEYVENNSLDRVLLGATKANIKLNWEKRSDICVGIAKGLAFLHEELVPHIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++ PKIGDFGLAKLFPDNITHI+T+IAGT GYLAPEYVL GQLTMKADVYSFG
Sbjct  178  SNILLDQEFNPKIGDFGLAKLFPDNITHITTRIAGTTGYLAPEYVLGGQLTMKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGR+S    WG   K LLE AW L+ E   LELVD E+  +P  E+++YMKVA
Sbjct  238  VLVLEIISGRNSGKAMWGQMNKFLLEWAWQLHQEEKPLELVDPELGEYPPNEIIRYMKVA  297

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQA+ASRRP M+QVI M
Sbjct  298  FFCTQAAASRRPQMNQVIKM  317



>ref|XP_006467832.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
 gb|KDO75882.1| hypothetical protein CISIN_1g017503mg [Citrus sinensis]
Length=370

 Score =   438 bits (1127),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 211/320 (66%), Positives = 250/320 (78%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN-FSYDELRTATNNFGQVNKIGRG  780
            MSC CFG S     ++   A++E+    D  + R  N FSY ELR+AT++F   NKIGRG
Sbjct  1    MSCRCFGGSRFHSKKS---AEREAPQGVDGELLRNVNHFSYTELRSATDDFHLSNKIGRG  57

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL NGR++AVK LSA+SKQG+REF+TEI T+SN RH NLVELIGCCV    R
Sbjct  58   GFGTVYKGTLTNGRRIAVKPLSAESKQGVREFITEIMTLSNVRHPNLVELIGCCVQGTRR  117

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN SLDRVL G + A +KL W  R+ ICVG A+GLA+LHEE+ PHIVHRDIKA
Sbjct  118  ILVYEYVENNSLDRVLLGATKANIKLNWEKRSDICVGIAKGLAFLHEELVPHIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++ PKIGDFGLAKLFPDNITHI+T+IAGT GYLAPEYVL GQLTMKADVYSFG
Sbjct  178  SNILLDQEFNPKIGDFGLAKLFPDNITHITTRIAGTTGYLAPEYVLGGQLTMKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGR+S    WG   K LLE AW L+ E   LELVD E+  +P  E+++YMKVA
Sbjct  238  VLVLEIISGRNSGKAMWGQMNKFLLEWAWQLHQEEKPLELVDPELGEYPPNEIIRYMKVA  297

Query  62   LLCTQASASRRPTMSQVIDM  3
              CTQA+ASRRP M+QVI M
Sbjct  298  FFCTQAAASRRPQMNQVIKM  317



>ref|XP_006377327.1| hypothetical protein POPTR_0011s04930g, partial [Populus trichocarpa]
 gb|ERP55124.1| hypothetical protein POPTR_0011s04930g, partial [Populus trichocarpa]
Length=347

 Score =   435 bits (1119),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 206/291 (71%), Positives = 241/291 (83%), Gaps = 1/291 (0%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I    + SY ELR+AT+NF   NKIGRGGFGTVYKGTLK+G QVAVK LSAQS QG+
Sbjct  1    DLLIQDINHLSYKELRSATDNFHTSNKIGRGGFGTVYKGTLKSGTQVAVKTLSAQSNQGV  60

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWH  516
            +EFL EI+T+S  +H NLVELIGCC   +NRILVYEY+EN SLDR L G +S  +KL+W 
Sbjct  61   QEFLNEIKTISKVKHPNLVELIGCCAQGSNRILVYEYVENNSLDRALLGSRSTDIKLDWG  120

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
             R+AIC+G ARGL +LH+EV PHIVHRDIKASNILLDKD+ PKIGDFGLAKLFPDNITHI
Sbjct  121  RRSAICLGIARGLDFLHKEVVPHIVHRDIKASNILLDKDFNPKIGDFGLAKLFPDNITHI  180

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST+IAGT GYLAPEY L GQLTMKADVYSFGVLILE+VSGRSS+  +WGG QK LLE AW
Sbjct  181  STRIAGTTGYLAPEYALGGQLTMKADVYSFGVLILEIVSGRSSAKPSWGGTQKLLLEWAW  240

Query  155  NLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             L++EG  LELVD E+  FP+EEV++Y+KVA  CTQ++A+RRP M+QV+DM
Sbjct  241  QLHEEGKHLELVDPEMGEFPEEEVIRYIKVAFFCTQSAANRRPIMTQVVDM  291



>ref|XP_010686542.1| PREDICTED: putative serine/threonine-protein kinase [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/319 (66%), Positives = 245/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFG+   ++ ++     +E        +   R+FSY+ELR ATN+F   NKIGRGG
Sbjct  1    MSCGCFGSPFTQKQKSLTPPPRE---VEGKVLDNIRHFSYNELRVATNDFSLSNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG  K+G QVAVKALSA+SKQG+REFL EI T+SN RH NLVELIGCCV   NRI
Sbjct  58   FGTVYKGIFKSGLQVAVKALSAESKQGVREFLAEINTISNVRHQNLVELIGCCVEGTNRI  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+ N SLDR L G  S   KL W  R+AIC+GTAR LA+LHEE+ PHIVHRDIKAS
Sbjct  118  LVYEYVVNNSLDRALLGYTSDRSKLNWERRSAICLGTARALAFLHEELVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILL +D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L G LTMKADVYSFGV
Sbjct  178  NILLGEDFAPKIGDFGLAKLFPDDITHISTRIAGTSGYLAPEYALGGHLTMKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+VSG+S+S  NWGG  K LLE AW LY+EG +LELVDSE+  +  +EV +YM VA 
Sbjct  238  LILEIVSGQSNSKSNWGGSNKLLLEWAWQLYEEGRLLELVDSEIGEYAVDEVFRYMIVAF  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA A+RRP MSQVI M
Sbjct  298  FCTQAGANRRPLMSQVIHM  316



>ref|XP_008802319.1| PREDICTED: putative serine/threonine-protein kinase [Phoenix 
dactylifera]
 ref|XP_008802327.1| PREDICTED: putative serine/threonine-protein kinase [Phoenix 
dactylifera]
Length=378

 Score =   433 bits (1114),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 251/320 (78%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSI-ARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC CFG    ++        Q   D G  S   + R FSY EL++AT+NF   NKIGRG
Sbjct  1    MSCGCFGPLLSKKKH----PPQSQLDMGGLSFDKKVRCFSYIELKSATDNFHPSNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKG L+NG  VA+K LSA+S+QG++EFLTEI+T++N RH NLVELIGCCV   NR
Sbjct  57   GFGTVYKGILRNGEAVAIKLLSAESRQGVKEFLTEIDTITNVRHPNLVELIGCCVEGINR  116

Query  599  ILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN SLD  L G  S   KL W TR+AIC+GTARGLAYLHEE+EPHIVHRDIKA
Sbjct  117  ILVYEYVENNSLDHALLGPNSDTAKLNWSTRSAICLGTARGLAYLHEELEPHIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+D+ PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY + GQLT KADVYSFG
Sbjct  177  SNILLDQDFAPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYAMHGQLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SG SSS   W    K +LE AW+LY++G + ELVDS ++ +P+++V++Y+KVA
Sbjct  237  VLVLEIISGSSSSKTIWSDMGKYILEWAWHLYEQGRLKELVDSSLKEYPEDQVVRYIKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA++ RRP+MSQV++M
Sbjct  297  LFCTQAASGRRPSMSQVVEM  316



>ref|XP_002519034.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF43245.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=367

 Score =   432 bits (1111),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 249/319 (78%), Gaps = 9/319 (3%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CFG+           A + + DA +  +    +FSY++LR+ATNNF   NKIGRGG
Sbjct  1    MRCSCFGSKGS--------AARPNLDADEELLRDINHFSYNQLRSATNNFHLTNKIGRGG  52

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKGTLK+GRQ+AVK LSAQSKQG+REFL EI T+S  RH NLVELIGCCV   NRI
Sbjct  53   FGIVYKGTLKDGRQIAVKTLSAQSKQGMREFLNEINTLSRVRHPNLVELIGCCVLGANRI  112

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SL+R L G Q+    L+W  R+AIC G A+GLA+LHEE+ PHIVHRDIKAS
Sbjct  113  LVYEYVENNSLERALLGSQNTNTTLDWGKRSAICFGIAKGLAFLHEELVPHIVHRDIKAS  172

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLDK+Y PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + G LTMKADVYSFG+
Sbjct  173  NVLLDKEYNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGPLTMKADVYSFGI  232

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SGRSSS  + GG +K LLE AW LY+ G +LELVD ++  FP+EEV+++MKVAL
Sbjct  233  LILEIISGRSSSKPSCGGMEKLLLEWAWELYEGGKLLELVDPQLGEFPEEEVIRHMKVAL  292

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ   SRRP MSQV++M
Sbjct  293  FCTQEVGSRRPLMSQVVEM  311



>gb|KEH31096.1| receptor-like kinase [Medicago truncatula]
Length=367

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 210/319 (66%), Positives = 254/319 (80%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGAS++++ R+      E        +    +FS  +LR AT+++    KIGRGG
Sbjct  1    MSCGCFGASTLKKKRSPPHTPNE---IDGYPLENIMHFSEKDLRLATDDYHPSKKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVY+GTLKNGRQVA+K+LSA SKQG+REFLTEI+T+S+ +H NLVEL+GCC  E NR 
Sbjct  58   FGTVYQGTLKNGRQVAIKSLSAASKQGVREFLTEIKTISHVKHPNLVELVGCCAQEPNRT  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G +S  +KL+W  R+ IC GTARGLA+LHEE  PHIVHRDIKAS
Sbjct  118  LVYEYVENNSLDRALLGNRSTNIKLDWGKRSNICTGTARGLAFLHEEAVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+ + PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFGV
Sbjct  178  NILLDRHFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILEV+SG+SS+  NWGG  K LLE AW L++E  +LELVD ++  FPKEEV++YMKVA 
Sbjct  238  LILEVISGQSSARTNWGGSNKFLLEWAWQLHEEERLLELVDPDMVEFPKEEVIRYMKVAF  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+ASRRP+MSQV+DM
Sbjct  298  FCTQAAASRRPSMSQVVDM  316



>ref|XP_010935639.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Elaeis guineensis]
 ref|XP_010935640.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Elaeis guineensis]
Length=378

 Score =   432 bits (1111),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 251/320 (78%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGD-NSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC CFG+   ++        Q   D G   S  + + FSY EL++AT++F   NKIGRG
Sbjct  1    MSCGCFGSLLSKKKH----PPQSQLDMGGLPSNKKIKLFSYIELKSATDSFRPRNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL NG  VAVK LSA+S+QG++EFLTEI+T++N RH NLVELIGCCV  +NR
Sbjct  57   GFGTVYKGTLTNGEAVAVKVLSAESRQGLKEFLTEIDTITNVRHPNLVELIGCCVEGSNR  116

Query  599  ILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN SLDR L G  S   K+ W TR+AIC+GTARGLAYLHEE+EP IVHRDIKA
Sbjct  117  ILVYEYVENNSLDRALLGPNSDTTKMNWATRSAICLGTARGLAYLHEELEPPIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+LLD+DY PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  177  SNVLLDRDYVPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYALHGQLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS   W    K +LE  W+LY++G + ELVD  +E +P++EV++YMKVA
Sbjct  237  VLVLEIISGRSSSKTVWSEMGKYILEWTWHLYEQGRLKELVDPALEEYPEDEVVRYMKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA++ RRP+ SQV++M
Sbjct  297  LFCTQAASVRRPSASQVVEM  316



>gb|KDP20943.1| hypothetical protein JCGZ_21414 [Jatropha curcas]
Length=367

 Score =   432 bits (1110),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 208/319 (65%), Positives = 246/319 (77%), Gaps = 9/319 (3%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG        T   A +   DA   S       SYDELR+AT+NF   NKIGRGG
Sbjct  1    MRYCCFG--------TKETAGRAYGDADGYSTRDINYISYDELRSATDNFHSTNKIGRGG  52

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL++GRQVAVK L+AQSKQG+REFL EI+T+S  RH NLVELIGCCV   NRI
Sbjct  53   FGTVYKGTLRSGRQVAVKTLAAQSKQGVREFLNEIDTISKVRHPNLVELIGCCVQGTNRI  112

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G ++  +KL+W  R+AIC+G ARGLA+LHEE+ PHIVHRDIKAS
Sbjct  113  LVYEYVENNSLDRALLGPRNQCIKLDWRKRSAICLGIARGLAFLHEELVPHIVHRDIKAS  172

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLDKD+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY   GQLTMKADVYSFGV
Sbjct  173  NVLLDKDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYAFGGQLTMKADVYSFGV  232

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRS+   + G  QK LLE AW L++EG  LELVD E+  FP++EV+++MK+A 
Sbjct  233  LVLEIISGRSTVKTSLGETQKLLLEWAWQLHEEGKHLELVDPEMGEFPEQEVIRHMKIAF  292

Query  59   LCTQASASRRPTMSQVIDM  3
             C Q +A+RRP MSQV+DM
Sbjct  293  FCAQGAANRRPLMSQVVDM  311



>ref|XP_010935637.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
 ref|XP_010935638.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
Length=382

 Score =   432 bits (1111),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 251/320 (78%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGD-NSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC CFG+   ++        Q   D G   S  + + FSY EL++AT++F   NKIGRG
Sbjct  5    MSCGCFGSLLSKKKH----PPQSQLDMGGLPSNKKIKLFSYIELKSATDSFRPRNKIGRG  60

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL NG  VAVK LSA+S+QG++EFLTEI+T++N RH NLVELIGCCV  +NR
Sbjct  61   GFGTVYKGTLTNGEAVAVKVLSAESRQGLKEFLTEIDTITNVRHPNLVELIGCCVEGSNR  120

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN SLDR L G  S   K+ W TR+AIC+GTARGLAYLHEE+EP IVHRDIKA
Sbjct  121  ILVYEYVENNSLDRALLGPNSDTTKMNWATRSAICLGTARGLAYLHEELEPPIVHRDIKA  180

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+LLD+DY PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  181  SNVLLDRDYVPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYALHGQLTKKADVYSFG  240

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS   W    K +LE  W+LY++G + ELVD  +E +P++EV++YMKVA
Sbjct  241  VLVLEIISGRSSSKTVWSEMGKYILEWTWHLYEQGRLKELVDPALEEYPEDEVVRYMKVA  300

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA++ RRP+ SQV++M
Sbjct  301  LFCTQAASVRRPSASQVVEM  320



>ref|XP_010052337.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010052338.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 gb|KCW76270.1| hypothetical protein EUGRSUZ_D00643 [Eucalyptus grandis]
Length=372

 Score =   431 bits (1107),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 209/321 (65%), Positives = 252/321 (79%), Gaps = 7/321 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC C G SS R++   +  Q    D   N      +F+  ELR AT+NF   NKIGRGG
Sbjct  1    MSCNCLGFSSKRKSPPSSSIQGIEVDLLRN----ITHFTSKELRLATDNFHSSNKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL+NG QVAVK LSA SKQG+REF++EI T++  RH NLV+LIGCCV   +RI
Sbjct  57   FGTVYKGTLRNGVQVAVKTLSATSKQGLREFVSEINTIATVRHQNLVQLIGCCVEGTDRI  116

Query  596  LVYEYLENRSLDRVLFG---QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIK  426
            LVYEYLEN SLDR L G   +   VKL+W  R+AIC+GTARGLA+LHEE E  IVHRDIK
Sbjct  117  LVYEYLENSSLDRALLGFGTKDAKVKLDWQKRSAICLGTARGLAFLHEESEQRIVHRDIK  176

Query  425  ASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSF  246
            ASNILLDKDY PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY   GQLT+KADVYSF
Sbjct  177  ASNILLDKDYNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAFGGQLTLKADVYSF  236

Query  245  GVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKV  66
            G+++LE++SGR+S+  +W G +K LLE+AW LY++G +LELVD +++ FP+EEVL+Y+KV
Sbjct  237  GIVVLEIISGRTSAKADWRGSEKFLLEQAWELYEKGALLELVDPDLDEFPEEEVLRYIKV  296

Query  65   ALLCTQASASRRPTMSQVIDM  3
            AL C QA+ASRRP MSQV+DM
Sbjct  297  ALFCAQAAASRRPLMSQVVDM  317



>ref|XP_008442328.1| PREDICTED: putative serine/threonine-protein kinase [Cucumis 
melo]
Length=371

 Score =   431 bits (1107),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 207/320 (65%), Positives = 252/320 (79%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQE-SFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSCTCFG+S++ + R    A +E   D  +N     +  S++ELR+A+++F   N+IGRG
Sbjct  1    MSCTCFGSSTLEKKRISIRADKELDIDLPEN----VKQISFNELRSASDDFHSSNRIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL+NG QVA+K LS +SKQG REFLTEI+T+SN RH NLVELIGCC  + NR
Sbjct  57   GFGTVYKGTLRNGVQVAIKKLSIESKQGAREFLTEIKTISNIRHPNLVELIGCCSQKANR  116

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLD  L   +  +V L+W  R++IC+GTARGL +LHEE  PHIVHRDIKA
Sbjct  117  ILVYEYLENNSLDHALLDPKKTSVHLDWGKRSSICIGTARGLQFLHEEAVPHIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT+KADVYSFG
Sbjct  177  SNILLDKDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE+VSG+ SS++        LL R W LY+EG +L++VD  +  +P+EEVL+YMKVA
Sbjct  237  VLILEIVSGKRSSTVFGVEISVLLLGRVWELYEEGKLLDIVDPRLGDYPQEEVLRYMKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+A+RRP MSQVIDM
Sbjct  297  LFCTQAAANRRPAMSQVIDM  316



>ref|XP_003637382.1| hypothetical protein MTR_084s0004 [Medicago truncatula]
Length=392

 Score =   427 bits (1098),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 210/326 (64%), Positives = 255/326 (78%), Gaps = 10/326 (3%)
 Frame = -1

Query  959  VMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            +MSC CFGAS++++ R+      E        +    +FS  +LR AT+++    KIGRG
Sbjct  19   IMSCGCFGASTLKKKRSPPHTPNE---IDGYPLENIMHFSEKDLRLATDDYHPSKKIGRG  75

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVY+GTLKNGRQVA+K+LSA SKQG+REFLTEI+T+S+ +H NLVEL+GCC  E NR
Sbjct  76   GFGTVYQGTLKNGRQVAIKSLSAASKQGVREFLTEIKTISHVKHPNLVELVGCCAQEPNR  135

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
             LVYEY+EN SLDR L G +S  +KL+W  R+ IC GTARGLA+LHEE  PHIVHRDIKA
Sbjct  136  TLVYEYVENNSLDRALLGNRSTNIKLDWGKRSNICTGTARGLAFLHEEAVPHIVHRDIKA  195

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+ + PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFG
Sbjct  196  SNILLDRHFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFG  255

Query  242  VLILEVVSGRSSSSMNWGGQQKALLE------RAWNLYDEGNMLELVDSEVERFPKEEVL  81
            VLILEV+SG+SS+  NWGG  K LLE       AW L++E  +LELVD ++  FPKEEV+
Sbjct  256  VLILEVISGQSSARTNWGGSNKFLLEWVRFQLPAWQLHEEERLLELVDPDMVEFPKEEVI  315

Query  80   KYMKVALLCTQASASRRPTMSQVIDM  3
            +YMKVA  CTQA+ASRRP+MSQV+DM
Sbjct  316  RYMKVAFFCTQAAASRRPSMSQVVDM  341



>ref|XP_004146592.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cucumis sativus]
 ref|XP_004158036.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Cucumis sativus]
Length=383

 Score =   426 bits (1094),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 205/320 (64%), Positives = 250/320 (78%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQE-SFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC CFG+S++ + R    A +E   D  +N     +  S++ELR+A+++F   N+IGRG
Sbjct  13   MSCICFGSSTLEKERISTRADKELDIDLLEN----VKQISFNELRSASDDFHSNNRIGRG  68

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL+NG QVA+K LS +SKQG REFLTEI+T+SN RH NLVELIGCC  + +R
Sbjct  69   GFGTVYKGTLRNGVQVAIKKLSIESKQGAREFLTEIKTISNIRHPNLVELIGCCSQKASR  128

Query  599  ILVYEYLENRSLDRVLFGQSG-AVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLD  L      +V L+W  R++IC+GTARGL +LHEE  PHIVHRDIKA
Sbjct  129  ILVYEYLENNSLDHALLDPKKISVHLDWRKRSSICIGTARGLQFLHEEAVPHIVHRDIKA  188

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT+KADVYSFG
Sbjct  189  SNILLDKDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFG  248

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE+VSG+ SS++        LL R W LY+EG +L++VD  +  +P+EEVL+YMKVA
Sbjct  249  VLILELVSGKRSSTVFGVEISILLLGRVWELYEEGKLLDIVDPRLGDYPQEEVLRYMKVA  308

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+A+RRP MSQVIDM
Sbjct  309  LFCTQAAANRRPVMSQVIDM  328



>ref|XP_010241991.1| PREDICTED: putative serine/threonine-protein kinase [Nelumbo 
nucifera]
Length=372

 Score =   423 bits (1087),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 213/319 (67%), Positives = 253/319 (79%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFGA +V + +      Q   DA +      + F Y+EL++ATNNF   NKIGRGG
Sbjct  1    MSCGCFGAPAVEKKKYHAYTHQ---DATEPLPGNIKIFRYNELKSATNNFDASNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKG L NG +VAVKALSA+SKQG+ +FL EI+TVSN +H NLVELIGCCV  NNRI
Sbjct  58   FGTVYKGILSNGTKVAVKALSAESKQGVNQFLAEIQTVSNVKHPNLVELIGCCVQGNNRI  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SLDR L G +S + KL+W  R++IC+GTARGL +LHEE+EP IVHRDIKAS
Sbjct  118  LVYEYVENNSLDRALLGSKSKSTKLDWDKRSSICMGTARGLIFLHEELEPPIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILL KD+  KIGDFGLAKLFP+NITHIST++AGT GYLAPEYVL GQLT KADVYSFGV
Sbjct  178  NILLGKDFIAKIGDFGLAKLFPENITHISTRLAGTTGYLAPEYVLRGQLTKKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L LEV+SGRS ++  WG  +K LLE  W+LY EG +LELVD E+E +P+EEVL+Y+KVAL
Sbjct  238  LTLEVISGRSVAT-TWGEMKKCLLEWTWHLYGEGKLLELVDPEIEEYPEEEVLRYIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ +A RRPTMSQV+DM
Sbjct  297  FCTQETAGRRPTMSQVMDM  315



>ref|XP_004485761.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Cicer arietinum]
 ref|XP_004485762.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Cicer arietinum]
 ref|XP_004485763.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X3 [Cicer arietinum]
Length=369

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 249/320 (78%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRR-NRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M C CFG  SV++  R  N    E      ++I   R+FS  ELR AT+NF   NKIGRG
Sbjct  1    MRCGCFGTLSVKKEKRPSNYISSEIEGYPLDNI---RHFSDKELRLATDNFHLSNKIGRG  57

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVY+GTLK+GR++AVK LS  SKQG+REFLTEI+T+SN +HSNLVEL+G C+   NR
Sbjct  58   GFGTVYQGTLKDGRKIAVKPLSVGSKQGVREFLTEIKTLSNVKHSNLVELVGFCIQGPNR  117

Query  599  ILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
             LVYEY+EN +L   L G+ S  +KLEW  R+AIC+GTA+GLAYLHEE+  HIVHRDIKA
Sbjct  118  TLVYEYVENGNLHTALLGKKSSNIKLEWRKRSAICIGTAKGLAYLHEELTQHIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+LLDKD+ PKIGDFG+AKLFPD+ITHIST+IAGT GYLAPEY L GQLT KAD+YSFG
Sbjct  178  SNVLLDKDFNPKIGDFGMAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTKKADIYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE++SG+SSS  NW G  K LLE AW L+++   LELVD  +E + ++EV+KY+KVA
Sbjct  238  VLILEIISGKSSSRTNWEGSHKFLLEWAWQLHEDEKWLELVDPNMEEYHEKEVIKYIKVA  297

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQ++A RRP MSQV+DM
Sbjct  298  LFCTQSTARRRPLMSQVVDM  317



>ref|XP_003593537.1| Cysteine-rich receptor-like protein kinase [Medicago truncatula]
 gb|AES63788.1| receptor-like kinase [Medicago truncatula]
Length=370

 Score =   420 bits (1080),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 201/322 (62%), Positives = 250/322 (78%), Gaps = 8/322 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGD---NSIARTRNFSYDELRTATNNFGQVNKIG  786
            M C CFGAS  R+       +   + +G+     +   R+FS  EL  AT+N+   NKIG
Sbjct  1    MRCGCFGASRTRKKER----KPSDYISGEIEGYPLDNIRHFSDKELSLATDNYHLGNKIG  56

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
            RGGFGTVY+GTLK+GR++AVK LS  SKQG+REFLTEI+T+SN +HSNLVEL+G C+   
Sbjct  57   RGGFGTVYQGTLKDGRKIAVKPLSVGSKQGVREFLTEIKTLSNVKHSNLVELVGFCIQGP  116

Query  605  NRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NR +VYEY+EN +L   L G+ S +VK++W  R+ IC+GTA+GLAYLHEE+  HIVHRDI
Sbjct  117  NRTVVYEYVENGNLHTALLGKKSLSVKMKWRERSTICIGTAKGLAYLHEELTQHIVHRDI  176

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASN+LLDKD+ PKIGDFG+AKLFPD+ITHIST+IAGT GYLAPEY L GQLT KADVYS
Sbjct  177  KASNVLLDKDFNPKIGDFGMAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTKKADVYS  236

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVLILE++SG+SSS  NW G  K+LLE AW L++E   L LVD E+E FP++EV+KY+K
Sbjct  237  FGVLILEIISGKSSSRTNWDGSHKSLLEWAWQLHEEEKWLALVDPEMEEFPEKEVIKYIK  296

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VAL CTQA+A RRP M+QV+DM
Sbjct  297  VALFCTQAAARRRPLMTQVVDM  318



>gb|AFK33937.1| unknown [Lotus japonicus]
Length=367

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 199/319 (62%), Positives = 245/319 (77%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFGASS ++    +    E        +A  R FS  ELR AT+N+   NKIGRGG
Sbjct  1    MVCACFGASSTKKEIRPSYISSE---IDGYPLADVRPFSDKELRLATDNYHLSNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTLK+GR+VAVK LS  SKQG+REFLTEI+T+S  +H NLV+LIG C+   NR 
Sbjct  58   FGTVYKGTLKDGRRVAVKTLSVGSKQGVREFLTEIKTLSTVKHPNLVKLIGFCIQAPNRA  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY+Y+EN S+   L G +   +KL+W  R+AIC+ TA+GLAYLHEE+ PHIVHRDIKAS
Sbjct  118  LVYQYMENGSIYSALLGTKKTNIKLDWQKRSAICLDTAKGLAYLHEELVPHIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD+D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT KADV+SFGV
Sbjct  178  NVLLDRDFKPKIGDFGLAKLFPDDITHISTRIAGTSGYLAPEYALGGQLTKKADVFSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE++SG SS+  N  G  K  LE AW LY+EG +LELVD +++ +P++EV +YMKVAL
Sbjct  238  LILEIISGTSSARTNRTGSHKLFLEWAWELYEEGKLLELVDPDMKEYPEKEVTRYMKVAL  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ++ASRRP M+QV+DM
Sbjct  298  FCTQSAASRRPLMTQVVDM  316



>gb|KHN08541.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=360

 Score =   417 bits (1071),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 200/320 (63%), Positives = 250/320 (78%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C CFGA S++  R   +  +      DN     R FS  ELR AT+N+   NKIGRGG
Sbjct  1    MTCGCFGAKSIKAKRPSYVPGEIDGYPLDN----VRQFSDKELRLATDNYNPKNKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVY+GTL++GR++AVK LS  SKQG+REFLTEI+T+SN +HSNLVELIG C+   +R 
Sbjct  57   FGTVYQGTLRDGRRIAVKTLSVWSKQGVREFLTEIKTLSNVKHSNLVELIGFCIQGPSRT  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYE++EN SL+  L G ++  +KLEW  R+AIC+G A+GLA+LHEE+ P IVHRDIKAS
Sbjct  117  LVYEHVENGSLNSALLGTRNKNMKLEWRKRSAICLGIAKGLAFLHEELSPPIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD+D+ PKIGDFGLAKLFPD++THIST+IAGT GYLAPEY L GQLT KAD+YSFGV
Sbjct  177  NVLLDRDFNPKIGDFGLAKLFPDDVTHISTRIAGTTGYLAPEYALGGQLTKKADIYSFGV  236

Query  239  LILEVVSGRSSS-SMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            LILE++SGRSS+   N GG  K LLE AW LY+E  +LE VD ++E FP+EEV++YMKVA
Sbjct  237  LILEIISGRSSARRTNGGGSHKFLLEWAWQLYEERKLLEFVDQDMEEFPEEEVIRYMKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQ++A+RRP M QV+DM
Sbjct  297  LFCTQSAANRRPLMIQVVDM  316



>ref|XP_003547141.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Glycine max]
 ref|XP_006597422.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Glycine max]
Length=360

 Score =   416 bits (1070),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 201/320 (63%), Positives = 248/320 (78%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C CFGA S++  R   +  +      DN     R FS  ELR AT+N+   NKIGRGG
Sbjct  1    MTCGCFGAKSIKAKRPSYVPGEIDGYPLDN----VRQFSDKELRLATDNYNPNNKIGRGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVY+GTL++GR +AVK LS  SKQG+REFLTEI+T+SN  H NLVELIG C+   +R 
Sbjct  57   FGTVYQGTLRDGRHIAVKTLSVWSKQGVREFLTEIKTLSNVEHPNLVELIGFCIQGPSRT  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEY+EN SL+  L G ++  +KL+W  R+AIC+GTA+GLA+LHEE+ P IVHRDIKAS
Sbjct  117  LVYEYVENGSLNSALLGTRNENMKLDWRKRSAICLGTAKGLAFLHEELSPPIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD+D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT KAD+YSFGV
Sbjct  177  NVLLDRDFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTKKADIYSFGV  236

Query  239  LILEVVSGRSSS-SMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            LILE++SGRSS+   N GG  K LLE AW LY+E  +LE VD ++E FP+EEV++YMKVA
Sbjct  237  LILEIISGRSSARRTNGGGSHKFLLEWAWQLYEERKLLEFVDQDMEEFPEEEVIRYMKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQ++A+RRP M QV+DM
Sbjct  297  LFCTQSAANRRPLMIQVVDM  316



>ref|XP_008809403.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Phoenix dactylifera]
Length=368

 Score =   415 bits (1066),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/320 (62%), Positives = 244/320 (76%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSV-RRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M   CF A SV  ++R  +        + +N       FSY ELR ATNNF   NK+G+G
Sbjct  1    MRWCCFDAPSVTEKDRPNSQQDLRRLSSSENITV----FSYGELRAATNNFHPCNKLGQG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTLKNG  VA K LSA+SKQG+ EFLTEI+ ++N +H NLVELIGCC+  + R
Sbjct  57   GFGTVYKGTLKNGAPVATKVLSAESKQGVHEFLTEIKILTNVKHPNLVELIGCCIQGSTR  116

Query  599  ILVYEYLENRSLDRVLFGQSGAV-KLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLDR L G  G + KL W  R++IC+GTARGLA+LHEE+EP IVHRDIKA
Sbjct  117  ILVYEYLENNSLDRALRGSDGEIGKLNWSMRSSICMGTARGLAFLHEELEPQIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++TPKIGDFGLA+LFPD+ THIST +AGT GY+APEY + G LT KADVYSFG
Sbjct  177  SNILLDRNFTPKIGDFGLARLFPDDTTHISTCVAGTTGYMAPEYAIHGHLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            +L LE+VSGRS S  NW  Q+K LLE AW LY+EGN++ELVD  ++ + +EEVL+Y+KVA
Sbjct  237  MLALEIVSGRSISKANWSEQEKFLLEWAWQLYEEGNLIELVDPNLKEYLEEEVLRYIKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+  +RPTM QV++M
Sbjct  297  LFCTQAATKQRPTMPQVVEM  316



>ref|XP_009382762.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382763.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382764.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382765.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382766.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382767.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382768.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382769.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   414 bits (1063),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 252/320 (79%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C+CF A  + R +    ++QE   AG +S  + + FSY +L +AT+NF    +IGRGG
Sbjct  1    MNCSCFDAL-LSRKKLRQHSEQEL--AGFSSDKKIKIFSYSDLSSATDNFCPDKRIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL+NG  VA+K LSA+SKQG++EFLTEI+T++N  H NLVELIGCCV +++RI
Sbjct  58   FGTVYKGTLRNGVTVAIKVLSAESKQGVKEFLTEIDTIANVGHPNLVELIGCCVQDSSRI  117

Query  596  LVYEYLENRSLDRVLFGQS--GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            LVYE++EN SLDR L G +   + KL W+ R+AIC+GTARGLA+LHE++EP IVHRDIKA
Sbjct  118  LVYEHMENGSLDRTLLGMNIDKSTKLSWNIRSAICIGTARGLAFLHEDLEPPIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD ++ PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  178  SNILLDSNFDPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYALQGQLTKKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL++E++SGRS S     G  + LLER W L+ EG + EL+D  ++ +P+E+VLK++KVA
Sbjct  238  VLVIEIISGRSISKSYLSGVNQFLLERTWQLFQEGRLKELIDPVLQEYPEEQVLKFIKVA  297

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA A RRP+M+QV+ M
Sbjct  298  LFCTQAVAVRRPSMTQVVHM  317



>ref|XP_009392252.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392253.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
Length=378

 Score =   412 bits (1060),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/320 (61%), Positives = 251/320 (78%), Gaps = 7/320 (2%)
 Frame = -1

Query  956  MSCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M+C+CFGA  S ++  T +    E F +  N     + FSY EL++AT+NF   NKIGRG
Sbjct  1    MNCSCFGAIFSWKKQLTYSEQNLEGFSSEKN----IKLFSYIELKSATDNFHPSNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL+NG  VA+K LSA+S+QGI+EFLTEI+ ++N +H NLVELIG CV   NR
Sbjct  57   GFGTVYKGTLRNGALVAIKVLSAESRQGIKEFLTEIDVITNVKHPNLVELIGSCVEGGNR  116

Query  599  ILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN S+DR L G+ S A KL W+ R++IC+G ARGL YLHEE+EP IVHRDIK 
Sbjct  117  ILVYEYLENSSIDRALLGRNSDATKLNWYIRSSICLGIARGLKYLHEELEPPIVHRDIKT  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++ PKIGDFG+AKLFPDNITHIST++AGT GYLAPEY + G+LT KAD+YSFG
Sbjct  177  SNILLDRNFVPKIGDFGVAKLFPDNITHISTRVAGTTGYLAPEYAMKGKLTKKADIYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            +L+LE++SGRS+S  +W    K LLE  WNL++EG + E+VD  ++ +P+++V++Y+KVA
Sbjct  237  ILVLEIISGRSNSK-SWSEIGKPLLEWTWNLFEEGRLAEVVDPALKEYPQDQVIRYIKVA  295

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA A RRP+M QV+DM
Sbjct  296  LFCTQAVAGRRPSMLQVVDM  315



>gb|EAZ32429.1| hypothetical protein OsJ_16639 [Oryza sativa Japonica Group]
Length=393

 Score =   409 bits (1051),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 201/330 (61%), Positives = 246/330 (75%), Gaps = 22/330 (7%)
 Frame = -1

Query  980  SFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNN  810
            S++CCI              +++ G    +  +  G + I   +N   FSY ELR+AT N
Sbjct  21   SWWCCIP-------------KSKKG----ENPYSHGVSGIPPEKNIRLFSYSELRSATEN  63

Query  809  FGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVEL  630
            F + NKIGRGGFGTVYKGT++NGR VAVK LSA+S+QG+REFLTEI+ ++N +H NLVEL
Sbjct  64   FNRSNKIGRGGFGTVYKGTIRNGRDVAVKVLSAESRQGVREFLTEIDVITNVKHPNLVEL  123

Query  629  IGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVE  453
            IGCCV  NNRILVYEYLEN SLDR L G  S      W  R+AIC+G A+GLAYLHEE+ 
Sbjct  124  IGCCVEGNNRILVYEYLENSSLDRALLGSNSEPANFTWSIRSAICIGIAKGLAYLHEEIA  183

Query  452  PHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQL  273
              IVHRDIKASNILLDK Y PKIGDFGLAKLFPDNITHIST++AGT GYLAPEY   GQL
Sbjct  184  SPIVHRDIKASNILLDKLYNPKIGDFGLAKLFPDNITHISTRVAGTTGYLAPEYAWHGQL  243

Query  272  TMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPK  93
            T +AD+YSFGVL+LE+VSG+ SSS +     K LLE+AW L++ G + ELVDSE+  +P+
Sbjct  244  TKRADIYSFGVLVLEIVSGK-SSSRSLLADDKILLEKAWELHEVGKLKELVDSEMGDYPE  302

Query  92   EEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            EEVL+Y+K AL CTQA+A+RRP+M QV+ M
Sbjct  303  EEVLRYIKTALFCTQAAAARRPSMPQVVTM  332



>ref|NP_001054279.1| Os04g0679200 [Oryza sativa Japonica Group]
 emb|CAE05726.2| OSJNBb0017I01.6 [Oryza sativa Japonica Group]
 dbj|BAF16193.1| Os04g0679200 [Oryza sativa Japonica Group]
 dbj|BAG94524.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97022.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   408 bits (1048),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 201/330 (61%), Positives = 246/330 (75%), Gaps = 22/330 (7%)
 Frame = -1

Query  980  SFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNN  810
            S++CCI              +++ G    +  +  G + I   +N   FSY ELR+AT N
Sbjct  2    SWWCCIP-------------KSKKG----ENPYSHGVSGIPPEKNIRLFSYSELRSATEN  44

Query  809  FGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVEL  630
            F + NKIGRGGFGTVYKGT++NGR VAVK LSA+S+QG+REFLTEI+ ++N +H NLVEL
Sbjct  45   FNRSNKIGRGGFGTVYKGTIRNGRDVAVKVLSAESRQGVREFLTEIDVITNVKHPNLVEL  104

Query  629  IGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVE  453
            IGCCV  NNRILVYEYLEN SLDR L G  S      W  R+AIC+G A+GLAYLHEE+ 
Sbjct  105  IGCCVEGNNRILVYEYLENSSLDRALLGSNSEPANFTWSIRSAICIGIAKGLAYLHEEIA  164

Query  452  PHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQL  273
              IVHRDIKASNILLDK Y PKIGDFGLAKLFPDNITHIST++AGT GYLAPEY   GQL
Sbjct  165  SPIVHRDIKASNILLDKLYNPKIGDFGLAKLFPDNITHISTRVAGTTGYLAPEYAWHGQL  224

Query  272  TMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPK  93
            T +AD+YSFGVL+LE+VSG+ SSS +     K LLE+AW L++ G + ELVDSE+  +P+
Sbjct  225  TKRADIYSFGVLVLEIVSGK-SSSRSLLADDKILLEKAWELHEVGKLKELVDSEMGDYPE  283

Query  92   EEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            EEVL+Y+K AL CTQA+A+RRP+M QV+ M
Sbjct  284  EEVLRYIKTALFCTQAAAARRPSMPQVVTM  313



>ref|XP_006653882.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like, partial [Oryza brachyantha]
Length=424

 Score =   409 bits (1052),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 193/284 (68%), Positives = 228/284 (80%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY ELR+AT NF + NKIGRGGFGTVYKGT++NGR VAVK LSA+S+QGIREFLTEI
Sbjct  81   RLFSYSELRSATENFSRGNKIGRGGFGTVYKGTIRNGRDVAVKVLSAESRQGIREFLTEI  140

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICV  495
            + ++N +H NLVELIGCCV  NNRILVYEYLEN SLDR L G  S      W  R+AIC+
Sbjct  141  DVITNVKHPNLVELIGCCVEANNRILVYEYLENSSLDRALLGSNSEPANFTWSVRSAICI  200

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G A+GLAYLHEE+   IVHRDIKASNILLDK Y PKIGDFGLAKLFPDNITHIST++AGT
Sbjct  201  GIAKGLAYLHEEIASPIVHRDIKASNILLDKLYNPKIGDFGLAKLFPDNITHISTRVAGT  260

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT +AD+YSFGVL+LE++SG+ SSS +     K LLE+AW L++ G 
Sbjct  261  TGYLAPEYAWHGQLTKRADIYSFGVLVLEIISGK-SSSRSLLADDKILLEKAWELHEAGK  319

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + ELVD E+  +P+EEVL+Y K AL CTQA+A+RRP+M QV+ M
Sbjct  320  LKELVDPEMGDYPEEEVLRYTKTALFCTQAAAARRPSMPQVVTM  363



>emb|CAJ86254.1| H0801D08.12 [Oryza sativa Indica Group]
 gb|EAY96066.1| hypothetical protein OsI_17939 [Oryza sativa Indica Group]
Length=393

 Score =   407 bits (1047),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 200/330 (61%), Positives = 246/330 (75%), Gaps = 22/330 (7%)
 Frame = -1

Query  980  SFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNN  810
            S++CCI              +++ G    +  +  G + I   +N   FSY ELR+AT N
Sbjct  21   SWWCCIP-------------KSKKG----ENPYSHGVSGIPPEKNIRLFSYSELRSATEN  63

Query  809  FGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVEL  630
            F + NKIGRGGFGTVYKGT++NGR VAVK LSA+S+QG+REFLTEI+ ++N +H NLVEL
Sbjct  64   FNRSNKIGRGGFGTVYKGTIRNGRDVAVKVLSAESRQGVREFLTEIDVITNVKHPNLVEL  123

Query  629  IGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVE  453
            IGCCV  NNRILVYEYLEN SLDR L G  S      W  R+AIC+G A+GLAYLHEE+ 
Sbjct  124  IGCCVEGNNRILVYEYLENSSLDRALLGSNSEPANFTWSIRSAICIGIAKGLAYLHEEIA  183

Query  452  PHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQL  273
              IVHRDIKASNILLDK Y PKIGDFGLAKLFPDNITHIST++AGT GYLAPEY   GQL
Sbjct  184  SPIVHRDIKASNILLDKLYNPKIGDFGLAKLFPDNITHISTRVAGTTGYLAPEYAWHGQL  243

Query  272  TMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPK  93
            T +AD+YSFGVL+LE+VSG+ SSS +     K LLE+AW L++ G + ELVDSE+  +P+
Sbjct  244  TKRADIYSFGVLVLEIVSGK-SSSRSLLADDKILLEKAWELHEVGKLKELVDSEMGDYPE  302

Query  92   EEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            EEVL+++K AL CTQA+A+RRP+M QV+ M
Sbjct  303  EEVLRFIKTALFCTQAAAARRPSMPQVVTM  332



>ref|XP_003580831.1| PREDICTED: putative serine/threonine-protein kinase [Brachypodium 
distachyon]
Length=383

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 194/311 (62%), Positives = 239/311 (77%), Gaps = 9/311 (3%)
 Frame = -1

Query  923  RRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIGRGGFGTVYKGT  753
            RR+R     Q+ S+      I+  +N   FSY ELR+AT+NF + NK+GRGGFGTVYKGT
Sbjct  17   RRSRE----QENSYSHSIGGISAEKNIRLFSYSELRSATDNFNRSNKVGRGGFGTVYKGT  72

Query  752  LKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLEN  573
            ++N R VAVK LSA+S+QG REFLTEI+ +SN +H NLVELIGCCV  ++RILVYEYLEN
Sbjct  73   IRNRRDVAVKVLSAESRQGTREFLTEIDVISNVKHPNLVELIGCCVEGDHRILVYEYLEN  132

Query  572  RSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDY  396
             SLDR L G  S      W  R+AIC G ARGLAYLHEE+   IVHRDIKASNIL+DK+Y
Sbjct  133  SSLDRALLGSNSEPANFTWSIRSAICTGVARGLAYLHEEIASPIVHRDIKASNILMDKNY  192

Query  395  TPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSG  216
             PKIGDFGLAKLFPDNITHIST++AGT GYLAPEY   GQLT KAD+YSFGVL++E++SG
Sbjct  193  IPKIGDFGLAKLFPDNITHISTRVAGTTGYLAPEYAWHGQLTKKADIYSFGVLVIEIISG  252

Query  215  RSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASAS  36
            + S S +     K LLE+AW LY+ GN+ ELVD ++  +P+EE ++Y+KVAL CTQA+A+
Sbjct  253  K-SGSRSLLADDKLLLEKAWELYEAGNLTELVDPDIRDYPEEEAIRYIKVALFCTQAAAA  311

Query  35   RRPTMSQVIDM  3
            RRP+M QV+ M
Sbjct  312  RRPSMPQVLKM  322



>ref|XP_009385996.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
Length=382

 Score =   405 bits (1040),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 249/320 (78%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+CF A   RR    + ++QE+   G +S    R  SYDELR+AT+NF Q NKIGRGG
Sbjct  1    MVCSCFNALLSRRKHRQH-SEQET--GGFSSDKNVRLISYDELRSATDNFHQSNKIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL+N  ++AVK LSA+SKQG+ EFLTEI+ ++N RH NLVELIGCC   ++RI
Sbjct  58   FGTVYKGTLRNRVEIAVKVLSAESKQGVNEFLTEIDAIANVRHPNLVELIGCCAQGSSRI  117

