BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21778_g1_i2 len=1786 path=[2054:0-139 2193:140-176 324:177-212
2265:213-215 2268:216-256 2309:257-333 @2386@!:334-940 23:941-970
4029:971-1785]

Length=1786
                                                                      Score     E

ref|XP_009595496.1|  PREDICTED: cytochrome c oxidase assembly pro...    398   3e-131   
ref|XP_004239062.1|  PREDICTED: cytochrome c oxidase assembly pro...    396   1e-130   
ref|XP_009780090.1|  PREDICTED: cytochrome c oxidase assembly pro...    394   6e-130   
ref|XP_006348705.1|  PREDICTED: cytochrome c oxidase assembly pro...    394   1e-129   
ref|XP_011085890.1|  PREDICTED: cytochrome c oxidase assembly pro...    381   5e-125   
ref|XP_007015809.1|  Cytochrome c oxidase assembly protein CtaG /...    380   2e-124   
ref|XP_007015807.1|  Cytochrome c oxidase assembly protein CtaG /...    378   1e