Query  596  LVYEYLENRSLDRVLFGQS--GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            LVYEY+EN SLDR L G +     KL W  R+A+C+GTA+GLAYLHEE+EP IVHRDIKA
Sbjct  118  LVYEYMENSSLDRALLGLNIDDTSKLNWKIRSAVCIGTAKGLAYLHEELEPPIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD D+ PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY + GQLT KADVYSFG
Sbjct  178  SNILLDSDFAPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYAMQGQLTKKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL++E++S RSSS   W G  ++LLE  W L+ EG + E++D  ++ +P+E+VL+++KV 
Sbjct  238  VLVIEIISSRSSSKTYWSGLGQSLLEWTWQLFGEGRIKEVIDPALQEYPEEQVLRFIKVG  297

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQASA RRP+M QV++M
Sbjct  298  LFCTQASAGRRPSMPQVVEM  317



>ref|XP_007148190.1| hypothetical protein PHAVU_006G187700g [Phaseolus vulgaris]
 ref|XP_007148191.1| hypothetical protein PHAVU_006G187700g [Phaseolus vulgaris]
 gb|ESW20184.1| hypothetical protein PHAVU_006G187700g [Phaseolus vulgaris]
 gb|ESW20185.1| hypothetical protein PHAVU_006G187700g [Phaseolus vulgaris]
Length=372

 Score =   404 bits (1039),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 252/321 (79%), Gaps = 6/321 (2%)
 Frame = -1

Query  959  VMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            +M+C CFGA S ++ R+ N+    + +     +   R FS  ELR AT+N+   NKIGRG
Sbjct  10   IMTCGCFGAKSAKKRRSSNV----NGEIDGYPLVNVRQFSDKELRLATDNYHSNNKIGRG  65

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVY+GTL++GR++AVK LS  SKQG+REFLTEI+T+SN +H+NLVELIG C+   +R
Sbjct  66   GFGTVYQGTLRDGRRIAVKTLSNWSKQGVREFLTEIKTLSNVKHANLVELIGFCIQGPSR  125

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
             LVYEY+EN SL+  L G ++  +KL+W  R+ IC+GTA+GLA+LHEE+ P IVHRDIKA
Sbjct  126  TLVYEYVENGSLNSALLGTRNEKIKLDWRKRSGICLGTAKGLAFLHEELSPPIVHRDIKA  185

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+LLDKD+ PKIGDFGLAKLFPD ITH+ST+IAGT GYLAPEY + GQLT KAD+YSFG
Sbjct  186  SNVLLDKDFNPKIGDFGLAKLFPDGITHVSTRIAGTAGYLAPEYAIGGQLTKKADIYSFG  245

Query  242  VLILEVVSGRSSS-SMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKV  66
            VL+LE+VSGRSS+   N GG  K LLE AW LY+EG +LE VD E+E FP+EEV++YMKV
Sbjct  246  VLVLEIVSGRSSARRTNGGGSHKFLLEWAWQLYEEGKLLEFVDPEMEEFPEEEVMRYMKV  305

Query  65   ALLCTQASASRRPTMSQVIDM  3
            AL CTQ++ASRRP M QV+ M
Sbjct  306  ALFCTQSAASRRPLMIQVVSM  326



>ref|XP_009765299.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Nicotiana sylvestris]
Length=317

 Score =   401 bits (1031),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 217/254 (85%), Gaps = 2/254 (1%)
 Frame = -1

Query  761  KGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEY  582
            +GTLK G +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIGCC+  +NRILVYEY
Sbjct  10   EGTLKRGVEVAVKTLSAESRQGLREFLTEIETISDVRHPNLVELIGCCLEGSNRILVYEY  69

Query  581  LENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLD  405
            +ENRSLDR LFG S   VKLEW TRAAIC+GTARGLAYLHEE+ PHIVHRDIKASNILLD
Sbjct  70   VENRSLDRALFGSSARNVKLEWDTRAAICLGTARGLAYLHEELVPHIVHRDIKASNILLD  129

Query  404  KDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEV  225
            KDY PKIGDFGLAKLFPDNITHI+TQI GT GYLAPEYV+  QLT KADVYSFGVLILE 
Sbjct  130  KDYKPKIGDFGLAKLFPDNITHITTQIKGTTGYLAPEYVIGRQLTSKADVYSFGVLILET  189

Query  224  VSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQA  45
            VSGRSS S  W G QK LLE AW LY+EG +LELVD E+  FP++EV+KY+KVAL CTQ 
Sbjct  190  VSGRSSGSGTWKG-QKLLLELAWQLYEEGKLLELVDPELRDFPEKEVVKYIKVALFCTQE  248

Query  44   SASRRPTMSQVIDM  3
            + +RRP MSQV+DM
Sbjct  249  NTNRRPMMSQVLDM  262



>ref|XP_002448782.1| hypothetical protein SORBIDRAFT_06g033075 [Sorghum bicolor]
 gb|EES13110.1| hypothetical protein SORBIDRAFT_06g033075 [Sorghum bicolor]
Length=377

 Score =   404 bits (1037),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 230/284 (81%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY ELR+AT+NF + NK+GRGGFGTVYKGT++NGR+VAVK LSA+S+QGIREFLTEI
Sbjct  32   RLFSYAELRSATDNFNRTNKVGRGGFGTVYKGTIRNGREVAVKVLSAESRQGIREFLTEI  91

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICV  495
            + ++N +H NLVELIGCCV  NNRILVYEYL+N SLDR L G  S      W  R+AIC+
Sbjct  92   DVITNVKHPNLVELIGCCVEGNNRILVYEYLKNSSLDRALLGSNSEPADFTWSIRSAICL  151

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G ARGLAYLHEE+   IVHRDIKASNILLD++Y PKIGDFGLAKLFPDN+THIST++AGT
Sbjct  152  GVARGLAYLHEEIASPIVHRDIKASNILLDRNYVPKIGDFGLAKLFPDNVTHISTRVAGT  211

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT KAD+YSFG+L+LE+VSG +SSS +     K LLE+ W LY+  +
Sbjct  212  TGYLAPEYAWHGQLTKKADIYSFGILVLEIVSG-TSSSRSILMDDKVLLEKTWELYEAKS  270

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + ELVD  +  +P+EEV++Y+KVAL C QA+A+RRPTM QV+ M
Sbjct  271  LKELVDPTLVDYPEEEVIRYIKVALFCLQAAAARRPTMPQVVTM  314



>ref|XP_010918428.1| PREDICTED: putative serine/threonine-protein kinase [Elaeis guineensis]
Length=368

 Score =   403 bits (1035),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 243/320 (76%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQES-FDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MS  CF A  V  N   N  Q      +G+N     + FSY EL+ ATNNF   NK+G+G
Sbjct  1    MSWCCFDAPLVTENDLSNPQQDLGRLSSGEN----IKLFSYSELKAATNNFDPCNKLGQG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTL+NG  VA K LSA+S+QG+ EFLTEI+ ++N +H NLV LIGCC+   NR
Sbjct  57   GFGTVYKGTLRNGAPVATKVLSAESRQGVHEFLTEIKILANVKHPNLVGLIGCCIQGTNR  116

Query  599  ILVYEYLENRSLDRVLFGQSGAV-KLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            IL+YEY+EN SLDR L G  G + KL W  R++IC+GTARGLA+LHEE++P IVHRDIKA
Sbjct  117  ILIYEYVENNSLDRALRGSDGEIGKLNWGIRSSICMGTARGLAFLHEELDPQIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++TPKIGDFGLA+LFPD+ THIST++AGT GY+APEY + G LT KADVYSFG
Sbjct  177  SNILLDRNFTPKIGDFGLARLFPDDTTHISTRVAGTTGYMAPEYAIHGHLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            +L LE++SGRS S   W  ++K LL+ AW LY EGN++ELVD  ++ + +EEVL+Y+KVA
Sbjct  237  MLALEIISGRSISKGYWSEKEKFLLDWAWQLYVEGNLIELVDPNLKEYLEEEVLRYIKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA A +RPTM QV++M
Sbjct  297  LFCTQAVARQRPTMPQVVEM  316



>dbj|BAJ93433.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=386

 Score =   403 bits (1036),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 196/324 (60%), Positives = 241/324 (74%), Gaps = 7/324 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDA-----GDNSIARTRNFSYDELRTATNNFGQVNK  792
            MS  C   +  +++   +  QQE   +     G ++    R FSY +LR+AT+NF   NK
Sbjct  1    MSWCCLPRAKKQQHNLYSHRQQEILHSNTSISGISAEKNIRLFSYAQLRSATDNFNHNNK  60

Query  791  IGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVH  612
            +GRGGFG VYKGTL+N + VAVK LSA+S+QGIREFLTEI+ +SN +H NLVELIGCCV 
Sbjct  61   VGRGGFGIVYKGTLQNKQDVAVKVLSAESRQGIREFLTEIDVISNVKHPNLVELIGCCVE  120

Query  611  ENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHR  435
             NNRILVYEYLEN SLDR L G  S      W  R++IC+G ARGLAYLHEE+   IVHR
Sbjct  121  ANNRILVYEYLENSSLDRALLGSTSDPANFTWSVRSSICIGVARGLAYLHEEIPSPIVHR  180

Query  434  DIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADV  255
            DIKASNIL+DK+Y PKIGDFGLAKLFPDNITHIST++AGT GYLAPEY   GQLT KAD+
Sbjct  181  DIKASNILMDKNYVPKIGDFGLAKLFPDNITHISTRVAGTTGYLAPEYAWHGQLTKKADI  240

Query  254  YSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKY  75
            YSFGVL++EV+SG+S S  +     K LLE+ W LY+ GN+ ELVD ++  +P EE ++Y
Sbjct  241  YSFGVLVIEVISGKSGSR-SLLADDKFLLEKTWELYEAGNLKELVDPDLGDYPDEEAIRY  299

Query  74   MKVALLCTQASASRRPTMSQVIDM  3
            +KVAL CTQA+A+RRPTM QV+ M
Sbjct  300  IKVALFCTQAAAARRPTMLQVVKM  323



>ref|XP_006649796.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Oryza brachyantha]
Length=393

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 197/322 (61%), Positives = 238/322 (74%), Gaps = 4/322 (1%)
 Frame = -1

Query  956  MSCTC-FGASSVRRNRTGNLA--QQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIG  786
            +S +C +G S  RRN+ G+ A     S      + +  R FS  ELR AT NF  +N IG
Sbjct  3    VSASCLWGGSDSRRNQNGSAAVTSPRSGQVISRAGSNVRVFSLKELRLATRNFHMMNCIG  62

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
            RGGFG VYKG LK+G Q+A+K LSA+SKQG  EFLTEI  +SN RH NLV+LIGCCV   
Sbjct  63   RGGFGAVYKGNLKDGCQIAIKKLSAESKQGTNEFLTEINVISNVRHPNLVKLIGCCVEGT  122

Query  605  NRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NR+LVYEY EN SL   L G +S  + L W  RAAICVGTA GLA+LHEE +P IVHRDI
Sbjct  123  NRLLVYEYAENNSLAHALLGPKSRCIPLNWQKRAAICVGTASGLAFLHEEAQPRIVHRDI  182

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDK   PKIGDFGLAKLFPD ITHIST++AGT GYLAPEY L GQLT KAD+YS
Sbjct  183  KASNILLDKKLLPKIGDFGLAKLFPDTITHISTRVAGTMGYLAPEYALLGQLTKKADIYS  242

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVL+LEV+SG+SSS   WG     L+E  W L +EG +LE+VD ++E +P+EE+L ++K
Sbjct  243  FGVLVLEVISGQSSSKSTWGHDMHVLVEWTWKLREEGRLLEIVDPDLEEYPEEEILHFIK  302

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VALLCTQA++ +RP+M QV+DM
Sbjct  303  VALLCTQATSQQRPSMKQVVDM  324



>ref|XP_007026739.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY07241.1| Kinase superfamily protein isoform 2 [Theobroma cacao]
Length=380

 Score =   402 bits (1034),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 245/319 (77%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC CFG   + + R  +  +Q    A DN     R FSY+ LR+AT++F   N+IG GG
Sbjct  1    MSCRCFGLFELFKGRNSHDQKQAQEFATDN----IRLFSYNSLRSATSDFHPSNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VY+G L++G QVA+K LSA+SKQG+REF+TEI+ +SN RH NLVELIGCCV +N+RI
Sbjct  57   FGVVYRGVLRDGTQVAIKTLSAESKQGLREFVTEIDMISNIRHPNLVELIGCCVDDNHRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL  VL G +S  + L+W  RAAIC+GTA GLA+LH E  PHIVHRDIKAS
Sbjct  117  LVYEYLENNSLASVLLGSRSKYIALDWPKRAAICLGTASGLAFLHYEAVPHIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFP+N+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  177  NILLDGNFQPKIGDFGLAKLFPENVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS   +G +   L+E  W L +E  +L++VD E+  +P+ EV++++KVAL
Sbjct  237  LVLELISGRSSSKAAFGVELMLLVEWTWKLKEEERLLDIVDPELTNYPQGEVMRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RPTM QV++M
Sbjct  297  FCTQATAHQRPTMKQVVEM  315



>ref|XP_010242968.1| PREDICTED: putative serine/threonine-protein kinase [Nelumbo 
nucifera]
Length=378

 Score =   402 bits (1032),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 193/282 (68%), Positives = 231/282 (82%), Gaps = 1/282 (0%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            F Y+EL+ AT+NF + NK+GRGGFGTVYKG L NG Q+AVK LS +SKQG  EFLTEI+ 
Sbjct  39   FRYNELKFATDNFHESNKVGRGGFGTVYKGILSNGTQIAVKVLSTESKQGTNEFLTEIQA  98

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGT  489
            VSN +H NLVELIGCC   NNRILVYEY+EN SLD  L G +   + L+W  R+ IC+ T
Sbjct  99   VSNVKHPNLVELIGCCAQGNNRILVYEYVENNSLDGALLGSKKKTINLDWDKRSTICMDT  158

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            ARGLA+LHEE+EPHIVHRDIKASNILL KD+  KIGDFGLAKLFP+NITHIST++AGT G
Sbjct  159  ARGLAFLHEELEPHIVHRDIKASNILLGKDFIAKIGDFGLAKLFPENITHISTRVAGTTG  218

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            YLAPEY L GQLT KADVYSFG+L LE++SGRS ++  WGG ++ LLE  W LY+EG +L
Sbjct  219  YLAPEYALRGQLTKKADVYSFGILTLEIISGRSVATATWGGMKRFLLEWTWQLYEEGKLL  278

Query  128  ELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ELVD E+E FP+EEVL+Y+K+AL CTQA+A RRPTM+QV+DM
Sbjct  279  ELVDPELEEFPEEEVLRYIKIALFCTQAAAGRRPTMTQVMDM  320



>ref|XP_010262824.1| PREDICTED: putative serine/threonine-protein kinase [Nelumbo 
nucifera]
 ref|XP_010262825.1| PREDICTED: putative serine/threonine-protein kinase [Nelumbo 
nucifera]
Length=378

 Score =   401 bits (1031),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 242/320 (76%), Gaps = 7/320 (2%)
 Frame = -1

Query  956  MSCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M  +CFGA  S +R    +  Q E   A +      R FSY  L +AT +F   N++G G
Sbjct  1    MKLSCFGAFKSCKRKNVHSPTQTEEIVASN-----VRLFSYKSLLSATGSFHPSNRVGGG  55

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKG L++G QVAVK+LSA+SKQGIREFLTEI+ +SN +H NLV+LIGCC+   NR
Sbjct  56   GFGIVYKGVLRDGTQVAVKSLSAESKQGIREFLTEIDMISNVKHPNLVQLIGCCIEGTNR  115

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            +LVY Y+EN SL  +L G +S  V L+W TRAAICVGTA GLA+LHEE +PHIVHRDIKA
Sbjct  116  MLVYVYMENNSLAHILLGSKSKHVLLDWPTRAAICVGTAHGLAFLHEEAKPHIVHRDIKA  175

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDK++ PKIGDFGLAKLFPDNITH+STQ+AGT GYLAPEY L GQLT KAD+YSFG
Sbjct  176  SNILLDKNFQPKIGDFGLAKLFPDNITHLSTQVAGTEGYLAPEYALLGQLTKKADIYSFG  235

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE+VSGRS+S   +G   K L+E  W L +EG +L++VD E+  +P++EV +Y+KVA
Sbjct  236  VLILEIVSGRSNSKAAFGEDLKVLVEWTWKLKEEGRLLDIVDPELLEYPEDEVARYIKVA  295

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA   +RP+M +V++M
Sbjct  296  LFCTQAPPQQRPSMKRVLEM  315



>ref|XP_010923071.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Elaeis guineensis]
Length=394

 Score =   401 bits (1031),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 196/336 (58%), Positives = 246/336 (73%), Gaps = 19/336 (6%)
 Frame = -1

Query  986  IGSFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIA-------RTRNFSYDEL  828
            +G  FCC        FGA   R  + G+  +    D+G  ++          R FSY+EL
Sbjct  1    MGRRFCC--------FGAPRSREKKNGHRTKS---DSGVGAVVGLLQAPKNVRLFSYNEL  49

Query  827  RTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARH  648
            ++AT NF   N+IGRGGFG VYKGTL++  QVA+K+LSA+SKQG  EFLTEI+ VSN RH
Sbjct  50   KSATRNFHPTNRIGRGGFGVVYKGTLRDETQVAIKSLSAESKQGTNEFLTEIDMVSNIRH  109

Query  647  SNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAY  471
             NLV+L+GCCV   NRILVYEYLEN SL+  L G ++  + L+W  RAAICVGTA GLA+
Sbjct  110  PNLVQLMGCCVEGTNRILVYEYLENNSLENALLGPKNKRIALDWPKRAAICVGTAHGLAF  169

Query  470  LHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEY  291
            LHEE EPHIVHRDIKASN+LLDKD  PKIGDFGLAKLFP+N+THIST++AGT GYLAPEY
Sbjct  170  LHEEAEPHIVHRDIKASNVLLDKDLAPKIGDFGLAKLFPNNVTHISTRVAGTMGYLAPEY  229

Query  290  VLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSE  111
             L GQLT KAD+YSFGVL+LE++SGRS S   W      LLE AW L DE  +L++VD E
Sbjct  230  ALLGQLTKKADIYSFGVLVLEIISGRSGSKSVWELDMHTLLEWAWKLRDEDRLLDIVDRE  289

Query  110  VERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +  + +EEVL+++KVAL CTQ ++++RP+M QV++M
Sbjct  290  LVGYSEEEVLRFIKVALFCTQGTSNQRPSMKQVVEM  325



>ref|XP_008785370.1| PREDICTED: putative serine/threonine-protein kinase [Phoenix 
dactylifera]
Length=401

 Score =   402 bits (1032),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 194/333 (58%), Positives = 244/333 (73%), Gaps = 14/333 (4%)
 Frame = -1

Query  989  RIGSFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAG---DNSIARTRNFSYDELRTA  819
            R+G  FCC        FGA+  R+ + G    + + D+G     +    R FSY+EL++A
Sbjct  14   RMGRRFCC--------FGAAQSRKRKNG--GHRTTSDSGVGLPQAPKNVRLFSYNELKSA  63

Query  818  TNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNL  639
              NF   N+IGRGGFG VYKGTL++  +VA+K LSA+SKQG  EFLTEI+ VSN RH NL
Sbjct  64   ARNFHPTNRIGRGGFGVVYKGTLRDETEVAIKTLSAESKQGTNEFLTEIDMVSNIRHPNL  123

Query  638  VELIGCCVHENNRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHE  462
            V+L+GCCV   NRILVYEYLEN SL   L G +   + L+W  RAAIC GTA+GLA+LHE
Sbjct  124  VQLMGCCVEGRNRILVYEYLENNSLANALLGPANKRIALDWPKRAAICAGTAQGLAFLHE  183

Query  461  EVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLA  282
            E EPHIVHRDIKASN+LLDKD  PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY L 
Sbjct  184  EAEPHIVHRDIKASNVLLDKDLAPKIGDFGLAKLFPDNVTHISTRVAGTMGYLAPEYALL  243

Query  281  GQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER  102
            GQLT KAD+YSFGVL+LE++SGR  S   W      LLE  W L DE  +L++VD E+  
Sbjct  244  GQLTKKADIYSFGVLVLEIISGRCGSKSIWELDMHTLLEWTWKLRDEDRLLDIVDPELVG  303

Query  101  FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +P+EEVL+++KVAL CTQA++++RP+M +V++M
Sbjct  304  YPEEEVLRFIKVALFCTQATSNQRPSMKRVVEM  336



>ref|XP_006848186.1| hypothetical protein AMTR_s00029p00237920 [Amborella trichopoda]
 gb|ERN09767.1| hypothetical protein AMTR_s00029p00237920 [Amborella trichopoda]
Length=381

 Score =   400 bits (1028),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 241/325 (74%), Gaps = 15/325 (5%)
 Frame = -1

Query  974  FCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVN  795
             CC+N+           RR +  +  Q + F A  N       FSY +LR+AT NF   N
Sbjct  3    LCCLNLR----------RRQKASDTLQAKEFSAKRN----INLFSYKQLRSATRNFHPEN  48

Query  794  KIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCV  615
            +IGRGGFG VYKG L++  QVAVK LSA+S QG+ EFLTEI+T+SN  H NLV+LIGCC+
Sbjct  49   RIGRGGFGVVYKGILRDETQVAVKLLSAESAQGLDEFLTEIDTISNVTHPNLVKLIGCCI  108

Query  614  HENNRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVH  438
             E++R+LVYEYLEN SL   L G  G  + L+W  R AIC+GTA GLA+LHEE+EPHIVH
Sbjct  109  EEDSRMLVYEYLENNSLAYALLGSKGKRIDLDWSKRVAICLGTAHGLAFLHEELEPHIVH  168

Query  437  RDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKAD  258
            RDIKASNILL KD  PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KAD
Sbjct  169  RDIKASNILLAKDLVPKIGDFGLAKLFPDNVTHLSTRVAGTIGYLAPEYALLGQLTKKAD  228

Query  257  VYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLK  78
            +YSFG+LILE+VSGRSSS+  W   +  LLE  W + +EG +LE+VD++++ FP+E+ L+
Sbjct  229  IYSFGILILEIVSGRSSSNTAWAADKYGLLEWIWEMREEGRLLEVVDNDLQEFPEEQALR  288

Query  77   YMKVALLCTQASASRRPTMSQVIDM  3
            ++ +AL CTQA++++RP M+QV+ M
Sbjct  289  FIIIALFCTQAASNQRPNMTQVVAM  313



>ref|XP_004505039.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X5 [Cicer arietinum]
Length=305

 Score =   396 bits (1017),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 184/253 (73%), Positives = 216/253 (85%), Gaps = 1/253 (0%)
 Frame = -1

Query  758  GTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYL  579
            GTLK+GRQVAVK LS  SKQG+REFLTEI+T+S+ +H NLVEL+GCCV E+NR LVYEY+
Sbjct  2    GTLKDGRQVAVKNLSVGSKQGVREFLTEIKTISHIKHPNLVELVGCCVQESNRTLVYEYV  61

Query  578  ENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDK  402
            EN SLDR L G+ S  ++L+W  R+ IC GTARGLA+LHEEV PHIVHRDIKASNILLD+
Sbjct  62   ENNSLDRALLGKRSTNLELDWGKRSNICRGTARGLAFLHEEVVPHIVHRDIKASNILLDR  121

Query  401  DYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVV  222
            D+ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY + GQLTMKADVYSFGVLILE++
Sbjct  122  DFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYAMGGQLTMKADVYSFGVLILEII  181

Query  221  SGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQAS  42
            SG+SS   NWGG  K LLE AW L++EG +LELVD E+  FP+EEV++YMKVA  CTQA+
Sbjct  182  SGKSSVRTNWGGSNKFLLEWAWQLHEEGKLLELVDPEMVEFPEEEVIRYMKVAFFCTQAA  241

Query  41   ASRRPTMSQVIDM  3
            ASRRP MSQV+DM
Sbjct  242  ASRRPLMSQVVDM  254



>ref|XP_004984696.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X4 [Setaria 
italica]
Length=388

 Score =   399 bits (1025),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 186/293 (63%), Positives = 231/293 (79%), Gaps = 5/293 (2%)
 Frame = -1

Query  878  AGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQ  699
            AG+N     R FS +EL+TAT NF  +N IGRGGFG VYKG LK+G Q+A+K L+A+SKQ
Sbjct  32   AGNN----VRVFSLNELKTATRNFHMMNCIGRGGFGAVYKGNLKDGTQIAIKKLAAESKQ  87

Query  698  GIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLE  522
            GI EFLTEI  +SN +H NLV+L+GCCV  NNR+LVYEY EN SL   L G +S  + L+
Sbjct  88   GISEFLTEINVISNVKHPNLVKLLGCCVEGNNRLLVYEYAENNSLANALLGPKSKCIPLD  147

Query  521  WHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNIT  342
            W  RAAIC+GTA GLA+LHEE +P IVHRDIKASNILLDK   PKIGDFGLAKLFPD IT
Sbjct  148  WQKRAAICIGTASGLAFLHEEAQPRIVHRDIKASNILLDKKLLPKIGDFGLAKLFPDAIT  207

Query  341  HISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLER  162
            HIST++AGT GYLAPEY L GQLT KAD+YSFGVL+LEV+SG SSS   WG     L+E 
Sbjct  208  HISTRVAGTMGYLAPEYALLGQLTKKADIYSFGVLLLEVISGESSSKSTWGPDMHVLVEW  267

Query  161  AWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             W L +EG +LE+VD ++E++P+E++L+++KVALLCTQA++ +RP+M QV++M
Sbjct  268  TWKLREEGRLLEIVDPDLEKYPEEQMLRFIKVALLCTQATSQQRPSMKQVVNM  320



>ref|XP_004963376.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Setaria italica]
Length=448

 Score =   401 bits (1030),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/284 (67%), Positives = 228/284 (80%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY ELR+AT+NF + NK+GRGGFG VYKGT++NGR+VAVK LSA+S+QGIREFLTEI
Sbjct  105  RLFSYAELRSATDNFNRTNKVGRGGFGIVYKGTIRNGREVAVKVLSAESRQGIREFLTEI  164

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICV  495
            + +SN +H NLVELIGCCV  NNRILVYEYL+N SLDR L G  S      W  R+AIC+
Sbjct  165  DVISNVKHPNLVELIGCCVEGNNRILVYEYLKNSSLDRALLGSNSEPADFTWSIRSAICL  224

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G ARGLAYLHEE+   IVHRDIKASNILLDK+Y PKIGDFGLAKLFPDN+THIST++AGT
Sbjct  225  GVARGLAYLHEEIASPIVHRDIKASNILLDKNYIPKIGDFGLAKLFPDNVTHISTRVAGT  284

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT KAD+YSFGVL+LE+VSG +SSS +     K LLE+ W LY+   
Sbjct  285  TGYLAPEYAWHGQLTKKADIYSFGVLVLEIVSG-TSSSRSILIDDKILLEKIWELYEANK  343

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + EL+D  +  +P+EEV++Y+KVAL C QA+A+RRP+M QV+ M
Sbjct  344  LKELIDPAIGDYPEEEVIRYIKVALFCIQAAANRRPSMPQVVTM  387



>ref|XP_004984693.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Setaria 
italica]
 ref|XP_004984694.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Setaria 
italica]
 ref|XP_004984695.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X3 [Setaria 
italica]
Length=393

 Score =   399 bits (1025),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 186/293 (63%), Positives = 231/293 (79%), Gaps = 5/293 (2%)
 Frame = -1

Query  878  AGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQ  699
            AG+N     R FS +EL+TAT NF  +N IGRGGFG VYKG LK+G Q+A+K L+A+SKQ
Sbjct  37   AGNN----VRVFSLNELKTATRNFHMMNCIGRGGFGAVYKGNLKDGTQIAIKKLAAESKQ  92

Query  698  GIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLE  522
            GI EFLTEI  +SN +H NLV+L+GCCV  NNR+LVYEY EN SL   L G +S  + L+
Sbjct  93   GISEFLTEINVISNVKHPNLVKLLGCCVEGNNRLLVYEYAENNSLANALLGPKSKCIPLD  152

Query  521  WHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNIT  342
            W  RAAIC+GTA GLA+LHEE +P IVHRDIKASNILLDK   PKIGDFGLAKLFPD IT
Sbjct  153  WQKRAAICIGTASGLAFLHEEAQPRIVHRDIKASNILLDKKLLPKIGDFGLAKLFPDAIT  212

Query  341  HISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLER  162
            HIST++AGT GYLAPEY L GQLT KAD+YSFGVL+LEV+SG SSS   WG     L+E 
Sbjct  213  HISTRVAGTMGYLAPEYALLGQLTKKADIYSFGVLLLEVISGESSSKSTWGPDMHVLVEW  272

Query  161  AWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             W L +EG +LE+VD ++E++P+E++L+++KVALLCTQA++ +RP+M QV++M
Sbjct  273  TWKLREEGRLLEIVDPDLEKYPEEQMLRFIKVALLCTQATSQQRPSMKQVVNM  325



>ref|NP_566341.1| protein kinase [Arabidopsis thaliana]
 gb|AAM61567.1| putative receptor ser thr protein kinase [Arabidopsis thaliana]
 gb|AEE74708.1| protein kinase [Arabidopsis thaliana]
Length=393

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG   +  N +  L Q+E+ +   N++   R FSY+ LR+AT++F   N+IG GG
Sbjct  1    MRYNCFGLLDMC-NGSDRLGQREAEEICTNNV---RVFSYNSLRSATDSFHPTNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV+LIGCC+  NNRI
Sbjct  57   YGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVKLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL  VL G +S  V L+W  RAAICVGTA GLA+LHEEVEPH+VHRDIKAS
Sbjct  117  LVYEYLENNSLASVLLGSRSRYVPLDWSKRAAICVGTASGLAFLHEEVEPHVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD +++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDSNFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SS+   +G +   L+E  W L +E  +LE VD E+ +FP +EV +++KVAL
Sbjct  237  LVLEVISGNSSTRAAFGDEYMVLVEWVWKLREERRLLECVDPELTKFPADEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQAAAQKRPNMKQVMEM  315



>ref|XP_006827803.1| hypothetical protein AMTR_s00009p00267490 [Amborella trichopoda]
 gb|ERM95219.1| hypothetical protein AMTR_s00009p00267490 [Amborella trichopoda]
Length=378

 Score =   396 bits (1018),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 190/282 (67%), Positives = 234/282 (83%), Gaps = 1/282 (0%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            FSY ELR+AT NF   N+IGRGGFGTVY+GTL++G +VAVK+LSA+SKQG+ EFLTEI+ 
Sbjct  32   FSYIELRSATKNFHPSNRIGRGGFGTVYRGTLRDGTEVAVKSLSAESKQGVHEFLTEIDM  91

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGT  489
            +++ RH NLV LIGCCV  N+RILVYEY+EN SL   L G ++  ++L+W+ R+AIC+GT
Sbjct  92   IADVRHPNLVTLIGCCVQGNHRILVYEYVENNSLAYALLGPENKRIELDWNRRSAICMGT  151

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A GLA+LHEE+EPHIVHRDIKASNILLDKD  PKIGDFGLAKLFP+NITHIST++AGT G
Sbjct  152  ANGLAFLHEELEPHIVHRDIKASNILLDKDLLPKIGDFGLAKLFPNNITHISTRVAGTVG  211

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            YLAPEY + GQLT KADVYSFG+LILE++SGRSS+   W   QK LLE  W LY+EG +L
Sbjct  212  YLAPEYAMRGQLTKKADVYSFGILILEIISGRSSAKATWSAMQKFLLEWTWQLYEEGRLL  271

Query  128  ELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ELVD E+E +P+EEVL+++KVAL CTQA+  +RP M QV+ M
Sbjct  272  ELVDPELEEYPEEEVLRFIKVALFCTQAACKQRPDMKQVVTM  313



>ref|XP_010029675.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010029759.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010029832.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010029912.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010029989.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010030068.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010030149.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 gb|KCW88109.1| hypothetical protein EUGRSUZ_A00508 [Eucalyptus grandis]
Length=385

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 194/320 (61%), Positives = 240/320 (75%), Gaps = 7/320 (2%)
 Frame = -1

Query  956  MSCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC CFG  SS +RN +   AQ E  +   N++   R FSY  LR+AT NF   NK+G G
Sbjct  5    MSCGCFGGFSSCKRNSSP--AQAEGDEIPTNNV---RLFSYPSLRSATGNFHPSNKLGGG  59

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKG L++G QVA+K+LSA+SKQG +EFLTEI  +SN  H NLVELIGCCV   NR
Sbjct  60   GFGVVYKGVLRDGTQVAIKSLSAESKQGTKEFLTEINMISNIHHPNLVELIGCCVEGKNR  119

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            +LVYEYLEN SL  VL    G  V L W  R AIC+G A GLA+LHEE +P IVHRDIKA
Sbjct  120  MLVYEYLENNSLASVLLSSKGKHVILNWPQRVAICLGMASGLAFLHEEAKPTIVHRDIKA  179

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+LLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KAD+YSFG
Sbjct  180  SNVLLDGNFHPKIGDFGLAKLFPDNVTHLSTRVAGTVGYLAPEYALFGQLTRKADIYSFG  239

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            +L+LE+VSGRSSS   +G +   L+E  W L  E  +LE+VD E+  +P++EVL+Y+KVA
Sbjct  240  ILLLEIVSGRSSSKAAFGEELMVLVEWTWKLKAEQRLLEIVDPELAEYPEDEVLRYIKVA  299

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA++++RPTM QV++M
Sbjct  300  LFCTQAASNQRPTMKQVVEM  319



>ref|NP_001142074.1| uncharacterized LOC100274231 [Zea mays]
 gb|ACF87585.1| unknown [Zea mays]
 tpg|DAA44524.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=393

 Score =   397 bits (1019),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 242/323 (75%), Gaps = 7/323 (2%)
 Frame = -1

Query  953  SCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRN----FSYDELRTATNNFGQVNKI  789
            S  C G  S  R+++ G +    S  +G + ++R  N    FS +EL+TAT NF  +N I
Sbjct  4    SVGCLGGGSKSRQDQNGQVVAGSSPRSG-HELSRPGNNVHVFSLNELKTATRNFHMLNCI  62

Query  788  GRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHE  609
            GRGGFG VYKG LKNG  +A+K L+A+SKQGI EFLTEI  +SN RH NL++LIGCCV  
Sbjct  63   GRGGFGAVYKGNLKNGTPIAIKKLAAESKQGISEFLTEINVISNVRHPNLIKLIGCCVEG  122

Query  608  NNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRD  432
            +NR+LVYEY EN SL   L G ++  + L+W  R AIC+GTA GLA+LHEE +P IVHRD
Sbjct  123  SNRLLVYEYAENNSLANALLGPKNKCIPLDWQKRVAICIGTASGLAFLHEEAQPRIVHRD  182

Query  431  IKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVY  252
            IKASNILLDK   PKIGDFGLAKLFPD +THIST++AGT GYLAPEY L GQLT KAD+Y
Sbjct  183  IKASNILLDKKLLPKIGDFGLAKLFPDTVTHISTRVAGTMGYLAPEYALLGQLTKKADIY  242

Query  251  SFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYM  72
            SFGVL+LE++SG SSS   WG     L+E  W L +EG +LE+VD E+E++P+E++L+++
Sbjct  243  SFGVLLLEMISGESSSKSTWGPNMHVLVEWTWKLREEGRLLEIVDPELEKYPEEQMLRFI  302

Query  71   KVALLCTQASASRRPTMSQVIDM  3
            KVALLCTQA++ +RP+M QV++M
Sbjct  303  KVALLCTQATSQQRPSMKQVVNM  325



>ref|XP_002468135.1| hypothetical protein SORBIDRAFT_01g040190 [Sorghum bicolor]
 gb|EER95133.1| hypothetical protein SORBIDRAFT_01g040190 [Sorghum bicolor]
Length=385

 Score =   396 bits (1017),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 186/307 (61%), Positives = 236/307 (77%), Gaps = 5/307 (2%)
 Frame = -1

Query  908  GNLAQQESFDAGDNSIARTRN----FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNG  741
            G+ ++Q+S     + ++R  N    FS +EL+TAT NF  +N IGRGGFG VYKG LK+G
Sbjct  11   GSKSRQDSSPRSGHVLSRAGNNVQVFSLNELKTATRNFHMLNCIGRGGFGAVYKGNLKDG  70

Query  740  RQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLD  561
             Q+A+K L+A+SKQGI EFLTEI  +SN RH NLV+LIGCC   +NR+LVYEY EN SL 
Sbjct  71   TQIAIKKLAAESKQGISEFLTEINVISNVRHPNLVKLIGCCAEGSNRLLVYEYAENNSLA  130

Query  560  RVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKI  384
              L G ++  + L+W  RAAIC+GTA GLA+LHEE +P IVHRDIKASNILLDK   PKI
Sbjct  131  NALLGPKNKCIPLDWQKRAAICIGTASGLAFLHEEAQPRIVHRDIKASNILLDKKLLPKI  190

Query  383  GDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSS  204
            GDFGLAKLFPD +THIST++AGT GYLAPEY L GQLT KAD+YSFGVL+LEV+SG SSS
Sbjct  191  GDFGLAKLFPDTVTHISTRVAGTMGYLAPEYALLGQLTKKADIYSFGVLLLEVISGESSS  250

Query  203  SMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPT  24
               WG     L+E  W L +EG +LE+VD E+E +P+E++L+++KVALLCTQA++ +RP+
Sbjct  251  KSTWGPDMHVLVEWTWKLREEGRLLEIVDPELENYPEEQMLRFIKVALLCTQATSQQRPS  310

Query  23   MSQVIDM  3
            M QV++M
Sbjct  311  MKQVVNM  317



>ref|XP_010468254.1| PREDICTED: putative serine/threonine-protein kinase [Camelina 
sativa]
Length=390

 Score =   396 bits (1018),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 240/319 (75%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG     +  +  L Q+E+ +   +++   R FSY+ LR+AT+ F   N+IG GG
Sbjct  1    MRCNCFGLLDKCKG-SDRLGQREAEEICTDNV---RVFSYNSLRSATDGFHPTNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRI
Sbjct  57   YGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W  RAAICVGTA GLAYLHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLASALLGSRSKYVALDWSKRAAICVGTASGLAYLHEEVEPQVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD +++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDGNFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +G +   L+E  W L +EG +LE VD  + +FP +EV +++KVAL
Sbjct  237  LVLEVISGSSSSRAAFGDEYMILIEWVWKLREEGRLLECVDPNLTKFPGDEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQATAQKRPNMKQVVEM  315



>ref|XP_010464533.1| PREDICTED: putative serine/threonine-protein kinase [Camelina 
sativa]
Length=390

 Score =   396 bits (1017),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 240/319 (75%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG    +  R+  L  +E+ +   +++   R FSY+ LR+AT+ F   N+IG GG
Sbjct  1    MRCNCFGILD-KCKRSDRLGHREAEEICTDNV---RVFSYNSLRSATDGFHPTNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRI
Sbjct  57   YGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W  RAAICVGTA GLAYLHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLASALLGSRSKYVALDWSKRAAICVGTASGLAYLHEEVEPQVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD +++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDGNFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +G +   L+E  W L +EG +LE VD  + +FP +EV +++KVAL
Sbjct  237  LVLEVISGSSSSRAAFGEEYMILIEWVWKLREEGRLLECVDPNLTKFPGDEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQATAQKRPNMKQVLEM  315



>gb|AAD56317.1|AC009326_4 putative receptor ser/thr protein kinase [Arabidopsis thaliana]
Length=383

 Score =   395 bits (1016),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/306 (62%), Positives = 239/306 (78%), Gaps = 4/306 (1%)
 Frame = -1

Query  917  NRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGR  738
            N +  L Q+E+ +   N++   R FSY+ LR+AT++F   N+IG GG+G V+KG L++G 
Sbjct  3    NGSDRLGQREAEEICTNNV---RVFSYNSLRSATDSFHPTNRIGGGGYGVVFKGVLRDGT  59

Query  737  QVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDR  558
            QVAVK+LSA+SKQG REFLTEI  +SN  H NLV+LIGCC+  NNRILVYEYLEN SL  
Sbjct  60   QVAVKSLSAESKQGTREFLTEINLISNIHHPNLVKLIGCCIEGNNRILVYEYLENNSLAS  119

Query  557  VLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIG  381
            VL G +S  V L+W  RAAICVGTA GLA+LHEEVEPH+VHRDIKASNILLD +++PKIG
Sbjct  120  VLLGSRSRYVPLDWSKRAAICVGTASGLAFLHEEVEPHVVHRDIKASNILLDSNFSPKIG  179

Query  380  DFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSS  201
            DFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+L+LEV+SG SS+ 
Sbjct  180  DFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGILVLEVISGNSSTR  239

Query  200  MNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTM  21
              +G +   L+E  W L +E  +LE VD E+ +FP +EV +++KVAL CTQA+A +RP M
Sbjct  240  AAFGDEYMVLVEWVWKLREERRLLECVDPELTKFPADEVTRFIKVALFCTQAAAQKRPNM  299

Query  20   SQVIDM  3
             QV++M
Sbjct  300  KQVMEM  305



>ref|NP_001151057.1| LOC100284690 [Zea mays]
 gb|ACG41453.1| ATP binding protein [Zea mays]
Length=388

 Score =   395 bits (1014),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 226/284 (80%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY ELR+AT+NF + NK+GRGGFGTVYKGT+++GR+VAVK LSA+S+QGIREFLTEI
Sbjct  42   RLFSYAELRSATDNFNRTNKVGRGGFGTVYKGTIRSGREVAVKVLSAESRQGIREFLTEI  101

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICV  495
            + +SN +H NLVELIGCCV  +NRILVYEYL+N SLDR L    S      W  R+AIC+
Sbjct  102  DVISNVKHPNLVELIGCCVEGSNRILVYEYLKNSSLDRALLASNSEPADFTWSVRSAICL  161

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G ARGLAYLHEE+   IVHRDIKASNILLD++Y PKIGDFGLAKLFPDN+THIST++AGT
Sbjct  162  GVARGLAYLHEEIAAPIVHRDIKASNILLDRNYVPKIGDFGLAKLFPDNVTHISTRVAGT  221

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT KAD+YSFGVL+LE+VSG +SSS +     K LLE+AW LY+   
Sbjct  222  TGYLAPEYAWHGQLTKKADIYSFGVLVLEIVSG-TSSSRSILMDDKILLEKAWELYEAKR  280

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + ELVD  +   P+EE ++Y+ VAL C QA+A+RRPTM QV+ M
Sbjct  281  LKELVDPALVDCPEEEAIRYIMVALFCLQAAAARRPTMPQVVTM  324



>ref|XP_011006892.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130 isoform X4 [Populus euphratica]
Length=313

 Score =   391 bits (1005),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 182/256 (71%), Positives = 216/256 (84%), Gaps = 1/256 (0%)
 Frame = -1

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            V+ GTLK+G QVAVK LSAQSKQG++EFL EI+T+S  +H NLVELIGCC    NRILVY
Sbjct  2    VWMGTLKSGTQVAVKTLSAQSKQGVQEFLNEIKTISKVKHPNLVELIGCCAQGTNRILVY  61

Query  587  EYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
            EY+EN SLDR L G +S  +KL+W  R+AIC+G ARGL +LH+EV PHIVHRDIKASNIL
Sbjct  62   EYVENSSLDRALLGSRSTDIKLDWGRRSAICLGIARGLDFLHKEVVPHIVHRDIKASNIL  121

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD+ PKIGDFGLAKLFPDNITHIST+IAGT GYLAPEY L GQLTMKADVYSFGVLIL
Sbjct  122  LDKDFNPKIGDFGLAKLFPDNITHISTRIAGTTGYLAPEYALGGQLTMKADVYSFGVLIL  181

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCT  51
            E++SGRS++  +WGG QK LLE AW L++EG  LELVD E+  FP+EEV++Y+KVA  CT
Sbjct  182  EIISGRSNTKPSWGGTQKLLLEWAWQLHEEGKHLELVDPEMGEFPEEEVIRYIKVAFFCT  241

Query  50   QASASRRPTMSQVIDM  3
            Q++A+RRP M+QV+DM
Sbjct  242  QSAANRRPLMTQVVDM  257



>ref|XP_008668089.1| PREDICTED: LOC100284690 isoform X1 [Zea mays]
 tpg|DAA35330.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=389

 Score =   394 bits (1012),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 225/284 (79%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY ELR+AT+NF + NK+GRGGFGTVYKGT+++GR+VAVK LSA+S+QGIREFLTEI
Sbjct  43   RLFSYAELRSATDNFNRTNKVGRGGFGTVYKGTIRSGREVAVKVLSAESRQGIREFLTEI  102

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICV  495
            + +SN +H NLVELIGCCV  +NRILVYEYL+N SLDR L    S      W  R+AIC+
Sbjct  103  DVISNVKHPNLVELIGCCVEGSNRILVYEYLKNSSLDRALLASNSEPADFTWSVRSAICL  162

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G ARGLAYLHEE+   IVHRDIKASNILLD++Y PKIGDFGLAKLFPDN+THIST++AGT
Sbjct  163  GVARGLAYLHEEIAAPIVHRDIKASNILLDRNYVPKIGDFGLAKLFPDNVTHISTRVAGT  222

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT KAD+YSFGVL+LE+VSG +SSS +     K LLE+AW LY+   
Sbjct  223  TGYLAPEYAWHGQLTKKADIYSFGVLVLEIVSG-TSSSRSILMDDKILLEKAWELYEAKR  281

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + ELVD  +   P EE ++Y+ VAL C QA+A+RRPTM QV+ M
Sbjct  282  LKELVDPALVDCPDEEAIRYIMVALFCLQAAAARRPTMPQVVTM  325



>ref|XP_003558291.1| PREDICTED: putative serine/threonine-protein kinase [Brachypodium 
distachyon]
Length=393

 Score =   394 bits (1012),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 239/322 (74%), Gaps = 6/322 (2%)
 Frame = -1

Query  953  SCTC-FGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIG  786
            S +C +G S   R++TG  A   S  +G       RN   FS  +L++AT NF  +N IG
Sbjct  4    SVSCIWGGSKSGRDQTGQ-AAAASPRSGRLLSRSGRNVQVFSLKDLKSATRNFNMMNCIG  62

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
            RGGFG VYKG LK+G QVA+K LSA+SKQG  EFLTEI+ +SN RH NLV+LIGCCV  N
Sbjct  63   RGGFGPVYKGNLKDGSQVAIKMLSAESKQGTSEFLTEIDVISNVRHPNLVKLIGCCVEGN  122

Query  605  NRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NR+LVYEY EN SL   L G ++  + L W  RAAIC+GTA GLA+LHEE +P IVHRDI
Sbjct  123  NRLLVYEYAENNSLSNALLGPKNRCIPLNWQKRAAICIGTASGLAFLHEEAQPRIVHRDI  182

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDK   PKIGDFGLAKLFPD ITHIST++AGT GYLAPEY L GQLT KAD+YS
Sbjct  183  KASNILLDKKLLPKIGDFGLAKLFPDAITHISTRVAGTMGYLAPEYALLGQLTKKADIYS  242

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVL+LEV+SG+SSS  NWG     L+E  W L +   +LE+VD ++E +P+E+VL+++K
Sbjct  243  FGVLVLEVISGQSSSKSNWGPDMHVLVEWTWKLREGERLLEIVDPDLEEYPEEQVLRFIK  302

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VALLCTQA+A +RP+M QV+ M
Sbjct  303  VALLCTQATAQQRPSMKQVVHM  324



>ref|XP_002882598.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58857.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=393

 Score =   394 bits (1011),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 243/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG  ++ +  +  L Q+E+ +   N++   R FSY+ LR+AT+ F    +IG GG
Sbjct  1    MRYNCFGLLAMCKG-SDRLGQREAEEICTNNV---RVFSYNSLRSATDGFHPTKRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRI
Sbjct  57   YGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL  VL G +S  V L+W  RAAICVGTA GLA+LHEEVEPH+VHRDIKAS
Sbjct  117  LVYEYLENNSLASVLLGSRSRYVPLDWSKRAAICVGTASGLAFLHEEVEPHVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD++++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDRNFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SS+   +G     L+E  W L +E  +LE VD ++ +FP++EV +++KVAL
Sbjct  237  LVLEVISGNSSTRAAFGDDYMVLVEWVWKLREEKRLLECVDPDLTKFPEDEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQAAAQKRPNMKQVVEM  315



>tpg|DAA35328.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=409

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/284 (66%), Positives = 225/284 (79%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY ELR+AT+NF + NK+GRGGFGTVYKGT+++GR+VAVK LSA+S+QGIREFLTEI
Sbjct  63   RLFSYAELRSATDNFNRTNKVGRGGFGTVYKGTIRSGREVAVKVLSAESRQGIREFLTEI  122

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICV  495
            + +SN +H NLVELIGCCV  +NRILVYEYL+N SLDR L    S      W  R+AIC+
Sbjct  123  DVISNVKHPNLVELIGCCVEGSNRILVYEYLKNSSLDRALLASNSEPADFTWSVRSAICL  182

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G ARGLAYLHEE+   IVHRDIKASNILLD++Y PKIGDFGLAKLFPDN+THIST++AGT
Sbjct  183  GVARGLAYLHEEIAAPIVHRDIKASNILLDRNYVPKIGDFGLAKLFPDNVTHISTRVAGT  242

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT KAD+YSFGVL+LE+VSG +SSS +     K LLE+AW LY+   
Sbjct  243  TGYLAPEYAWHGQLTKKADIYSFGVLVLEIVSG-TSSSRSILMDDKILLEKAWELYEAKR  301

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + ELVD  +   P EE ++Y+ VAL C QA+A+RRPTM QV+ M
Sbjct  302  LKELVDPALVDCPDEEAIRYIMVALFCLQAAAARRPTMPQVVTM  345



>ref|XP_011047443.1| PREDICTED: putative serine/threonine-protein kinase [Populus 
euphratica]
Length=385

 Score =   393 bits (1010),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 236/322 (73%), Gaps = 8/322 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIG  786
            MSC+CFG S+  +    N    ++    +  +  T N   FSY+ LR+AT NF   N+IG
Sbjct  1    MSCSCFGISNWFKGNNHN----DTPGQANTQVIATDNVNLFSYNSLRSATRNFHPSNRIG  56

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
             GGFG VYKG L++G  VA+K LSA+SKQG  EF+TEI  +S  +H NLVEL+GCCV EN
Sbjct  57   GGGFGVVYKGVLRDGTSVAIKCLSAESKQGTDEFVTEIRMISTIKHPNLVELVGCCVEEN  116

Query  605  NRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NRILVYEY+EN S+   L G  G  V ++W TRAAIC+GTA GLA+LHEE  PHIVHRDI
Sbjct  117  NRILVYEYMENNSISTALLGSQGKHVAMDWPTRAAICIGTASGLAFLHEEANPHIVHRDI  176

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASN+LLD +  P+IGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYS
Sbjct  177  KASNVLLDGNLRPRIGDFGLAKLFPDNVTHLSTRVAGTMGYLAPEYALLGQLTKKADVYS  236

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVLILE++SGRSSS   +G     L+E  W L+ E  +L++VD E+  +P+ EV+++MK
Sbjct  237  FGVLILEIISGRSSSKAAFGEDMLVLVEWTWKLWKEERLLDIVDPEMTGYPENEVIRFMK  296

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VAL CTQA A++RP M QV+ M
Sbjct  297  VALFCTQAVANQRPNMKQVLKM  318



>ref|XP_009398440.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
Length=378

 Score =   392 bits (1008),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 196/320 (61%), Positives = 249/320 (78%), Gaps = 7/320 (2%)
 Frame = -1

Query  956  MSCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M C+CFGA  S +R+   +    E F + +N       FSY EL++AT+NF   NKIGRG
Sbjct  1    MRCSCFGALFSRKRHLIDSEKNLEGFSSENN----LSLFSYIELKSATDNFHPSNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKG L+NG  VAVK LSA S+QG+REFLTEI+ ++N +HSNLVELIGCCV  +NR
Sbjct  57   GFGTVYKGILRNGIIVAVKVLSADSRQGVREFLTEIDIITNIKHSNLVELIGCCVEGSNR  116

Query  599  ILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLDR L G  S A +L W+ R+AIC+  ARGL YLHEE++P +VHRDIKA
Sbjct  117  ILVYEYLENGSLDRALLGSNSDAGRLNWYIRSAICMSIARGLMYLHEELQPPVVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++ PKIGDFG+AKLFPD+ITHIST++AGT GYLAPEY L GQLT KAD+YSFG
Sbjct  177  SNILLDRNFLPKIGDFGVAKLFPDDITHISTRVAGTTGYLAPEYALKGQLTKKADIYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRS+S  +W      LLE  W L +E  + ELVD+ ++ +P+++V++Y+KVA
Sbjct  237  VLVLEIISGRSNSK-SWSEMGIPLLEWTWTLLEEERLTELVDAALKDYPEDQVIRYIKVA  295

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+A RRP+MSQV++M
Sbjct  296  LFCTQAAAGRRPSMSQVVEM  315



>emb|CDY07897.1| BnaC03g36260D [Brassica napus]
Length=390

 Score =   393 bits (1009),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/326 (60%), Positives = 241/326 (74%), Gaps = 13/326 (4%)
 Frame = -1

Query  977  FFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQV  798
            FF C  V+          +  R   L Q+E+ +   +++   R FSY+ LR+AT++F   
Sbjct  2    FFNCFRVLD---------KCKRNDRLGQKEAEEICTDNV---RVFSYNSLRSATDDFHPS  49

Query  797  NKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCC  618
             +IG GGFG VYKG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC
Sbjct  50   TRIGGGGFGVVYKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCC  109

Query  617  VHENNRILVYEYLENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIV  441
            +  NNRILVYEYLEN SL  VL G  S  V L+W TRAAICVGTA GLA+LHEEVEP +V
Sbjct  110  IEGNNRILVYEYLENNSLASVLLGSMSKYVPLDWSTRAAICVGTASGLAFLHEEVEPQMV  169

Query  440  HRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKA  261
            HRDIKASNILLD+++ PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KA
Sbjct  170  HRDIKASNILLDRNFCPKIGDFGLAKLFPDNVTHISTRVAGTVGYLAPEYALLGQLTKKA  229

Query  260  DVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVL  81
            DVYSFG+L+LEV+SG SSS   +  +   L+E  W L +EG +LE VD  + +FP+ EV+
Sbjct  230  DVYSFGILVLEVISGGSSSRAAFTDELLVLVEWVWKLREEGRLLECVDPYLTKFPEAEVI  289

Query  80   KYMKVALLCTQASASRRPTMSQVIDM  3
            +++KVAL CTQA+A +RP M QV++M
Sbjct  290  RFIKVALFCTQAAAQKRPNMKQVVEM  315



>ref|XP_008356053.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Malus domestica]
Length=353

 Score =   390 bits (1003),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/253 (71%), Positives = 214/253 (85%), Gaps = 1/253 (0%)
 Frame = -1

Query  758  GTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYL  579
            GTL +G+ VAVK L+AQSKQG+REFL EI T+SN RH NLVELIGCCV E +R+LVYEY+
Sbjct  47   GTLTSGKHVAVKTLAAQSKQGVREFLNEINTISNVRHPNLVELIGCCVQEADRVLVYEYV  106

Query  578  ENRSLDRVLFGQ-SGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDK  402
            EN+SLD  L G  S  +KL+W  R+AIC+GTARGL YLHEE+ PHIVHRDIKASN+LLD+
Sbjct  107  ENKSLDHALLGPTSRTIKLDWEKRSAICLGTARGLTYLHEELVPHIVHRDIKASNLLLDR  166

Query  401  DYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVV  222
            ++ PKIGDFGLAKLFPD+ITHIST+IAGT GYLAPEY L GQLT+KADVYSFGVL+LE+V
Sbjct  167  EFNPKIGDFGLAKLFPDDITHISTRIAGTTGYLAPEYALGGQLTLKADVYSFGVLVLEIV  226

Query  221  SGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQAS  42
             GRSS+  +WGG +K LLE AW L++EG +LEL D E+  FP+EEVL+YMKVA  CTQA+
Sbjct  227  CGRSSAKGDWGGAEKFLLEWAWQLHEEGRLLELADPEMGEFPEEEVLRYMKVAFFCTQAA  286

Query  41   ASRRPTMSQVIDM  3
            A+RRP MSQV+DM
Sbjct  287  ANRRPKMSQVLDM  299



>gb|KDP24465.1| hypothetical protein JCGZ_25029 [Jatropha curcas]
Length=387

 Score =   392 bits (1006),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 193/320 (60%), Positives = 242/320 (76%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MS TCFG S+  + RT +  QQ   +   N++   R FSY+ LR+AT NF    +IG GG
Sbjct  1    MSFTCFGLSNWCK-RTSSHDQQRPEELATNNV---RVFSYNSLRSATENFHPSYRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VY+G L++G QVA+K LSA+SKQG  EF+TEI+ +SN  H NLVELIGCCV  +NRI
Sbjct  57   FGVVYRGVLRDGTQVAIKCLSAESKQGKHEFMTEIKIISNIHHPNLVELIGCCVEGSNRI  116

Query  596  LVYEYLENRSL-DRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            LVYEYLEN SL   +L G  G  + ++W  RAAIC+GTA GLA+LHEE+EP IVHRDIKA
Sbjct  117  LVYEYLENNSLATSLLSGSKGKHIAMDWSKRAAICLGTATGLAFLHEEIEPPIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD++  PKIGDFGLAKLFPDN+TH++T++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  177  SNILLDRNLQPKIGDFGLAKLFPDNVTHVTTRVAGTVGYLAPEYALLGQLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VLILE++SGRSSS   +G     L+E  W L+ E  +L LVD E+  +P+EEV++++KVA
Sbjct  237  VLILEIISGRSSSKAAFGIDLLVLIEWTWKLWKEKRLLALVDPELVAYPEEEVMRFIKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+A +RPTM QV++M
Sbjct  297  LFCTQAAAHQRPTMKQVVEM  316



>ref|XP_009135076.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
Length=390

 Score =   392 bits (1006),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 234/308 (76%), Gaps = 7/308 (2%)
 Frame = -1

Query  923  RRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKN  744
            R +R G    +E F   DN     R FSY+ LR+AT++F    +IG GGFG VYKG L++
Sbjct  14   RNDRLGQKEAEEIFT--DN----VRVFSYNSLRSATDDFHPSTRIGGGGFGVVYKGVLRD  67

Query  743  GRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSL  564
            G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRILVYEYLEN SL
Sbjct  68   GTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCCIEGNNRILVYEYLENNSL  127

Query  563  DRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPK  387
              VL G +S  V L+W  RAAICVGTA GLA+LHEEVEP +VHRDIKASNILLD+++ PK
Sbjct  128  ASVLLGSRSKYVPLDWSKRAAICVGTASGLAFLHEEVEPQVVHRDIKASNILLDRNFCPK  187

Query  386  IGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSS  207
            IGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KADVYSFG+L+LEV+SG SS
Sbjct  188  IGDFGLAKLFPDNVTHISTRVAGTVGYLAPEYALLGQLTKKADVYSFGILVLEVISGGSS  247

Query  206  SSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRP  27
            S   +  +   L+E  W L +EG +LE VD  + +FP+ EV++++KVAL CTQA+A +RP
Sbjct  248  SRAAFTDELLVLVEWVWKLREEGRLLECVDPYLTKFPEAEVIRFIKVALFCTQAAAQKRP  307

Query  26   TMSQVIDM  3
             M QV++M
Sbjct  308  NMKQVVEM  315



>ref|XP_010486455.1| PREDICTED: putative serine/threonine-protein kinase [Camelina 
sativa]
Length=390

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 238/319 (75%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG     +  +  L  +E+ +   +++   R FSY+ LR+AT+ F   N+IG GG
Sbjct  1    MRCNCFGLLDKCKG-SDRLGLREAEEICTDNV---RVFSYNSLRSATDGFHPTNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRI
Sbjct  57   YGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W  RAAICVGTA GLAYLHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLASALLGSRSKYVALDWSKRAAICVGTASGLAYLHEEVEPQVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD +++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDGNFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +G +   L+E  W L  EG +LE VD  + +FP +EV +++KVAL
Sbjct  237  LVLEVISGSSSSRAAFGEEYMILIEWVWKLRKEGRLLECVDPNLTKFPGDEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQATAQKRPNMKQVVEM  315



>emb|CDX73951.1| BnaA03g30960D [Brassica napus]
Length=390

 Score =   392 bits (1006),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 192/308 (62%), Positives = 234/308 (76%), Gaps = 7/308 (2%)
 Frame = -1

Query  923  RRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKN  744
            R +R G    +E F   DN     R FSY+ LR+AT++F    +IG GGFG VYKG L++
Sbjct  14   RNDRLGQKEAEEIFT--DN----VRVFSYNSLRSATDDFHPSTRIGGGGFGVVYKGVLRD  67

Query  743  GRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSL  564
            G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRILVYEYLEN SL
Sbjct  68   GTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLIGCCIEGNNRILVYEYLENNSL  127

Query  563  DRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPK  387
              VL G +S  V L+W  RAAICVGTA GLA+LHEEVEP +VHRDIKASNILLD+++ PK
Sbjct  128  ASVLLGSRSKYVPLDWSKRAAICVGTASGLAFLHEEVEPQVVHRDIKASNILLDRNFCPK  187

Query  386  IGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSS  207
            IGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KADVYSFG+L+LEV+SG SS
Sbjct  188  IGDFGLAKLFPDNVTHISTRVAGTVGYLAPEYALLGQLTKKADVYSFGILVLEVISGGSS  247

Query  206  SSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRP  27
            S   +  +   L+E  W L +EG +LE VD  + +FP+ EV++++KVAL CTQA+A +RP
Sbjct  248  SRAAFTDELLVLVEWVWKLREEGRLLECVDPYLTKFPEAEVIRFIKVALFCTQAAAQKRP  307

Query  26   TMSQVIDM  3
             M QV++M
Sbjct  308  NMKQVVEM  315



>ref|XP_002323571.1| kinase family protein [Populus trichocarpa]
 gb|EEF05332.1| kinase family protein [Populus trichocarpa]
Length=385

 Score =   391 bits (1005),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 188/322 (58%), Positives = 236/322 (73%), Gaps = 8/322 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIG  786
            MSC+CFG S+  +    N    ++    +  +  T N   FSY+ LR+AT NF   N+IG
Sbjct  1    MSCSCFGRSNWFKGNNHNDTPGQT----NAQVIATDNVNLFSYNSLRSATRNFHPSNRIG  56

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
             GGFG VYKG L++G  VA+K LSA+SKQG  EF+TEI  +S  +H  LVEL+GCCV EN
Sbjct  57   GGGFGVVYKGVLRDGTPVAIKCLSAESKQGTDEFVTEIRMISTIKHPTLVELVGCCVEEN  116

Query  605  NRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NRILVYEY+EN S+   L G  G  V ++W TRAAIC+GTA GLA+LHEE +PHIVHRDI
Sbjct  117  NRILVYEYMENNSISTALLGSKGKHVAMDWPTRAAICIGTASGLAFLHEEAKPHIVHRDI  176

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASN+LLD +  PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYS
Sbjct  177  KASNVLLDGNLRPKIGDFGLAKLFPDNVTHLSTRVAGTMGYLAPEYALLGQLTKKADVYS  236

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVLILE++SGRSSS   +G     L+E AW L+ E  +L++VD E+  +P+ E +++MK
Sbjct  237  FGVLILEIISGRSSSKAAFGEDLLVLVEWAWKLWKEERLLDIVDPEMTGYPENEAMRFMK  296

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VAL CTQA A++RP M QV+ M
Sbjct  297  VALFCTQAVANQRPNMKQVVKM  318



>ref|XP_006481015.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Citrus sinensis]
Length=378

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 185/319 (58%), Positives = 239/319 (75%), Gaps = 6/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MS +CFGA    + +  + A+       + ++     +SY+ LR+AT +F   N IG G 
Sbjct  1    MSWSCFGAFKCCKRKDSDQAEAHGISTYNITL-----YSYNSLRSATRDFHPSNMIGGGA  55

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VY+GTL++G Q+A+K LSA+SKQG +EFLTEI+ + N RH NLV+LIGCCV +NNRI
Sbjct  56   FGVVYRGTLRDGAQIAIKCLSAESKQGTKEFLTEIDMIWNIRHPNLVQLIGCCVEDNNRI  115

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W TRA IC+GTA GL++LHEE +P IVHRDIKAS
Sbjct  116  LVYEYLENNSLANALLGSKSKYVSLDWPTRANICLGTASGLSFLHEEADPPIVHRDIKAS  175

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  176  NVLLDGNFHPKIGDFGLAKLFPDNVTHVSTRVAGTMGYLAPEYALLGQLTKKADVYSFGV  235

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS   +G     L+E  W L +EG +LE+VD E+ +FP++EV++++KV L
Sbjct  236  LLLEIISGRSSSKAAFGDDMLILVEWTWKLREEGRLLEIVDPELTQFPEKEVMRFIKVGL  295

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA A  RPTM QV++M
Sbjct  296  FCTQAGAHYRPTMKQVVEM  314



>ref|XP_006429351.1| hypothetical protein CICLE_v10011991mg [Citrus clementina]
 gb|ESR42591.1| hypothetical protein CICLE_v10011991mg [Citrus clementina]
Length=371

 Score =   388 bits (997),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 184/319 (58%), Positives = 239/319 (75%), Gaps = 6/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MS +CFGA    + +  + A+       + ++     +SY+ LR+AT +F   N IG G 
Sbjct  1    MSWSCFGAFKCCKGKDSDQAEAHGISTYNITL-----YSYNSLRSATRDFHPSNMIGGGA  55

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VY+G+L++G Q+A+K LSA+SKQG +EFLTEI+ + N RH NLV+LIGCCV +NNRI
Sbjct  56   FGVVYRGSLRDGAQIAIKCLSAESKQGTKEFLTEIDMIWNIRHPNLVQLIGCCVEDNNRI  115

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W TRA IC+GTA GL++LHEE +P IVHRDIKAS
Sbjct  116  LVYEYLENNSLANALLGSKSKYVSLDWPTRANICLGTASGLSFLHEEADPPIVHRDIKAS  175

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  176  NVLLDGNFHPKIGDFGLAKLFPDNVTHVSTRVAGTMGYLAPEYALLGQLTKKADVYSFGV  235

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS   +G     L+E  W L +EG +LE+VD E+ +FP++EV++++KV L
Sbjct  236  LLLEIISGRSSSKAAFGDDMLILIEWTWKLREEGRLLEIVDPELTQFPEKEVMRFIKVGL  295

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA A  RPTM QV++M
Sbjct  296  FCTQAGAHYRPTMKQVVEM  314



>ref|XP_009769553.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
Length=379

 Score =   388 bits (997),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 192/320 (60%), Positives = 236/320 (74%), Gaps = 8/320 (3%)
 Frame = -1

Query  956  MSCTCFGAS-SVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M  +CFG+    + NR     Q +  +   N++     FSY+ LR+AT +F   NKIG G
Sbjct  1    MGFSCFGSFLQCKDNRE---TQVQGLELATNNVTL---FSYNSLRSATGHFHPSNKIGGG  54

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKG L++GR VAVK LSA+SKQG RE LTEI  +SN RH NLV+LIGCCV   NR
Sbjct  55   GFGVVYKGVLRDGRSVAVKCLSAESKQGTRELLTEINMISNTRHPNLVQLIGCCVEGGNR  114

Query  599  ILVYEYLENRSLDRVLFGQSG-AVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SL   L G  G  V L+W  RAAIC+GTA GLA+LHE+ EP IVHRDIKA
Sbjct  115  ILVYEYLENNSLASALLGSKGKCVPLDWPKRAAICLGTASGLAFLHEDAEPPIVHRDIKA  174

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+L+D++  PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  175  SNVLIDENLHPKIGDFGLAKLFPDNITHVSTRVAGTIGYLAPEYALLGQLTKKADVYSFG  234

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS+  +G     L+E AW L +EG +L+LVD E+  +P+ EVL+++KVA
Sbjct  235  VLVLEIISGRSSSNAAFGEDLLVLVEWAWKLREEGRLLDLVDPELTEYPEAEVLRFIKVA  294

Query  62   LLCTQASASRRPTMSQVIDM  3
            L C QA+ + RP M QVI+M
Sbjct  295  LFCIQAAYNHRPNMKQVIEM  314



>ref|XP_010256572.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
 ref|XP_010256573.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Nelumbo nucifera]
Length=382

 Score =   387 bits (994),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/317 (59%), Positives = 233/317 (74%), Gaps = 7/317 (2%)
 Frame = -1

Query  950  CTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFG  771
            C C   SS R+        +E       S +  R FSY  LR+AT NF   N+IG GGFG
Sbjct  5    CFCAFRSSKRKTLDSPTLAEEI------STSNVRLFSYSMLRSATGNFHPSNRIGGGGFG  58

Query  770  TVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILV  591
             VYKG L +  QVAVK+LSA+SKQG REFLTEI+ +SN RH NLV+L+GCC+   NR+LV
Sbjct  59   VVYKGVLSDDTQVAVKSLSAESKQGTREFLTEIDMISNVRHPNLVQLLGCCIEGTNRMLV  118

Query  590  YEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
            YEY+EN SL   L G +     L+W TRAAIC+GTA+GL +LHEE EPH+VHRDIKASNI
Sbjct  119  YEYMENNSLASALLGPKHKHADLDWPTRAAICMGTAQGLLFLHEEAEPHVVHRDIKASNI  178

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LL +D+ PKIGDFGLAKLFPDN+TH+STQ+AGT GYLAPEY L GQLT KAD+YSFGVLI
Sbjct  179  LLGRDFHPKIGDFGLAKLFPDNVTHLSTQVAGTMGYLAPEYALLGQLTKKADIYSFGVLI  238

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLC  54
            LE+VSGRSSS   +G     L+E  W L +E  +L++VD E+  +P++EV +++KVAL C
Sbjct  239  LEIVSGRSSSKAAFGEDLMVLVEWTWKLKEESRLLDIVDPELVEYPEDEVERFIKVALFC  298

Query  53   TQASASRRPTMSQVIDM  3
            TQAS+ +RP++ QV++M
Sbjct  299  TQASSQQRPSIKQVVEM  315



>ref|XP_009772662.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
Length=378

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 238/320 (74%), Gaps = 10/320 (3%)
 Frame = -1

Query  956  MSCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M C+CFGA  S + NR   + +  +     N++   R FSY+ LR+AT +F   NKIG G
Sbjct  1    MGCSCFGAFKSYKDNRETQVQELTT-----NNV---RLFSYNSLRSATGHFHPSNKIGGG  52

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKG L++G  VA+K LSA+SKQG  EFLTEI  +S+ RH NLV+LIGCCV  +NR
Sbjct  53   GFGVVYKGVLRDGTHVAIKCLSAESKQGTNEFLTEINMISDTRHPNLVQLIGCCVESDNR  112

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            +L+YEYLEN SL   L G  G  V L+W  R AIC+GTA GLA+LHEE  P IVHRDIKA
Sbjct  113  MLIYEYLENNSLACALLGSKGKRVALDWPKRVAICLGTASGLAFLHEEATPPIVHRDIKA  172

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+L+D+++ PKIGDFGLAKLFP+N+TH+ST++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  173  SNVLIDENFQPKIGDFGLAKLFPENVTHLSTRVAGTVGYLAPEYALFGQLTKKADVYSFG  232

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS   +G     L+E  W L +EG +L++VD E+  +P+ E+L+++KVA
Sbjct  233  VLLLEIISGRSSSKAAFGVDLLILVEWVWKLREEGRLLDIVDPELTEYPEAELLRFIKVA  292

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+ ++RP M QVIDM
Sbjct  293  LFCTQAAPTQRPNMKQVIDM  312



>ref|XP_006349462.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X1 [Solanum tuberosum]
Length=376

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 235/319 (74%), Gaps = 6/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+ +CFG  S R+ +     Q +  +   N++   R FSY+ LR+AT NF    KIG GG
Sbjct  1    MTFSCFG--SFRQCKDNRGTQVQGLEIATNNV---RLFSYNSLRSATENFHPSKKIGGGG  55

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKG L++GR VA+K LSA+SKQG  EFLTEI  +SN RH NLV+LIGCCV   +RI
Sbjct  56   FGVVYKGVLRDGRTVAIKCLSAESKQGTSEFLTEINMISNTRHPNLVQLIGCCVEGVHRI  115

Query  596  LVYEYLENRSLDRVLFGQSG-AVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G  G  V L W  RAAIC+GTA GLA+LHEE +P IVHRDIKAS
Sbjct  116  LVYEYLENNSLASALLGSKGKPVPLNWTKRAAICLGTASGLAFLHEEAQPPIVHRDIKAS  175

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+L+D++  PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  176  NVLIDENLHPKIGDFGLAKLFPDNITHVSTRVAGTIGYLAPEYALLGQLTKKADVYSFGV  235

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+VSG SSS+  +G     L+E AW L +EG +L+LVD E+  +P+ EVL+++KVA 
Sbjct  236  LILEIVSGSSSSNAAFGEDLLILVEWAWKLREEGRLLDLVDPELTEYPEAEVLRFIKVAF  295

Query  59   LCTQASASRRPTMSQVIDM  3
             C Q++ ++RP M QVI+M
Sbjct  296  FCIQSAYNQRPNMKQVIEM  314



>ref|XP_010109622.1| hypothetical protein L484_015577 [Morus notabilis]
 gb|EXC23667.1| hypothetical protein L484_015577 [Morus notabilis]
Length=382

 Score =   385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 242/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFGA + R+ +  + +Q E+   G    +  R FSY+ LR+AT +F   NKIG GG
Sbjct  1    MGCACFGALNWRKGKNDS-SQLETPGIG---TSNARLFSYNSLRSATMDFHPSNKIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G V++G L++G QVAVK+LSA SKQG  EFLTEI  +SN RH NLV+LIGCCV  ++RI
Sbjct  57   YGVVHRGVLRDGTQVAVKSLSAGSKQGTDEFLTEINMISNTRHPNLVKLIGCCVEGDHRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  + L+W  R+ ICV TA GLA+LHEEVEP+IVHRDIKAS
Sbjct  117  LVYEYLENNSLANSLLGSKSKYIFLDWPKRSVICVETAIGLAFLHEEVEPNIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  177  NILLDGNFLPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SG SSS   +G +   L+E  W L +EG +L++VD E+ + P++EV +++KVAL
Sbjct  237  LMLEIISGSSSSKAAFGEELLVLVEWTWKLREEGRLLDVVDPELTKVPEDEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RPTM QV++M
Sbjct  297  FCTQAAAHQRPTMKQVVEM  315



>ref|XP_004249079.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Solanum lycopersicum]
Length=376

 Score =   385 bits (990),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 234/319 (73%), Gaps = 6/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+ +CFG  S R+ +     Q +  +   N++   R FSY+ LR+AT NF    KIG GG
Sbjct  1    MAFSCFG--SFRQCKDNRGTQVQGLEIATNNV---RLFSYNSLRSATENFHPSKKIGGGG  55

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKG L++GR VA+K LSA+SKQG  E LTEI  +SN RH NLV+LIGCCV   NRI
Sbjct  56   FGVVYKGVLRDGRTVAIKCLSAESKQGTSELLTEINMISNTRHPNLVQLIGCCVEGVNRI  115

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G  G  V L W  RAAIC+GTA GLA+LHEE EP IVHRDIKAS
Sbjct  116  LVYEYLENNSLASALLGSKGKRVPLNWTKRAAICLGTASGLAFLHEEAEPPIVHRDIKAS  175

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+L+D++  PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  176  NVLIDENLHPKIGDFGLAKLFPDNITHVSTRVAGTIGYLAPEYALLGQLTKKADVYSFGV  235

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+VSG SSS+  +G     L+E AW L +EG +L+LVD E+  +P+ EVL+++KVAL
Sbjct  236  LILEIVSGSSSSNAAFGEDLLILVEWAWKLREEGRLLDLVDPELTDYPEAEVLRFIKVAL  295

Query  59   LCTQASASRRPTMSQVIDM  3
             C Q++ ++RP M QVI M
Sbjct  296  FCIQSAYNQRPNMKQVIKM  314



>gb|AAF07841.1|AC010871_17 putative protein kinase [Arabidopsis thaliana]
Length=384

 Score =   385 bits (990),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 188/309 (61%), Positives = 238/309 (77%), Gaps = 9/309 (3%)
 Frame = -1

Query  917  NRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGR  738
            N +  L Q+E+ +   N++   R FSY+ LR+AT++F   N+IG GG+G V+KG L++G 
Sbjct  3    NGSDRLGQREAEEICTNNV---RVFSYNSLRSATDSFHPTNRIGGGGYGVVFKGVLRDGT  59

Query  737  QVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDR  558
            QVAVK+LSA+SKQG REFLTEI  +SN  H NLV+LIGCC+  NNRILVYEYLEN SL  
Sbjct  60   QVAVKSLSAESKQGTREFLTEINLISNIHHPNLVKLIGCCIEGNNRILVYEYLENNSLAS  119

Query  557  VLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIG  381
            VL G +S  V L+W  RAAICVGTA GLA+LHEEVEPH+VHRDIKASNILLD +++PKIG
Sbjct  120  VLLGSRSRYVPLDWSKRAAICVGTASGLAFLHEEVEPHVVHRDIKASNILLDSNFSPKIG  179

Query  380  DFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSS  201
            DFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+L+LEV+SG SS+ 
Sbjct  180  DFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGILVLEVISGNSSTR  239

Query  200  MNWGGQQKALLERAW---NLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRR  30
              +G +   L+E  W      +E  +LE VD E+ +FP +EV +++KVAL CTQA+A +R
Sbjct  240  AAFGDEYMVLVE--WVKLKASEERRLLECVDPELTKFPADEVTRFIKVALFCTQAAAQKR  297

Query  29   PTMSQVIDM  3
            P M QV++M
Sbjct  298  PNMKQVMEM  306



>ref|XP_004156667.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Cucumis sativus]
Length=383

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 188/327 (57%), Positives = 237/327 (72%), Gaps = 19/327 (6%)
 Frame = -1

Query  971  CCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQ  801
            CC  +++C C G SS  +   G              IA T N   FSY+ LR+AT NF  
Sbjct  4    CCFAILNC-CKGNSSTEKPAEG--------------IAVTNNVRIFSYNSLRSATRNFHP  48

Query  800  VNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGC  621
             ++IG GG+G VYKG L++G  VA+K+LSA+S QG REFLTEI  +SN RH NLV+LIGC
Sbjct  49   SSRIGAGGYGVVYKGVLRDGTNVAIKSLSAESTQGTREFLTEINMISNIRHQNLVQLIGC  108

Query  620  CVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHI  444
            C+   +RILVYEYLEN SL   L G  S  V L+W  RA IC+GTA GLA+LHE+ EP +
Sbjct  109  CIEGTHRILVYEYLENNSLASTLLGTMSKHVDLDWPKRAKICLGTALGLAFLHEDAEPSV  168

Query  443  VHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMK  264
            VHRDIKASNILLD+++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT K
Sbjct  169  VHRDIKASNILLDRNFDPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKK  228

Query  263  ADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEV  84
            ADVYSFGVL+LEVVSG SSS   +G +   L+E  W L  EG ++EL+D E+  +PK EV
Sbjct  229  ADVYSFGVLMLEVVSGSSSSKTAFGEELSILVEWTWKLKQEGRLVELIDPELIDYPKAEV  288

Query  83   LKYMKVALLCTQASASRRPTMSQVIDM  3
            ++++ VAL CTQA+A++RP+M QV++M
Sbjct  289  MRFITVALFCTQAAANQRPSMKQVVEM  315



>ref|XP_009612243.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Nicotiana tomentosiformis]
Length=379

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 189/326 (58%), Positives = 237/326 (73%), Gaps = 16/326 (5%)
 Frame = -1

Query  974  FCCI-NVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQV  798
            FCC  +++ C        + NR     Q +  +   N++   R FSY+ LR+AT +F   
Sbjct  3    FCCFRSILQC--------KDNRE---TQVQGLELATNNV---RLFSYNSLRSATEHFHPS  48

Query  797  NKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCC  618
            NKIG GGFG VYKG L++GR VA+K LSA+SKQG  E LTEI  +SN RH NLV+LIGCC
Sbjct  49   NKIGGGGFGVVYKGVLRDGRPVAIKCLSAESKQGTSELLTEITMISNTRHPNLVQLIGCC  108

Query  617  VHENNRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIV  441
            +   NRILVYEYLEN SL   L G  G  V L+W  RAAIC+GTA GLA+LHE+ EP IV
Sbjct  109  IEGGNRILVYEYLENNSLASALLGSKGKRVPLDWPKRAAICLGTASGLAFLHEDAEPPIV  168

Query  440  HRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKA  261
            HRDIKASN+L+D++  PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KA
Sbjct  169  HRDIKASNVLIDENLHPKIGDFGLAKLFPDNITHVSTRVAGTIGYLAPEYALLGQLTKKA  228

Query  260  DVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVL  81
            DVYSFGVL+LE++SGRSSS+  +G     L+E AW L +EG +L+LVD E+  +P+ EVL
Sbjct  229  DVYSFGVLVLEIISGRSSSNAAFGEDLLVLVEWAWKLREEGKLLDLVDPELTEYPEAEVL  288

Query  80   KYMKVALLCTQASASRRPTMSQVIDM  3
            +++KVAL C QA+ + RP M QV++M
Sbjct  289  RFIKVALFCIQAAYNHRPNMKQVMEM  314



>ref|XP_008660308.1| PREDICTED: putative serine/threonine-protein kinase [Zea mays]
 gb|AFW88884.1| putative protein kinase superfamily protein [Zea mays]
Length=371

 Score =   384 bits (986),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 236/317 (74%), Gaps = 6/317 (2%)
 Frame = -1

Query  938  GASSVRRNRTGNLAQQESFDAGDNSIARTRN----FSYDELRTATNNFGQVNKIGRGGFG  771
            G S  R+++   +    S  +G + ++R  N    FS +EL+TAT NF  +N IGRGGFG
Sbjct  10   GGSKSRQDQNCQVVAGSSHSSG-HVLSRAGNNVQVFSLNELKTATQNFHMLNCIGRGGFG  68

Query  770  TVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILV  591
             VYKG LK+G Q+A+K L+ +SKQ I EFLTEI  +SN RH NLV LIGCC    NR+LV
Sbjct  69   AVYKGNLKDGTQIAIKKLAVESKQRISEFLTEINVISNVRHPNLVRLIGCCAEGKNRLLV  128

Query  590  YEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
            YEY EN SL   L G ++  + L+W  RAAIC+GTA GLA+LHE+ +P IVHRDIKASNI
Sbjct  129  YEYAENNSLANALLGPKNKCIPLDWQKRAAICIGTASGLAFLHEKAQPCIVHRDIKASNI  188

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LLDK   PKIGDFGLAK+FPD +THIST++AGT GYLAPEY L GQLT KAD+YSFGVL+
Sbjct  189  LLDKKLLPKIGDFGLAKIFPDTVTHISTRVAGTMGYLAPEYALLGQLTKKADIYSFGVLL  248

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLC  54
            LEV+SG +SS   WG     L+E  W L +EG +LE+VD E++++P+E++L+++KVALLC
Sbjct  249  LEVISGENSSKPTWGPNMHVLVEWTWKLREEGRLLEIVDPELKKYPEEQMLRFIKVALLC  308

Query  53   TQASASRRPTMSQVIDM  3
            TQA++ +RP+M QV++M
Sbjct  309  TQATSQQRPSMKQVVNM  325



>ref|XP_008442433.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Cucumis melo]
Length=383

 Score =   384 bits (987),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 187/327 (57%), Positives = 237/327 (72%), Gaps = 19/327 (6%)
 Frame = -1

Query  971  CCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQ  801
            CC  +++C           R GN + QE  +     IA T N   FSY+ LR+AT NF  
Sbjct  4    CCFAILNC-----------RKGNSSLQEPAEG----IAVTNNVRIFSYNSLRSATRNFHP  48

Query  800  VNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGC  621
             ++IG GG+G VYKG L++G  VA+K+LSA+S QG REFLTEI  +SN RH NLV+LIGC
Sbjct  49   SSRIGAGGYGVVYKGVLRDGTNVAIKSLSAESTQGTREFLTEINMISNIRHQNLVQLIGC  108

Query  620  CVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHI  444
            C+   +RILVYEYLEN SL   L G  S  V L+W  RA IC+GTA GLA+LHEE EP +
Sbjct  109  CIEGTHRILVYEYLENNSLASTLLGTMSKHVDLDWPKRAKICLGTALGLAFLHEEAEPSV  168

Query  443  VHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMK  264
            VHRDIKASNILLD+++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT K
Sbjct  169  VHRDIKASNILLDRNFDPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKK  228

Query  263  ADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEV  84
            ADVYSFGVL+LEV+SG SSS   +G +   L+E  W L  EG ++EL+D E+  +P  EV
Sbjct  229  ADVYSFGVLMLEVISGSSSSKTAFGEELSILVEWTWKLKQEGRLVELIDPELIDYPNAEV  288

Query  83   LKYMKVALLCTQASASRRPTMSQVIDM  3
            ++++ VAL CTQA+A++RP+M QV++M
Sbjct  289  MRFITVALFCTQAAANQRPSMKQVVEM  315



>ref|XP_011094993.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Sesamum indicum]
Length=378

 Score =   384 bits (985),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 231/316 (73%), Gaps = 8/316 (3%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            +CFG    RR +T  + +  + +         R FSY  LR+AT  F   N+IGRGGFG 
Sbjct  5    SCFGVFDSRREKTATVTEGITTN-------NLRLFSYHSLRSATRLFHPSNRIGRGGFGV  57

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG L++G QVA+K LSA+SKQG  EFLTEI  +SN RH NLV+LIGCC+  NNRILVY
Sbjct  58   VYKGILRDGTQVAIKTLSAESKQGTNEFLTEINMISNIRHPNLVQLIGCCIEGNNRILVY  117

Query  587  EYLENRSLDRVLFGQSGAV-KLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
            EYLEN SL   L    G   +L+W  RAAIC GTA GLA+LHE+ EP IVHRDIKASN+L
Sbjct  118  EYLENNSLAGALLASKGKRHELDWSKRAAICKGTASGLAFLHEDAEPRIVHRDIKASNVL  177

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LD+++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGVL+L
Sbjct  178  LDENFLPKIGDFGLAKLFPDNVTHVSTRVAGTEGYLAPEYALLGQLTKKADVYSFGVLLL  237

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCT  51
            E++SG+SSS   +G     LLE  W L+ E  +LE+VD ++  +P++E++++ KVAL CT
Sbjct  238  EIISGKSSSKAAFGDDFLVLLEWTWKLFSEDRLLEIVDPDLIEYPQDEIMRFTKVALFCT  297

Query  50   QASASRRPTMSQVIDM  3
            QA++ +RP M QV+ M
Sbjct  298  QAASQQRPDMKQVVTM  313



>gb|ABK25075.1| unknown [Picea sitchensis]
Length=402

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 240/324 (74%), Gaps = 10/324 (3%)
 Frame = -1

Query  974  FCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVN  795
            FCC++         S  +R  + + A         +SI   + + Y EL+ ATN F   N
Sbjct  8    FCCLD---------SFWKRKTSKDQAPHNEIGDVISSIPDVKVYPYAELKIATNIFHLDN  58

Query  794  KIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCV  615
            KIG GGFG+VYKGTLK+G  VAVK LSAQSKQG++EFLTEI T+S+ +H NLV+L GCC 
Sbjct  59   KIGSGGFGSVYKGTLKDGTVVAVKQLSAQSKQGVKEFLTEIATISDVQHENLVKLHGCCA  118

Query  614  HENNRILVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHR  435
             E +RILVYEYLE  S+ + L   +  + ++W  RA IC+GTARGL+YLHEE+ PHIVHR
Sbjct  119  EEEHRILVYEYLEKNSIAQALLDNT-RMDMDWTMRAKICMGTARGLSYLHEELVPHIVHR  177

Query  434  DIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADV  255
            DIKASN+LLD+D  PKI DFGLAKLFPDN+THIST++AGT GYLAPEY + GQLT KAD+
Sbjct  178  DIKASNVLLDRDLNPKIADFGLAKLFPDNVTHISTRVAGTIGYLAPEYAMRGQLTKKADI  237

Query  254  YSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKY  75
            YSFGVL+LE++SGRS++   +  +++ LLE  W L +E  +L++VD  +E +PKEEVL++
Sbjct  238  YSFGVLVLEIISGRSNTKSTFPLEEQFLLEWTWQLREESRLLDIVDPRLEEYPKEEVLRF  297

Query  74   MKVALLCTQASASRRPTMSQVIDM  3
            +KVALLCTQA+++ RP+MSQV+ M
Sbjct  298  IKVALLCTQAASNFRPSMSQVVAM  321



>ref|XP_010317443.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X2 [Solanum lycopersicum]
Length=301

 Score =   380 bits (977),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 183/246 (74%), Positives = 208/246 (85%), Gaps = 2/246 (1%)
 Frame = -1

Query  737  QVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDR  558
            +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIG C+  +NRILVYEYLEN+SLDR
Sbjct  2    EVAVKTLSAESRQGLREFLTEIETISDIRHPNLVELIGYCLDGHNRILVYEYLENKSLDR  61

Query  557  VLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIG  381
             LFG S + VKL+W TRAAIC+GTA GLA+LHEE+ PHIVHRDIKASNILLDKDY PKIG
Sbjct  62   ALFGSSTSNVKLDWETRAAICLGTATGLAFLHEELVPHIVHRDIKASNILLDKDYKPKIG  121

Query  380  DFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSS  201
            DFGLAKLFPDNITHI+TQI GT GYLAPEYV   QLT KADVYSFGVL+LE VSGRSS S
Sbjct  122  DFGLAKLFPDNITHITTQIKGTTGYLAPEYVRGRQLTSKADVYSFGVLLLETVSGRSSGS  181

Query  200  MNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTM  21
              W G QK LLE AW  Y+EG +LELVD E+  FP+++VLKY+KVAL CTQ  A+RRP M
Sbjct  182  GTWQG-QKLLLESAWEFYEEGKLLELVDPEMGDFPEKQVLKYIKVALFCTQEKANRRPMM  240

Query  20   SQVIDM  3
            SQV+DM
Sbjct  241  SQVLDM  246



>ref|XP_009607275.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X2 [Nicotiana 
tomentosiformis]
Length=317

 Score =   381 bits (979),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/254 (76%), Positives = 217/254 (85%), Gaps = 2/254 (1%)
 Frame = -1

Query  761  KGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEY  582
            +GTLK G +VAVK LSA+S+QG+REFLTEIET+S+ RH NLVELIGCC+  +NRILVYEY
Sbjct  10   EGTLKRGVEVAVKTLSAESRQGLREFLTEIETISDVRHPNLVELIGCCLEGSNRILVYEY  69

Query  581  LENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLD  405
            LENRSLDR LFG S   VKLEW TRAAIC+GTARGLAYLHEE+ PHIVHRDIKASNILLD
Sbjct  70   LENRSLDRALFGSSTRNVKLEWDTRAAICLGTARGLAYLHEELVPHIVHRDIKASNILLD  129

Query  404  KDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEV  225
            KDY PKIGDFGLAKLFPDNITHI+TQI GT GYLAPEYV+  QLT KADVYSFGVLILE 
Sbjct  130  KDYKPKIGDFGLAKLFPDNITHITTQIKGTTGYLAPEYVIGRQLTSKADVYSFGVLILET  189

Query  224  VSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQA  45
            VSGRSS S  W G QK LLE AW LY+E  +LELVD E+  FP++EV+KY+KVAL CTQ 
Sbjct  190  VSGRSSGSGTWQG-QKLLLELAWQLYEEEKLLELVDPELGDFPEKEVVKYIKVALFCTQE  248

Query  44   SASRRPTMSQVIDM  3
            +A+RRP MSQV++M
Sbjct  249  NANRRPMMSQVLEM  262



>ref|XP_004137905.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like [Cucumis sativus]
 gb|KGN58767.1| hypothetical protein Csa_3G731780 [Cucumis sativus]
Length=383

 Score =   384 bits (985),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 188/327 (57%), Positives = 236/327 (72%), Gaps = 19/327 (6%)
 Frame = -1

Query  971  CCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQ  801
            CC  +++C C G SS      G              IA T N   FSY+ LR+AT NF  
Sbjct  4    CCFAILNC-CKGNSSTEEPAEG--------------IAVTNNVRIFSYNSLRSATRNFHP  48

Query  800  VNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGC  621
             ++IG GG+G VYKG L++G  VA+K+LSA+S QG REFLTEI  +SN RH NLV+LIGC
Sbjct  49   SSRIGAGGYGVVYKGVLRDGTNVAIKSLSAESTQGTREFLTEINMISNIRHQNLVQLIGC  108

Query  620  CVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHI  444
            C+   +RILVYEYLEN SL   L G  S  V L+W  RA IC+GTA GLA+LHE+ EP +
Sbjct  109  CIEGTHRILVYEYLENNSLASTLLGTMSKHVDLDWPKRAKICLGTALGLAFLHEDAEPSV  168

Query  443  VHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMK  264
            VHRDIKASNILLD+++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT K
Sbjct  169  VHRDIKASNILLDRNFDPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKK  228

Query  263  ADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEV  84
            ADVYSFGVL+LEVVSG SSS   +G +   L+E  W L  EG ++EL+D E+  +PK EV
Sbjct  229  ADVYSFGVLMLEVVSGSSSSKTAFGEELSILVEWTWKLKQEGRLVELIDPELIDYPKAEV  288

Query  83   LKYMKVALLCTQASASRRPTMSQVIDM  3
            ++++ VAL CTQA+A++RP+M QV++M
Sbjct  289  MRFITVALFCTQAAANQRPSMKQVVEM  315



>ref|NP_001241281.1| receptor ser thr protein kinase [Glycine max]
 gb|ACM89501.1| receptor ser thr protein kinase [Glycine max]
Length=770

 Score =   396 bits (1018),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 198/344 (58%), Positives = 249/344 (72%), Gaps = 34/344 (10%)
 Frame = -1

Query  1034  LFTVFFRCVHVECVIRIGSFFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIAR  855
              F  FF  ++V C++ +  FFCC                             AG   +  
Sbjct  442   FFKNFFPFLYVYCLMFL--FFCC-----------------------------AG-YPLDN  469

Query  854   TRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTE  675
              R FS  ELR AT+N+   NKIGRGGFGTVY+GTL++GR++AVK LS  SKQG+REFLTE
Sbjct  470   VRQFSDKELRLATDNYNPKNKIGRGGFGTVYQGTLRDGRRIAVKTLSVWSKQGVREFLTE  529

Query  674   IETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAIC  498
             I+T+SN +HSNLVELIG C+   +R LVYE++EN SL+  L G ++  +KLEW  R+AIC
Sbjct  530   IKTLSNVKHSNLVELIGFCIQGPSRTLVYEHVENGSLNSALLGTRNKNMKLEWRKRSAIC  589

Query  497   VGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAG  318
             +G A+GLA+LHEE+ P IVHRDIKASN+LLD+D+ PKIGDFGLAKLFPD++THIST+IAG
Sbjct  590   LGIAKGLAFLHEELSPPIVHRDIKASNVLLDRDFNPKIGDFGLAKLFPDDVTHISTRIAG  649

Query  317   TCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSS-SMNWGGQQKALLERAWNLYDE  141
             T GYLAPEY L GQLT KAD+YSFGVLILE++SGRSS+   N GG  K LLE AW LY+E
Sbjct  650   TTGYLAPEYALGGQLTKKADIYSFGVLILEIISGRSSARRTNGGGSHKFLLEWAWQLYEE  709

Query  140   GNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVI  9
               +LE VD ++E FP+EEV++YMKVAL CTQ++A+RRP M Q +
Sbjct  710   RKLLEFVDQDMEEFPEEEVIRYMKVALFCTQSAANRRPLMIQYL  753



>ref|XP_006349463.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430-like isoform X2 [Solanum tuberosum]
Length=374

 Score =   383 bits (983),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 233/319 (73%), Gaps = 8/319 (3%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+ +CFG+    ++  G   Q+ + +         R FSY+ LR+AT NF    KIG GG
Sbjct  1    MTFSCFGSFRQCKDNRGTQVQEIATN-------NVRLFSYNSLRSATENFHPSKKIGGGG  53

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKG L++GR VA+K LSA+SKQG  EFLTEI  +SN RH NLV+LIGCCV   +RI
Sbjct  54   FGVVYKGVLRDGRTVAIKCLSAESKQGTSEFLTEINMISNTRHPNLVQLIGCCVEGVHRI  113

Query  596  LVYEYLENRSLDRVLFGQSG-AVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G  G  V L W  RAAIC+GTA GLA+LHEE +P IVHRDIKAS
Sbjct  114  LVYEYLENNSLASALLGSKGKPVPLNWTKRAAICLGTASGLAFLHEEAQPPIVHRDIKAS  173

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+L+D++  PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  174  NVLIDENLHPKIGDFGLAKLFPDNITHVSTRVAGTIGYLAPEYALLGQLTKKADVYSFGV  233

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+VSG SSS+  +G     L+E AW L +EG +L+LVD E+  +P+ EVL+++KVA 
Sbjct  234  LILEIVSGSSSSNAAFGEDLLILVEWAWKLREEGRLLDLVDPELTEYPEAEVLRFIKVAF  293

Query  59   LCTQASASRRPTMSQVIDM  3
             C Q++ ++RP M QVI+M
Sbjct  294  FCIQSAYNQRPNMKQVIEM  312



>ref|XP_010327728.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Solanum lycopersicum]
Length=374

 Score =   383 bits (983),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 232/319 (73%), Gaps = 8/319 (3%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+ +CFG+    ++  G   Q+ + +         R FSY+ LR+AT NF    KIG GG
Sbjct  1    MAFSCFGSFRQCKDNRGTQVQEIATN-------NVRLFSYNSLRSATENFHPSKKIGGGG  53

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKG L++GR VA+K LSA+SKQG  E LTEI  +SN RH NLV+LIGCCV   NRI
Sbjct  54   FGVVYKGVLRDGRTVAIKCLSAESKQGTSELLTEINMISNTRHPNLVQLIGCCVEGVNRI  113

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G  G  V L W  RAAIC+GTA GLA+LHEE EP IVHRDIKAS
Sbjct  114  LVYEYLENNSLASALLGSKGKRVPLNWTKRAAICLGTASGLAFLHEEAEPPIVHRDIKAS  173

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+L+D++  PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  174  NVLIDENLHPKIGDFGLAKLFPDNITHVSTRVAGTIGYLAPEYALLGQLTKKADVYSFGV  233

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            LILE+VSG SSS+  +G     L+E AW L +EG +L+LVD E+  +P+ EVL+++KVAL
Sbjct  234  LILEIVSGSSSSNAAFGEDLLILVEWAWKLREEGRLLDLVDPELTDYPEAEVLRFIKVAL  293

Query  59   LCTQASASRRPTMSQVIDM  3
             C Q++ ++RP M QVI M
Sbjct  294  FCIQSAYNQRPNMKQVIKM  312



>ref|XP_006449304.1| hypothetical protein CICLE_v10015669mg [Citrus clementina]
 gb|ESR62544.1| hypothetical protein CICLE_v10015669mg [Citrus clementina]
Length=307

 Score =   380 bits (976),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 207/253 (82%), Gaps = 1/253 (0%)
 Frame = -1

Query  758  GTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYL  579
            GTL NGR +AVK LSA+SKQG+REF+TEI+T+SN RH NLVELIGCCV    RILVYEY+
Sbjct  2    GTLTNGRHIAVKPLSAESKQGVREFITEIKTLSNVRHPNLVELIGCCVQGTRRILVYEYV  61

Query  578  ENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDK  402
            EN SLDRVL G + A +KL W  R+ ICVG A+GLA+LHEE+ PHIVHRDIKASNILLD+
Sbjct  62   ENNSLDRVLLGATKANIKLNWEKRSDICVGIAKGLAFLHEELVPHIVHRDIKASNILLDQ  121

Query  401  DYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVV  222
            ++ PKIGDFGLAKLFPDNITHI+T+IAGT GYLAPEYVL GQLTMKADVYSFGVL+LE++
Sbjct  122  EFNPKIGDFGLAKLFPDNITHITTRIAGTTGYLAPEYVLGGQLTMKADVYSFGVLVLEII  181

Query  221  SGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQAS  42
            SGR+S    WG   K LLE AW L+ E   LELVD E+  +P  E+++YMKVA  CTQA+
Sbjct  182  SGRNSGKAMWGQMNKFLLEWAWQLHQEEKPLELVDPELGEYPPNEIIRYMKVAFFCTQAA  241

Query  41   ASRRPTMSQVIDM  3
            ASRRP M+QVI M
Sbjct  242  ASRRPQMNQVIKM  254



>gb|KDO75883.1| hypothetical protein CISIN_1g017503mg [Citrus sinensis]
Length=307

 Score =   379 bits (974),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 177/253 (70%), Positives = 207/253 (82%), Gaps = 1/253 (0%)
 Frame = -1

Query  758  GTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYL  579
            GTL NGR++AVK LSA+SKQG+REF+TEI T+SN RH NLVELIGCCV    RILVYEY+
Sbjct  2    GTLTNGRRIAVKPLSAESKQGVREFITEIMTLSNVRHPNLVELIGCCVQGTRRILVYEYV  61

Query  578  ENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDK  402
            EN SLDRVL G + A +KL W  R+ ICVG A+GLA+LHEE+ PHIVHRDIKASNILLD+
Sbjct  62   ENNSLDRVLLGATKANIKLNWEKRSDICVGIAKGLAFLHEELVPHIVHRDIKASNILLDQ  121

Query  401  DYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVV  222
            ++ PKIGDFGLAKLFPDNITHI+T+IAGT GYLAPEYVL GQLTMKADVYSFGVL+LE++
Sbjct  122  EFNPKIGDFGLAKLFPDNITHITTRIAGTTGYLAPEYVLGGQLTMKADVYSFGVLVLEII  181

Query  221  SGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQAS  42
            SGR+S    WG   K LLE AW L+ E   LELVD E+  +P  E+++YMKVA  CTQA+
Sbjct  182  SGRNSGKAMWGQMNKFLLEWAWQLHQEEKPLELVDPELGEYPPNEIIRYMKVAFFCTQAA  241

Query  41   ASRRPTMSQVIDM  3
            ASRRP M+QVI M
Sbjct  242  ASRRPQMNQVIKM  254



>ref|XP_007026738.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY07240.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=420

 Score =   383 bits (984),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 192/359 (53%), Positives = 245/359 (68%), Gaps = 45/359 (13%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFD------------------AGDNSIARTRNFSYDE  831
            MSC CFG   + + R  +  +Q                      A DN     R FSY+ 
Sbjct  1    MSCRCFGLFELFKGRNSHDQKQAQVPDKVLICSCVCCICAWLEFATDN----IRLFSYNS  56

Query  830  LRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNAR  651
            LR+AT++F   N+IG GGFG VY+G L++G QVA+K LSA+SKQG+REF+TEI+ +SN R
Sbjct  57   LRSATSDFHPSNRIGGGGFGVVYRGVLRDGTQVAIKTLSAESKQGLREFVTEIDMISNIR  116

Query  650  HSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-----------------------QS  540
            H NLVELIGCCV +N+RILVYEYLEN SL  VL G                       +S
Sbjct  117  HPNLVELIGCCVDDNHRILVYEYLENNSLASVLLGNHITPMPSTFGVLMSRNHNFSGSRS  176

Query  539  GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKL  360
              + L+W  RAAIC+GTA GLA+LH E  PHIVHRDIKASNILLD ++ PKIGDFGLAKL
Sbjct  177  KYIALDWPKRAAICLGTASGLAFLHYEAVPHIVHRDIKASNILLDGNFQPKIGDFGLAKL  236

Query  359  FPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQ  180
            FP+N+TH+ST++AGT GYLAPEY L GQLT KADVYSFGVL+LE++SGRSSS   +G + 
Sbjct  237  FPENVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGVLVLELISGRSSSKAAFGVEL  296

Query  179  KALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
              L+E  W L +E  +L++VD E+  +P+ EV++++KVAL CTQA+A +RPTM QV++M
Sbjct  297  MLLVEWTWKLKEEERLLDIVDPELTNYPQGEVMRFIKVALFCTQATAHQRPTMKQVVEM  355



>ref|XP_009382770.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=355

 Score =   381 bits (978),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/298 (60%), Positives = 234/298 (79%), Gaps = 5/298 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C+CF A  + R +    ++QE   AG +S  + + FSY +L +AT+NF    +IGRGG
Sbjct  1    MNCSCFDAL-LSRKKLRQHSEQEL--AGFSSDKKIKIFSYSDLSSATDNFCPDKRIGRGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FGTVYKGTL+NG  VA+K LSA+SKQG++EFLTEI+T++N  H NLVELIGCCV +++RI
Sbjct  58   FGTVYKGTLRNGVTVAIKVLSAESKQGVKEFLTEIDTIANVGHPNLVELIGCCVQDSSRI  117

Query  596  LVYEYLENRSLDRVLFGQS--GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            LVYE++EN SLDR L G +   + KL W+ R+AIC+GTARGLA+LHE++EP IVHRDIKA
Sbjct  118  LVYEHMENGSLDRTLLGMNIDKSTKLSWNIRSAICIGTARGLAFLHEDLEPPIVHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD ++ PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY L GQLT KADVYSFG
Sbjct  178  SNILLDSNFDPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYALQGQLTKKADVYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            VL++E++SGRS S     G  + LLER W L+ EG + EL+D  ++ +P+E+VLK++K
Sbjct  238  VLVIEIISGRSISKSYLSGVNQFLLERTWQLFQEGRLKELIDPVLQEYPEEQVLKFIK  295



>ref|XP_010558367.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X1 [Tarenaya hassleriana]
Length=434

 Score =   382 bits (982),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 248/321 (77%), Gaps = 5/321 (2%)
 Frame = -1

Query  962  NVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGR  783
            +VM C CFG   + +   G L Q+E+ +   N++   R FS+  LR+ATNNF   N+IG 
Sbjct  52   SVMLCNCFGVFDMCKGSDG-LGQREAQEIVTNNV---RVFSHSSLRSATNNFHPSNRIGG  107

Query  782  GGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENN  603
            GG+G VY+G L++G QVAVK+LSA+S+QG +EFLTEI T+SN  H NLVELIGCCV  NN
Sbjct  108  GGYGVVYRGVLRDGTQVAVKSLSAESRQGTQEFLTEINTISNIHHPNLVELIGCCVEGNN  167

Query  602  RILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIK  426
            RILVYE+LE  SL  VL G +S  V+L+W  RA IC+GTA GLA+LHEE EPHIVHRDIK
Sbjct  168  RILVYEFLERNSLSSVLLGSKSKYVQLDWSKRAEICLGTALGLAFLHEEAEPHIVHRDIK  227

Query  425  ASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSF  246
            ASNILLD+D++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSF
Sbjct  228  ASNILLDRDFSPKIGDFGLAKLFPDNVTHVSTRVAGTFGYLAPEYALLGQLTKKADVYSF  287

Query  245  GVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKV  66
            GVL+LE++SG SS    +G     L+E AW L +EG ++EL+D E+ ++P+EEV++++KV
Sbjct  288  GVLVLEIISGCSSGKAAFGDGFSVLVEWAWKLREEGRLVELIDPELTQYPEEEVIRFIKV  347

Query  65   ALLCTQASASRRPTMSQVIDM  3
            A  CTQA+A +RP M QV++M
Sbjct  348  AFFCTQAAAQKRPNMKQVVEM  368



>ref|XP_010558368.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Tarenaya hassleriana]
Length=381

 Score =   380 bits (977),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 193/319 (61%), Positives = 246/319 (77%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG   + +   G L Q+E+ +   N++   R FS+  LR+ATNNF   N+IG GG
Sbjct  1    MLCNCFGVFDMCKGSDG-LGQREAQEIVTNNV---RVFSHSSLRSATNNFHPSNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++G QVAVK+LSA+S+QG +EFLTEI T+SN  H NLVELIGCCV  NNRI
Sbjct  57   YGVVYRGVLRDGTQVAVKSLSAESRQGTQEFLTEINTISNIHHPNLVELIGCCVEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYE+LE  SL  VL G +S  V+L+W  RA IC+GTA GLA+LHEE EPHIVHRDIKAS
Sbjct  117  LVYEFLERNSLSSVLLGSKSKYVQLDWSKRAEICLGTALGLAFLHEEAEPHIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  177  NILLDRDFSPKIGDFGLAKLFPDNVTHVSTRVAGTFGYLAPEYALLGQLTKKADVYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SG SS    +G     L+E AW L +EG ++EL+D E+ ++P+EEV++++KVA 
Sbjct  237  LVLEIISGCSSGKAAFGDGFSVLVEWAWKLREEGRLVELIDPELTQYPEEEVIRFIKVAF  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQAAAQKRPNMKQVVEM  315



>gb|AAP06827.1| putative receptor ser/thr protein [Oryza sativa Japonica Group]
 gb|ABF95119.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
Length=392

 Score =   380 bits (977),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 192/322 (60%), Positives = 237/322 (74%), Gaps = 4/322 (1%)
 Frame = -1

Query  956  MSCTC-FGASSVRRNRTGNLA--QQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIG  786
            +S +C +G S  R N+ G+ A     S      + +  R FS  EL+ AT NF  +N +G
Sbjct  3    VSASCLWGGSESRGNQNGSAAVTSPRSGQVISRAGSNVRVFSLKELKLATRNFHMMNCVG  62

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
            RGGFG VYKG LK+G Q+A+K LSA+SKQG  EFLTEI  +SN RH NLV+LIGCCV   
Sbjct  63   RGGFGAVYKGNLKDGTQIAIKKLSAESKQGANEFLTEINVISNVRHPNLVKLIGCCVEGT  122

Query  605  NRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NR+LVYEY EN SL   L G +S  + L W  RAAIC+GTA GLA+LHEE +P IVHRDI
Sbjct  123  NRLLVYEYAENNSLAHALLGPRSRCIPLNWQKRAAICIGTASGLAFLHEEAQPRIVHRDI  182

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDK   PKIGDFGLAKLFPD ITHIST++AGT GYLAPEY L GQLT KAD+YS
Sbjct  183  KASNILLDKKLLPKIGDFGLAKLFPDTITHISTRVAGTMGYLAPEYALLGQLTKKADIYS  242

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVL+LEV+SG SSS   WG     L+E  W L ++G +LE+VD E+E +P+EE+L+++K
Sbjct  243  FGVLVLEVISGESSSKSTWGQDMNVLVEWTWKLREQGRLLEIVDPELEEYPEEEMLRFIK  302

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VAL+CTQA++ +RP+M QV+DM
Sbjct  303  VALVCTQATSQQRPSMKQVVDM  324



>ref|XP_011094994.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Sesamum indicum]
Length=373

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 177/284 (62%), Positives = 219/284 (77%), Gaps = 1/284 (0%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY  LR+AT  F   N+IGRGGFG VYKG L++G QVA+K LSA+SKQG  EFLTEI
Sbjct  25   RLFSYHSLRSATRLFHPSNRIGRGGFGVVYKGILRDGTQVAIKTLSAESKQGTNEFLTEI  84

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGAV-KLEWHTRAAICV  495
              +SN RH NLV+LIGCC+  NNRILVYEYLEN SL   L    G   +L+W  RAAIC 
Sbjct  85   NMISNIRHPNLVQLIGCCIEGNNRILVYEYLENNSLAGALLASKGKRHELDWSKRAAICK  144

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            GTA GLA+LHE+ EP IVHRDIKASN+LLD+++ PKIGDFGLAKLFPDN+TH+ST++AGT
Sbjct  145  GTASGLAFLHEDAEPRIVHRDIKASNVLLDENFLPKIGDFGLAKLFPDNVTHVSTRVAGT  204

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY L GQLT KADVYSFGVL+LE++SG+SSS   +G     LLE  W L+ E  
Sbjct  205  EGYLAPEYALLGQLTKKADVYSFGVLLLEIISGKSSSKAAFGDDFLVLLEWTWKLFSEDR  264

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +LE+VD ++  +P++E++++ KVAL CTQA++ +RP M QV+ M
Sbjct  265  LLEIVDPDLIEYPQDEIMRFTKVALFCTQAASQQRPDMKQVVTM  308



>ref|XP_008442432.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Cucumis melo]
Length=388

 Score =   379 bits (974),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 236/332 (71%), Gaps = 24/332 (7%)
 Frame = -1

Query  971  CCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQ  801
            CC  +++C           R GN + QE  +     IA T N   FSY+ LR+AT NF  
Sbjct  4    CCFAILNC-----------RKGNSSLQEPAEG----IAVTNNVRIFSYNSLRSATRNFHP  48

Query  800  VNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGC  621
             ++IG GG+G VYKG L++G  VA+K+LSA+S QG REFLTEI  +SN RH NLV+LIGC
Sbjct  49   SSRIGAGGYGVVYKGVLRDGTNVAIKSLSAESTQGTREFLTEINMISNIRHQNLVQLIGC  108

Query  620  CVHENNRILVYEYLENRSLDRVLF------GQSGAVKLEWHTRAAICVGTARGLAYLHEE  459
            C+   +RILVYEYLEN SL   L         S  V L+W  RA IC+GTA GLA+LHEE
Sbjct  109  CIEGTHRILVYEYLENNSLASTLLETIISGTMSKHVDLDWPKRAKICLGTALGLAFLHEE  168

Query  458  VEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAG  279
             EP +VHRDIKASNILLD+++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L G
Sbjct  169  AEPSVVHRDIKASNILLDRNFDPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLG  228

Query  278  QLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERF  99
            QLT KADVYSFGVL+LEV+SG SSS   +G +   L+E  W L  EG ++EL+D E+  +
Sbjct  229  QLTKKADVYSFGVLMLEVISGSSSSKTAFGEELSILVEWTWKLKQEGRLVELIDPELIDY  288

Query  98   PKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            P  EV++++ VAL CTQA+A++RP+M QV++M
Sbjct  289  PNAEVMRFITVALFCTQAAANQRPSMKQVVEM  320



>ref|XP_010256574.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Nelumbo nucifera]
Length=345

 Score =   377 bits (969),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 175/277 (63%), Positives = 219/277 (79%), Gaps = 1/277 (0%)
 Frame = -1

Query  830  LRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNAR  651
            LR+AT NF   N+IG GGFG VYKG L +  QVAVK+LSA+SKQG REFLTEI+ +SN R
Sbjct  2    LRSATGNFHPSNRIGGGGFGVVYKGVLSDDTQVAVKSLSAESKQGTREFLTEIDMISNVR  61

Query  650  HSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLA  474
            H NLV+L+GCC+   NR+LVYEY+EN SL   L G +     L+W TRAAIC+GTA+GL 
Sbjct  62   HPNLVQLLGCCIEGTNRMLVYEYMENNSLASALLGPKHKHADLDWPTRAAICMGTAQGLL  121

Query  473  YLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPE  294
            +LHEE EPH+VHRDIKASNILL +D+ PKIGDFGLAKLFPDN+TH+STQ+AGT GYLAPE
Sbjct  122  FLHEEAEPHVVHRDIKASNILLGRDFHPKIGDFGLAKLFPDNVTHLSTQVAGTMGYLAPE  181

Query  293  YVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDS  114
            Y L GQLT KAD+YSFGVLILE+VSGRSSS   +G     L+E  W L +E  +L++VD 
Sbjct  182  YALLGQLTKKADIYSFGVLILEIVSGRSSSKAAFGEDLMVLVEWTWKLKEESRLLDIVDP  241

Query  113  EVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            E+  +P++EV +++KVAL CTQAS+ +RP++ QV++M
Sbjct  242  ELVEYPEDEVERFIKVALFCTQASSQQRPSIKQVVEM  278



>gb|EEE58749.1| hypothetical protein OsJ_10239 [Oryza sativa Japonica Group]
Length=437

 Score =   380 bits (976),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 192/322 (60%), Positives = 237/322 (74%), Gaps = 4/322 (1%)
 Frame = -1

Query  956  MSCTC-FGASSVRRNRTGNLA--QQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIG  786
            +S +C +G S  R N+ G+ A     S      + +  R FS  EL+ AT NF  +N +G
Sbjct  48   VSASCLWGGSESRGNQNGSAAVTSPRSGQVISRAGSNVRVFSLKELKLATRNFHMMNCVG  107

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
            RGGFG VYKG LK+G Q+A+K LSA+SKQG  EFLTEI  +SN RH NLV+LIGCCV   
Sbjct  108  RGGFGAVYKGNLKDGTQIAIKKLSAESKQGANEFLTEINVISNVRHPNLVKLIGCCVEGT  167

Query  605  NRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NR+LVYEY EN SL   L G +S  + L W  RAAIC+GTA GLA+LHEE +P IVHRDI
Sbjct  168  NRLLVYEYAENNSLAHALLGPRSRCIPLNWQKRAAICIGTASGLAFLHEEAQPRIVHRDI  227

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDK   PKIGDFGLAKLFPD ITHIST++AGT GYLAPEY L GQLT KAD+YS
Sbjct  228  KASNILLDKKLLPKIGDFGLAKLFPDTITHISTRVAGTMGYLAPEYALLGQLTKKADIYS  287

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVL+LEV+SG SSS   WG     L+E  W L ++G +LE+VD E+E +P+EE+L+++K
Sbjct  288  FGVLVLEVISGESSSKSTWGQDMNVLVEWTWKLREQGRLLEIVDPELEEYPEEEMLRFIK  347

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VAL+CTQA++ +RP+M QV+DM
Sbjct  348  VALVCTQATSQQRPSMKQVVDM  369



>gb|KFK38286.1| hypothetical protein AALP_AA3G094700 [Arabis alpina]
Length=390

 Score =   378 bits (970),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG   + +    +L QQE+ +   N++   R FSY+ LR+AT++F   N+IG GG
Sbjct  1    MRYNCFGIFDMCKG-NDHLGQQEAEEICTNNV---RVFSYNSLRSATDHFHPSNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG V++G L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV+LIGCC+  NNRI
Sbjct  57   FGVVFRGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVKLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL  VL G +S  V L+W  RA IC+GTA GLA+LHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLSSVLLGSRSKYVPLDWSKRAVICIGTASGLAFLHEEVEPQVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDRDFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +G +   L+E  W L +EG +LE VD ++ +FP +EV +++KVAL
Sbjct  237  LVLEVISGGSSSRAAFGDEYLVLVEWVWKLREEGRLLECVDPDLTKFPADEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQAAAQKRPNMKQVVEM  315



>ref|XP_010553095.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Tarenaya hassleriana]
 ref|XP_010553097.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Tarenaya hassleriana]
Length=382

 Score =   377 bits (968),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG   + +   G L Q+E+ +   N++   R FSY+ LR+AT +F   N+IG GG
Sbjct  1    MRCNCFGVLDMCKGSDG-LGQREAQEIVTNNV---RVFSYNSLRSATADFHPSNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++G QVAVK+LSA+SKQG REFLTEI+ +SN  H NLVELIGCCV  N RI
Sbjct  57   YGVVYRGVLRDGTQVAVKSLSAESKQGTREFLTEIDMISNIHHPNLVELIGCCVEGNKRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYE+LE  SL  VL G +S  + L+W  RAAIC+GTA GLA+LHEE EPHIVHRDIKAS
Sbjct  117  LVYEFLEKNSLSSVLLGSKSKYIPLDWSKRAAICLGTASGLAFLHEEAEPHIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD++++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY   GQLT KADVYSFGV
Sbjct  177  NILLDREFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYARLGQLTKKADVYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SG SSS   +G +   L+E AW L +EG M EL+D E+   P+EEV++++KV L
Sbjct  237  LVLEIISGCSSSKAAFGAEFLVLVEWAWKLREEGRMGELIDEEMSNCPEEEVIRFIKVGL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M+QV++M
Sbjct  297  FCTQAAAQKRPNMNQVVEM  315



>gb|EEC74913.1| hypothetical protein OsI_10854 [Oryza sativa Indica Group]
Length=437

 Score =   378 bits (971),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/322 (60%), Positives = 237/322 (74%), Gaps = 4/322 (1%)
 Frame = -1

Query  956  MSCTC-FGASSVRRNRTGNLA--QQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIG  786
            +S +C +G S  R N+ G+ A     S      + +  R FS  EL+ AT NF  +N IG
Sbjct  48   VSASCLWGGSESRGNQNGSAAVTSPRSGQVISRAGSNVRVFSLKELKLATRNFHMMNCIG  107

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
            RGGFG VYKG LK+G Q+A+K LSA+SKQG  EFLTEI  +SN RH NLV+LIG C    
Sbjct  108  RGGFGAVYKGNLKDGTQIAIKKLSAESKQGANEFLTEINVISNVRHPNLVKLIGYCDEGT  167

Query  605  NRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            NR+LVYEY EN SL  VL G +S  + L W  RAAIC+GTA GLA+LHEE +PHIVHRDI
Sbjct  168  NRLLVYEYAENNSLAHVLLGPRSRCIPLNWQKRAAICIGTASGLAFLHEEAQPHIVHRDI  227

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDK   PKIGDFGLAKLFPD ITHIST++AGT GYLAPEY L GQLT KAD+YS
Sbjct  228  KASNILLDKKLLPKIGDFGLAKLFPDTITHISTRVAGTMGYLAPEYALLGQLTKKADIYS  287

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            FGVL+LEV+SG SSS   WG     L+E  W L ++G +LE+VD E+E +P+EE+L+++K
Sbjct  288  FGVLVLEVISGESSSKSTWGQDMNVLVEWTWKLREQGRLLEIVDPELEEYPEEEMLRFIK  347

Query  68   VALLCTQASASRRPTMSQVIDM  3
            VAL+CTQA++ +RP+M QV+DM
Sbjct  348  VALVCTQATSQQRPSMKQVVDM  369



>ref|NP_001136520.1| uncharacterized LOC100216635 [Zea mays]
 ref|XP_008681261.1| PREDICTED: uncharacterized LOC100216635 isoform X1 [Zea mays]
 ref|XP_008681262.1| PREDICTED: uncharacterized LOC100216635 isoform X1 [Zea mays]
 ref|XP_008681263.1| PREDICTED: uncharacterized LOC100216635 isoform X1 [Zea mays]
 gb|ACF82095.1| unknown [Zea mays]
 gb|AFW72510.1| putative protein kinase superfamily protein [Zea mays]
Length=333

 Score =   372 bits (955),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 176/283 (62%), Positives = 216/283 (76%), Gaps = 4/283 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY E+R  TNNF Q NK+GRGGFGTVYKG L++G + A K LS++S+QGI+EFL EI
Sbjct  25   RLFSYREIRAGTNNFDQSNKLGRGGFGTVYKGVLRDGTEFAAKVLSSESEQGIKEFLAEI  84

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVG  492
            E++S  +H+NLV L+GCCV    RILVYEYL N SLD  L G   A  L W TR+ IC+G
Sbjct  85   ESISQVKHANLVRLLGCCVQRKKRILVYEYLANNSLDHALKG--AAADLPWSTRSGICLG  142

Query  491  TARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTC  312
            TA+GL+YLHEE EP+IVHRDIKASN+LLD+DY PKIGDFGLAKLFPDNITHIST + GT 
Sbjct  143  TAKGLSYLHEEHEPNIVHRDIKASNVLLDRDYLPKIGDFGLAKLFPDNITHISTAVVGTS  202

Query  311  GYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNM  132
            GYLAPEY + GQLT KADVYSFGVL+LE+VSGR  S           +  AW +Y +G +
Sbjct  203  GYLAPEYFVHGQLTKKADVYSFGVLVLEIVSGRRVSQTIQSDMFP--VREAWMMYQQGRL  260

Query  131  LELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            LE+VD+ +  +P++EVL+Y+KV L CTQA+ S RPTM QV+ +
Sbjct  261  LEIVDASMGSYPEKEVLRYIKVGLACTQATPSSRPTMRQVLAL  303



>gb|ACG41490.1| hypothetical protein [Zea mays]
Length=333

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 175/283 (62%), Positives = 216/283 (76%), Gaps = 4/283 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY E+R  TNNF Q NK+GRGGFGTVYKG L++G + A K LS++S+QGI+EFL EI
Sbjct  25   RLFSYREIRAGTNNFDQSNKLGRGGFGTVYKGVLRDGTEFAAKVLSSESEQGIKEFLAEI  84

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVG  492
            E++S  +H+NLV L+GCCV    RILVYEYL N SLD  L G   A  L W TR+ IC+G
Sbjct  85   ESISQVKHANLVRLLGCCVQRKKRILVYEYLANNSLDHALKG--AAADLPWSTRSGICLG  142

Query  491  TARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTC  312
            TA+GL+YLHEE EP+IVHRDIKASN+LLD+DY PKIGDFGLAKLFPDNITHIST + GT 
Sbjct  143  TAKGLSYLHEEHEPNIVHRDIKASNVLLDRDYLPKIGDFGLAKLFPDNITHISTAVVGTS  202

Query  311  GYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNM  132
            GYLAPEY + GQLT KADVYSFGVL+LE++SGR  S           +  AW +Y +G +
Sbjct  203  GYLAPEYFVHGQLTKKADVYSFGVLVLEIISGRRVSQTIQSDMFP--VREAWMMYQQGRL  260

Query  131  LELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            LE+VD+ +  +P++EVL+Y+KV L CTQA+ S RPTM QV+ +
Sbjct  261  LEIVDASMGSYPEKEVLRYIKVGLACTQATPSSRPTMRQVLAL  303



>ref|XP_006407720.1| hypothetical protein EUTSA_v10020896mg [Eutrema salsugineum]
 gb|ESQ49173.1| hypothetical protein EUTSA_v10020896mg [Eutrema salsugineum]
Length=390

 Score =   373 bits (958),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG   + +     L Q+E+ +   +++   R FSY+ LR+AT++F    +IG GG
Sbjct  1    MRYNCFGILDLCKG-NDRLGQREAEEICTDNV---RVFSYNSLRSATDSFHPSKRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV LIGCC+  NNRI
Sbjct  57   FGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVTLIGCCIEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL  VL G +S  V L+W  RAAICVGTA GLA+LHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLASVLLGSRSKYVPLDWSKRAAICVGTASGLAFLHEEVEPQVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDRDFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +G +   L+E  W L +EG +LE VD ++ +FP++EV++++KVAL
Sbjct  237  LVLEVISGGSSSRAAFGDEFLVLVEWVWKLREEGRLLECVDPDLTKFPEDEVVRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQAAAPKRPNMKQVVEM  315



>ref|XP_008809404.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Phoenix dactylifera]
Length=347

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/320 (58%), Positives = 228/320 (71%), Gaps = 27/320 (8%)
 Frame = -1

Query  956  MSCTCFGASSV-RRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M   CF A SV  ++R  +        + +N       FSY ELR ATNNF   NK+G+G
Sbjct  1    MRWCCFDAPSVTEKDRPNSQQDLRRLSSSENITV----FSYGELRAATNNFHPCNKLGQG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKGTLKNG  VA K LSA+SKQG+ EFLTEI+ ++N +H NLVELIGCC+  + R
Sbjct  57   GFGTVYKGTLKNGAPVATKVLSAESKQGVHEFLTEIKILTNVKHPNLVELIGCCIQGSTR  116

Query  599  ILVYEYLENRSLDRVLFGQSGAV-KLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEYLEN SLDR L G  G + KL W  R++IC+GTARGLA+LHEE+EP IVHRDIKA
Sbjct  117  ILVYEYLENNSLDRALRGSDGEIGKLNWSMRSSICMGTARGLAFLHEELEPQIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+++TPKIGDFGLA+LFPD+ THIST +AGT                     +FG
Sbjct  177  SNILLDRNFTPKIGDFGLARLFPDDTTHISTCVAGT---------------------TFG  215

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            +L LE+VSGRS S  NW  Q+K LLE AW LY+EGN++ELVD  ++ + +EEVL+Y+KVA
Sbjct  216  MLALEIVSGRSISKANWSEQEKFLLEWAWQLYEEGNLIELVDPNLKEYLEEEVLRYIKVA  275

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+  +RPTM QV++M
Sbjct  276  LFCTQAATKQRPTMPQVVEM  295



>ref|XP_006297864.1| hypothetical protein CARUB_v10013905mg [Capsella rubella]
 gb|EOA30762.1| hypothetical protein CARUB_v10013905mg [Capsella rubella]
Length=390

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 240/319 (75%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG   + + R+  L Q E+ +   +++   R FSY+ LR+AT +F   N+IG GG
Sbjct  1    MRYNCFGLLDMCK-RSDRLGQTEAEEICTDNV---RVFSYNSLRSATGDFHPTNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG V+KG L++G QVAVK+LSA+SKQG REFLTEI  +SN  H NLV L+GCC+  N+RI
Sbjct  57   FGVVFKGVLRDGTQVAVKSLSAESKQGTREFLTEINLISNIHHPNLVNLLGCCIEGNHRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W  RA+ICVGTA GLA+LHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLASTLLGSRSKYVHLDWSKRASICVGTASGLAFLHEEVEPQVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NILLDRDFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +G +   L+E  W L +EG +LE VD  + +FP +EV +++KVAL
Sbjct  237  LVLEVISGNSSSRAAFGEEYMVLIEWVWKLREEGRLLECVDPNLTKFPGDEVTRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA A +RP M QV+DM
Sbjct  297  FCTQAVAQKRPNMKQVVDM  315



>ref|XP_009626619.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Nicotiana tomentosiformis]
Length=378

 Score =   370 bits (950),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 233/320 (73%), Gaps = 10/320 (3%)
 Frame = -1

Query  956  MSCTCFGA-SSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M  +CFGA  S + NR   + +     A +N     R FSY+ LR+AT +F   NKIG G
Sbjct  1    MDWSCFGAFQSCKNNRETQVQEL----ATNN----VRLFSYNSLRSATGHFHPSNKIGGG  52

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VYKG L++G +VA+K LSA+SKQG +E LTEI  +S+ RH NLV+LIGCCV   NR
Sbjct  53   GFGVVYKGVLRDGSRVAIKCLSAESKQGTKELLTEINIISDTRHPNLVQLIGCCVESGNR  112

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            +L+YEYLEN SL   L G  G  V L+W  R AI +GTA GLA+LHEE  P IVHRDIKA
Sbjct  113  MLIYEYLENNSLACALLGSKGKRVALDWPKRVAIILGTASGLAFLHEEATPPIVHRDIKA  172

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+L+D++  PKIGDFGLAKLFP+N+TH+STQ+AGT GYLAPEY L GQLT KADVYSFG
Sbjct  173  SNVLIDENLQPKIGDFGLAKLFPENVTHLSTQVAGTVGYLAPEYALFGQLTKKADVYSFG  232

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS   +G     L+E  W L +EG +L++VD E+  + + E+L+++KVA
Sbjct  233  VLLLEIISGRSSSKAAFGVDLLILVEWVWKLREEGRLLDIVDPELIEYSEAELLRFIKVA  292

Query  62   LLCTQASASRRPTMSQVIDM  3
            L CTQA+ ++RP M QVI+M
Sbjct  293  LFCTQAAPTQRPNMKQVIEM  312



>ref|XP_006451719.1| hypothetical protein CICLE_v10008583mg [Citrus clementina]
 gb|ESR64959.1| hypothetical protein CICLE_v10008583mg [Citrus clementina]
Length=388

 Score =   369 bits (948),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 230/317 (73%), Gaps = 3/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     RR R  +   +   +   + I  T  + Y +LR AT NF   NKIG+GGFG+
Sbjct  2    TCFHLF-FRRKRASSATHRVEVNKDVSEIQDTNLYGYKDLRVATENFSPANKIGQGGFGS  60

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKGTLK+G   A+K LSA S+QG+REFLTEI  + + +H NLVEL GCCV  ++RILVY
Sbjct  61   VYKGTLKDGTLAAIKVLSADSRQGVREFLTEINVIKDIKHENLVELYGCCVEGDHRILVY  120

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G+   +++  W TR  IC+G A+GLA+LHEEV+PHIVHRDIKASNIL
Sbjct  121  GYLENNSLAQTLLGRGHSSIQFNWQTRRNICIGVAKGLAFLHEEVQPHIVHRDIKASNIL  180

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKLFP N+THIST++AGT GYLAPEY + GQLT KAD+YSFGVL+L
Sbjct  181  LDKDLTPKISDFGLAKLFPANLTHISTRVAGTEGYLAPEYAIRGQLTRKADIYSFGVLLL  240

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+VSGR +++     +++ LLE AW LY+ G ++ELVD+ +   +  EE  +Y+K+ALLC
Sbjct  241  EIVSGRCNTNRRLPYEEQYLLEMAWKLYERGKLVELVDASLNGDYSVEEAHRYLKIALLC  300

Query  53   TQASASRRPTMSQVIDM  3
            TQ    RRP+MS +++M
Sbjct  301  TQDMPKRRPSMSTLVNM  317



>ref|XP_006485660.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Citrus sinensis]
Length=388

 Score =   369 bits (947),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 230/317 (73%), Gaps = 3/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     RR R  +   +   +   + I  T  + Y +LR AT NF   NKIG+GGFG+
Sbjct  2    TCFHLF-FRRKRASSATHRVEVNEDVSEIQDTNLYGYKDLRVATENFSPANKIGQGGFGS  60

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKGTLK+G   A+K LSA S+QG+REFLTEI  + + +H NLVEL GCCV  ++RILVY
Sbjct  61   VYKGTLKDGTLAAIKVLSADSRQGVREFLTEINVIKDIKHENLVELYGCCVEGDHRILVY  120

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G+   +++  W TR  IC+G A+GLA+LHEEV+PHIVHRDIKASNIL
Sbjct  121  GYLENNSLAQTLLGRGHSSIQFNWQTRRNICIGVAKGLAFLHEEVQPHIVHRDIKASNIL  180

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKLFP N+THIST++AGT GYLAPEY + GQLT KAD+YSFGVL+L
Sbjct  181  LDKDLTPKISDFGLAKLFPANLTHISTRVAGTEGYLAPEYAIRGQLTRKADIYSFGVLLL  240

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+VSGR +++     +++ LLE AW LY+ G ++ELVD+ +   +  EE  +Y+K+ALLC
Sbjct  241  EIVSGRCNTNRRLPYEEQYLLEMAWKLYERGKLVELVDASLNGDYSVEEAHRYLKIALLC  300

Query  53   TQASASRRPTMSQVIDM  3
            TQ    RRP+MS +++M
Sbjct  301  TQDMPKRRPSMSTLVNM  317



>ref|XP_007206230.1| hypothetical protein PRUPE_ppa015440mg [Prunus persica]
 gb|EMJ07429.1| hypothetical protein PRUPE_ppa015440mg [Prunus persica]
Length=386

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 240/319 (75%), Gaps = 3/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG     R++ GN A   S  A   + +  R FSY+ LR+AT NF   ++IG GG
Sbjct  1    MVCGCFGGV-FNRSKEGN-ASGSSVQAQGITTSNVRLFSYNSLRSATRNFHPSSRIGGGG  58

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++G QVA+K LSA+SKQG  EFLTEI  +S+ RH NLVELIGCCV +N+RI
Sbjct  59   YGVVYRGVLRDGTQVAIKCLSAESKQGANEFLTEINVISSMRHPNLVELIGCCVEDNHRI  118

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W  RAAIC+GTA GLA+LHEE E HIVHRDIKAS
Sbjct  119  LVYEYLENNSLASSLLGSRSKYVFLDWPKRAAICLGTATGLAFLHEEAEQHIVHRDIKAS  178

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  179  NILLDANFHPKIGDFGLAKLFPDNVTHLSTRVAGTEGYLAPEYALLGQLTKKADVYSFGV  238

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            ++LE++SGRSSS   +G Q + L+E  W L +E  +LE+VD E+  + + EV++++KVAL
Sbjct  239  VLLEIISGRSSSKAAFGEQLQVLVEWTWKLREEKRLLEIVDPELTAYSEAEVMRFIKVAL  298

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ +A +RPTM QV++M
Sbjct  299  FCTQGAAQQRPTMKQVVEM  317



>gb|EAZ23941.1| hypothetical protein OsJ_07669 [Oryza sativa Japonica Group]
Length=369

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 221/283 (78%), Gaps = 4/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            FSY E+R ATNNF   NKIGRGGFGTVYKGT ++G   A K LSA+S+QGI EFLTEIE+
Sbjct  27   FSYREIRAATNNFDDGNKIGRGGFGTVYKGTFEDGTAFAAKVLSAESEQGINEFLTEIES  86

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGT  489
            ++ A+H+NLV L+GCCV   NRIL+YEY+EN SLD  L G + G   L W TR+ IC+G 
Sbjct  87   ITEAKHANLVRLLGCCVQRQNRILIYEYVENNSLDNALQGSAAGVTDLSWSTRSDICMGV  146

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A+GL+YLHEE EP IVHRDIKASN+LLD++Y PKIGDFG+AKLFPDN++H+ST++ GT G
Sbjct  147  AKGLSYLHEEHEPSIVHRDIKASNVLLDRNYIPKIGDFGIAKLFPDNVSHVSTRVIGTTG  206

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            Y+APEYV+ GQLT KADVYSFGVLILE++SGR  S     G    L+ +AW L+++G++L
Sbjct  207  YMAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGM--FLVRQAWMLHEQGSLL  264

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ++VD  ++  +P+EE LK++KVAL CTQA    RPTM QV+ +
Sbjct  265  DMVDPSMKGGYPEEEALKFIKVALACTQAKPCSRPTMRQVVKL  307



>ref|XP_010553099.1| PREDICTED: putative serine/threonine-protein kinase isoform X4 
[Tarenaya hassleriana]
Length=372

 Score =   368 bits (944),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/285 (64%), Positives = 227/285 (80%), Gaps = 1/285 (0%)
 Frame = -1

Query  854  TRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTE  675
             R FSY+ LR+AT +F   N+IG GG+G VY+G L++G QVAVK+LSA+SKQG REFLTE
Sbjct  21   VRVFSYNSLRSATADFHPSNRIGGGGYGVVYRGVLRDGTQVAVKSLSAESKQGTREFLTE  80

Query  674  IETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAIC  498
            I+ +SN  H NLVELIGCCV  N RILVYE+LE  SL  VL G +S  + L+W  RAAIC
Sbjct  81   IDMISNIHHPNLVELIGCCVEGNKRILVYEFLEKNSLSSVLLGSKSKYIPLDWSKRAAIC  140

Query  497  VGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAG  318
            +GTA GLA+LHEE EPHIVHRDIKASNILLD++++PKIGDFGLAKLFPDN+TH+ST++AG
Sbjct  141  LGTASGLAFLHEEAEPHIVHRDIKASNILLDREFSPKIGDFGLAKLFPDNVTHVSTRVAG  200

Query  317  TCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEG  138
            T GYLAPEY   GQLT KADVYSFGVL+LE++SG SSS   +G +   L+E AW L +EG
Sbjct  201  TVGYLAPEYARLGQLTKKADVYSFGVLVLEIISGCSSSKAAFGAEFLVLVEWAWKLREEG  260

Query  137  NMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             M EL+D E+   P+EEV++++KV L CTQA+A +RP M+QV++M
Sbjct  261  RMGELIDEEMSNCPEEEVIRFIKVGLFCTQAAAQKRPNMNQVVEM  305



>ref|XP_009123510.1| PREDICTED: LOW QUALITY PROTEIN: putative serine/threonine-protein 
kinase [Brassica rapa]
Length=390

 Score =   368 bits (945),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 243/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFG   + +    +L Q+E+ +   +++   R FSY+ LR+AT+NF   N+IG GG
Sbjct  1    MHFNCFGLLDMCKG-NDHLGQKEAEEICTDNV---RVFSYNSLRSATDNFHPTNRIGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG V++G L++G QVAVK+LSA+SKQG REFLTEI  +S   H NLV LIGCCV  NNRI
Sbjct  57   FGVVFRGVLRDGTQVAVKSLSAESKQGTREFLTEINLISIIHHPNLVNLIGCCVEGNNRI  116

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL  VL G +S  V L+W  RAAICVGTA GLA+LHEEVEP +VHRDIKAS
Sbjct  117  LVYEYLENNSLSSVLLGSRSKYVPLDWSKRAAICVGTASGLAFLHEEVEPPVVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD++++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  177  NVLLDRNFSPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LEV+SG SSS   +  +   L+E  W L ++G +LE VD  + +FP++EV++++KVAL
Sbjct  237  LVLEVISGGSSSRAAFTDEFLVLVEWVWKLREDGRLLECVDPYLNKFPQDEVIRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RP M QV++M
Sbjct  297  FCTQAAAQKRPNMKQVVEM  315



>ref|XP_002274657.1| PREDICTED: putative serine/threonine-protein kinase [Vitis vinifera]
 emb|CBI30401.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   368 bits (944),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 186/319 (58%), Positives = 242/319 (76%), Gaps = 5/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M   CFGA    + +  +L + E+ +   N++   R FSY+ LR+ATNNF   +++G GG
Sbjct  1    MGLNCFGAFEWCKGKK-SLREPEAEEIATNNV---RLFSYNSLRSATNNFHPSSRVGGGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VY+G L++G QVA+K LSA+SKQG +EFLTEI  +SN RH NLVELIGCC+  +NRI
Sbjct  57   FGVVYRGVLRDGTQVAIKCLSAESKQGTQEFLTEINMISNIRHPNLVELIGCCIEGSNRI  116

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN S+  ++ G  G  V L+W TR +IC+GTA GLAYLHEE EPHIVHRDIKAS
Sbjct  117  LVYEYLENNSIASIILGSKGKHVILDWPTRVSICMGTASGLAYLHEEAEPHIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            N+LLD  + PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  177  NVLLDGSFLPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS   +G +   L+E  W L +E  +LE+VD E+  +P++E+++++KVAL
Sbjct  237  LMLEIISGRSSSKAAFGEELLVLVEWTWKLKEEERLLEIVDPELTDYPEDEMMRFIKVAL  296

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA++ +RP M  V+DM
Sbjct  297  FCTQAASHQRPNMKLVVDM  315



>ref|XP_010553098.1| PREDICTED: putative serine/threonine-protein kinase isoform X3 
[Tarenaya hassleriana]
Length=376

 Score =   367 bits (943),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 182/285 (64%), Positives = 227/285 (80%), Gaps = 1/285 (0%)
 Frame = -1

Query  854  TRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTE  675
             R FSY+ LR+AT +F   N+IG GG+G VY+G L++G QVAVK+LSA+SKQG REFLTE
Sbjct  25   VRVFSYNSLRSATADFHPSNRIGGGGYGVVYRGVLRDGTQVAVKSLSAESKQGTREFLTE  84

Query  674  IETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAIC  498
            I+ +SN  H NLVELIGCCV  N RILVYE+LE  SL  VL G +S  + L+W  RAAIC
Sbjct  85   IDMISNIHHPNLVELIGCCVEGNKRILVYEFLEKNSLSSVLLGSKSKYIPLDWSKRAAIC  144

Query  497  VGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAG  318
            +GTA GLA+LHEE EPHIVHRDIKASNILLD++++PKIGDFGLAKLFPDN+TH+ST++AG
Sbjct  145  LGTASGLAFLHEEAEPHIVHRDIKASNILLDREFSPKIGDFGLAKLFPDNVTHVSTRVAG  204

Query  317  TCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEG  138
            T GYLAPEY   GQLT KADVYSFGVL+LE++SG SSS   +G +   L+E AW L +EG
Sbjct  205  TVGYLAPEYARLGQLTKKADVYSFGVLVLEIISGCSSSKAAFGAEFLVLVEWAWKLREEG  264

Query  137  NMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             M EL+D E+   P+EEV++++KV L CTQA+A +RP M+QV++M
Sbjct  265  RMGELIDEEMSNCPEEEVIRFIKVGLFCTQAAAQKRPNMNQVVEM  309



>gb|KDO48322.1| hypothetical protein CISIN_1g044232mg, partial [Citrus sinensis]
Length=415

 Score =   369 bits (947),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 228/310 (74%), Gaps = 2/310 (1%)
 Frame = -1

Query  926  VRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLK  747
            +RR R  +   +   +   + I  T  + Y +LR AT NF   NKIG+GGFG+VYKGTLK
Sbjct  35   LRRKRASSATHRVEVNEDVSEIQDTNLYGYKDLRVATENFSPANKIGQGGFGSVYKGTLK  94

Query  746  NGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRS  567
            +G   A+K LSA S+QG+REFLTEI  + + +H NLVEL GCCV  ++RILVY YLEN S
Sbjct  95   DGTLAAIKVLSADSRQGVREFLTEINVIKDIKHENLVELYGCCVEGDHRILVYGYLENNS  154

Query  566  LDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTP  390
            L + L G+   +++  W TR  IC+G A+GLA+LHEEV+PHIVHRDIKASNILLDKD TP
Sbjct  155  LAQTLLGRGHSSIQFNWQTRRNICIGVAKGLAFLHEEVQPHIVHRDIKASNILLDKDLTP  214

Query  389  KIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRS  210
            KI DFGLAKLFP N+THIST++AGT GYLAPEY + GQLT KAD+YSFGVL+LE+VSGR 
Sbjct  215  KISDFGLAKLFPANLTHISTRVAGTEGYLAPEYAIRGQLTRKADIYSFGVLLLEIVSGRC  274

Query  209  SSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASR  33
            +++     +++ LLE AW LY+ G ++ELVD+ +   +  EE  +Y+K+ALLCTQ    R
Sbjct  275  NTNRRLPYEEQYLLEMAWKLYERGKLVELVDASLNGDYSVEEAHRYLKIALLCTQDMPKR  334

Query  32   RPTMSQVIDM  3
            RP+MS +++M
Sbjct  335  RPSMSTLVNM  344



>gb|KDO47717.1| hypothetical protein CISIN_1g020720mg [Citrus sinensis]
Length=322

 Score =   365 bits (938),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 169/264 (64%), Positives = 212/264 (80%), Gaps = 1/264 (0%)
 Frame = -1

Query  791  IGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVH  612
            IG G FG VY+G+L++G Q+A+K LSA+SKQG +EFLTEI+ + N RH NLV+LIGCCV 
Sbjct  2    IGGGAFGVVYRGSLRDGTQIAIKCLSAESKQGTKEFLTEIDMIWNIRHPNLVQLIGCCVE  61

Query  611  ENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHR  435
            +NNRILVYEYLEN SL   L G +S  V L+W TRA IC+GTA GL++LHEE +P IVHR
Sbjct  62   DNNRILVYEYLENNSLANALLGSKSKYVSLDWPTRANICLGTASGLSFLHEEADPPIVHR  121

Query  434  DIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADV  255
            DIKASN+LLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADV
Sbjct  122  DIKASNVLLDGNFHPKIGDFGLAKLFPDNVTHVSTRVAGTMGYLAPEYALLGQLTKKADV  181

Query  254  YSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKY  75
            YSFGVL+LE++SGRSSS   +G     L+E  W L +EG +LE+VD E+ +FP++EV+++
Sbjct  182  YSFGVLLLEIISGRSSSKAAFGDDMLILVEWTWKLREEGRLLEIVDPELTQFPEKEVMRF  241

Query  74   MKVALLCTQASASRRPTMSQVIDM  3
            +KV L CTQA A  RPTM QV++M
Sbjct  242  IKVGLFCTQAGAHYRPTMKQVVEM  265



>ref|XP_010553092.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Tarenaya hassleriana]
 ref|XP_010553093.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Tarenaya hassleriana]
 ref|XP_010553094.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Tarenaya hassleriana]
Length=389

 Score =   367 bits (943),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/285 (64%), Positives = 227/285 (80%), Gaps = 1/285 (0%)
 Frame = -1

Query  854  TRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTE  675
             R FSY+ LR+AT +F   N+IG GG+G VY+G L++G QVAVK+LSA+SKQG REFLTE
Sbjct  38   VRVFSYNSLRSATADFHPSNRIGGGGYGVVYRGVLRDGTQVAVKSLSAESKQGTREFLTE  97

Query  674  IETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAIC  498
            I+ +SN  H NLVELIGCCV  N RILVYE+LE  SL  VL G +S  + L+W  RAAIC
Sbjct  98   IDMISNIHHPNLVELIGCCVEGNKRILVYEFLEKNSLSSVLLGSKSKYIPLDWSKRAAIC  157

Query  497  VGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAG  318
            +GTA GLA+LHEE EPHIVHRDIKASNILLD++++PKIGDFGLAKLFPDN+TH+ST++AG
Sbjct  158  LGTASGLAFLHEEAEPHIVHRDIKASNILLDREFSPKIGDFGLAKLFPDNVTHVSTRVAG  217

Query  317  TCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEG  138
            T GYLAPEY   GQLT KADVYSFGVL+LE++SG SSS   +G +   L+E AW L +EG
Sbjct  218  TVGYLAPEYARLGQLTKKADVYSFGVLVLEIISGCSSSKAAFGAEFLVLVEWAWKLREEG  277

Query  137  NMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             M EL+D E+   P+EEV++++KV L CTQA+A +RP M+QV++M
Sbjct  278  RMGELIDEEMSNCPEEEVIRFIKVGLFCTQAAAQKRPNMNQVVEM  322



>ref|XP_008243896.1| PREDICTED: putative serine/threonine-protein kinase [Prunus mume]
 ref|XP_008243900.1| PREDICTED: putative serine/threonine-protein kinase [Prunus mume]
Length=386

 Score =   367 bits (942),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 191/319 (60%), Positives = 239/319 (75%), Gaps = 3/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFG     R++ GN     S  A   + +  R FSY+ LR+AT NF   ++IG GG
Sbjct  1    MVCGCFGGV-FNRSKEGN-PSGSSVQAQGIATSNVRLFSYNSLRSATRNFHPSSRIGGGG  58

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++G QVA+K LSA+S+QG  EFLTEI  +S+ RH NLVELIGCCV +N+RI
Sbjct  59   YGVVYRGVLRDGTQVAIKCLSAESRQGANEFLTEINVISSMRHPNLVELIGCCVEDNHRI  118

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL   L G +S  V L+W  RAAIC+GTA GLA+LHEE E HIVHRDIKAS
Sbjct  119  LVYEYLENNSLASSLLGSRSNYVFLDWPKRAAICLGTATGLAFLHEEAEQHIVHRDIKAS  178

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDNITH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  179  NILLDANFHPKIGDFGLAKLFPDNITHLSTRVAGTEGYLAPEYALLGQLTKKADVYSFGV  238

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            ++LE++SGRSSS   +G Q   L+E  WNL +E  +LE+VD E+  + + EV++++KVAL
Sbjct  239  VLLEIISGRSSSKAAFGEQLLVLVEWTWNLREEERLLEIVDPELTAYSEAEVMRFIKVAL  298

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ +A +RPTM QV++M
Sbjct  299  FCTQGAAQQRPTMKQVVEM  317



>ref|XP_010650918.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
 ref|XP_010650919.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
 ref|XP_010650920.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Vitis vinifera]
Length=385

 Score =   366 bits (939),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 237/325 (73%), Gaps = 11/325 (3%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFD-AGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M+ + F    + + + G+  Q+E+ + AG N     R FSY+ LR+AT NF   N+IGRG
Sbjct  1    MNFSSFSVMKLCKMKNGDHHQKEAEEIAGKN----VRLFSYNALRSATRNFHPSNRIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VY+G L++G QVAVK+LS +SKQG REFLTEI+ +SN +H  LV LIGCCV   +R
Sbjct  57   GFGIVYRGVLRDGTQVAVKSLSVESKQGKREFLTEIDMISNIQHPCLVRLIGCCVGGGSR  116

Query  599  ILVYEYLENRSLDRVLF------GQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVH  438
            +LVYEYLEN+SL   L        +S    L+W  RAAIC  TA GLA+LHEE EP I+H
Sbjct  117  MLVYEYLENKSLSSALLTSAISGSKSKRSVLDWPKRAAICTSTAHGLAFLHEEAEPRIIH  176

Query  437  RDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKAD  258
            RDIKASNILLD D  P+IGDFGLAKLFP+N+THIST++AGT GY+APEY L+G+LT KAD
Sbjct  177  RDIKASNILLDGDLNPRIGDFGLAKLFPENVTHISTRVAGTMGYMAPEYALSGRLTEKAD  236

Query  257  VYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLK  78
            VYSFGVL+LE++SGRSSS   +G     L+E  W L ++ ++L++VD E+  +P++EV  
Sbjct  237  VYSFGVLMLEIISGRSSSKAAFGENLLVLVEWTWKLKEDNSLLDMVDPELVEYPEDEVSC  296

Query  77   YMKVALLCTQASASRRPTMSQVIDM  3
            ++KVALLC QA + +RPTM+QV+ M
Sbjct  297  FIKVALLCIQAVSWQRPTMTQVLQM  321



>dbj|BAD25347.1| receptor ser/thr protein kinase-like [Oryza sativa Japonica Group]
 dbj|BAD25902.1| receptor ser/thr protein kinase-like [Oryza sativa Japonica Group]
Length=447

 Score =   368 bits (944),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 221/283 (78%), Gaps = 4/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            FSY E+R ATNNF   NKIGRGGFGTVYKGT ++G   A K LSA+S+QGI EFLTEIE+
Sbjct  27   FSYREIRAATNNFDDGNKIGRGGFGTVYKGTFEDGTAFAAKVLSAESEQGINEFLTEIES  86

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGT  489
            ++ A+H+NLV L+GCCV   NRIL+YEY+EN SLD  L G + G   L W TR+ IC+G 
Sbjct  87   ITEAKHANLVRLLGCCVQRQNRILIYEYVENNSLDNALQGSAAGVTDLSWSTRSDICMGV  146

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A+GL+YLHEE EP IVHRDIKASN+LLD++Y PKIGDFG+AKLFPDN++H+ST++ GT G
Sbjct  147  AKGLSYLHEEHEPSIVHRDIKASNVLLDRNYIPKIGDFGIAKLFPDNVSHVSTRVIGTTG  206

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            Y+APEYV+ GQLT KADVYSFGVLILE++SGR  S     G    L+ +AW L+++G++L
Sbjct  207  YMAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGM--FLVRQAWMLHEQGSLL  264

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ++VD  ++  +P+EE LK++KVAL CTQA    RPTM QV+ +
Sbjct  265  DMVDPSMKGGYPEEEALKFIKVALACTQAKPCSRPTMRQVVKL  307



>ref|XP_010326139.1| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
Length=376

 Score =   363 bits (932),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 218/284 (77%), Gaps = 2/284 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY+ LR+AT +F   NKIG GGFG VYKG L++G  +A+K LSA+SKQG +EFLTEI
Sbjct  34   RLFSYNSLRSATGHFHPSNKIGGGGFGVVYKGVLRDGTCIAIKCLSAESKQGTKEFLTEI  93

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICV  495
              +SN +H NLV+LIGCCV   NR+L+YEYL+N SL   L G +G  V L W  R AIC+
Sbjct  94   NMISNTQHPNLVQLIGCCVESGNRMLIYEYLKNNSLASALLGSNGKRVALNWPQRVAICL  153

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            GTA GLA+LHEE  P IVHRDIKASNIL+D++  PKIGDFGLAKLFP+N+TH+ST++AGT
Sbjct  154  GTASGLAFLHEEASPTIVHRDIKASNILIDENLHPKIGDFGLAKLFPENVTHLSTRVAGT  213

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEYVL GQLT KADVYSFGV +LE++SGR SS   +G     L+E  W L +EG 
Sbjct  214  IGYLAPEYVLFGQLTKKADVYSFGV-VLEIISGRRSSKSAFGVDLLVLVEWVWKLREEGR  272

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +LE++D E+  +P+ E+L+++KVAL C Q++ ++RP M QVI+M
Sbjct  273  VLEIIDPELTEYPETELLRFIKVALFCIQSAPNQRPNMKQVIEM  316



>gb|EMT16836.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=368

 Score =   362 bits (930),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 170/270 (63%), Positives = 210/270 (78%), Gaps = 2/270 (1%)
 Frame = -1

Query  851  RNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEI  672
            R FSY +L++AT+ F + NK+GRGGFGTVYKGTL N + VAVK LSA+S+QGIREFLTEI
Sbjct  42   RLFSYAQLKSATDKFDRNNKVGRGGFGTVYKGTLPNKQDVAVKVLSAESRQGIREFLTEI  101

Query  671  ETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICV  495
            + +SN +H NLVELIGCCV  +NRILVYEYLEN SLDR L G  S      W  R++IC+
Sbjct  102  DVISNVKHPNLVELIGCCVEGDNRILVYEYLENSSLDRALLGSNSDPANFTWSVRSSICI  161

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G ARGLAYLHEE+   IVHRDIKASNIL+DK+Y PKIGDFGLAKLFPDNITHIST++AGT
Sbjct  162  GVARGLAYLHEEIPSPIVHRDIKASNILIDKNYVPKIGDFGLAKLFPDNITHISTRVAGT  221

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY   GQLT KAD+YSFGVL++E+VSG+ S S +     K LLE+ W LY+ G 
Sbjct  222  TGYLAPEYAWHGQLTKKADIYSFGVLVIEIVSGK-SGSRSLLADDKFLLEKTWELYEAGK  280

Query  134  MLELVDSEVERFPKEEVLKYMKVALLCTQA  45
            + ELVD ++  +P EE ++++KV  + ++ 
Sbjct  281  LKELVDPDLGDYPDEEAIRFIKVVKMLSKP  310



>ref|NP_001047537.1| Os02g0639100 [Oryza sativa Japonica Group]
 dbj|BAF09451.1| Os02g0639100 [Oryza sativa Japonica Group]
Length=480

 Score =   367 bits (941),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 173/283 (61%), Positives = 221/283 (78%), Gaps = 4/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            FSY E+R ATNNF   NKIGRGGFGTVYKGT ++G   A K LSA+S+QGI EFLTEIE+
Sbjct  27   FSYREIRAATNNFDDGNKIGRGGFGTVYKGTFEDGTAFAAKVLSAESEQGINEFLTEIES  86

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGT  489
            ++ A+H+NLV L+GCCV   NRIL+YEY+EN SLD  L G + G   L W TR+ IC+G 
Sbjct  87   ITEAKHANLVRLLGCCVQRQNRILIYEYVENNSLDNALQGSAAGVTDLSWSTRSDICMGV  146

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A+GL+YLHEE EP IVHRDIKASN+LLD++Y PKIGDFG+AKLFPDN++H+ST++ GT G
Sbjct  147  AKGLSYLHEEHEPSIVHRDIKASNVLLDRNYIPKIGDFGIAKLFPDNVSHVSTRVIGTTG  206

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            Y+APEYV+ GQLT KADVYSFGVLILE++SGR  S     G    L+ +AW L+++G++L
Sbjct  207  YMAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIRSGM--FLVRQAWMLHEQGSLL  264

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ++VD  ++  +P+EE LK++KVAL CTQA    RPTM QV+ +
Sbjct  265  DMVDPSMKGGYPEEEALKFIKVALACTQAKPCSRPTMRQVVKL  307



>ref|XP_008778927.1| PREDICTED: putative serine/threonine-protein kinase [Phoenix 
dactylifera]
 ref|XP_008778928.1| PREDICTED: putative serine/threonine-protein kinase [Phoenix 
dactylifera]
Length=279

 Score =   359 bits (921),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 204/266 (77%), Gaps = 6/266 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSI-ARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC CFG    ++        Q   D G  S   + R FSY EL++AT+NF   NKIGRG
Sbjct  1    MSCGCFGPLLSKKKH----PPQSQLDMGGLSFDKKVRCFSYIELKSATDNFHPSNKIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFGTVYKG L+NG  VA+K LSA+S+QG++EFLTEI+T++N RH NLVELIGCCV   NR
Sbjct  57   GFGTVYKGILRNGEAVAIKLLSAESRQGVKEFLTEIDTITNVRHPNLVELIGCCVEGINR  116

Query  599  ILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVYEY+EN SLD  L G  S   KL W TR+AIC+GTARGLAYLHEE+EPHIVHRDIKA
Sbjct  117  ILVYEYVENNSLDHALLGPNSDTAKLNWSTRSAICLGTARGLAYLHEELEPHIVHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD+D+ PKIGDFGLAKLFPDN+THIST++AGT GYLAPEY + GQLT KADVYSFG
Sbjct  177  SNILLDQDFAPKIGDFGLAKLFPDNVTHISTRVAGTTGYLAPEYAMHGQLTKKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLE  165
            VL+LE++SG SSS   W    K +LE
Sbjct  237  VLVLEIISGSSSSKTIWSDMGKYILE  262



>gb|KDP32521.1| hypothetical protein JCGZ_14724 [Jatropha curcas]
Length=438

 Score =   365 bits (936),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/327 (54%), Positives = 229/327 (70%), Gaps = 3/327 (1%)
 Frame = -1

Query  977  FFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQV  798
             F CINV   TCF  S  ++  +    +    D   +S+  T  ++Y ELR AT NF   
Sbjct  38   IFICINVPVMTCF-PSFFKKKGSPPTKRATEVDEVVSSVQNTNLYTYKELRIATENFNPA  96

Query  797  NKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCC  618
            NK+G GGFG+VYKG LK+G  VA+K LSA S+QG+REFLTEI+ +++  H NLV+L GCC
Sbjct  97   NKVGEGGFGSVYKGVLKDGSVVAIKVLSADSRQGLREFLTEIKLIADIEHENLVKLYGCC  156

Query  617  VHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIV  441
            V E++RILVY YL+N SL + L G    +++  W TR  IC+G A+GLA+LHEEV PHIV
Sbjct  157  VEEDHRILVYGYLKNNSLAQTLLGGGHSSIQFSWPTRCKICIGVAQGLAFLHEEVSPHIV  216

Query  440  HRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKA  261
            HRDIKASNILLD++   KI DFGLAKLFP N+THIST++AGT GYLAPEY + GQLT KA
Sbjct  217  HRDIKASNILLDENLMAKISDFGLAKLFPPNMTHISTRVAGTAGYLAPEYAIRGQLTRKA  276

Query  260  DVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEV  84
            D+YSFGVLILE+V GRS+++     +++ LLER W L+++G +  L+D  +   +  EE 
Sbjct  277  DLYSFGVLILEIVCGRSNTNRRLPPEEQYLLERVWELHEKGELATLIDPSLHGDYDTEEA  336

Query  83   LKYMKVALLCTQASASRRPTMSQVIDM  3
             KYMK+ LLCTQ     RPTMS V+ M
Sbjct  337  CKYMKIGLLCTQDIPKLRPTMSTVVKM  363



>ref|XP_004302654.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Fragaria vesca subsp. vesca]
Length=382

 Score =   362 bits (930),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 187/318 (59%), Positives = 232/318 (73%), Gaps = 3/318 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M  +CFG  +  +  T      ++     N++   R FSY+ LR+AT NF   NKIG GG
Sbjct  1    MVYSCFGLLNCCKEDTNLEPSSQAQGIPTNNV---RLFSYNSLRSATRNFHPSNKIGGGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VYKG L++  QVA+K LS+ S+QG+ EFLTEI T+S  RH NLVELIGCCV +N+RI
Sbjct  58   YGVVYKGVLRDDTQVAIKCLSSDSRQGVNEFLTEINTISRIRHPNLVELIGCCVEDNHRI  117

Query  596  LVYEYLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            LVYEYLEN SL   L G    V L+W  R  IC+GTA GLA+LH+E EPHIVHRDIKASN
Sbjct  118  LVYEYLENNSLASSLLGLRSHVSLDWPQRVVICLGTATGLAFLHDEAEPHIVHRDIKASN  177

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILL  +Y PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGVL
Sbjct  178  ILLGANYCPKIGDFGLAKLFPDNVTHLSTRVAGTVGYLAPEYALFGQLTKKADVYSFGVL  237

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALL  57
            +LEV+SGRSSS   +G Q   LLE  W L +E  +LE+VD E+  +P+ EVL+++KVAL 
Sbjct  238  LLEVISGRSSSKAAFGDQMLLLLEWTWKLREEERLLEIVDPELTAYPEAEVLRFIKVALF  297

Query  56   CTQASASRRPTMSQVIDM  3
            CTQ ++ +RP M QV++M
Sbjct  298  CTQEASQQRPGMKQVVEM  315



>gb|KHG11617.1| hypothetical protein F383_12148 [Gossypium arboreum]
Length=385

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 225/320 (70%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C  F  S   R +T +  Q    D   + I  T+ F Y EL+ AT NF   NKIG GG
Sbjct  1    MTCFSFLFS---RKKTFSAEQTIEIDEEVSGIQNTKLFPYKELKMATGNFHHSNKIGEGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKGT ++G   A+K L+A SKQG+REFLTEI  ++   H NLVEL GCCV  N+RI
Sbjct  58   FGVVYKGTFRDGTMGAIKVLAADSKQGVREFLTEINVIAEIEHENLVELCGCCVEGNHRI  117

Query  596  LVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G    +++  W  R  IC+G A+GLA+LHEEV+PHI+HRDIKAS
Sbjct  118  LVYGYLENNSLAQTLLGGGHSSMQFSWEARRNICIGVAKGLAFLHEEVQPHIIHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDK+  PKI DFGLAKLFPDN+THIST++AGT GYLAPEY + GQLT KAD+YSFGV
Sbjct  178  NILLDKNLNPKISDFGLAKLFPDNMTHISTRVAGTTGYLAPEYAIRGQLTRKADIYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            L+LE+VSGR +++      ++ LLERAWN Y+   ++EL+D+ +   + +EE  K++K+ 
Sbjct  238  LLLEIVSGRCNTNRRLPLSEQYLLERAWNKYESRELVELIDTSISGEYDEEEAQKFLKIG  297

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ     RP+MSQV+ M
Sbjct  298  LLCTQDIPKFRPSMSQVVKM  317



>ref|XP_007021689.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY13214.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=386

 Score =   361 bits (926),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 175/317 (55%), Positives = 223/317 (70%), Gaps = 2/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     R+    +  Q    D     I  T+ F+Y EL+ AT NF   NKIG GGFG 
Sbjct  2    TCFSFLFSRKKAAFSAEQTVEIDEEVAGIQNTKLFTYKELKMATGNFHYSNKIGEGGFGV  61

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKGT ++G   A+K LSA SKQG+REFLTEI  +++  H NLV+L GCCV  N+RILVY
Sbjct  62   VYKGTFRDGTVGAIKVLSADSKQGVREFLTEINVIADIEHENLVKLYGCCVEGNHRILVY  121

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G    +++  W  R  IC+G A+GLA+LHEEV PHIVHRDIKASNIL
Sbjct  122  GYLENNSLAQTLLGGGHSSMQFSWQARRNICIGVAKGLAFLHEEVRPHIVHRDIKASNIL  181

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDK+  PKI DFGLAKLFP+ +THIST++AGT GYLAPEY + GQLT KAD+YSFGVL+L
Sbjct  182  LDKNLMPKISDFGLAKLFPEYVTHISTRVAGTTGYLAPEYAIRGQLTRKADIYSFGVLLL  241

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+VSGR +++      ++ LLERAW +Y++G ++ELVD+ +   F  EE  +++K+ALLC
Sbjct  242  EIVSGRCNTNRRLPLSEQYLLERAWEMYEQGQLVELVDTSLNGDFNDEEAQRFLKIALLC  301

Query  53   TQASASRRPTMSQVIDM  3
            TQ     RPTMS+V+ M
Sbjct  302  TQDMPKLRPTMSEVVKM  318



>ref|XP_007149257.1| hypothetical protein PHAVU_005G055000g [Phaseolus vulgaris]
 gb|ESW21251.1| hypothetical protein PHAVU_005G055000g [Phaseolus vulgaris]
Length=383

 Score =   360 bits (925),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 168/291 (58%), Positives = 215/291 (74%), Gaps = 1/291 (0%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I   + +S+ ELR AT +F Q NKIG GGFG+VYKG LK+G+  A+K L+A S+QG+
Sbjct  22   DEGIDNVKLYSHKELRNATEDFSQANKIGEGGFGSVYKGRLKDGKVAAIKVLAADSRQGV  81

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGA-VKLEWH  516
            +EFLTEI  +S   H NLV+L GC V +N RILVY YLEN SL + L G S + +  +W 
Sbjct  82   KEFLTEINVISEIEHENLVKLYGCSVDKNKRILVYNYLENNSLSQTLLGGSHSRIFFDWR  141

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
            TR  I +G ARGLAYLHEEV PHIVHRDIKASNILLDKD TPKI DFGLAKL P N+TH+
Sbjct  142  TRCKISIGIARGLAYLHEEVRPHIVHRDIKASNILLDKDLTPKISDFGLAKLIPANMTHV  201

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++AGT GYLAPEY + G+LT KADVYSFGVL++E+VSGRS+++     +++ LLER W
Sbjct  202  STRVAGTIGYLAPEYAIGGKLTRKADVYSFGVLLVEIVSGRSNTNSRLPIEEQFLLERTW  261

Query  155  NLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             LY+   ++ LVD+ ++ F  E+  ++MK+ LLCTQ S   RP+MS V+ M
Sbjct  262  ELYERKELVGLVDTSLDEFDAEQACEFMKIGLLCTQESPKLRPSMSSVVKM  312



>ref|XP_007021692.1| Kinase superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY13217.1| Kinase superfamily protein isoform 4 [Theobroma cacao]
Length=383

 Score =   360 bits (924),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 176/317 (56%), Positives = 224/317 (71%), Gaps = 5/317 (2%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     R+    +  Q    D G   I  T+ F+Y EL+ AT NF   NKIG GGFG 
Sbjct  2    TCFSFLFSRKKAAFSAEQTVEIDEG---IQNTKLFTYKELKMATGNFHYSNKIGEGGFGV  58

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKGT ++G   A+K LSA SKQG+REFLTEI  +++  H NLV+L GCCV  N+RILVY
Sbjct  59   VYKGTFRDGTVGAIKVLSADSKQGVREFLTEINVIADIEHENLVKLYGCCVEGNHRILVY  118

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G    +++  W  R  IC+G A+GLA+LHEEV PHIVHRDIKASNIL
Sbjct  119  GYLENNSLAQTLLGGGHSSMQFSWQARRNICIGVAKGLAFLHEEVRPHIVHRDIKASNIL  178

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDK+  PKI DFGLAKLFP+ +THIST++AGT GYLAPEY + GQLT KAD+YSFGVL+L
Sbjct  179  LDKNLMPKISDFGLAKLFPEYVTHISTRVAGTTGYLAPEYAIRGQLTRKADIYSFGVLLL  238

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+VSGR +++      ++ LLERAW +Y++G ++ELVD+ +   F  EE  +++K+ALLC
Sbjct  239  EIVSGRCNTNRRLPLSEQYLLERAWEMYEQGQLVELVDTSLNGDFNDEEAQRFLKIALLC  298

Query  53   TQASASRRPTMSQVIDM  3
            TQ     RPTMS+V+ M
Sbjct  299  TQDMPKLRPTMSEVVKM  315



>ref|XP_009619738.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 [Nicotiana tomentosiformis]
Length=444

 Score =   362 bits (929),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 236/337 (70%), Gaps = 20/337 (6%)
 Frame = -1

Query  974  FCCINVMS-----CTCFG------ASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDEL  828
            F C++  S      TCFG      AS    N T         D   ++I   R + Y EL
Sbjct  47   FLCVDSNSKSGVKMTCFGLCLRGIASPTHNNLT-------EIDEEISTIENARVYHYKEL  99

Query  827  RTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARH  648
            + AT +F  VNKIG+GGFG+VYKG LK+GR  A+K LS +SKQG++EFLTEI+ +SN  H
Sbjct  100  QAATEDFCPVNKIGKGGFGSVYKGRLKDGRLAAIKVLSVESKQGVKEFLTEIKVISNIEH  159

Query  647  SNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAY  471
             NLV+L GCC   ++RILVY YLEN SL + L G +  +++  W TR  IC+G ARGLA+
Sbjct  160  ENLVKLYGCCAEGDHRILVYGYLENNSLAQTLLGGAHSSLQFSWKTRTKICIGVARGLAF  219

Query  470  LHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEY  291
            LHEEV+P+IVHRDIKASNILLD+D TPKI DFGLAKL P ++TH+ST++AGT GYLAPEY
Sbjct  220  LHEEVQPYIVHRDIKASNILLDRDLTPKISDFGLAKLIPADMTHVSTRVAGTLGYLAPEY  279

Query  290  VLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSE  111
             + GQLT KADVYSFG+L+LE+VSGR +++     +Q+ LLERAW LY +G ++ELVD+ 
Sbjct  280  AIRGQLTRKADVYSFGILLLEIVSGRCNTNKRLPIEQQYLLERAWKLYKKGELIELVDTS  339

Query  110  V-ERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + + F  +E  +++KV+LLCTQ     RP+MS V+ +
Sbjct  340  LGDDFNVDEACRFLKVSLLCTQVMPKSRPSMSTVVKL  376



>ref|XP_004488850.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X1 [Cicer arietinum]
 ref|XP_004488851.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X2 [Cicer arietinum]
 ref|XP_004488852.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like isoform X3 [Cicer arietinum]
Length=387

 Score =   359 bits (922),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 223/320 (70%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C  F  S    +   N    E      + I   R +SY ELR AT+NF   NKIG GG
Sbjct  1    MTCFPFLFSKTSSSSRQNPDNDEDI----SGIHNVRIYSYRELRNATDNFSPANKIGEGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKG LK+G+  A+K LSA+SKQG++EFLTEI  +S   H NLV+L GCCV ++NRI
Sbjct  57   FGPVYKGQLKDGKLAAIKVLSAESKQGVKEFLTEINVISEIEHENLVKLYGCCVEKDNRI  116

Query  596  LVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G S  ++  +W  R  ICVG ARGLA+LHEEV P IVHRDIKAS
Sbjct  117  LVYNYLENNSLAQTLLGGSHNSIHFDWRARCKICVGVARGLAFLHEEVRPLIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + G+LT KAD+YSFGV
Sbjct  177  NILLDKDLTPKISDFGLAKLIPANVTHVSTRVAGTLGYLAPEYAIGGRLTRKADIYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            L++E+VSGR +++      ++ +LERAW LY++  ++ LVD+ +   F  E+  K++K+ 
Sbjct  237  LLVEIVSGRCNTNSRLPSNEQFILERAWALYEQNELVGLVDTSLNWEFYAEQACKFLKIG  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ S   RP+MS V+ M
Sbjct  297  LLCTQESPKHRPSMSSVVKM  316



>ref|XP_010558369.1| PREDICTED: putative serine/threonine-protein kinase isoform X3 
[Tarenaya hassleriana]
Length=324

 Score =   357 bits (915),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/256 (64%), Positives = 208/256 (81%), Gaps = 1/256 (0%)
 Frame = -1

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            ++ G L++G QVAVK+LSA+S+QG +EFLTEI T+SN  H NLVELIGCCV  NNRILVY
Sbjct  3    LFTGVLRDGTQVAVKSLSAESRQGTQEFLTEINTISNIHHPNLVELIGCCVEGNNRILVY  62

Query  587  EYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
            E+LE  SL  VL G +S  V+L+W  RA IC+GTA GLA+LHEE EPHIVHRDIKASNIL
Sbjct  63   EFLERNSLSSVLLGSKSKYVQLDWSKRAEICLGTALGLAFLHEEAEPHIVHRDIKASNIL  122

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LD+D++PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGVL+L
Sbjct  123  LDRDFSPKIGDFGLAKLFPDNVTHVSTRVAGTFGYLAPEYALLGQLTKKADVYSFGVLVL  182

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCT  51
            E++SG SS    +G     L+E AW L +EG ++EL+D E+ ++P+EEV++++KVA  CT
Sbjct  183  EIISGCSSGKAAFGDGFSVLVEWAWKLREEGRLVELIDPELTQYPEEEVIRFIKVAFFCT  242

Query  50   QASASRRPTMSQVIDM  3
            QA+A +RP M QV++M
Sbjct  243  QAAAQKRPNMKQVVEM  258



>gb|EEC73672.1| hypothetical protein OsI_08219 [Oryza sativa Indica Group]
Length=369

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/283 (60%), Positives = 218/283 (77%), Gaps = 4/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            FSY E+R AT+NF   NKIGRGGFGTVYKGT ++G   A K LSA+S+QGI EFLTEIE+
Sbjct  27   FSYREIRAATSNFDDGNKIGRGGFGTVYKGTFEDGTAFAAKVLSAESEQGINEFLTEIES  86

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGT  489
            ++ A+H+NLV L+GCCV    RIL+YEY+EN SLD  L G + G   L W TR+ IC+G 
Sbjct  87   ITEAKHANLVRLLGCCVQRQKRILIYEYVENNSLDNALQGSAAGVTDLSWSTRSDICMGV  146

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A+GL+YLHEE EP IVHRDIKASN+LLD++Y PKIGDFG+AKLFPDN++H+ST++ GT G
Sbjct  147  AKGLSYLHEEHEPSIVHRDIKASNVLLDRNYIPKIGDFGVAKLFPDNVSHVSTRVIGTTG  206

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            Y+APEYV+ GQLT KADVYSFGVLILE++SGR  S          L+ +AW L+++ ++L
Sbjct  207  YMAPEYVVHGQLTKKADVYSFGVLILEIISGRRMSQTIR--SDMFLVRQAWVLHEQDSLL  264

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ++VD  ++  +P+EE LK++KVAL CTQA    RPTM QV+ +
Sbjct  265  DMVDPSMKGGYPEEEALKFIKVALACTQAKPCSRPTMRQVVKL  307



>ref|XP_006598182.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440-like [Glycine max]
Length=383

 Score =   358 bits (920),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 214/292 (73%), Gaps = 2/292 (1%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I   + +SY +LR AT  F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG+
Sbjct  22   DEGIHNVKLYSYKQLRNATEKFSPANKIGEGGFGSVYKGRLKDGKVAAIKVLSAESRQGV  81

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWH  516
            +EFLTEI  +S   H NLV+L GCCV +NNRILVY YLEN SL + L G    ++  +W 
Sbjct  82   KEFLTEINVISEIEHENLVKLYGCCVEKNNRILVYNYLENNSLSQTLLGGGHNSLYFDWG  141

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
            TR  IC+G ARGLAYLHEEV PHIVHRDIKASNILLDKD TPKI DFGLAKL P N+TH+
Sbjct  142  TRCKICIGVARGLAYLHEEVRPHIVHRDIKASNILLDKDLTPKISDFGLAKLIPANMTHV  201

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++AGT GYLAPEY + G+LT KAD+YSFGVL+ E++SGR + +     +++ LLER W
Sbjct  202  STRVAGTLGYLAPEYAIGGKLTRKADIYSFGVLLAEIISGRCNINSRLPIEEQFLLERTW  261

Query  155  NLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +LY+   ++ELVD  +   F  E+  K++K++LLCTQ S   RP+MS V+ M
Sbjct  262  DLYERKELVELVDISLNGEFDAEQACKFLKISLLCTQESPKLRPSMSSVVKM  313



>gb|KHN26796.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=378

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 168/292 (58%), Positives = 215/292 (74%), Gaps = 2/292 (1%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I   + +SY ELR AT +F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG+
Sbjct  23   DEGIHNVKLYSYKELRNATEDFSPANKIGEGGFGSVYKGRLKDGKVAAIKVLSAESRQGV  82

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWH  516
            +EFLTEI  +S  +H NLV+L GCCV +NNRILVY YLEN SL + L G    ++  +W 
Sbjct  83   KEFLTEINVISEIQHENLVKLYGCCVEKNNRILVYNYLENNSLSQTLLGGGHSSLYFDWR  142

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
            TR  IC+G ARGLAYLHEEV PHIVHRDIKASNILLDKD TPKI DFGLAKL P N+TH+
Sbjct  143  TRCKICIGVARGLAYLHEEVRPHIVHRDIKASNILLDKDLTPKISDFGLAKLIPANMTHV  202

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++AGT GYLAPEY + G+LT KAD+YSFGVL+ E++SGR +++     +++ LLER W
Sbjct  203  STRVAGTIGYLAPEYAIGGKLTRKADIYSFGVLLGEIISGRCNTNSRLPIEEQFLLERTW  262

Query  155  NLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +LY+   ++ LVD  +   F  E+  K++K+ LLCTQ S   RP+MS V+ M
Sbjct  263  DLYERKELVGLVDMSLNGEFDAEQACKFLKIGLLCTQESPKHRPSMSSVVKM  314



>ref|XP_006647582.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53420-like [Oryza brachyantha]
Length=333

 Score =   357 bits (915),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 167/290 (58%), Positives = 222/290 (77%), Gaps = 4/290 (1%)
 Frame = -1

Query  866  SIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIRE  687
            S+   + FSY E++ ATNNF   N +GRGGFGTVYKGT ++G   A K LS +S+QGI+E
Sbjct  20   SLKNVQLFSYREIKVATNNFDHGNMLGRGGFGTVYKGTFQDGTAFAAKVLSVESEQGIKE  79

Query  686  FLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTR  510
            FLTEIE+++ A+H+NLV L+GCCV    +IL+YEY+EN SLD  L G + G   L W TR
Sbjct  80   FLTEIESITEAKHANLVSLLGCCVQRQKKILIYEYVENNSLDHALQGSAAGVTDLSWSTR  139

Query  509  AAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHIST  330
            + IC+G A+GL+YLHEE EP IVHRDIKASN+LLD++Y+PKIGDFG+AKLFPDN+TH+ST
Sbjct  140  SDICMGIAKGLSYLHEEHEPSIVHRDIKASNVLLDRNYSPKIGDFGVAKLFPDNVTHVST  199

Query  329  QIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNL  150
            ++ GT GYLAPEYV+ GQLT KADVYSFGVL+LE++SGR  S          L+ +AW L
Sbjct  200  RVVGTTGYLAPEYVVHGQLTKKADVYSFGVLVLEIISGRRISQTIR--SDMFLVRQAWVL  257

Query  149  YDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +++  +L++VD+ ++  +P+EE LK++KVAL CTQA+   RPTM QV+ +
Sbjct  258  HEQRRLLDMVDANMKGGYPEEEALKFIKVALACTQATPCSRPTMQQVVRL  307



>ref|XP_009784604.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
Length=395

 Score =   359 bits (921),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 230/317 (73%), Gaps = 3/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF +   R++R+    Q   FD   + +     FSY ELR AT++F  VNKIG GGFG+
Sbjct  2    TCFPSLFCRKHRSST-RQPSEFDDELSGVKNVTLFSYKELRIATDDFSPVNKIGEGGFGS  60

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG L++G+  A+K LS++SKQG++EFLTEI+ +S+  H NLV+L GCC+ +++RIL+Y
Sbjct  61   VYKGRLRSGKMAAIKVLSSESKQGVKEFLTEIKVISDVEHGNLVKLYGCCIEDDHRILIY  120

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G    +++  W TR  IC+G A+GLAYLHE+V+PHI+HRDIKASNIL
Sbjct  121  NYLENNSLAQTLLGGGHSSIQFSWRTRTKICIGVAKGLAYLHEQVKPHIIHRDIKASNIL  180

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQ T K+DVYS+GVL++
Sbjct  181  LDKDLTPKISDFGLAKLIPPNMTHVSTRVAGTIGYLAPEYAIRGQATRKSDVYSYGVLLI  240

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+V+GR +++      ++ LLER W LY+   ++ LVD+ ++  F  E+  +++K+ LLC
Sbjct  241  EIVTGRCNTNTRLPIDEQYLLERTWQLYERKELILLVDTSLDGDFDAEQACRFLKIGLLC  300

Query  53   TQASASRRPTMSQVIDM  3
            TQ +   RP+MS ++ M
Sbjct  301  TQDALKLRPSMSTILKM  317



>emb|CDP06496.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   358 bits (919),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 229/326 (70%), Gaps = 14/326 (4%)
 Frame = -1

Query  977  FFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQV  798
            F  C      TC   S  +R R             + + +  R FSY+ LR+AT +F   
Sbjct  3    FSSCFGAFGSTCKETSKTQRPR-------------ELATSNVRLFSYNSLRSATGHFHPS  49

Query  797  NKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCC  618
            N+IG GGFG VY+G L++G QVA+K LSA SKQG  EFLTEI  +SN RH NLV+LIGC 
Sbjct  50   NRIGGGGFGVVYRGVLRDGTQVAIKCLSADSKQGTTEFLTEINMISNIRHPNLVQLIGCG  109

Query  617  VHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIV  441
            +  + RILVYEY+EN SL   L   +   ++++W  RA IC GTA GLA+LHEE +P IV
Sbjct  110  IEGSYRILVYEYMENNSLASSLLSSKVKRLEMDWSKRANICRGTASGLAFLHEEADPSIV  169

Query  440  HRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKA  261
            HRDIKASN+LLD++  PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQL+ KA
Sbjct  170  HRDIKASNVLLDENLHPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLSKKA  229

Query  260  DVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVL  81
            DVYSFGVL+LE+VSGRSSS   +G     L+E  W L +EG +LE+VD E+  +P+EEV+
Sbjct  230  DVYSFGVLVLELVSGRSSSKAAFGEDLLVLVEWTWKLREEGRILEIVDPELGEYPEEEVI  289

Query  80   KYMKVALLCTQASASRRPTMSQVIDM  3
            ++++VAL CTQA+A +RP M QV+ M
Sbjct  290  RFIQVALFCTQAAAHQRPGMKQVLKM  315



>gb|KFK43871.1| hypothetical protein AALP_AA1G184900 [Arabis alpina]
Length=403

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 170/293 (58%), Positives = 221/293 (75%), Gaps = 6/293 (2%)
 Frame = -1

Query  866  SIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIRE  687
            +I   + + Y E+R AT++F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG+RE
Sbjct  35   AIDNVKIYKYREIRQATDDFSGDNKIGEGGFGSVYKGRLKDGKLAAIKVLSAESRQGVRE  94

Query  686  FLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEW  519
            FLTEI  +S  +H NLV+L GCCV  N+RILVY YLEN SLD+ L    + +SG ++ +W
Sbjct  95   FLTEINVISEIQHENLVKLYGCCVEGNHRILVYNYLENNSLDKTLLAGGYSRSG-IQFDW  153

Query  518  HTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITH  339
             TRA ICVG A+GLA+LHEEV PH++HRDIKASNILLDKD +PKI DFGLA+L P N+TH
Sbjct  154  STRANICVGVAKGLAFLHEEVRPHVIHRDIKASNILLDKDLSPKISDFGLARLMPANMTH  213

Query  338  ISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERA  159
            +ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERA
Sbjct  214  VSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERA  273

Query  158  WNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            W LY+   +++LVDS +   F  EE  KY+K+ LLCTQ S   RPTMS V+ +
Sbjct  274  WELYERNELVDLVDSGLNGVFDAEEACKYLKIGLLCTQDSPKLRPTMSTVVRL  326



>ref|XP_010537769.1| PREDICTED: putative serine/threonine-protein kinase [Tarenaya 
hassleriana]
Length=396

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 175/306 (57%), Positives = 227/306 (74%), Gaps = 9/306 (3%)
 Frame = -1

Query  896  QQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAV  726
            ++E     D  IA  +N   ++Y EL+ AT++FG  NKIG GGFG+VYKG L++G+  A+
Sbjct  10   KREDIAEVDGEIAGLQNVKVYTYKELQHATDDFGAENKIGEGGFGSVYKGRLRDGKIAAI  69

Query  725  KALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL--  552
            K LSA+S+QG REFLTEI  +S  +H NLV+L GCCV  N+RILVY +LEN SLD+ L  
Sbjct  70   KVLSAESRQGAREFLTEITVISEIQHENLVKLYGCCVEGNHRILVYNFLENNSLDKTLLA  129

Query  551  --FGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGD  378
              + QSG ++ +W TRA IC+G A+GLA+LHEEV+P+IVHRDIKASNILLDKD +PKI D
Sbjct  130  GGYSQSG-IQFDWRTRARICIGIAKGLAFLHEEVQPYIVHRDIKASNILLDKDLSPKISD  188

Query  377  FGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSM  198
            FGLA+L P N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVL+LE+VSGRS+ + 
Sbjct  189  FGLARLIPSNMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGVLLLEIVSGRSNKNS  248

Query  197  NWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTM  21
                + + LLERAW LY+   ++ LVDS +   F  EE  ++MKV LLCTQ S   RP+M
Sbjct  249  RLPTEYQYLLERAWELYERNELVFLVDSALNGDFDAEEACRFMKVGLLCTQDSPKLRPSM  308

Query  20   SQVIDM  3
            S VI +
Sbjct  309  SSVIKL  314



>ref|XP_004244262.1| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
Length=385

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/322 (54%), Positives = 233/322 (72%), Gaps = 13/322 (4%)
 Frame = -1

Query  947  TCFG-----ASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGR  783
            TCFG      +S R N    + ++ S      +I   R +SY ELR AT +F  VNKIG+
Sbjct  2    TCFGLCLGGKASPRHNHVVEIDEEIS------TIENARVYSYRELRAATEDFCPVNKIGK  55

Query  782  GGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENN  603
            GGFG+VYKG L++G+  A+K LS +SKQG++EFLTEI+ +SN  H NLV+L GCC   ++
Sbjct  56   GGFGSVYKGRLRDGKMAAIKVLSVESKQGVKEFLTEIKVISNIEHENLVKLYGCCAEGDH  115

Query  602  RILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIK  426
            RILVY YLEN SL + L G +  +++  W TR  IC+G ARGLA+LHEEV+P+IVHRDIK
Sbjct  116  RILVYNYLENNSLSQTLLGGAHSSLQFSWITRTKICIGVARGLAFLHEEVQPYIVHRDIK  175

Query  425  ASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSF  246
            ASNILLDKD TPKI DFGLAKL P ++TH+ST++AGT GYLAPEY + GQLT KADVYSF
Sbjct  176  ASNILLDKDLTPKISDFGLAKLIPADLTHVSTRVAGTLGYLAPEYAMRGQLTRKADVYSF  235

Query  245  GVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMK  69
            G+L+LE+VSGR +++     +++ LLERAW L+ +G +++LVD+ + + F   +  K++K
Sbjct  236  GILLLEIVSGRCNTNKRLPIEEQYLLERAWRLFKKGELIQLVDALLGDDFDVVDACKFLK  295

Query  68   VALLCTQASASRRPTMSQVIDM  3
            V+LLCTQ     RP+MS V+ +
Sbjct  296  VSLLCTQVMPKSRPSMSTVVKL  317



>ref|XP_009766561.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
 ref|XP_009766562.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
 ref|XP_009766563.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
 ref|XP_009766564.1| PREDICTED: putative serine/threonine-protein kinase [Nicotiana 
sylvestris]
Length=385

 Score =   358 bits (918),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 172/316 (54%), Positives = 230/316 (73%), Gaps = 3/316 (1%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTV  765
            CFG   +R N +         D   ++I   R + Y EL+ AT +F  VNKIG+GGFG+V
Sbjct  3    CFGFC-LRGNASPTHNHLTEIDEEISTIENARVYHYKELQAATEDFCPVNKIGKGGFGSV  61

Query  764  YKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYE  585
            YKG LK+G+  A+K LS +SKQG+REFLTEI+ +S+  H NLV+L GCC   ++RILVY 
Sbjct  62   YKGRLKDGKLAAIKVLSVESKQGVREFLTEIKVISSIEHENLVKLYGCCAEGDHRILVYG  121

Query  584  YLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILL  408
            YLEN SL + L G +  +++  W TR  IC+G ARGLA+LHEEV+P+IVHRDIKASNILL
Sbjct  122  YLENNSLAQTLLGGAHSSLQFSWKTRTKICIGVARGLAFLHEEVQPYIVHRDIKASNILL  181

Query  407  DKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILE  228
            D+D TPKI DFGLAKL P ++TH+ST++AGT GYLAPEY + GQLT KADVYSFG+L+LE
Sbjct  182  DRDLTPKISDFGLAKLIPADMTHVSTRVAGTLGYLAPEYAIRGQLTRKADVYSFGILLLE  241

Query  227  VVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLCT  51
            +VSGR +++     +Q+ LLERAW LY +G ++ELVD+ + + F  +E  +++KV+LLCT
Sbjct  242  IVSGRCNTNKRLPIEQQYLLERAWKLYKKGELIELVDTSLGDDFNVDEACRFLKVSLLCT  301

Query  50   QASASRRPTMSQVIDM  3
            Q     RP+MS V+ +
Sbjct  302  QVMPKSRPSMSTVVRL  317



>ref|XP_011097664.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Sesamum indicum]
 ref|XP_011097665.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Sesamum indicum]
Length=392

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/283 (58%), Positives = 217/283 (77%), Gaps = 2/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            +SY ELR AT++F  VNKIG GGFG+V+KG L+NG+  A+K LS++S+QG+REFLTEI+ 
Sbjct  34   YSYKELRIATDDFSPVNKIGEGGFGSVFKGKLRNGQMAAIKVLSSESRQGVREFLTEIQV  93

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGT  489
            +S+  H NLV+L GCCV  N+RILVY YLEN SL + L G + G ++  W TRA IC+G 
Sbjct  94   ISDIEHENLVKLYGCCVEGNHRILVYNYLENNSLAQTLLGGRHGNLEFGWRTRAKICIGV  153

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A+GLAYLHEEV PHIVHRDIKASNILLD+D TPKI DFGLAKL P N+TH+ST++AGT G
Sbjct  154  AKGLAYLHEEVRPHIVHRDIKASNILLDQDMTPKISDFGLAKLIPPNMTHVSTRVAGTIG  213

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            YLAPEY + GQLT +ADVYSFGVL++E+VSGRS+++      ++ +LER W L++   ++
Sbjct  214  YLAPEYAIKGQLTRRADVYSFGVLLIEIVSGRSNTNTRLPVDEQYILERTWKLFERKELV  273

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             LVD+ +   F  E+  +++K+ LLCTQ S   RP+MS V+ M
Sbjct  274  ALVDTSLNGDFDAEQACRFLKIGLLCTQDSPKLRPSMSNVVRM  316



>ref|XP_006348290.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Solanum tuberosum]
 ref|XP_006348291.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Solanum tuberosum]
Length=385

 Score =   357 bits (917),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 172/322 (53%), Positives = 233/322 (72%), Gaps = 13/322 (4%)
 Frame = -1

Query  947  TCFG-----ASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGR  783
            TCFG      +S   NR   + ++ S      +I   R +SY ELR AT +F  VNKIG+
Sbjct  2    TCFGLCLGGKASPPHNRVVEIDEEIS------TIENARVYSYRELRAATEDFCPVNKIGK  55

Query  782  GGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENN  603
            GGFG+VYKG L++G+  A+K LS +SKQG++EFLTEI+ +SN  H NLV+L GCC   ++
Sbjct  56   GGFGSVYKGRLRDGKMAAIKVLSVESKQGVKEFLTEIKVISNIEHENLVKLYGCCAEGDH  115

Query  602  RILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIK  426
            RILVY YLEN SL + L G +  +++  W TR  IC+G ARGLA+LHEE +P+IVHRDIK
Sbjct  116  RILVYNYLENNSLSQTLLGGAHSSLQFSWITRTKICIGVARGLAFLHEEAQPYIVHRDIK  175

Query  425  ASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSF  246
            ASNILLDKD TPKI DFGLAKL P ++TH+ST++AGT GYLAPEY + GQLT KADVYSF
Sbjct  176  ASNILLDKDLTPKISDFGLAKLIPADLTHVSTRVAGTLGYLAPEYAMRGQLTRKADVYSF  235

Query  245  GVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMK  69
            G+L+LE+VSGR +++     +++ LLERAW L+ +G +++LVD+ + + F  ++  K++K
Sbjct  236  GILLLEIVSGRCNTNKRLPIEEQYLLERAWRLFKKGELIQLVDALLGDDFDVDDACKFLK  295

Query  68   VALLCTQASASRRPTMSQVIDM  3
            V+LLCTQ     RP+MS V+ +
Sbjct  296  VSLLCTQVMPKSRPSMSTVVKL  317



>ref|XP_006441015.1| hypothetical protein CICLE_v10020517mg [Citrus clementina]
 gb|ESR54255.1| hypothetical protein CICLE_v10020517mg [Citrus clementina]
Length=391

 Score =   358 bits (918),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 226/318 (71%), Gaps = 6/318 (2%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTV  765
            CF     RR+   N   +   D   + I   + +SY EL  AT++F  +NKIG GGFG+V
Sbjct  3    CFSFLFRRRDSPRNRVPE--VDEEFSGIHNVKLYSYKELSIATDDFSPINKIGEGGFGSV  60

Query  764  YKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYE  585
            YKG LK+G+  A+K LSA+S+QG++EFLTEI+ +S   H NLV+L GCCV  N+RILVY 
Sbjct  61   YKGRLKDGKIAAIKVLSAESRQGVKEFLTEIQVISEIEHENLVKLYGCCVEGNHRILVYN  120

Query  584  YLENRSLDRVLFG---QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
            YLEN SL + L G       ++  W TR+ IC+G ARGLA+LHEEV PHI+HRDIKASNI
Sbjct  121  YLENNSLAQTLIGGGHHYSNIQFSWRTRSRICIGIARGLAFLHEEVRPHIIHRDIKASNI  180

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LLDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQ+T KAD+YSFGVL+
Sbjct  181  LLDKDLTPKISDFGLAKLIPANMTHVSTRVAGTIGYLAPEYAIRGQVTRKADIYSFGVLL  240

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALL  57
            +E+VSGR +++M    +++ LLER W+LY+   ++ LVD+ +   F  EE  +++KV LL
Sbjct  241  VEIVSGRCNTNMRLPAEEQYLLERTWDLYERRELILLVDTSLNGDFDAEEACRFLKVGLL  300

Query  56   CTQASASRRPTMSQVIDM  3
            CTQ +   RP+MS V+ M
Sbjct  301  CTQDTPKLRPSMSTVVQM  318



>gb|KHN27752.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=392

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 214/292 (73%), Gaps = 2/292 (1%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I   + ++Y +LR AT  F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG+
Sbjct  31   DEGIHNVKLYAYKQLRNATEKFSPANKIGEGGFGSVYKGRLKDGKVAAIKVLSAESRQGV  90

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWH  516
            +EFLTEI  +S   H NLV+L GCCV +NNRILVY YLEN SL + L G    ++  +W 
Sbjct  91   KEFLTEINVISEIEHENLVKLYGCCVEKNNRILVYNYLENNSLSQTLLGGGHNSLYFDWG  150

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
            TR  IC+G ARGLAYLHEEV PHIVHRDIKASNILLDKD TPKI DFGLAKL P N+TH+
Sbjct  151  TRCKICIGVARGLAYLHEEVRPHIVHRDIKASNILLDKDLTPKISDFGLAKLIPANMTHV  210

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++AGT GYLAPEY + G+LT KAD+YSFGVL+ E++SGR + +     +++ LLER W
Sbjct  211  STRVAGTLGYLAPEYAIGGKLTRKADIYSFGVLLAEIISGRCNINSRLPIEEQFLLERTW  270

Query  155  NLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +LY+   ++ELVD  +   F  E+  K++K++LLCTQ S   RP+MS V+ M
Sbjct  271  DLYERKELVELVDISLNGEFDAEQACKFLKISLLCTQESPKLRPSMSSVVKM  322



>gb|KDO53434.1| hypothetical protein CISIN_1g016347mg [Citrus sinensis]
Length=391

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 226/318 (71%), Gaps = 6/318 (2%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTV  765
            CF     RR+   N   +   D   + I   + +SY EL  AT++F  +NKIG GGFG+V
Sbjct  3    CFSFLFRRRDSPRNRVPE--VDEEFSGIHNVKLYSYKELSIATDDFSPINKIGEGGFGSV  60

Query  764  YKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYE  585
            YKG LK+G+  A+K LSA+S+QG++EFLTEI+ +S   H NLV+L GCCV  N+RILVY 
Sbjct  61   YKGRLKDGKIAAIKVLSAESRQGVKEFLTEIQVISEIEHENLVKLYGCCVEGNHRILVYN  120

Query  584  YLENRSLDRVLFG---QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
            YLEN SL + L G       ++  W TR+ IC+G ARGLA+LHEEV PHI+HRDIKASNI
Sbjct  121  YLENNSLAQTLIGGGHHYSNIQFSWRTRSRICIGIARGLAFLHEEVRPHIIHRDIKASNI  180

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LLDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQ+T KAD+YSFGVL+
Sbjct  181  LLDKDLTPKISDFGLAKLIPANMTHVSTRVAGTIGYLAPEYAIRGQVTRKADIYSFGVLL  240

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALL  57
            +E+VSGR +++M    +++ LLER W+LY+   ++ LVD+ +   F  EE  +++KV LL
Sbjct  241  VEIVSGRCNTNMRLPTEEQYLLERTWDLYERRELILLVDTSLNGDFDAEEACRFLKVGLL  300

Query  56   CTQASASRRPTMSQVIDM  3
            CTQ +   RP+MS V+ M
Sbjct  301  CTQDTPKLRPSMSTVVQM  318



>ref|XP_006416794.1| hypothetical protein EUTSA_v10007825mg [Eutrema salsugineum]
 gb|ESQ35147.1| hypothetical protein EUTSA_v10007825mg [Eutrema salsugineum]
Length=396

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/293 (58%), Positives = 221/293 (75%), Gaps = 6/293 (2%)
 Frame = -1

Query  866  SIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIRE  687
            +I   + + Y E+R AT++F  +NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG+RE
Sbjct  24   AIDNVKIYKYKEIRQATDDFNSLNKIGEGGFGSVYKGNLKDGKIAAIKVLSAESRQGVRE  83

Query  686  FLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEW  519
            FLTEI  +S  +H NLV+L GCCV  N+RILVY YLEN SLD+ L    + +SG +  +W
Sbjct  84   FLTEINVISEIQHDNLVKLYGCCVEGNHRILVYNYLENNSLDKTLLAGGYTRSG-ILFDW  142

Query  518  HTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITH  339
             TRA ICVG A+GLA+LHEEV PHI+HRDIKASNILLDKD +PKI DFGLA+L P N+TH
Sbjct  143  STRANICVGIAKGLAFLHEEVRPHIIHRDIKASNILLDKDLSPKISDFGLARLMPPNMTH  202

Query  338  ISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERA  159
            +ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERA
Sbjct  203  VSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERA  262

Query  158  WNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            W L++   +++LVDS +   F  EE  +Y+K+ LLCTQ S   RPTMS V+ +
Sbjct  263  WELFERNELVDLVDSGLNGVFDAEEACRYLKIGLLCTQDSPKLRPTMSTVVRL  315



>ref|XP_008451823.1| PREDICTED: putative serine/threonine-protein kinase [Cucumis 
melo]
 ref|XP_008451824.1| PREDICTED: putative serine/threonine-protein kinase [Cucumis 
melo]
Length=398

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 229/320 (72%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C  F  S   +  T +L  +E F    +S+   + ++Y EL+ AT +F   NKIG GG
Sbjct  1    MTCFPFLFSKRVKPPTRSLVDEEDF----SSMQNVKFYTYKELKVATEDFSLANKIGEGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG+REFLTEI  +S   H NLV+L GCCV +N+RI
Sbjct  57   FGSVYKGKLKDGKIAAIKVLSAESRQGLREFLTEINVISEIEHENLVQLYGCCVDDNHRI  116

Query  596  LVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G+   ++   W TR+ IC+G ARGLA+LHE+V+PHI+HRDIKAS
Sbjct  117  LVYNYLENNSLAQTLLGRGYSSILFNWRTRSKICIGIARGLAFLHEDVQPHIIHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD D +PKI DFGLAKL P ++TH+ST++AGT GYLAPEY + GQ+T K+D+YSFGV
Sbjct  177  NILLDHDLSPKISDFGLAKLIPASMTHVSTRVAGTIGYLAPEYAIRGQVTRKSDIYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            L++E+VSGR +++      ++ LLER WNLY+ G ++ LVD+ +   F  E   KY+K+ 
Sbjct  237  LLVEIVSGRWNTNTQLPIGEQYLLERTWNLYERGELVLLVDTSLNGDFDAEVACKYLKIG  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ S   RP+MS V+ M
Sbjct  297  LLCTQDSPKLRPSMSTVVKM  316



>ref|XP_004147755.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Cucumis sativus]
Length=397

 Score =   357 bits (916),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 169/320 (53%), Positives = 230/320 (72%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C  F  S   +  T +   +E F    +S+   + ++Y EL+ AT +F   NKIG GG
Sbjct  1    MTCFPFLFSKRVKGPTRSSVDEEDF----SSMQNVKFYTYKELKVATEDFSLANKIGEGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG+REFLTEI  +S   H NLV+L GCCV +N+RI
Sbjct  57   FGSVYKGKLKDGKLAAIKVLSAESRQGLREFLTEINVISKIEHENLVQLYGCCVDDNHRI  116

Query  596  LVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G+   +++  W TR+ IC+G ARGLA+LHE+V+PHI+HRDIKAS
Sbjct  117  LVYNYLENNSLAQTLLGRGYSSIQFNWRTRSKICIGIARGLAFLHEDVQPHIIHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD D +PKI DFGLAKL P ++TH+ST++AGT GYLAPEY + GQ+T K+D+YSFGV
Sbjct  177  NILLDHDLSPKISDFGLAKLIPASMTHVSTRVAGTIGYLAPEYAIRGQVTRKSDIYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            L++E+VSGR +++      ++ LLER WNLY++G ++ LVD+ +   F  E   KY+K+ 
Sbjct  237  LLVEIVSGRWNTNTQLPIGEQYLLERTWNLYEQGELVLLVDTSLNGDFDAEMACKYLKIG  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ S   RP+MS V+ M
Sbjct  297  LLCTQDSPKLRPSMSTVVKM  316



>gb|AES66260.2| receptor-like kinase [Medicago truncatula]
Length=381

 Score =   356 bits (914),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 213/292 (73%), Gaps = 2/292 (1%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I   + ++Y EL  AT+NF   NKIG GGFG+VY G LKNG+  A+K LSA+SKQG+
Sbjct  22   DEGIHNVKIYTYKELSNATDNFSLANKIGEGGFGSVYMGRLKNGKLAAIKVLSAESKQGV  81

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWH  516
            +EFLTEI  +S   H NLV+L GCCV +NNRILVY YLEN SL + L G    ++  +W 
Sbjct  82   KEFLTEINVISEVEHENLVKLYGCCVEKNNRILVYNYLENNSLSQTLLGGGHSSIYFDWR  141

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
            TR  ICVG ARGLA+LHEEV P I+HRDIKASNILLDKD TPKI DFGLAKL P N TH+
Sbjct  142  TRCRICVGIARGLAFLHEEVRPPIIHRDIKASNILLDKDLTPKISDFGLAKLMPANATHV  201

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++AGT GYLAPEY + G+LT KAD+YSFGVL++E+VSGR +++     +++ +LER W
Sbjct  202  STRVAGTLGYLAPEYAIGGRLTRKADIYSFGVLLVEIVSGRRNTNSRLPTEEQFILERTW  261

Query  155  NLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             LY+   ++ L+D+ +   F  E+  K++K+ LLCTQ S  RRP+MS V+ M
Sbjct  262  ELYERKELVGLIDTSLNGEFDAEQACKFLKIGLLCTQESPKRRPSMSSVVKM  313



>emb|CDX81773.1| BnaC08g38280D [Brassica napus]
Length=395

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/290 (58%), Positives = 220/290 (76%), Gaps = 6/290 (2%)
 Frame = -1

Query  857  RTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLT  678
            + + + Y E+R AT++F  +NKIG GGFG VYKG L++G+  A+K LSA+S+QG+REFLT
Sbjct  27   KVKIYKYKEIRQATDDFSPINKIGEGGFGPVYKGCLRDGKVAAIKVLSAESRQGVREFLT  86

Query  677  EIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEWHTR  510
            EI  +S  +H NLV+L GCCV  N+RILVY YLEN SLD+ L    + QSG +K +W TR
Sbjct  87   EINVISEIQHGNLVKLYGCCVEGNHRILVYNYLENNSLDKTLLVGGYTQSG-IKFDWSTR  145

Query  509  AAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHIST  330
            A IC+G A+GL++LHEEV PHIVHRDIKASNILLD+D +PKI DFGLA+L P N+TH+ST
Sbjct  146  ANICIGVAKGLSFLHEEVTPHIVHRDIKASNILLDRDLSPKISDFGLARLMPPNMTHVST  205

Query  329  QIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNL  150
            ++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERAW L
Sbjct  206  RVAGTLGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYEYLLERAWKL  265

Query  149  YDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            Y+   +++LVD+ ++  F  EE  +Y+KV LLCTQ S   RP MS V+ +
Sbjct  266  YERNELVDLVDTGLDGLFDVEEACRYLKVGLLCTQDSPKLRPKMSTVVKL  315



>ref|XP_003596008.1| Protein kinase catalytic domain-containing protein [Medicago 
truncatula]
 gb|AES66259.1| receptor-like kinase [Medicago truncatula]
Length=390

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 223/319 (70%), Gaps = 6/319 (2%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF  S  +   +    Q    D   +SI   + +++ ELR AT+NF   NKIG GGFG+
Sbjct  2    TCFPFSFSKTPSSSR--QHPDNDEDISSIHDVKIYTFKELRNATDNFSPANKIGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VY G LK G+  A+K LSA+S+QG++EFLTEI  +S   H NLV+L GCCV +NNRILVY
Sbjct  60   VYMGRLKGGKLAAIKVLSAESRQGVKEFLTEINVISAVEHENLVKLYGCCVEKNNRILVY  119

Query  587  EYLENRSLDRVLFG---QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
             YLEN SL R L G    S ++  +W TR  IC+G ARGLA+LHEEV P I+HRDIKASN
Sbjct  120  NYLENNSLSRTLLGGGHNSDSIYFDWRTRCRICIGVARGLAFLHEEVRPPIIHRDIKASN  179

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKD TPKI DFGLAKL P N TH+ST++AGT GYLAPEY + G+LT KAD+YSFGVL
Sbjct  180  ILLDKDLTPKISDFGLAKLIPANATHVSTRVAGTLGYLAPEYAIGGRLTRKADIYSFGVL  239

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVAL  60
            ++E+VSGR +++     +++ +LER W+LY+   ++ LVD+ +   F  E+  K++K+ L
Sbjct  240  LVEIVSGRCNTNSRLPIEEQFILERTWDLYERKELVGLVDTSLNGEFDAEQACKFLKIGL  299

Query  59   LCTQASASRRPTMSQVIDM  3
            LCTQ S   RP+MS V+ M
Sbjct  300  LCTQESPKSRPSMSTVVKM  318



>ref|XP_009117750.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
 ref|XP_009117751.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
 emb|CDY50993.1| BnaA09g56220D [Brassica napus]
Length=390

 Score =   357 bits (915),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/290 (58%), Positives = 221/290 (76%), Gaps = 6/290 (2%)
 Frame = -1

Query  857  RTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLT  678
            + + + Y E+R AT++F  +NKIG GGFG+VYKG L++G+  A+K LSA+S+QG+REFLT
Sbjct  27   KVKIYKYKEIRQATDDFNPINKIGEGGFGSVYKGCLRDGKVAAIKVLSAESRQGVREFLT  86

Query  677  EIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEWHTR  510
            EI  +S  +H NLV+L GCCV  N+RILVY YLEN SLD+ L    + QSG +K +W TR
Sbjct  87   EINVISEIQHENLVKLYGCCVEGNHRILVYNYLENNSLDKTLLVGGYTQSG-IKFDWSTR  145

Query  509  AAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHIST  330
            A IC+G A+GL++LHEEV PHIVHRDIKASNILLD+D +PKI DFGLA+L P N+TH+ST
Sbjct  146  ANICIGVAKGLSFLHEEVTPHIVHRDIKASNILLDRDLSPKISDFGLARLMPPNMTHVST  205

Query  329  QIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNL  150
            ++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERAW L
Sbjct  206  RVAGTLGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYEYLLERAWKL  265

Query  149  YDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            Y+   +++LVD+ ++  F  EE  +Y+KV LLCTQ S   RP MS V+ +
Sbjct  266  YERNELVDLVDTGLDGLFDVEEACRYLKVGLLCTQDSPKLRPKMSTVVKL  315



>ref|XP_010650921.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Vitis vinifera]
Length=380

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 235/320 (73%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFD-AGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            M+ + F    + + + G+  Q+E+ + AG N     R FSY+ LR+AT NF   N+IGRG
Sbjct  1    MNFSSFSVMKLCKMKNGDHHQKEAEEIAGKN----VRLFSYNALRSATRNFHPSNRIGRG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG VY+G L++G QVAVK+LS +SKQG REFLTEI+ +SN +H  LV LIGCCV   +R
Sbjct  57   GFGIVYRGVLRDGTQVAVKSLSVESKQGKREFLTEIDMISNIQHPCLVRLIGCCVGGGSR  116

Query  599  ILVYEYLENRSLDRVLFGQSGAVK-LEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            +LVYEYLEN+SL   L         L+W  RAAIC  TA GLA+LHEE EP I+HRDIKA
Sbjct  117  MLVYEYLENKSLSSALLSSKSKRSVLDWPKRAAICTSTAHGLAFLHEEAEPRIIHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLD D  P+IGDFGLAKLFP+N+THIST++AGT GY+APEY L+G+LT KADVYSFG
Sbjct  177  SNILLDGDLNPRIGDFGLAKLFPENVTHISTRVAGTMGYMAPEYALSGRLTEKADVYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVA  63
            VL+LE++SGRSSS   +G     L+E  W L ++ ++L++VD E+  +P++EV  ++KVA
Sbjct  237  VLMLEIISGRSSSKAAFGENLLVLVEWTWKLKEDNSLLDMVDPELVEYPEDEVSCFIKVA  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLC QA + +RPTM+QV+ M
Sbjct  297  LLCIQAVSWQRPTMTQVLQM  316



>gb|EYU33758.1| hypothetical protein MIMGU_mgv1a007949mg [Erythranthe guttata]
Length=390

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/317 (53%), Positives = 223/317 (70%), Gaps = 5/317 (2%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            +CF  S  RR   G       FD   + I R   FSY ELR ATN+F   NKIG GGFG+
Sbjct  3    SCFPCSRSRRLDPG--THDPEFDDELSEI-RINLFSYKELRKATNDFSPANKIGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            V+KG L+NG   A+K LS++S+QG++EFLTEI+ +S+ +H NLV+L GCC   N+RIL+Y
Sbjct  60   VFKGKLRNGPMAAIKVLSSESRQGVKEFLTEIQVISDIKHENLVKLYGCCAEGNHRILIY  119

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL   L G S  ++   W TR  IC+G A+GLA+LHEEV PHI+HRDIKASNIL
Sbjct  120  NYLENNSLAESLIGGSRKSIHFNWKTRVKICIGVAKGLAFLHEEVTPHIIHRDIKASNIL  179

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LD+D  PKI DFGLAKL P  +TH+ST++AGT GYLAPEY + GQLT +AD+YSFGVL++
Sbjct  180  LDEDLNPKISDFGLAKLIPSTVTHVSTRVAGTIGYLAPEYAIRGQLTRRADIYSFGVLLI  239

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+VSGR +++      ++ +LERAW LY++  ++ LVD+ ++  F   E  +++K+ LLC
Sbjct  240  EIVSGRCNTNRKLPVDEQFILERAWKLYEKNELVALVDTSLDGEFDPVEACRFLKIGLLC  299

Query  53   TQASASRRPTMSQVIDM  3
            TQ S   RPTMS V+ M
Sbjct  300  TQDSPKLRPTMSNVVQM  316



>dbj|BAK04486.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 180/322 (56%), Positives = 224/322 (70%), Gaps = 38/322 (12%)
 Frame = -1

Query  863  IARTRN---FSYDELRTATNNFGQVNKIGRGGFGTVYK----------------------  759
            + RT N   FSY E+R ATNNF   NK+GRGGFGTVYK                      
Sbjct  18   LLRTTNIHLFSYKEIRRATNNFDHGNKLGRGGFGTVYKVLVLLLPLGACSVKLGKIEQWR  77

Query  758  -----GTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRIL  594
                 GT  +G   A K LS +S+QGI+EFLTEIE++S A+H+NLV L+GCCV + NRIL
Sbjct  78   RVYMQGTFGDGTAFAAKVLSCESEQGIKEFLTEIESISEAKHANLVSLLGCCVQKQNRIL  137

Query  593  VYEYLENRSLD---RVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            VYEY EN SLD   + L   SGA  L W  R+ IC+GTA+GL+YLHEE EP+IVHRDIKA
Sbjct  138  VYEYAENNSLDHALKALGSASGATILPWSVRSGICMGTAKGLSYLHEEHEPNIVHRDIKA  197

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SN+LL + Y+PKIGDFGLAKLFPDN+TH++T++ GT GYLAPEYV+ GQLT KADVYSFG
Sbjct  198  SNVLLGRGYSPKIGDFGLAKLFPDNVTHVTTRVVGTTGYLAPEYVVHGQLTKKADVYSFG  257

Query  242  VLILEVVSGRSSSSMNWGGQQKALLER--AWNLYDEGNMLELVDSEVERFPKEEVLKYMK  69
            VL+LE++SGR  S      +    L R  AW LY++G  L++VD+ V+ +P+ EVL+Y+K
Sbjct  258  VLVLEIISGRRVSETI---RSDTFLVRQVAWLLYEQGKPLDMVDARVKDYPEAEVLRYIK  314

Query  68   VALLCTQASASRRPTMSQVIDM  3
            V L CTQA+ S RPTM QV+ M
Sbjct  315  VGLACTQAAPSGRPTMQQVVKM  336



>ref|XP_007026740.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY07242.1| Kinase superfamily protein isoform 3 [Theobroma cacao]
Length=325

 Score =   353 bits (907),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 207/254 (81%), Gaps = 1/254 (0%)
 Frame = -1

Query  761  KGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEY  582
            KG L++G QVA+K LSA+SKQG+REF+TEI+ +SN RH NLVELIGCCV +N+RILVYEY
Sbjct  7    KGVLRDGTQVAIKTLSAESKQGLREFVTEIDMISNIRHPNLVELIGCCVDDNHRILVYEY  66

Query  581  LENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLD  405
            LEN SL  VL G +S  + L+W  RAAIC+GTA GLA+LH E  PHIVHRDIKASNILLD
Sbjct  67   LENNSLASVLLGSRSKYIALDWPKRAAICLGTASGLAFLHYEAVPHIVHRDIKASNILLD  126

Query  404  KDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEV  225
             ++ PKIGDFGLAKLFP+N+TH+ST++AGT GYLAPEY L GQLT KADVYSFGVL+LE+
Sbjct  127  GNFQPKIGDFGLAKLFPENVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGVLVLEL  186

Query  224  VSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQA  45
            +SGRSSS   +G +   L+E  W L +E  +L++VD E+  +P+ EV++++KVAL CTQA
Sbjct  187  ISGRSSSKAAFGVELMLLVEWTWKLKEEERLLDIVDPELTNYPQGEVMRFIKVALFCTQA  246

Query  44   SASRRPTMSQVIDM  3
            +A +RPTM QV++M
Sbjct  247  TAHQRPTMKQVVEM  260



>emb|CDY35110.1| BnaA06g11200D [Brassica napus]
Length=396

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 230/323 (71%), Gaps = 14/323 (4%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+ F       +R G     E  D G  SI   + + Y E+R AT++F   NKIG GG
Sbjct  1    MGCSWF-------SRRGG-GPSEVDDGGIASIQNVKIYKYKEIRQATDDFNPHNKIGEGG  52

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI  +S  +H NLV+L GCCV  N+RI
Sbjct  53   FGSVYKGHLKDGKIAAIKVLSAESRQGVKEFLTEINVISEIQHENLVKLYGCCVEGNHRI  112

Query  596  LVYEYLENRSLDRVL----FGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            L+Y YLEN SLD+ L    + +SG ++ +W TRA IC+G A+GLA+LHEEV PHI+HRDI
Sbjct  113  LIYNYLENNSLDKTLLAGGYTRSG-IQFDWRTRAKICIGVAKGLAFLHEEVRPHIIHRDI  171

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLD+D +PKI DFGLA+L P N+TH+ST++AGT GYLAPEY + GQLT KAD+YS
Sbjct  172  KASNILLDRDLSPKISDFGLARLMPPNMTHVSTRVAGTIGYLAPEYAVRGQLTRKADIYS  231

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYM  72
            FGVL++E+VS RS+ +     + + LLERAW LY+   +++LVD+ +   F  EE  +Y+
Sbjct  232  FGVLLMEIVSARSNKNTRLPTEYQYLLERAWELYERNELVDLVDAGLNGVFDAEEACRYL  291

Query  71   KVALLCTQASASRRPTMSQVIDM  3
            K+ LLCTQ S   RPTMS V+ +
Sbjct  292  KIGLLCTQDSPKLRPTMSTVVKL  314



>ref|XP_009407704.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407705.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
 ref|XP_009407706.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Musa acuminata subsp. 
malaccensis]
Length=395

 Score =   356 bits (913),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/289 (58%), Positives = 215/289 (74%), Gaps = 2/289 (1%)
 Frame = -1

Query  863  IARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREF  684
            I   + +SY+ELR AT +F   NKIG GGFG VYKG LK+G  VA+K LSA+SKQG+REF
Sbjct  28   IENVKIYSYNELRHATEDFSLGNKIGEGGFGYVYKGKLKDGSIVAIKVLSAESKQGVREF  87

Query  683  LTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRA  507
            L E++ +S   H NLV++ GCCV ++ RILVY Y+EN SL + L G+  + ++  W  RA
Sbjct  88   LNELKAISTIAHENLVKIYGCCVEQDQRILVYNYVENNSLAQTLLGKGYSNIQFTWRIRA  147

Query  506  AICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQ  327
             IC+G ARGLA+LHEEV+PHI+HRDIKASN+LLDKD TPKI DFGLA+L P N+THIST+
Sbjct  148  KICIGVARGLAFLHEEVQPHIIHRDIKASNVLLDKDLTPKISDFGLARLLPSNMTHISTR  207

Query  326  IAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLY  147
            +AGT GYLAPEY L GQLT +AD+YSFGVL+LE+VSGRS+ +     + + LLER W LY
Sbjct  208  VAGTVGYLAPEYALRGQLTRRADIYSFGVLLLEIVSGRSNVNTRLPYEDQLLLERTWALY  267

Query  146  DEGNMLELVDSEV-ERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            + G + ++VD+ + + F  EE  KY+KV LLCTQ +   RP MS V+ M
Sbjct  268  ERGELEQIVDTSLNDDFDAEEACKYLKVGLLCTQDNPKLRPAMSAVVMM  316



>ref|XP_006478006.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like [Citrus sinensis]
Length=391

 Score =   355 bits (912),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 171/318 (54%), Positives = 226/318 (71%), Gaps = 6/318 (2%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTV  765
            CF  S + R R     +    D   + I   + +SY EL  AT++F  +NKIG GGFG+V
Sbjct  3    CF--SFLFRRRGSPRNRLPEVDEEFSGIHNVKLYSYKELSIATDDFSPINKIGEGGFGSV  60

Query  764  YKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYE  585
            YKG LK+G+  A+K LSA+S+QG++EFLTEI+ +S   H NLV+L GCCV  N+RILVY 
Sbjct  61   YKGRLKDGKIAAIKVLSAESRQGVKEFLTEIQVISEIEHENLVKLYGCCVEGNHRILVYN  120

Query  584  YLENRSLDRVLFG---QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
            YLEN SL + L G       ++  W TR+ IC+G ARGLA+LHEEV PHI+HRDIKASNI
Sbjct  121  YLENNSLAQTLIGGGHHYSNIQFSWRTRSRICIGIARGLAFLHEEVRPHIIHRDIKASNI  180

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LLDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQ+T KAD+YSFGVL+
Sbjct  181  LLDKDLTPKISDFGLAKLIPANMTHVSTRVAGTIGYLAPEYAIRGQVTRKADIYSFGVLL  240

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALL  57
            +E+VSGR +++M    +++ LLER W+LY+   ++ LVD+ +   F  EE  +++KV LL
Sbjct  241  VEIVSGRCNTNMRLPTEEQYLLERTWDLYERRELILLVDTSLNGDFDAEEACRFLKVGLL  300

Query  56   CTQASASRRPTMSQVIDM  3
            CTQ +   RP+MS V+ M
Sbjct  301  CTQDTPKLRPSMSTVVQM  318



>gb|AFK44150.1| unknown [Medicago truncatula]
Length=390

 Score =   355 bits (912),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 223/319 (70%), Gaps = 6/319 (2%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF  S  +   +    Q    D   +SI   + +++ ELR AT+NF   NKIG GGFG+
Sbjct  2    TCFPFSFSKTPSSSR--QHPDNDEDISSIHDVKIYTFKELRNATDNFSPANKIGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VY G LK G+  A+K LSA+S+QG++EFLTEI  +S   H NLV+L GCCV +NNRILVY
Sbjct  60   VYMGRLKGGKLAAIKVLSAESRQGVKEFLTEINVISTVEHENLVKLYGCCVEKNNRILVY  119

Query  587  EYLENRSLDRVLFG---QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
             YLEN SL R L G    S ++  +W TR  IC+G ARGLA+LHEEV P I+HRDIKASN
Sbjct  120  NYLENNSLSRTLLGGGHNSDSIYFDWRTRCRICIGVARGLAFLHEEVRPPIIHRDIKASN  179

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            ILLDKD TPKI DFGLAKL P + TH+ST++AGT GYLAPEY + G+LT KAD+YSFGVL
Sbjct  180  ILLDKDLTPKISDFGLAKLIPADATHVSTRVAGTLGYLAPEYAIGGRLTRKADIYSFGVL  239

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVAL  60
            ++E+VSGR +++     +++ +LER W+LY+   ++ LVD+ +   F  E+  K++K+ L
Sbjct  240  LVEIVSGRCNTNSRLPIEEQFILERTWDLYERKELVGLVDTSLNGEFDAEQACKFLKIGL  299

Query  59   LCTQASASRRPTMSQVIDM  3
            LCTQ S   RP+MS V+ M
Sbjct  300  LCTQESPKSRPSMSTVVKM  318



>ref|XP_009149104.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
Length=396

 Score =   355 bits (912),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 230/323 (71%), Gaps = 14/323 (4%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+ F       +R G     E  D G  SI   + + Y E+R AT++F   NKIG GG
Sbjct  1    MGCSWF-------SRRGG-GPSEVDDGGIASIQNVKIYKYKEIRQATDDFNPHNKIGEGG  52

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI  +S  +H NLV+L GCCV  N+RI
Sbjct  53   FGSVYKGHLKDGKIAAIKVLSAESRQGVKEFLTEINVISEIQHENLVKLYGCCVEGNHRI  112

Query  596  LVYEYLENRSLDRVL----FGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            L+Y YLEN SLD+ L    + +SG ++ +W TRA IC+G A+GLA+LHEEV PHI+HRDI
Sbjct  113  LIYNYLENNSLDKTLLAGGYTRSG-IQFDWRTRAKICIGVAKGLAFLHEEVRPHIIHRDI  171

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLD+D +PKI DFGLA+L P N+TH+ST++AGT GYLAPEY + GQLT KAD+YS
Sbjct  172  KASNILLDRDLSPKISDFGLARLMPPNMTHVSTRVAGTIGYLAPEYAVRGQLTRKADIYS  231

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYM  72
            FGVL++E+VS RS+ +     + + LLERAW LY+   +++LVD+ +   F  EE  +Y+
Sbjct  232  FGVLLMEIVSARSNKNTRLPTEYQYLLERAWELYERNELVDLVDAGLNGVFDAEEACRYL  291

Query  71   KVALLCTQASASRRPTMSQVIDM  3
            K+ LLCTQ S   RPTMS V+ +
Sbjct  292  KIGLLCTQDSPKLRPTMSTVVKL  314



>ref|XP_004170048.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like [Cucumis sativus]
Length=397

 Score =   355 bits (912),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 230/320 (72%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C  F  S   +  T +   +E F    +S+   + ++Y +L+ AT +F   NKIG GG
Sbjct  1    MTCFPFLFSKRGKGPTRSSVDEEDF----SSMQNVKFYTYKQLKVATEDFSLANKIGEGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG+REFLTEI  +S   H NLV+L GCCV +N+RI
Sbjct  57   FGSVYKGKLKDGKLAAIKVLSAESRQGLREFLTEINVISKIEHENLVQLYGCCVDDNHRI  116

Query  596  LVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G+   +++  W TR+ IC+G ARGLA+LHE+V+PHI+HRDIKAS
Sbjct  117  LVYNYLENNSLAQTLLGRGYSSIQFNWRTRSKICIGIARGLAFLHEDVQPHIIHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD D +PKI DFGLAKL P ++TH+ST++AGT GYLAPEY + GQ+T K+D+YSFGV
Sbjct  177  NILLDHDLSPKISDFGLAKLIPASMTHVSTRVAGTIGYLAPEYAIRGQVTRKSDIYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            L++E+VSGR +++      ++ LLER WNLY++G ++ LVD+ +   F  E   KY+K+ 
Sbjct  237  LLVEIVSGRWNTNTQLPIGEQYLLERTWNLYEQGELVLLVDTSLNGDFDAEMACKYLKIG  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ S   RP+MS V+ M
Sbjct  297  LLCTQDSPKLRPSMSTVVKM  316



>emb|CBI15972.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 178/308 (58%), Positives = 230/308 (75%), Gaps = 6/308 (2%)
 Frame = -1

Query  920  RNRTGNLAQQESFD-AGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKN  744
            + + G+  Q+E+ + AG N     R FSY+ LR+AT NF   N+IGRGGFG VY+G L++
Sbjct  5    KMKNGDHHQKEAEEIAGKN----VRLFSYNALRSATRNFHPSNRIGRGGFGIVYRGVLRD  60

Query  743  GRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSL  564
            G QVAVK+LS +SKQG REFLTEI+ +SN +H  LV LIGCCV   +R+LVYEYLEN+SL
Sbjct  61   GTQVAVKSLSVESKQGKREFLTEIDMISNIQHPCLVRLIGCCVGGGSRMLVYEYLENKSL  120

Query  563  DRVLFGQSGAVK-LEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPK  387
               L         L+W  RAAIC  TA GLA+LHEE EP I+HRDIKASNILLD D  P+
Sbjct  121  SSALLSSKSKRSVLDWPKRAAICTSTAHGLAFLHEEAEPRIIHRDIKASNILLDGDLNPR  180

Query  386  IGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSS  207
            IGDFGLAKLFP+N+THIST++AGT GY+APEY L+G+LT KADVYSFGVL+LE++SGRSS
Sbjct  181  IGDFGLAKLFPENVTHISTRVAGTMGYMAPEYALSGRLTEKADVYSFGVLMLEIISGRSS  240

Query  206  SSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQASASRRP  27
            S   +G     L+E  W L ++ ++L++VD E+  +P++EV  ++KVALLC QA + +RP
Sbjct  241  SKAAFGENLLVLVEWTWKLKEDNSLLDMVDPELVEYPEDEVSCFIKVALLCIQAVSWQRP  300

Query  26   TMSQVIDM  3
            TM+QV+ M
Sbjct  301  TMTQVLQM  308



>gb|EYU27526.1| hypothetical protein MIMGU_mgv1a008049mg [Erythranthe guttata]
 gb|EYU27527.1| hypothetical protein MIMGU_mgv1a008049mg [Erythranthe guttata]
Length=386

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/283 (57%), Positives = 212/283 (75%), Gaps = 2/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            ++Y EL+ ATN+F   NKIG GGFG+VYKG L+NG+  A+K LSA+S+QG+REFLTEI+ 
Sbjct  27   YTYKELKIATNDFSPANKIGEGGFGSVYKGKLRNGQMAAIKVLSAESRQGVREFLTEIQI  86

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGT  489
            +S+  H NLV+L GCCV  N RILVY YLEN SL R L G    ++   W TR  IC+G 
Sbjct  87   ISDIEHENLVKLYGCCVEANQRILVYNYLENNSLARTLLGGGHSSIYFSWQTRVKICIGV  146

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            ARGLAYLHE+V PHIVHRDIKASNILLD+D TPKI DFGLAKL P N+TH+ST++AGT G
Sbjct  147  ARGLAYLHEQVVPHIVHRDIKASNILLDRDLTPKISDFGLAKLMPPNMTHVSTRVAGTIG  206

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            YLAPEY + GQLT +AD+YSFGVL++E+VSGR +++      ++ +LER W+LY++  ++
Sbjct  207  YLAPEYAIRGQLTRRADIYSFGVLLIEIVSGRCNTNTRLPIDEQYILERTWHLYEKNALV  266

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             LVD+ +   F  E   +++K+ LLCTQ +   RP+MS V+ M
Sbjct  267  ALVDTSLNGDFDGERACRFLKIGLLCTQDAPKLRPSMSSVVRM  309



>ref|XP_009393313.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 225/317 (71%), Gaps = 4/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     +R  +     Q S D     +A+   ++Y EL+ AT++F   NK+G GGFG+
Sbjct  2    TCFSCIFRKRKTSRRQHDQPSEDIPGTEVAKI--YTYKELKNATDDFSPANKVGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG L++G+ VA+K LS++SKQG REFLTEI  +S   H NLV+L GCCV   +RILVY
Sbjct  60   VYKGRLRDGKFVAIKVLSSESKQGAREFLTEITVISGIIHENLVKLYGCCVEGTHRILVY  119

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             Y EN SL + L G S  +++L+W TRA ICVG ARGLA+LHEEV PH+VHRDIKASNIL
Sbjct  120  NYCENNSLAQTLLGSSHSSIQLDWRTRAKICVGVARGLAFLHEEVRPHVVHRDIKASNIL  179

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQ+T K+DVYS+GVL+L
Sbjct  180  LDKDLTPKISDFGLAKLLPANMTHVSTRVAGTIGYLAPEYAVRGQVTRKSDVYSYGVLLL  239

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLC  54
            E+VSGR +++     + + LLER W LY+ G +  ++D+ + +    EE  K++K+ LLC
Sbjct  240  EIVSGRCNTNTRLPYEDQFLLERTWGLYECGKLANIIDNSLTDDLDVEEACKFLKIGLLC  299

Query  53   TQASASRRPTMSQVIDM  3
            TQ +   RP+MS V+ M
Sbjct  300  TQDTMKLRPSMSNVVKM  316



>ref|XP_010923072.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Elaeis guineensis]
Length=331

 Score =   352 bits (902),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/254 (65%), Positives = 204/254 (80%), Gaps = 1/254 (0%)
 Frame = -1

Query  761  KGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEY  582
            +GTL++  QVA+K+LSA+SKQG  EFLTEI+ VSN RH NLV+L+GCCV   NRILVYEY
Sbjct  9    QGTLRDETQVAIKSLSAESKQGTNEFLTEIDMVSNIRHPNLVQLMGCCVEGTNRILVYEY  68

Query  581  LENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLD  405
            LEN SL+  L G ++  + L+W  RAAICVGTA GLA+LHEE EPHIVHRDIKASN+LLD
Sbjct  69   LENNSLENALLGPKNKRIALDWPKRAAICVGTAHGLAFLHEEAEPHIVHRDIKASNVLLD  128

Query  404  KDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEV  225
            KD  PKIGDFGLAKLFP+N+THIST++AGT GYLAPEY L GQLT KAD+YSFGVL+LE+
Sbjct  129  KDLAPKIGDFGLAKLFPNNVTHISTRVAGTMGYLAPEYALLGQLTKKADIYSFGVLVLEI  188

Query  224  VSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLCTQA  45
            +SGRS S   W      LLE AW L DE  +L++VD E+  + +EEVL+++KVAL CTQ 
Sbjct  189  ISGRSGSKSVWELDMHTLLEWAWKLRDEDRLLDIVDRELVGYSEEEVLRFIKVALFCTQG  248

Query  44   SASRRPTMSQVIDM  3
            ++++RP+M QV++M
Sbjct  249  TSNQRPSMKQVVEM  262



>ref|XP_010236833.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Brachypodium distachyon]
Length=472

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/292 (59%), Positives = 213/292 (73%), Gaps = 27/292 (9%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            FSY +++ ATNNF + NK+GRGGFGTVYKG   +G   A K LS++SKQGI EFLTEIE+
Sbjct  132  FSYKQIKRATNNFERTNKLGRGGFGTVYKGIFVDGTAFAAKVLSSESKQGIEEFLTEIES  191

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQ----------SGAVKLEWH  516
            ++ A+H+NLV L+GCCV + NR+LVYEY EN SLD  L G           SGA  L W 
Sbjct  192  LTEAKHANLVRLLGCCVQKQNRVLVYEYAENNSLDHALKGDFRSLSALGSPSGAANLPWS  251

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
             R+ IC+GTARGL++LHEE EP IVHRDIKASN+LLD+++ PKI DFGLAKLFPDNITHI
Sbjct  252  VRSDICIGTARGLSFLHEEHEPSIVHRDIKASNVLLDRNFVPKIADFGLAKLFPDNITHI  311

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++ GT GYLAPEY + GQLT KADVYSFGVL+LE++SG                +RAW
Sbjct  312  STRVVGTTGYLAPEYFVHGQLTKKADVYSFGVLVLEIISG----------------QRAW  355

Query  155  NLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             LY E  +LE+VD+ + +  P+ EVL+Y KV L CTQA+ + RPTMSQV+ M
Sbjct  356  LLYQEDRLLEMVDASIKDDCPEAEVLRYAKVGLACTQAAPAGRPTMSQVVKM  407



>ref|XP_004248347.1| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
 ref|XP_010327222.1| PREDICTED: putative serine/threonine-protein kinase [Solanum 
lycopersicum]
Length=385

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 224/317 (71%), Gaps = 4/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF      R    +      FD   + +     FSY +LR AT++F  +NKIG GGFG+
Sbjct  2    TCFPL--FHRKHQSSTRHASEFDDELSGVKNVTLFSYKQLRIATDDFSTLNKIGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG LK+G+  A+K LS++SKQG+REFLTEI+ +S+  H NLV+L GCC+ +++RILVY
Sbjct  60   VYKGRLKSGKMAAIKVLSSESKQGVREFLTEIKVISDVDHENLVKLYGCCIEDDHRILVY  119

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G    +++  W TR  IC+G A+GLAYLHE+V+PHI+HRDIKASNIL
Sbjct  120  NYLENNSLAQTLLGGGHSSIQFSWRTRTKICIGVAKGLAYLHEQVKPHIIHRDIKASNIL  179

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P N TH+ST++AGT GYLAPEY + GQ T K+DVYS+GVL++
Sbjct  180  LDKDLTPKISDFGLAKLIPPNATHVSTRVAGTIGYLAPEYAIRGQATRKSDVYSYGVLLI  239

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+V+GR +++      ++ LLER W LY+   ++ LVD+ ++  F  E+  +Y+K+ LLC
Sbjct  240  EIVTGRCNTNSRLPIDEQYLLERTWQLYERNELVMLVDTSLDGDFDAEQACRYLKIGLLC  299

Query  53   TQASASRRPTMSQVIDM  3
            TQ +   RP+MS ++ M
Sbjct  300  TQDALKLRPSMSTILKM  316



>emb|CDY40041.1| BnaC05g12740D [Brassica napus]
Length=396

 Score =   353 bits (906),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 228/323 (71%), Gaps = 14/323 (4%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+ F     R          E  D G  SI   + + Y E+R AT++F   NKIG GG
Sbjct  1    MGCSWFSRRGGR--------PSEVDDGGIASIQNVKIYKYKEIRQATDDFNPHNKIGEGG  52

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG+REFLTEI  +S  +H NLV+L G CV  N+RI
Sbjct  53   FGSVYKGHLKDGKIAAIKVLSAESRQGVREFLTEINVISEIQHENLVKLYGYCVEGNHRI  112

Query  596  LVYEYLENRSLDRVL----FGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            LVY YLEN+SLD+ L    + +SG ++ +W TRA IC+G A+GLA+LHEEV PHI+HRDI
Sbjct  113  LVYNYLENKSLDKTLLAGGYTRSG-IQFDWRTRANICIGVAKGLAFLHEEVRPHIIHRDI  171

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLD+D +PKI DFGLA+L P N+TH+ST++AGT GYLAPEY + GQ+T KAD+YS
Sbjct  172  KASNILLDRDLSPKISDFGLARLMPPNMTHVSTRVAGTIGYLAPEYAVRGQVTRKADIYS  231

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYM  72
            FGVL++E+VS RS+ +     + + LLERAW LY+   +++LVD+ +   F  EE  +Y+
Sbjct  232  FGVLLMEIVSARSNKNTRLPTEYQYLLERAWELYERNELVDLVDTGLNGVFDAEEACRYL  291

Query  71   KVALLCTQASASRRPTMSQVIDM  3
            K+ LLCTQ S   RPTMS V+ +
Sbjct  292  KIGLLCTQDSPKLRPTMSTVVKL  314



>ref|XP_009627196.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} [Nicotiana tomentosiformis]
Length=395

 Score =   353 bits (906),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 228/317 (72%), Gaps = 3/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF +   R++        E FD   + +     FSY ELR AT++F  VNKIG GGFG+
Sbjct  2    TCFPSLFCRKHHPSTRHPSE-FDDELSGVKNVILFSYKELRIATDDFSPVNKIGEGGFGS  60

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG L++G+  A+K LS++SKQG++EFLTEI+ +S+  H NLV+L GCC+ +++RIL+Y
Sbjct  61   VYKGRLRSGKMAAIKVLSSESKQGVKEFLTEIKVISDVEHENLVKLYGCCIEDDHRILIY  120

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G    +++  W TR  IC+G A+GLAYLHE+V+PHI+HRDIKASNIL
Sbjct  121  NYLENNSLAQTLLGGGHSSIQFSWRTRTKICIGVAKGLAYLHEQVKPHIIHRDIKASNIL  180

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQ T K+DVYS+GVL++
Sbjct  181  LDKDLTPKISDFGLAKLIPPNMTHVSTRVAGTIGYLAPEYAIRGQATRKSDVYSYGVLLI  240

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+V+GR +++      ++ LLER W +Y+   ++ LVD+ ++  F  E+  +++K+ LLC
Sbjct  241  EIVTGRCNTNTRLPIDEQYLLERTWQVYERKELILLVDTSLDGDFDAEQACRFLKIGLLC  300

Query  53   TQASASRRPTMSQVIDM  3
            TQ +   RP+MS ++ M
Sbjct  301  TQDALKLRPSMSTILKM  317



>ref|XP_006854496.1| hypothetical protein AMTR_s00175p00044500 [Amborella trichopoda]
 gb|ERN15963.1| hypothetical protein AMTR_s00175p00044500 [Amborella trichopoda]
Length=372

 Score =   352 bits (904),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 170/283 (60%), Positives = 214/283 (76%), Gaps = 2/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            +SY++L+ AT +FG+ NKIG+GGFG++YKG LKNG  VAVK LSAQS QG REFL EI  
Sbjct  31   YSYNDLKIATEDFGESNKIGQGGFGSIYKGKLKNGATVAVKVLSAQSTQGEREFLNEISA  90

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGT  489
            + + +H NLVEL GCCV  + RILVY YLEN SL +V  G +S  ++ +W  R  I +G 
Sbjct  91   IFDIKHQNLVELYGCCVDGDTRILVYGYLENNSLAQVFLGRESSGIEFDWMRRRTIGLGV  150

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            A GLAYLHEEV+PHIVHRDIKASNILLDKD  PKI DFGLAKLFPD+ THIST++AGT G
Sbjct  151  ASGLAYLHEEVKPHIVHRDIKASNILLDKDLNPKISDFGLAKLFPDDKTHISTRVAGTLG  210

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            YLAPEY ++GQLT KADVYSFGVL+LE+VSG S        +++ LL+RAW L+  G +L
Sbjct  211  YLAPEYAISGQLTRKADVYSFGVLLLEIVSGGSILYSGVQIEEQYLLKRAWELHKAGELL  270

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            EL+D ++   +P+EE + ++KVALLC Q   + RP MS+V+ M
Sbjct  271  ELIDPKLNGDYPREEAIWFLKVALLCVQEKPNLRPNMSEVVKM  313



>ref|XP_009344302.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Pyrus x bretschneideri]
Length=409

 Score =   353 bits (906),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 226/321 (70%), Gaps = 7/321 (2%)
 Frame = -1

Query  956  MSCTCF-GASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC  F   + V ++R          D   + I   + F+Y EL  AT +F  VNKIG G
Sbjct  1    MSCFSFLSGTRVEKSR----KPSSDIDEEVSGIHDVKLFTYKELIIATEDFSPVNKIGEG  56

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI  +S   H+NLV+L GCCV  N+R
Sbjct  57   GFGSVYKGRLKDGKFAAIKVLSAESRQGVKEFLTEINVISKIEHANLVKLYGCCVEGNHR  116

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVY YLEN SL + L G S + ++  W TR  IC+G A GLA+LHEEV PHI+HRDIKA
Sbjct  117  ILVYNYLENNSLAQNLIGGSSSNLQFSWRTRRQICIGIACGLAFLHEEVHPHIIHRDIKA  176

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD  PKI DFGLAKL P N TH+ST++AGT GYLAPEY + GQLT +AD+YSFG
Sbjct  177  SNILLDKDLMPKISDFGLAKLIPPNTTHVSTRVAGTIGYLAPEYAIRGQLTRRADIYSFG  236

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKV  66
            VL++E+VSGRS+++     +++ LLER W LY+   ++ LVD+ ++  F  EE  +++K+
Sbjct  237  VLLVEIVSGRSNTNTRLPIEEQYLLERTWQLYERKELVGLVDTSLDGDFDAEEACRFLKI  296

Query  65   ALLCTQASASRRPTMSQVIDM  3
             LLCTQ  A RRP+MS V+ M
Sbjct  297  GLLCTQDLAKRRPSMSSVVKM  317



>ref|XP_010060678.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010060679.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010060680.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010060681.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010060682.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 ref|XP_010060683.1| PREDICTED: putative serine/threonine-protein kinase [Eucalyptus 
grandis]
 gb|KCW67480.1| hypothetical protein EUGRSUZ_F01220 [Eucalyptus grandis]
Length=399

 Score =   353 bits (905),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 171/319 (54%), Positives = 224/319 (70%), Gaps = 5/319 (2%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQES---FDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGF  774
            CF +   +RN T      +S    D   +SI   + ++Y ELR AT  F   NK+G GGF
Sbjct  3    CFSSFFKKRNATPARRPDQSNVELDEDVSSIQNIKMYTYKELRVATEGFSPDNKVGEGGF  62

Query  773  GTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRIL  594
            G+VYKGTLK+G  VA+K LS++S+QG+REFL EI+ +++  H NLV+L GCCV   +RIL
Sbjct  63   GSVYKGTLKDGTLVAIKVLSSESRQGVREFLNEIKVIADIEHDNLVKLYGCCVDGKHRIL  122

Query  593  VYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASN  417
            VY YLEN SL + L G    +++  WH R  ICVG A+GLAYLHEEV+PHIVHRDIKASN
Sbjct  123  VYGYLENNSLAQTLLGGGHSSIQFNWHARREICVGIAKGLAYLHEEVQPHIVHRDIKASN  182

Query  416  ILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVL  237
            +LLD+   PKI DFGLAKLFP N+TH+ST++AGT GYLAPEY + G L  KADVYSFGVL
Sbjct  183  VLLDRYLKPKISDFGLAKLFPPNMTHVSTRVAGTAGYLAPEYAIRGHLNRKADVYSFGVL  242

Query  236  ILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVAL  60
            + E+VSGRS+++     +++ LLE+AW L++ G + +L D+ ++     EEV KY+KV L
Sbjct  243  VTEIVSGRSNTNRKLPAEERYLLEKAWKLHERGELAQLADASLDGDCDVEEVCKYLKVGL  302

Query  59   LCTQASASRRPTMSQVIDM  3
            LCTQ     RPTM+ V+ M
Sbjct  303  LCTQDMPKLRPTMTTVVKM  321



>ref|XP_002285391.1| PREDICTED: putative serine/threonine-protein kinase [Vitis vinifera]
 emb|CBI20206.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 175/318 (55%), Positives = 220/318 (69%), Gaps = 5/318 (2%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF +   R+    ++ +    D   + I     +SY ELR AT +F   NKIG GGFG+
Sbjct  2    TCF-SFCFRKKVASSITRTAEVDDVVSGIQNVNRYSYRELRIATQDFSLANKIGEGGFGS  60

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKGTL++G  VA+K LSAQS+QG+REFLTE+  +S   H NLVEL GCCV E+ RILVY
Sbjct  61   VYKGTLRDGTVVAIKVLSAQSRQGLREFLTELSVISVIEHENLVELYGCCVDEDQRILVY  120

Query  587  EYLENRSLDRVLF--GQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
             YLEN SL + L   G SG ++  W TR  IC+G ARGLA+LHEEV PHIVHRDIKASNI
Sbjct  121  GYLENNSLAQTLLDGGHSG-IQFSWKTRTKICIGVARGLAFLHEEVHPHIVHRDIKASNI  179

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LLDKD TPKI DFGLAKL P++ TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVL+
Sbjct  180  LLDKDLTPKISDFGLAKLIPEDQTHVSTRVAGTTGYLAPEYAIRGQLTRKADIYSFGVLL  239

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALL  57
            LE+V GRS+ +      +  LLE  W L++   + + VD+ +   F  EEV +++K+ LL
Sbjct  240  LEIVCGRSNKNTRLAYGEHFLLEMVWELHERRELADAVDTSLNGDFDIEEVCRFLKIGLL  299

Query  56   CTQASASRRPTMSQVIDM  3
            CTQ     RPTMS V+ M
Sbjct  300  CTQDMPKSRPTMSTVVSM  317



>ref|XP_008372847.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Malus domestica]
Length=408

 Score =   353 bits (905),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 222/315 (70%), Gaps = 2/315 (1%)
 Frame = -1

Query  941  FGASSVRRNRTGNLAQQESFDAGDNS-IARTRNFSYDELRTATNNFGQVNKIGRGGFGTV  765
             G  S    R  N +++   D  + S I   + F+Y ELR AT++F   NKIG GGFG+V
Sbjct  1    MGCFSFLSGRIVNKSRKPGSDIDEVSGIHNVKLFTYKELRIATDDFSPANKIGEGGFGSV  60

Query  764  YKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYE  585
            YKG LK+ +  A+K LSA+S+QG++EFLTEI+ +S  +H NLVEL GCCV  N RILVY 
Sbjct  61   YKGQLKDRKFAAIKVLSAESRQGVKEFLTEIDVISKIKHENLVELFGCCVEGNQRILVYN  120

Query  584  YLENRSLDRVLFGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLD  405
            YLEN SL++ L G S  ++  W TR  IC G A GLA+LHEEV PHI+HRDIKASNILLD
Sbjct  121  YLENNSLEQNLIGGSSXLQFSWRTRREICNGIACGLAFLHEEVRPHIIHRDIKASNILLD  180

Query  404  KDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEV  225
            KD  PKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+
Sbjct  181  KDLMPKISDFGLAKLIPPNMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGVLLMEI  240

Query  224  VSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQ  48
            VSGR +++      ++ LLER W LY+   ++ LVD+ ++  F  EE  +++K+ LLCTQ
Sbjct  241  VSGRCNTNTRLPIDEQYLLERTWKLYERRELVGLVDTSLDGDFDAEEACRFLKIGLLCTQ  300

Query  47   ASASRRPTMSQVIDM  3
             S   RP+MS V+ M
Sbjct  301  DSPKLRPSMSTVVKM  315



>ref|XP_009377792.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140 isoform X3 [Pyrus x bretschneideri]
Length=343

 Score =   350 bits (898),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 236/319 (74%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CF   SV + R    A   SF          R FSY+ LR+AT NF   ++IG GG
Sbjct  1    MVCGCF---SVLKWRKEERASSSSFQEQGIINNNVRLFSYNSLRSATRNFHPSSRIGGGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++  QVA+K LSA+S+QG  EFLTEI  +S  RH NLVEL+GCCV +N+RI
Sbjct  58   YGVVYRGVLRDDAQVAIKCLSAESRQGANEFLTEINVISRIRHPNLVELLGCCVEDNHRI  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL + L G +S  V L+W TR +IC+GTA GLA+LHEE E  IVHRDIKAS
Sbjct  118  LVYEYLENNSLSKSLLGSRSKYVFLDWPTRVSICLGTATGLAFLHEEAEQQIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  178  NILLDANFRPKIGDFGLAKLFPDNVTHLSTRVAGTEGYLAPEYALLGQLTKKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS + +G Q   L+E  W L +E  +LELVD E+  +P+ EV++++KVAL
Sbjct  238  LLLEIISGRSSSKVAFGEQLLVLVEWVWKLREEERLLELVDPELTAYPEAEVMRFIKVAL  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RPTM QV++M
Sbjct  298  FCTQATAQQRPTMKQVVEM  316



>ref|XP_008372846.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Malus domestica]
Length=409

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/288 (57%), Positives = 212/288 (74%), Gaps = 1/288 (0%)
 Frame = -1

Query  863  IARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREF  684
            I   + F+Y ELR AT++F   NKIG GGFG+VYKG LK+ +  A+K LSA+S+QG++EF
Sbjct  29   IHNVKLFTYKELRIATDDFSPANKIGEGGFGSVYKGQLKDRKFAAIKVLSAESRQGVKEF  88

Query  683  LTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQSGAVKLEWHTRAA  504
            LTEI+ +S  +H NLVEL GCCV  N RILVY YLEN SL++ L G S  ++  W TR  
Sbjct  89   LTEIDVISKIKHENLVELFGCCVEGNQRILVYNYLENNSLEQNLIGGSSXLQFSWRTRRE  148

Query  503  ICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQI  324
            IC G A GLA+LHEEV PHI+HRDIKASNILLDKD  PKI DFGLAKL P N+TH+ST++
Sbjct  149  ICNGIACGLAFLHEEVRPHIIHRDIKASNILLDKDLMPKISDFGLAKLIPPNMTHVSTRV  208

Query  323  AGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYD  144
            AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGR +++      ++ LLER W LY+
Sbjct  209  AGTIGYLAPEYAIRGQLTRKADIYSFGVLLMEIVSGRCNTNTRLPIDEQYLLERTWKLYE  268

Query  143  EGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
               ++ LVD+ ++  F  EE  +++K+ LLCTQ S   RP+MS V+ M
Sbjct  269  RRELVGLVDTSLDGDFDAEEACRFLKIGLLCTQDSPKLRPSMSTVVKM  316



>ref|XP_006352577.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g14840-like [Solanum tuberosum]
Length=386

 Score =   352 bits (902),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 225/317 (71%), Gaps = 4/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     RR    +      F+   + +     FSY +LR AT++F  VNKIG GGFG+
Sbjct  2    TCFPL--FRRKHQSSTRHASEFNDELSGVKNVTLFSYKQLRIATDDFSSVNKIGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG LK+G+  A+K LS++SKQG+REFLTEI+ +S+  H NLV+L GCC+ +++RILVY
Sbjct  60   VYKGRLKSGKMAAIKVLSSESKQGVREFLTEIKVISDVDHENLVKLYGCCIEDDHRILVY  119

Query  587  EYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G    +++  W TR  I +G A+GLAYLHE+V+PHI+HRDIKASNIL
Sbjct  120  NYLENNSLAQTLLGGGHSSIQFSWRTRTKISIGVAKGLAYLHEQVKPHIIHRDIKASNIL  179

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P N TH+ST++AGT GYLAPEY + GQ T K+DVYS+GVL++
Sbjct  180  LDKDLTPKISDFGLAKLIPPNATHVSTRVAGTIGYLAPEYAIRGQATRKSDVYSYGVLLI  239

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLC  54
            E+V+GR +++      ++ LLERAW LY+   ++ LVD+ ++  F  E+  +++K+ LLC
Sbjct  240  EIVTGRCNTNSRLPIDEQYLLERAWQLYERKELVLLVDTSLDGDFDAEQACRFLKIGLLC  299

Query  53   TQASASRRPTMSQVIDM  3
            TQ S   RP+MS ++ M
Sbjct  300  TQDSLKLRPSMSTILKM  316



>emb|CDP05995.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   352 bits (903),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 170/316 (54%), Positives = 227/316 (72%), Gaps = 7/316 (2%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTV  765
            CF   +    R G +  +E     DN+    R +SY++LR AT +F  VNKIG+GGFG+V
Sbjct  10   CFKQKASSPTR-GTIELEEEGLNVDNA----RLYSYEDLRIATEDFSPVNKIGKGGFGSV  64

Query  764  YKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYE  585
            YKG LK+G   A+K LSA S QGIREFLTEI T+S+  H NLV+L GCC   ++RILVY 
Sbjct  65   YKGRLKDGTLAAIKVLSADSTQGIREFLTEIVTISDLEHENLVKLYGCCAEGDHRILVYG  124

Query  584  YLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILL  408
            YLEN SL + L G    +++  W TR  IC+G A+GLA+LHEEV+PH++HRDIKASNILL
Sbjct  125  YLENNSLAQTLLGGHRSSIQFSWKTRTKICIGIAQGLAFLHEEVQPHVIHRDIKASNILL  184

Query  407  DKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILE  228
            DKD TPKI DFGLAKLFP ++TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVL+LE
Sbjct  185  DKDLTPKISDFGLAKLFPSSLTHVSTRVAGTLGYLAPEYAIRGQLTRKADIYSFGVLLLE  244

Query  227  VVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLCT  51
            +VSGR +++      ++ LLER W L+++G ++++VD ++      +E  +Y+K++LLCT
Sbjct  245  IVSGRCNTNKRLPVGEQFLLERVWVLFEKGELVQMVDPDLGGDIDVDEATRYLKISLLCT  304

Query  50   QASASRRPTMSQVIDM  3
            Q     RP+MS V+ M
Sbjct  305  QDVPKNRPSMSTVVKM  320



>ref|XP_008370070.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Malus domestica]
 ref|XP_008370071.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Malus domestica]
 ref|XP_008370072.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 [Malus domestica]
Length=384

 Score =   351 bits (901),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 190/319 (60%), Positives = 237/319 (74%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CF   SV + R    A   SF          R FSY+ LR+AT NF   ++IG GG
Sbjct  1    MVCGCF---SVLKWRKEERASSSSFQEQGIINNNXRLFSYNSLRSATRNFHPSSRIGGGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++  QVA+K LSA+S+QG  EFLTEI  +S  RH NLVEL+GCCV +N+RI
Sbjct  58   YGVVYRGVLRDDAQVAIKCLSAESRQGANEFLTEINVISRIRHPNLVELLGCCVEDNHRI  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL R L G +S  V L+W TR +IC+GTA GLA+LHEE E  IVHRDIKAS
Sbjct  118  LVYEYLENNSLSRSLLGSRSKYVFLDWPTRVSICLGTATGLAFLHEEXEQQIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  178  NILLDANFRPKIGDFGLAKLFPDNVTHLSTRVAGTEGYLAPEYALLGQLTKKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS + +G Q   L+E  W L +E  +LELVD E+  +P+ EV++++KVAL
Sbjct  238  LLLEIISGRSSSKVAFGEQLLVLVEWVWKLREEERLLELVDPELTAYPEAEVMRFIKVAL  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RPTM+QV++M
Sbjct  298  FCTQATAQQRPTMTQVVEM  316



>ref|XP_009344303.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Pyrus x bretschneideri]
Length=408

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 229/322 (71%), Gaps = 10/322 (3%)
 Frame = -1

Query  956  MSCTCF-GASSVRRNRTGNLAQQESFDAGDNS-IARTRNFSYDELRTATNNFGQVNKIGR  783
            MSC  F   + V ++R      + S D  + S I   + F+Y EL  AT +F  VNKIG 
Sbjct  1    MSCFSFLSGTRVEKSR------KPSSDIDEVSGIHDVKLFTYKELIIATEDFSPVNKIGE  54

Query  782  GGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENN  603
            GGFG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI  +S   H+NLV+L GCCV  N+
Sbjct  55   GGFGSVYKGRLKDGKFAAIKVLSAESRQGVKEFLTEINVISKIEHANLVKLYGCCVEGNH  114

Query  602  RILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIK  426
            RILVY YLEN SL + L G S + ++  W TR  IC+G A GLA+LHEEV PHI+HRDIK
Sbjct  115  RILVYNYLENNSLAQNLIGGSSSNLQFSWRTRRQICIGIACGLAFLHEEVHPHIIHRDIK  174

Query  425  ASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSF  246
            ASNILLDKD  PKI DFGLAKL P N TH+ST++AGT GYLAPEY + GQLT +AD+YSF
Sbjct  175  ASNILLDKDLMPKISDFGLAKLIPPNTTHVSTRVAGTIGYLAPEYAIRGQLTRRADIYSF  234

Query  245  GVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMK  69
            GVL++E+VSGRS+++     +++ LLER W LY+   ++ LVD+ ++  F  EE  +++K
Sbjct  235  GVLLVEIVSGRSNTNTRLPIEEQYLLERTWQLYERKELVGLVDTSLDGDFDAEEACRFLK  294

Query  68   VALLCTQASASRRPTMSQVIDM  3
            + LLCTQ  A RRP+MS V+ M
Sbjct  295  IGLLCTQDLAKRRPSMSSVVKM  316



>ref|XP_006304968.1| hypothetical protein CARUB_v10012041mg [Capsella rubella]
 gb|EOA37866.1| hypothetical protein CARUB_v10012041mg [Capsella rubella]
Length=390

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 170/296 (57%), Positives = 220/296 (74%), Gaps = 9/296 (3%)
 Frame = -1

Query  872  DNSIARTRN---FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSK  702
            D  IA   N   + Y E+R AT++F   NKIG GGFG+VYKG LK+G+  A+K LSA+SK
Sbjct  17   DGEIAAIDNVKIYKYREIRQATDDFSAGNKIGEGGFGSVYKGRLKDGKLAAIKVLSAESK  76

Query  701  QGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGA  534
            QG++EFLTEI  +S  +H NLVEL GCCV  N+RILVY +LEN SLD+ L    + +SG 
Sbjct  77   QGVKEFLTEINVISKIQHENLVELYGCCVEGNHRILVYNFLENNSLDKTLLAGGYTRSG-  135

Query  533  VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFP  354
            ++ +W +RA ICVG A+GLA+LHEEV PHI+HRDIKASNILLDK  +PKI DFGLA+L P
Sbjct  136  IQFDWSSRANICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDKYLSPKISDFGLARLMP  195

Query  353  DNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKA  174
             N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + 
Sbjct  196  PNMTHVSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQY  255

Query  173  LLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVI  9
            LLERAW LY+   +++LVDS +   F  EE  +Y+K+ LLCTQ S   RP+MS V+
Sbjct  256  LLERAWELYERNELVDLVDSGLNGIFDAEEACRYLKIGLLCTQDSPKLRPSMSTVV  311



>ref|XP_009377790.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53440 isoform X1 [Pyrus x bretschneideri]
Length=386

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 189/319 (59%), Positives = 236/319 (74%), Gaps = 4/319 (1%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CF   SV + R    A   SF          R FSY+ LR+AT NF   ++IG GG
Sbjct  1    MVCGCF---SVLKWRKEERASSSSFQEQGIINNNVRLFSYNSLRSATRNFHPSSRIGGGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VY+G L++  QVA+K LSA+S+QG  EFLTEI  +S  RH NLVEL+GCCV +N+RI
Sbjct  58   YGVVYRGVLRDDAQVAIKCLSAESRQGANEFLTEINVISRIRHPNLVELLGCCVEDNHRI  117

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYEYLEN SL + L G +S  V L+W TR +IC+GTA GLA+LHEE E  IVHRDIKAS
Sbjct  118  LVYEYLENNSLSKSLLGSRSKYVFLDWPTRVSICLGTATGLAFLHEEAEQQIVHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFGV
Sbjct  178  NILLDANFRPKIGDFGLAKLFPDNVTHLSTRVAGTEGYLAPEYALLGQLTKKADVYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SGRSSS + +G Q   L+E  W L +E  +LELVD E+  +P+ EV++++KVAL
Sbjct  238  LLLEIISGRSSSKVAFGEQLLVLVEWVWKLREEERLLELVDPELTAYPEAEVMRFIKVAL  297

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQA+A +RPTM QV++M
Sbjct  298  FCTQATAQQRPTMKQVVEM  316



>gb|KHG11618.1| hypothetical protein F383_12148 [Gossypium arboreum]
Length=410

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 225/345 (65%), Gaps = 30/345 (9%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C  F  S   R +T +  Q    D   + I  T+ F Y EL+ AT NF   NKIG GG
Sbjct  1    MTCFSFLFS---RKKTFSAEQTIEIDEEVSGIQNTKLFPYKELKMATGNFHHSNKIGEGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG VYKGT ++G   A+K L+A SKQG+REFLTEI  ++   H NLVEL GCCV  N+RI
Sbjct  58   FGVVYKGTFRDGTMGAIKVLAADSKQGVREFLTEINVIAEIEHENLVELCGCCVEGNHRI  117

Query  596  LVYEYLENRSLDRVLFGQ--------------------------SGAVKLEWHTRAAICV  495
            LVY YLEN SL + L G                             +++  W  R  IC+
Sbjct  118  LVYGYLENNSLAQTLLGNYFYSWFVFNIRLNINNLKPLYLLGGGHSSMQFSWEARRNICI  177

Query  494  GTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGT  315
            G A+GLA+LHEEV+PHI+HRDIKASNILLDK+  PKI DFGLAKLFPDN+THIST++AGT
Sbjct  178  GVAKGLAFLHEEVQPHIIHRDIKASNILLDKNLNPKISDFGLAKLFPDNMTHISTRVAGT  237

Query  314  CGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGN  135
             GYLAPEY + GQLT KAD+YSFGVL+LE+VSGR +++      ++ LLERAWN Y+   
Sbjct  238  TGYLAPEYAIRGQLTRKADIYSFGVLLLEIVSGRCNTNRRLPLSEQYLLERAWNKYESRE  297

Query  134  MLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            ++EL+D+ +   + +EE  K++K+ LLCTQ     RP+MSQV+ M
Sbjct  298  LVELIDTSISGEYDEEEAQKFLKIGLLCTQDIPKFRPSMSQVVKM  342



>ref|XP_004294124.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform 2 [Fragaria vesca subsp. vesca]
Length=387

 Score =   350 bits (899),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 225/325 (69%), Gaps = 19/325 (6%)
 Frame = -1

Query  947  TCF-------GASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKI  789
            TCF        ASSV+R            D   + I+  + ++Y ELR AT NF   NKI
Sbjct  2    TCFSCLFSQKAASSVKRTV--------EIDEVVSGISNLKLYTYKELRNATENFSGENKI  53

Query  788  GRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHE  609
            G+GGFG+VYKGTLK+G   A+K LS  S+QG REFLTEIE +++  H NLV+L GCC   
Sbjct  54   GQGGFGSVYKGTLKDGSVAAIKVLSGDSRQGSREFLTEIEVIASVNHENLVKLYGCCAEG  113

Query  608  NNRILVYEYLENRSLDRVLFG--QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHR  435
            N+RILVY YLEN SL + L G  QSG ++  W TR  IC+G ARGLAYLHE+V+PHI+HR
Sbjct  114  NHRILVYGYLENNSLSQTLLGRGQSG-IQFSWQTRCKICIGIARGLAYLHEDVQPHIIHR  172

Query  434  DIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADV  255
            DIKASNILLD+D +PKI DFGLAK    N+TH+ST++AGT GYLAPEY + GQ+T KAD+
Sbjct  173  DIKASNILLDEDLSPKISDFGLAKFIAPNLTHVSTRVAGTAGYLAPEYAIRGQVTRKADI  232

Query  254  YSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLK  78
            YSFGVL+LE+VSGR +++     +++ LLER W L++ G + EL+D+ + E    EE  +
Sbjct  233  YSFGVLVLEIVSGRCNTNRRLPPKEQYLLERVWELHERGQLAELIDTFLNEDLNVEEACR  292

Query  77   YMKVALLCTQASASRRPTMSQVIDM  3
            +MK+ LLCTQ     RP+MS V+ M
Sbjct  293  FMKIGLLCTQDKPKLRPSMSMVVKM  317



>ref|XP_010926928.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Elaeis guineensis]
Length=384

 Score =   350 bits (898),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 228/323 (71%), Gaps = 12/323 (4%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIG  786
            MSC  F     RR RT   +QQE+   GD  I    N   +SY+ELR+AT +F   NK+G
Sbjct  1    MSCFSF---IFRRKRT---SQQETH-RGDEDIPGIENVTFYSYNELRSATGDFSAANKVG  53

Query  785  RGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHEN  606
             GGFG+VY+G LK+G  VA+K LS++S+QG+REFLTE+  +S   H NLV L GCCV   
Sbjct  54   EGGFGSVYRGRLKDGTTVAIKVLSSESRQGVREFLTELTVISGILHENLVRLYGCCVEGT  113

Query  605  NRILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            +RI+VY YLEN SL + L G + + ++ +W  R  IC+G ARGLA+LHEEV PHIVHRDI
Sbjct  114  HRIIVYNYLENNSLAQTLLGSAHSNIQFDWRARVKICIGIARGLAFLHEEVRPHIVHRDI  173

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDKD T KI DFGLAKL P N TH+ST++AGT GYLAPEY + GQ+T K+DVYS
Sbjct  174  KASNILLDKDLTAKISDFGLAKLLPANTTHVSTRVAGTIGYLAPEYAVRGQVTRKSDVYS  233

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYM  72
            FGVL+LE+VSGR +++     + + LLER W LY++  + +++DS + +    E+  K++
Sbjct  234  FGVLLLEIVSGRCNTNTRLPYEDQFLLERTWVLYEQNELWKIIDSSLTDDLDIEQACKFL  293

Query  71   KVALLCTQASASRRPTMSQVIDM  3
            KV LLCTQ +A  RP MS V++M
Sbjct  294  KVGLLCTQDAAKLRPAMSNVLEM  316



>ref|XP_008804702.1| PREDICTED: putative serine/threonine-protein kinase [Phoenix 
dactylifera]
Length=382

 Score =   350 bits (898),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 170/317 (54%), Positives = 221/317 (70%), Gaps = 6/317 (2%)
 Frame = -1

Query  944  CFGASSVRRNRTGNLAQQESFDAGD-NSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            CF     +RN +G   +Q   D GD   I   R ++Y ELR+AT +F   NKIG GGFG+
Sbjct  3    CFSCIFKKRNTSG---EQIVRDHGDIPGIENVRIYTYKELRSATEDFSSANKIGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            V+KG LK+G  VA+K LS++S+QG+REFL E+  +S   H NLV L GCCV    RILVY
Sbjct  60   VFKGKLKDGTVVAIKVLSSESRQGVREFLNELTVISTIVHENLVRLYGCCVEGGERILVY  119

Query  587  EYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             +LEN SL + L G   + ++  W TR  IC+G ARGLA+LHEEV PHIVHRDIKASNIL
Sbjct  120  NFLENNSLAQTLLGGGCSNIQFSWRTRCNICIGVARGLAFLHEEVRPHIVHRDIKASNIL  179

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQLT +AD+YSFGVL+L
Sbjct  180  LDKDLTPKISDFGLAKLLPANMTHVSTRVAGTIGYLAPEYAIRGQLTRRADIYSFGVLLL  239

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLC  54
            E+VSGR +++     + + LLER W LY+   ++ +VD+ + + F  EE  ++++V LLC
Sbjct  240  EIVSGRCNTNTRLPYEDQFLLERTWTLYERSQLVRIVDTSLNDDFNAEEACRFLRVGLLC  299

Query  53   TQASASRRPTMSQVIDM  3
            TQ     RP+MS V+ M
Sbjct  300  TQDDPKLRPSMSTVVKM  316



>ref|XP_010539590.1| PREDICTED: putative serine/threonine-protein kinase [Tarenaya 
hassleriana]
Length=394

 Score =   350 bits (899),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 168/298 (56%), Positives = 217/298 (73%), Gaps = 7/298 (2%)
 Frame = -1

Query  875  GDNSIARTRN---FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQS  705
            G+ ++A   N   +SY ELR AT+NF   NKIG GGFG+VYKG LK+G+  A+K LS +S
Sbjct  21   GEITVAEPLNVKIYSYKELRHATDNFSVENKIGEGGFGSVYKGRLKDGKIAAIKVLSTES  80

Query  704  KQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS---GA  534
            +QG+REFLTEI  +S  +H NLVEL GCCV  N+RILVY YLEN SLD+ L         
Sbjct  81   RQGVREFLTEINVISEIQHENLVELYGCCVEGNHRILVYNYLENNSLDKTLLAGGYSWNG  140

Query  533  VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFP  354
            ++ +W TR  IC+G A+GLA+LHEEV P++VHRDIKASNILLD+D +PKI DFGLA+L P
Sbjct  141  MQFDWRTRVRICIGIAKGLAFLHEEVRPYVVHRDIKASNILLDRDLSPKISDFGLARLIP  200

Query  353  DNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKA  174
             N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVLI+E+VSGRS+ +     + + 
Sbjct  201  PNMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGVLIMEIVSGRSNKNSRLPAEYQI  260

Query  173  LLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            LL RAW LY+   +++LVDS +   F  EE  +++KV LLCTQ S   RP MS V+ +
Sbjct  261  LLARAWELYERNELVDLVDSALNGDFDVEEACRFLKVGLLCTQDSPKLRPWMSSVVKL  318



>ref|XP_008226283.1| PREDICTED: putative serine/threonine-protein kinase [Prunus mume]
Length=407

 Score =   350 bits (899),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 222/320 (69%), Gaps = 6/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC  F    +RR    +       D   + I+  + ++Y E++ AT +F   NKIG GG
Sbjct  1    MSCFSF----LRRGVNSSRKPGSDVDKELSGISDVKLYTYKEMKIATEDFSPANKIGEGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+SKQG++EFLTEI+ +S   H NLV+L GCCV EN RI
Sbjct  57   FGSVYKGQLKDGKMAAIKVLSAESKQGVKEFLTEIDVISKIEHENLVKLYGCCVDENQRI  116

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G   + ++  W TR  IC+G A GLA+LHEEV PHI+HRDIKAS
Sbjct  117  LVYNYLENNSLAQTLIGGGHSNIQFSWRTRREICIGIACGLAFLHEEVRPHIIHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD+D  PKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGV
Sbjct  177  NILLDRDLMPKISDFGLAKLIPPNMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            L++E+VSGR +++      ++ LLER W +Y+   ++ LVD+ +   F  EE  +++K+ 
Sbjct  237  LLVEIVSGRCNTNTRLPIDEQYLLERTWQVYERRELVGLVDTSLNGDFDAEEACRFLKIG  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ +   RP+MS V+ M
Sbjct  297  LLCTQDTPKLRPSMSSVVKM  316



>ref|XP_009417843.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417844.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   350 bits (897),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 172/317 (54%), Positives = 218/317 (69%), Gaps = 4/317 (1%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF     R   +G  + Q   D     I   R +SY ELR AT +F   NK+G GGFG+
Sbjct  2    TCFSFIFKRIGCSGQQSDQHLEDIP--GIENVRIYSYKELRNATGDFSLTNKVGEGGFGS  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG LK+G+ VAVK LS++S+QG+ EFL EI  +S   H NLV L GCCV E +RILVY
Sbjct  60   VYKGKLKDGKIVAVKVLSSESRQGVPEFLNEIAVISGIEHENLVSLHGCCVEETHRILVY  119

Query  587  EYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G   + ++  W TR  IC+G ARGLA+LHEEV PHIVHRDIKASNIL
Sbjct  120  NYLENNSLAQTLLGSGCSNIQFNWRTRVRICIGVARGLAFLHEEVRPHIVHRDIKASNIL  179

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P NITH+ST++AGT GYLAPEY + GQ+  K+DVYSFGVL+L
Sbjct  180  LDKDLTPKISDFGLAKLLPPNITHVSTRVAGTIGYLAPEYAIKGQVNRKSDVYSFGVLLL  239

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLC  54
            E+V+GR +++      ++ LLER WNLY+ G +  ++D+ + +    +E  K++KV LLC
Sbjct  240  EIVTGRCNTNTRLPYDEQFLLERTWNLYEHGEIANIIDTSLTDDLDVDEACKFLKVGLLC  299

Query  53   TQASASRRPTMSQVIDM  3
            TQ +   RP+MS V  M
Sbjct  300  TQDTVKLRPSMSNVARM  316



>ref|XP_009417850.1| PREDICTED: putative serine/threonine-protein kinase {ECO:0000250|UniProtKB:Q9FE20, 
ECO:0000303|Ref.2} isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   350 bits (897),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 218/317 (69%), Gaps = 7/317 (2%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCF   S    R G   QQ   D     I   R +SY ELR AT +F   NK+G GGFG+
Sbjct  2    TCF---SFIFKRIGCSGQQS--DQHLEGIENVRIYSYKELRNATGDFSLTNKVGEGGFGS  56

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG LK+G+ VAVK LS++S+QG+ EFL EI  +S   H NLV L GCCV E +RILVY
Sbjct  57   VYKGKLKDGKIVAVKVLSSESRQGVPEFLNEIAVISGIEHENLVSLHGCCVEETHRILVY  116

Query  587  EYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNIL  411
             YLEN SL + L G   + ++  W TR  IC+G ARGLA+LHEEV PHIVHRDIKASNIL
Sbjct  117  NYLENNSLAQTLLGSGCSNIQFNWRTRVRICIGVARGLAFLHEEVRPHIVHRDIKASNIL  176

Query  410  LDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLIL  231
            LDKD TPKI DFGLAKL P NITH+ST++AGT GYLAPEY + GQ+  K+DVYSFGVL+L
Sbjct  177  LDKDLTPKISDFGLAKLLPPNITHVSTRVAGTIGYLAPEYAIKGQVNRKSDVYSFGVLLL  236

Query  230  EVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKVALLC  54
            E+V+GR +++      ++ LLER WNLY+ G +  ++D+ + +    +E  K++KV LLC
Sbjct  237  EIVTGRCNTNTRLPYDEQFLLERTWNLYEHGEIANIIDTSLTDDLDVDEACKFLKVGLLC  296

Query  53   TQASASRRPTMSQVIDM  3
            TQ +   RP+MS V  M
Sbjct  297  TQDTVKLRPSMSNVARM  313



>emb|CDX83948.1| BnaC08g16970D [Brassica napus]
Length=398

 Score =   350 bits (898),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 221/294 (75%), Gaps = 6/294 (2%)
 Frame = -1

Query  869  NSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIR  690
            ++I + + + Y E+R AT++F  +NKIG GGFG+VYKG LK+G   A+K LSA+S+QG++
Sbjct  23   SAIIKVKIYKYKEIRQATDDFDPLNKIGEGGFGSVYKGRLKDGNIAAIKVLSAESRQGVK  82

Query  689  EFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG----QSGAVKLE  522
            EFLTEI  +S  +H NLV+L GCCV  ++RILVY YLEN SLD  L      +SG ++ +
Sbjct  83   EFLTEINVISEIQHENLVKLYGCCVERDHRILVYNYLENSSLDMTLLAGGYIKSG-IQFD  141

Query  521  WHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNIT  342
            W TR+ ICVG A+GLA+LHEEV PHI+HRDIKASNILLD+D++PKI DFGLAKL P N+T
Sbjct  142  WRTRSRICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDRDFSPKIADFGLAKLMPPNMT  201

Query  341  HISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLER  162
            H+ST++AGT GYLAPEY + GQ+T KADVYSFGVL++E+VS RS+ +       + LLER
Sbjct  202  HVSTRVAGTIGYLAPEYAVRGQVTRKADVYSFGVLLMEIVSARSNKNTRLPQGYQYLLER  261

Query  161  AWNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            AW+LY+   +++LVD+ +   F  EE  +Y+K+ LLCTQ +   RP+MS V+ +
Sbjct  262  AWDLYERNELVDLVDTGLNGVFDGEEACRYLKIGLLCTQDNPKLRPSMSTVVKL  315



>ref|XP_003530276.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X1 [Glycine max]
 ref|XP_006583644.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform X2 [Glycine max]
 gb|KHN22747.1| Putative LRR receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=380

 Score =   349 bits (896),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 233/319 (73%), Gaps = 7/319 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C CFGA     NR G   + +S D     +  T+ FSY+ LR+AT +F   +KIG GG
Sbjct  1    MFCNCFGA----LNRCGR--RDDSEDQPHEQVVATKMFSYNSLRSATGDFHPSSKIGGGG  54

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            +G VYKG L++G Q A+K+LS +SKQG  EF+TEI+ +SN RH NLVELIGCCV  ++RI
Sbjct  55   YGVVYKGVLRDGTQAAIKSLSVESKQGTHEFMTEIDMISNIRHPNLVELIGCCVEGSHRI  114

Query  596  LVYEYLENRSLDRVLFG-QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVYE+LEN SL   L G +S  V L+W  R AIC GTA GL +LH+E +P+IVHRDIKAS
Sbjct  115  LVYEFLENNSLASSLLGSKSKYVALDWPKRVAICRGTASGLTFLHDEAQPNIVHRDIKAS  174

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD ++ PKIGDFGLAKLFPDN+TH+ST++AGT GYLAPEY L GQLT KADVYSFG+
Sbjct  175  NILLDGNFNPKIGDFGLAKLFPDNVTHVSTRVAGTVGYLAPEYALLGQLTKKADVYSFGI  234

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVAL  60
            L+LE++SG+SSS   +      L+E AW L  E  +L+LVDSE+  + + EV +++ VAL
Sbjct  235  LMLEIISGKSSSIAAFEDDYLVLVEWAWKLRGENRLLDLVDSELSEYDESEVYRFLIVAL  294

Query  59   LCTQASASRRPTMSQVIDM  3
             CTQ++A  RP+M QV++M
Sbjct  295  FCTQSAAQHRPSMKQVLEM  313



>ref|XP_004294123.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56140-like isoform 1 [Fragaria vesca subsp. vesca]
Length=402

 Score =   350 bits (898),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 222/328 (68%), Gaps = 23/328 (7%)
 Frame = -1

Query  977  FFCCINVMSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQV  798
            F+  +    C C GA                     + I+  + ++Y ELR AT NF   
Sbjct  25   FYPTVKASKCDCMGAVV-------------------SGISNLKLYTYKELRNATENFSGE  65

Query  797  NKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCC  618
            NKIG+GGFG+VYKGTLK+G   A+K LS  S+QG REFLTEIE +++  H NLV+L GCC
Sbjct  66   NKIGQGGFGSVYKGTLKDGSVAAIKVLSGDSRQGSREFLTEIEVIASVNHENLVKLYGCC  125

Query  617  VHENNRILVYEYLENRSLDRVLFG--QSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHI  444
               N+RILVY YLEN SL + L G  QSG ++  W TR  IC+G ARGLAYLHE+V+PHI
Sbjct  126  AEGNHRILVYGYLENNSLSQTLLGRGQSG-IQFSWQTRCKICIGIARGLAYLHEDVQPHI  184

Query  443  VHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMK  264
            +HRDIKASNILLD+D +PKI DFGLAK    N+TH+ST++AGT GYLAPEY + GQ+T K
Sbjct  185  IHRDIKASNILLDEDLSPKISDFGLAKFIAPNLTHVSTRVAGTAGYLAPEYAIRGQVTRK  244

Query  263  ADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEE  87
            AD+YSFGVL+LE+VSGR +++     +++ LLER W L++ G + EL+D+ + E    EE
Sbjct  245  ADIYSFGVLVLEIVSGRCNTNRRLPPKEQYLLERVWELHERGQLAELIDTFLNEDLNVEE  304

Query  86   VLKYMKVALLCTQASASRRPTMSQVIDM  3
              ++MK+ LLCTQ     RP+MS V+ M
Sbjct  305  ACRFMKIGLLCTQDKPKLRPSMSMVVKM  332



>ref|XP_008383025.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Malus domestica]
Length=409

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/320 (54%), Positives = 224/320 (70%), Gaps = 5/320 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            MSC  F  S  R N++   +     D   + I   + F+Y EL  AT +F   NK+G GG
Sbjct  1    MSCFSF-LSGARVNKSRKPSSD--IDEEVSGIHDVKLFTYKELIIATEDFSPANKVGEGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI+ +S   H NLV+L GCCV  N RI
Sbjct  58   FGSVYKGRLKDGKFAAIKVLSAESRQGVKEFLTEIDVISKIEHENLVKLYGCCVEGNQRI  117

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G S + +   W TR  IC+G A GLA+LHEEV PHI+HRDIKAS
Sbjct  118  LVYNYLENNSLAQNLIGGSSSNLHFSWQTRRQICIGIACGLAFLHEEVHPHIIHRDIKAS  177

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKD  PKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGV
Sbjct  178  NILLDKDLMPKISDFGLAKLIPPNMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFGV  237

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKVA  63
            LI+E+VSGRS+++      ++ L+ER W LY+   ++ LVD+ ++  F  EE  +++K+ 
Sbjct  238  LIVEIVSGRSNTNNRLPIDEQYLIERTWQLYERKELVGLVDTSLDGDFDAEEACRFLKIG  297

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ +A  RP+MS V+ M
Sbjct  298  LLCTQDTAKLRPSMSTVVKM  317



>ref|XP_002890180.1| hypothetical protein ARALYDRAFT_471863 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66439.1| hypothetical protein ARALYDRAFT_471863 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 231/323 (72%), Gaps = 14/323 (4%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+ F  S  RR +   +   E   A DN     + + Y E+R AT++F   NKIG GG
Sbjct  1    MGCSWF--SCHRRGKATEV--DEEIAAIDN----VKIYKYREIRQATDDFSAENKIGEGG  52

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI  +S  +H NLV+L GCCV  N+RI
Sbjct  53   FGSVYKGCLKDGKLAAIKVLSAESRQGVKEFLTEINVISEIQHENLVKLYGCCVEGNHRI  112

Query  596  LVYEYLENRSLDRVL----FGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            LVY +LEN SLD+ L    + +SG ++ +W +RA ICVG A+GLA+LHEEV PHI+HRDI
Sbjct  113  LVYNFLENNSLDKTLLAGGYTRSG-IQFDWSSRANICVGVAKGLAFLHEEVRPHIIHRDI  171

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLDK  +PKI DFGLA+L P N+TH+ST++AGT GYLAPEY + GQLT KAD+YS
Sbjct  172  KASNILLDKYLSPKISDFGLARLMPPNMTHVSTRVAGTIGYLAPEYAVRGQLTRKADIYS  231

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYM  72
            FGVL++E+VSGRS+ +     + + LLERAW LY+   +++LVDS +   F  EE  +Y+
Sbjct  232  FGVLLMEIVSGRSNKNTRLPTEYQYLLERAWELYERNELVDLVDSGLNGVFDAEEACRYL  291

Query  71   KVALLCTQASASRRPTMSQVIDM  3
            K+ LLCTQ S   RP+MS V+ +
Sbjct  292  KIGLLCTQDSPKLRPSMSTVVRL  314



>ref|XP_008383026.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Malus domestica]
Length=408

 Score =   350 bits (898),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 227/321 (71%), Gaps = 8/321 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNS-IARTRNFSYDELRTATNNFGQVNKIGRG  780
            MSC  F  S  R N+    +++ S D  + S I   + F+Y EL  AT +F   NK+G G
Sbjct  1    MSCFSF-LSGARVNK----SRKPSSDIDEVSGIHDVKLFTYKELIIATEDFSPANKVGEG  55

Query  779  GFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNR  600
            GFG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI+ +S   H NLV+L GCCV  N R
Sbjct  56   GFGSVYKGRLKDGKFAAIKVLSAESRQGVKEFLTEIDVISKIEHENLVKLYGCCVEGNQR  115

Query  599  ILVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            ILVY YLEN SL + L G S + +   W TR  IC+G A GLA+LHEEV PHI+HRDIKA
Sbjct  116  ILVYNYLENNSLAQNLIGGSSSNLHFSWQTRRQICIGIACGLAFLHEEVHPHIIHRDIKA  175

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD  PKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFG
Sbjct  176  SNILLDKDLMPKISDFGLAKLIPPNMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYSFG  235

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKYMKV  66
            VLI+E+VSGRS+++      ++ L+ER W LY+   ++ LVD+ ++  F  EE  +++K+
Sbjct  236  VLIVEIVSGRSNTNNRLPIDEQYLIERTWQLYERKELVGLVDTSLDGDFDAEEACRFLKI  295

Query  65   ALLCTQASASRRPTMSQVIDM  3
             LLCTQ +A  RP+MS V+ M
Sbjct  296  GLLCTQDTAKLRPSMSTVVKM  316



>gb|ACN36883.1| unknown [Zea mays]
 gb|AFW59484.1| putative protein kinase superfamily protein isoform 1 [Zea mays]
 gb|AFW59485.1| putative protein kinase superfamily protein isoform 2 [Zea mays]
Length=374

 Score =   349 bits (895),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 166/305 (54%), Positives = 220/305 (72%), Gaps = 6/305 (2%)
 Frame = -1

Query  908  GNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVA  729
            G  A+Q +   GD  +   + FSY ELR AT +F   NKIG GGFG+V++G LK+G  VA
Sbjct  8    GKKAKQTT--EGDEDLHSVKVFSYSELRKATQDFSGANKIGEGGFGSVFRGVLKDGTVVA  65

Query  728  VKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLF  549
            VK LSA S+QGIREFLTE+  +S+ +H NLV LIGCC   + RILVY YLEN SL + L 
Sbjct  66   VKVLSATSRQGIREFLTELTAISDIKHENLVTLIGCCAEGSRRILVYNYLENNSLAQTLL  125

Query  548  GQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFG  372
            G   + ++  WH RA I VG ARGLA+LHEE+ P I+HRDIKASNILLDKD TPKI DFG
Sbjct  126  GSRHSNIRFNWHARARIAVGVARGLAFLHEEIRPPIIHRDIKASNILLDKDLTPKISDFG  185

Query  371  LAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNW  192
            LA+L P N TH+ST++AGT GYLAPEY + GQ+T K+D+YS+GVL+LE+VSGR +++   
Sbjct  186  LARLLPPNATHVSTRVAGTLGYLAPEYAIRGQVTKKSDIYSYGVLLLEIVSGRCNTNTRL  245

Query  191  GGQQKALLERAWNLYDEGNMLELVDSEV--ERFPKEEVLKYMKVALLCTQASASRRPTMS  18
              + + LLER W LY++G + ++VD ++  +R   EE  +++K+ LLCTQ + +RRP M+
Sbjct  246  PSEDQFLLERTWALYEQGRLEDIVDMDIGGDR-DVEEACRFLKIGLLCTQDAMARRPNMT  304

Query  17   QVIDM  3
             V+ M
Sbjct  305  NVVRM  309



>ref|XP_007022315.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY13840.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=392

 Score =   349 bits (896),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 168/320 (53%), Positives = 226/320 (71%), Gaps = 10/320 (3%)
 Frame = -1

Query  947  TCFGASSVRR---NRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            TCF     RR   +   +   +E FD     I   + ++Y EL++AT +F   NKIG GG
Sbjct  2    TCFSFLFRRRLDSSTNQSFEVEEEFD-----IHNVKLYTYKELKSATEDFSLANKIGEGG  56

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LKNG   A+K LSA+S+QG++EF+TEI+ +S   H NLV+L GCCV +N+RI
Sbjct  57   FGSVYKGRLKNGNLAAIKVLSAESRQGVKEFMTEIKVISEVEHENLVKLYGCCVEDNHRI  116

Query  596  LVYEYLENRSLDRVLFGQSGA-VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G   + ++  W TR+ IC+G ARGLA+LH+EV+P+IVHRDIKAS
Sbjct  117  LVYNYLENNSLSQTLLGSGRSNIQFNWKTRSKICIGIARGLAFLHDEVKPYIVHRDIKAS  176

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLDKD TPKI DFGLAKL P N+TH+ST++AGT GYLAPEY + GQLT KAD+Y FGV
Sbjct  177  NILLDKDLTPKISDFGLAKLIPANMTHVSTRVAGTIGYLAPEYAIRGQLTRKADIYGFGV  236

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYMKVA  63
            L++E+VSGR +++      ++ LLE+ W+LY+   ++ LVD  +   F  EE  +++K+ 
Sbjct  237  LLIEIVSGRCNTNTQLPVGEQYLLEQTWDLYERRELVGLVDVSLNSDFDPEEACRFLKIG  296

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ +   RP+MS V+ M
Sbjct  297  LLCTQDTPKLRPSMSSVVMM  316



>ref|NP_564003.1| putative serine/threonine kinase [Arabidopsis thaliana]
 gb|AAL24403.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15471.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29481.1| kinase domain-containing protein [Arabidopsis thaliana]
Length=390

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/293 (56%), Positives = 220/293 (75%), Gaps = 6/293 (2%)
 Frame = -1

Query  866  SIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIRE  687
            +I   + + Y E+R AT++F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG++E
Sbjct  22   AIDNVKIYKYREIRQATDDFSAENKIGEGGFGSVYKGCLKDGKLAAIKVLSAESRQGVKE  81

Query  686  FLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEW  519
            FLTEI  +S  +H NLV+L GCCV  N+RILVY +LEN SLD+ L    + +SG ++ +W
Sbjct  82   FLTEINVISEIQHENLVKLYGCCVEGNHRILVYNFLENNSLDKTLLAGGYTRSG-IQFDW  140

Query  518  HTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITH  339
             +RA ICVG A+GLA+LHEEV PHI+HRDIKASNILLDK  +PKI DFGLA+L P N+TH
Sbjct  141  SSRANICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDKYLSPKISDFGLARLMPPNMTH  200

Query  338  ISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERA  159
            +ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERA
Sbjct  201  VSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERA  260

Query  158  WNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            W LY+   +++LVDS +   F  EE  +Y+K+ LLCTQ S   RP+MS V+ +
Sbjct  261  WELYERNELVDLVDSGLNGVFDAEEACRYLKIGLLCTQDSPKLRPSMSTVVRL  313



>gb|EYU41879.1| hypothetical protein MIMGU_mgv11b022476mg [Erythranthe guttata]
Length=367

 Score =   348 bits (892),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/317 (55%), Positives = 220/317 (69%), Gaps = 19/317 (6%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGT  768
            TCFGA    + +       E+     N++   R F+Y  LR+AT  F  +N+IGRGGFG 
Sbjct  7    TCFGAFDSCKEKI----VTEAKGIAPNNV---RLFTYHSLRSATQVFHPLNRIGRGGFGV  59

Query  767  VYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVY  588
            VYKG L++G QVA+K LSA SKQG  EFLTEI T+SN +H NLV+LIGCC+  NNRILVY
Sbjct  60   VYKGVLRDGTQVAIKCLSAASKQGTNEFLTEINTISNIQHPNLVQLIGCCIEGNNRILVY  119

Query  587  EYLENRSLDRVLF--GQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNI  414
            EYLEN SL   L        V+L+W  RAAICVGTA GLA+LHE+ EP IVHRDIKASNI
Sbjct  120  EYLENNSLTSALLVSHDKRVVELDWSKRAAICVGTASGLAFLHEDAEPSIVHRDIKASNI  179

Query  413  LLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLI  234
            LLD+++ PKIGDFGLAKLFPDN+TH+S            +Y L GQLT KADVYSFGVL+
Sbjct  180  LLDENFNPKIGDFGLAKLFPDNVTHVSDT----------KYALMGQLTKKADVYSFGVLL  229

Query  233  LEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVERFPKEEVLKYMKVALLC  54
            LE+++GRSS   ++G     LLE  W L+ EG ++E+VD E++ +  +E+ ++ KVAL C
Sbjct  230  LEIITGRSSGKASFGEDFLVLLEWTWKLFKEGRLVEIVDPELKDYRTDEITRFAKVALFC  289

Query  53   TQASASRRPTMSQVIDM  3
            TQA+  +RP M QV+ M
Sbjct  290  TQAAVQQRPDMKQVLKM  306



>ref|XP_004516018.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X1 [Cicer arietinum]
 ref|XP_004516019.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X2 [Cicer arietinum]
 ref|XP_004516020.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X3 [Cicer arietinum]
 ref|XP_004516021.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g56130-like isoform X4 [Cicer arietinum]
Length=392

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 225/324 (69%), Gaps = 18/324 (6%)
 Frame = -1

Query  947  TCFG-------ASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKI  789
            TCF        +S VRR+           D G + I R + ++Y +L+ A++NF   NKI
Sbjct  2    TCFPFLFGKKVSSDVRRD--------PEIDEGLSGI-RIKVYTYKQLKIASDNFSPANKI  52

Query  788  GRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHE  609
            G GGFG+V+KG LK+G+  A+K LS +SKQG++EFLTEI  +S  +H NLV L GCCV  
Sbjct  53   GEGGFGSVFKGVLKDGKVAAIKVLSTESKQGVKEFLTEINVISEIQHENLVILYGCCVEG  112

Query  608  NNRILVYEYLENRSLDRVLF-GQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRD  432
            ++RILVY YLEN SL + L  G    +  +W TR  IC+G ARGLA+LHEEV+PHIVHRD
Sbjct  113  DHRILVYNYLENNSLAQTLLAGGHSNLYFDWQTRCRICIGVARGLAFLHEEVQPHIVHRD  172

Query  431  IKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVY  252
            IKASNILLDKD TPKI DFGLAKL P  ++H+ST++AGT GYLAPEY + GQLT KAD+Y
Sbjct  173  IKASNILLDKDLTPKISDFGLAKLIPSYMSHVSTRVAGTIGYLAPEYAIRGQLTRKADIY  232

Query  251  SFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKY  75
            SFGVL++E+VSGR++++       + +LER W LY+   +++LVD  +   F  EE  KY
Sbjct  233  SFGVLLVEIVSGRTNTNTRLPMGDQYILERTWELYERKELVQLVDISLNGGFNAEEACKY  292

Query  74   MKVALLCTQASASRRPTMSQVIDM  3
            +K+ALLCTQ +   RPTMS V+ M
Sbjct  293  LKIALLCTQDTPKHRPTMSSVVKM  316



>gb|AAG10816.1|AC011808_4 Unknown protein [Arabidopsis thaliana]
Length=396

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/293 (56%), Positives = 220/293 (75%), Gaps = 6/293 (2%)
 Frame = -1

Query  866  SIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIRE  687
            +I   + + Y E+R AT++F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG++E
Sbjct  28   AIDNVKIYKYREIRQATDDFSAENKIGEGGFGSVYKGCLKDGKLAAIKVLSAESRQGVKE  87

Query  686  FLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEW  519
            FLTEI  +S  +H NLV+L GCCV  N+RILVY +LEN SLD+ L    + +SG ++ +W
Sbjct  88   FLTEINVISEIQHENLVKLYGCCVEGNHRILVYNFLENNSLDKTLLAGGYTRSG-IQFDW  146

Query  518  HTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITH  339
             +RA ICVG A+GLA+LHEEV PHI+HRDIKASNILLDK  +PKI DFGLA+L P N+TH
Sbjct  147  SSRANICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDKYLSPKISDFGLARLMPPNMTH  206

Query  338  ISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERA  159
            +ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERA
Sbjct  207  VSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERA  266

Query  158  WNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            W LY+   +++LVDS +   F  EE  +Y+K+ LLCTQ S   RP+MS V+ +
Sbjct  267  WELYERNELVDLVDSGLNGVFDAEEACRYLKIGLLCTQDSPKLRPSMSTVVRL  319



>ref|XP_010459208.1| PREDICTED: putative serine/threonine-protein kinase isoform X2 
[Camelina sativa]
Length=384

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 168/296 (57%), Positives = 220/296 (74%), Gaps = 9/296 (3%)
 Frame = -1

Query  872  DNSIARTRN---FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSK  702
            D  IA   N   F Y E+R AT++F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+
Sbjct  17   DGEIAAIDNVKIFKYREIRQATDDFSAENKIGEGGFGSVYKGRLKDGKLAAIKVLSAESR  76

Query  701  QGIREFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGA  534
            QG++EFLTEI  +S  +H NLVEL GCCV   +RILVY +LEN SLD+ L    + +SG 
Sbjct  77   QGVKEFLTEINVISKIQHENLVELYGCCVEGIHRILVYNFLENNSLDKTLLAGGYTRSG-  135

Query  533  VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFP  354
            ++ +W +RA ICVG A+GLA+LHEEV PHI+HRDIKASNILLD+  +PKI DFGLA+L P
Sbjct  136  IQFDWSSRANICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDRYLSPKISDFGLARLMP  195

Query  353  DNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKA  174
             N+TH+ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + 
Sbjct  196  PNMTHVSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQY  255

Query  173  LLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVI  9
            LLERAW+LY+   +++LVDS +   F  EE  +Y+K+ LLCTQ S   RP+MS V+
Sbjct  256  LLERAWDLYERNELVDLVDSGLNGIFDAEEACRYLKIGLLCTQDSPKLRPSMSTVV  311



>ref|XP_010459206.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Camelina sativa]
 ref|XP_010459207.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Camelina sativa]
Length=389

 Score =   348 bits (893),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/291 (57%), Positives = 219/291 (75%), Gaps = 6/291 (2%)
 Frame = -1

Query  866  SIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIRE  687
            +I   + F Y E+R AT++F   NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG++E
Sbjct  22   AIDNVKIFKYREIRQATDDFSAENKIGEGGFGSVYKGRLKDGKLAAIKVLSAESRQGVKE  81

Query  686  FLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVL----FGQSGAVKLEW  519
            FLTEI  +S  +H NLVEL GCCV   +RILVY +LEN SLD+ L    + +SG ++ +W
Sbjct  82   FLTEINVISKIQHENLVELYGCCVEGIHRILVYNFLENNSLDKTLLAGGYTRSG-IQFDW  140

Query  518  HTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITH  339
             +RA ICVG A+GLA+LHEEV PHI+HRDIKASNILLD+  +PKI DFGLA+L P N+TH
Sbjct  141  SSRANICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDRYLSPKISDFGLARLMPPNMTH  200

Query  338  ISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERA  159
            +ST++AGT GYLAPEY + GQLT KAD+YSFGVL++E+VSGRS+ +     + + LLERA
Sbjct  201  VSTRVAGTIGYLAPEYAVRGQLTRKADIYSFGVLLMEIVSGRSNKNTRLPTEYQYLLERA  260

Query  158  WNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVI  9
            W+LY+   +++LVDS +   F  EE  +Y+K+ LLCTQ S   RP+MS V+
Sbjct  261  WDLYERNELVDLVDSGLNGIFDAEEACRYLKIGLLCTQDSPKLRPSMSTVV  311



>ref|XP_003596009.1| Protein kinase and PP2C-like domain-containing protein [Medicago 
truncatula]
Length=540

 Score =   353 bits (907),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 213/292 (73%), Gaps = 2/292 (1%)
 Frame = -1

Query  872  DNSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGI  693
            D  I   + ++Y EL  AT+NF   NKIG GGFG+VY G LKNG+  A+K LSA+SKQG+
Sbjct  22   DEGIHNVKIYTYKELSNATDNFSLANKIGEGGFGSVYMGRLKNGKLAAIKVLSAESKQGV  81

Query  692  REFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWH  516
            +EFLTEI  +S   H NLV+L GCCV +NNRILVY YLEN SL + L G    ++  +W 
Sbjct  82   KEFLTEINVISEVEHENLVKLYGCCVEKNNRILVYNYLENNSLSQTLLGGGHSSIYFDWR  141

Query  515  TRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHI  336
            TR  ICVG ARGLA+LHEEV P I+HRDIKASNILLDKD TPKI DFGLAKL P N TH+
Sbjct  142  TRCRICVGIARGLAFLHEEVRPPIIHRDIKASNILLDKDLTPKISDFGLAKLMPANATHV  201

Query  335  STQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAW  156
            ST++AGT GYLAPEY + G+LT KAD+YSFGVL++E+VSGR +++     +++ +LER W
Sbjct  202  STRVAGTLGYLAPEYAIGGRLTRKADIYSFGVLLVEIVSGRRNTNSRLPTEEQFILERTW  261

Query  155  NLYDEGNMLELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
             LY+   ++ L+D+ +   F  E+  K++K+ LLCTQ S  RRP+MS V+ M
Sbjct  262  ELYERKELVGLIDTSLNGEFDAEQACKFLKIGLLCTQESPKRRPSMSSVVKM  313



>ref|XP_009340140.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009340152.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009340159.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009340167.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Pyrus x bretschneideri]
Length=398

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 224/324 (69%), Gaps = 6/324 (2%)
 Frame = -1

Query  956  MSCTCF---GASSVRRNR-TGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKI  789
            MSC  F      + R NR  G + +    D   + +   + + Y EL+ AT NF + NKI
Sbjct  1    MSCFSFLFRKKEASRVNRPVGIVNRPVEIDEVVSGVLNVKQYGYRELQIATENFSEENKI  60

Query  788  GRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHE  609
            G+GGFG+VYKGTLK+G  VA+K LSA+S QG+REFLTEIE ++   H NLV+L GCC   
Sbjct  61   GQGGFGSVYKGTLKDGTLVAIKELSAESSQGLREFLTEIEVIATVEHDNLVKLYGCCAEG  120

Query  608  NNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRD  432
            ++RILVY YLEN SL + L G+    ++  W TR  IC+G ARGLAYLHEEV PHI+HRD
Sbjct  121  DHRILVYGYLENNSLAQTLLGKGYSGIQFTWLTRCKICIGVARGLAYLHEEVSPHIIHRD  180

Query  431  IKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVY  252
            IKASNILLDKD +PKI DFGLAK    N+TH+ST++AGT GYLAPEY + GQ+T KAD+Y
Sbjct  181  IKASNILLDKDLSPKISDFGLAKFIAPNLTHVSTRVAGTTGYLAPEYAIRGQVTRKADIY  240

Query  251  SFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVE-RFPKEEVLKY  75
            SFGVL+LE+V GRS+++     + + LL RAW  ++ G ++ELVD+ +   F  EE  ++
Sbjct  241  SFGVLLLEIVCGRSNTNRQLSPKDQYLLARAWEHHERGQLVELVDASLNGNFDVEEACRF  300

Query  74   MKVALLCTQASASRRPTMSQVIDM  3
            +KV LLCTQ     RP+MS V+ M
Sbjct  301  LKVGLLCTQDMPKLRPSMSTVVQM  324



>ref|XP_006370174.1| hypothetical protein POPTR_0001s40370g [Populus trichocarpa]
 gb|ERP66743.1| hypothetical protein POPTR_0001s40370g [Populus trichocarpa]
Length=394

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/320 (53%), Positives = 233/320 (73%), Gaps = 8/320 (3%)
 Frame = -1

Query  947  TCFGASSVRRNRTGNLAQQESFDAGDNSIARTRN---FSYDELRTATNNFGQVNKIGRGG  777
            TCF   S  + +  + A +++ +A D+ ++ ++N   +++ EL+ AT NF   NK+G GG
Sbjct  2    TCF--FSFCKGKGVSRATRQTLEA-DDEVSGSQNICCYTHRELQMATENFNSANKVGEGG  58

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G   A+K LSA+S+QG+REFLTEI+ +++  H+NLV+L G C   N+RI
Sbjct  59   FGSVYKGILKDGTVAAIKVLSAESRQGLREFLTEIKVIADIEHNNLVKLYGYCADGNHRI  118

Query  596  LVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKAS  420
            LVY YLEN SL + L G    ++K  W TR  ICVG ARGLA+LHEEV+PHIVHRDIKAS
Sbjct  119  LVYGYLENNSLAQTLLGGGHSSIKFSWSTRRKICVGVARGLAFLHEEVQPHIVHRDIKAS  178

Query  419  NILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGV  240
            NILLD +  PKI DFGLAKLFP ++THIST++AGT GYLAPEY + GQLT KAD+YSFGV
Sbjct  179  NILLDSELEPKISDFGLAKLFPSHLTHISTRVAGTTGYLAPEYAIRGQLTRKADIYSFGV  238

Query  239  LILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYMKVA  63
            L+LE+VSGRS+++     +++ LL+R W  Y++G ++ LVD+ + R +  EE  KY+K+ 
Sbjct  239  LLLEIVSGRSNTNRRLPTEEQCLLKRVWVFYEKGELVNLVDTSLGRDYDAEEACKYLKIG  298

Query  62   LLCTQASASRRPTMSQVIDM  3
            LLCTQ  +  RP MS V+ M
Sbjct  299  LLCTQEVSKLRPLMSTVVSM  318



>ref|XP_008451770.1| PREDICTED: putative serine/threonine-protein kinase isoform X1 
[Cucumis melo]
Length=380

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 221/321 (69%), Gaps = 6/321 (2%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M+C CFG    +RNR  + AQ  +     ++I   R +SY+ELR AT NF   NK+G+GG
Sbjct  1    MTCFCFGP---KRNRDSSAAQTIAVVEEISNIPNVRLYSYEELRKATENFRSENKLGQGG  57

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG L NG   A+K LS  S QG REFL EI  +S   H NLV+L GCCV   +RI
Sbjct  58   FGSVYKGRLGNGTLAAIKVLSMDSSQGTREFLAEINVISVINHDNLVKLRGCCVEGQHRI  117

Query  596  LVYEYLENRSLDRVLFGQSGA--VKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDIKA  423
            LVY YLEN SLD++LFG  G   ++  W TR  IC+G A+GLA+LHEEV+PH++HRDIKA
Sbjct  118  LVYPYLENSSLDKMLFGGRGHRNIQFNWQTRRKICIGIAQGLAFLHEEVQPHVIHRDIKA  177

Query  422  SNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYSFG  243
            SNILLDKD  PKI DFGLA+L P ++TH+ST++AGT GYLAPE+ + GQ T + D+YSFG
Sbjct  178  SNILLDKDLNPKIADFGLARLLPAHLTHVSTRVAGTVGYLAPEFAIRGQATRRTDIYSFG  237

Query  242  VLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEV-ERFPKEEVLKYMKV  66
            VL+LE+V GR + +     ++  LLE  W  +++G +LELVD  + E F  E+  +Y+K+
Sbjct  238  VLLLEIVCGRYNINRRLPAEEPYLLEMVWEHHEKGQLLELVDISLREDFVTEQACRYLKI  297

Query  65   ALLCTQASASRRPTMSQVIDM  3
             LLCTQ     RP+M+ V+ M
Sbjct  298  GLLCTQDMPKLRPSMATVVKM  318



>ref|XP_009110447.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
 ref|XP_009110448.1| PREDICTED: putative serine/threonine-protein kinase [Brassica 
rapa]
Length=397

 Score =   348 bits (894),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/294 (55%), Positives = 221/294 (75%), Gaps = 6/294 (2%)
 Frame = -1

Query  869  NSIARTRNFSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIR  690
            ++I + + + Y E+R AT++F  +NKIG GGFG+VYKG LK+G+  A+K LSA+S+QG++
Sbjct  23   SAIIKVKIYKYKEIRQATDDFDALNKIGEGGFGSVYKGRLKDGKIAAIKILSAESRQGVK  82

Query  689  EFLTEIETVSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFG----QSGAVKLE  522
            EFLTEI  +S  +H NLV+L GCCV  N+RILVY YLEN SLD  L      +SG ++ +
Sbjct  83   EFLTEINVISEIQHENLVKLYGCCVEGNHRILVYNYLENGSLDMTLLAGGYIKSG-IQFD  141

Query  521  WHTRAAICVGTARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNIT  342
            W TR+ ICVG A+GLA+LHEEV PHI+HRDIKASNILLD+D +PKI DFGLAKL P N+T
Sbjct  142  WRTRSRICVGVAKGLAFLHEEVRPHIIHRDIKASNILLDRDLSPKIADFGLAKLMPPNMT  201

Query  341  HISTQIAGTCGYLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLER  162
            H+ST++AGT GYLAPEY + GQ+T KADVYS+GVL++E+VS RS+ +       + LLER
Sbjct  202  HVSTRVAGTIGYLAPEYAVRGQVTRKADVYSYGVLLMEIVSARSNKNTRLPQGYQYLLER  261

Query  161  AWNLYDEGNMLELVDSEVER-FPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            AW+LY+   +++LVD+ +   F  EE  +Y+K+ LLCTQ +   RP+MS V+ +
Sbjct  262  AWDLYERNELVDLVDTGLNGVFDGEEACRYLKIGLLCTQDNPKLRPSMSTVVKL  315



>ref|XP_006836383.1| hypothetical protein AMTR_s00092p00128890 [Amborella trichopoda]
 gb|ERM99236.1| hypothetical protein AMTR_s00092p00128890 [Amborella trichopoda]
Length=371

 Score =   347 bits (891),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/283 (61%), Positives = 209/283 (74%), Gaps = 2/283 (1%)
 Frame = -1

Query  845  FSYDELRTATNNFGQVNKIGRGGFGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIET  666
            + Y ELR AT++F   NKIG GGFG+VYKG LKNGR VAVK LSA+SKQG +EFLTEI  
Sbjct  30   YPYKELRNATDDFSPNNKIGEGGFGSVYKGKLKNGRLVAVKVLSAESKQGTQEFLTEINV  89

Query  665  VSNARHSNLVELIGCCVHENNRILVYEYLENRSLDRVLFGQS-GAVKLEWHTRAAICVGT  489
            +S+  H NLV+L GCCV  NNRILVY YLEN SL + L G +   +   W TR  ICVG 
Sbjct  90   ISSIEHENLVKLHGCCVERNNRILVYGYLENNSLAQTLLGDARDDLVFNWTTRCNICVGV  149

Query  488  ARGLAYLHEEVEPHIVHRDIKASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCG  309
            ARGLAYLHEEV+P IVHRDIKASNILLD   TPKI DFGLAKLFP+N THIST++AGT G
Sbjct  150  ARGLAYLHEEVKPRIVHRDIKASNILLDGTLTPKISDFGLAKLFPNNETHISTRVAGTIG  209

Query  308  YLAPEYVLAGQLTMKADVYSFGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNML  129
            YLAPEY + G LT KAD+YSFGVL+LE++SGR ++      +   LLER + LY+   +L
Sbjct  210  YLAPEYAIRGHLTRKADIYSFGVLMLEIISGRCNTDRRLPLEDHYLLERTYQLYEADELL  269

Query  128  ELVDSEVE-RFPKEEVLKYMKVALLCTQASASRRPTMSQVIDM  3
            +LVD  +   +  +EV ++++VALLCTQ SA  RP+MS V+ M
Sbjct  270  QLVDPSLYGDYNSKEVSRFIRVALLCTQDSAKLRPSMSTVVSM  312



>ref|XP_010497985.1| PREDICTED: putative serine/threonine-protein kinase [Camelina 
sativa]
 ref|XP_010497986.1| PREDICTED: putative serine/threonine-protein kinase [Camelina 
sativa]
Length=390

 Score =   348 bits (893),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/321 (53%), Positives = 226/321 (70%), Gaps = 15/321 (5%)
 Frame = -1

Query  956  MSCTCFGASSVRRNRTGNLAQQESFDAGDNSIARTRNFSYDELRTATNNFGQVNKIGRGG  777
            M C+ F   S          +    D    +I   + F Y E+R AT++F   NKIG GG
Sbjct  1    MGCSWFACLS---------GEAREVDGEIAAIDNVKIFKYREIRQATDDFSAENKIGEGG  51

Query  776  FGTVYKGTLKNGRQVAVKALSAQSKQGIREFLTEIETVSNARHSNLVELIGCCVHENNRI  597
            FG+VYKG LK+G+  A+K LSA+S+QG++EFLTEI  +S  +H NLVEL GCCV   +RI
Sbjct  52   FGSVYKGRLKDGKLAAIKVLSAESRQGVKEFLTEINVISKIQHENLVELYGCCVEGIHRI  111

Query  596  LVYEYLENRSLDRVL----FGQSGAVKLEWHTRAAICVGTARGLAYLHEEVEPHIVHRDI  429
            LVY +LEN SLD+ L    + +SG ++ +W +RA ICVG A+GLA+LHEEV PHI+HRDI
Sbjct  112  LVYNFLENNSLDKTLLAGGYTRSG-IQFDWSSRANICVGVAKGLAFLHEEVRPHIIHRDI  170

Query  428  KASNILLDKDYTPKIGDFGLAKLFPDNITHISTQIAGTCGYLAPEYVLAGQLTMKADVYS  249
            KASNILLD+  +PKI DFGLA+L P N+TH+ST++AGT GYLAPEY + GQLT KAD+YS
Sbjct  171  KASNILLDRYLSPKISDFGLARLMPPNMTHVSTRVAGTIGYLAPEYAVRGQLTRKADIYS  230

Query  248  FGVLILEVVSGRSSSSMNWGGQQKALLERAWNLYDEGNMLELVDSEVER-FPKEEVLKYM  72
            FGVL++E+VSGRS+ +     + + LLERAW+LY+   +++LVDS +   F  EE  +Y+
Sbjct  231  FGVLLMEIVSGRSNKNTRLPTEYQYLLERAWDLYERNELVDLVDSGLNGIFDAEEACRYL  290

Query  71   KVALLCTQASASRRPTMSQVI  9
            K+ LLCTQ S   RP+MS V+
Sbjct  291  KIGLLCTQDSPKLRPSMSTVV  311



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2953106737764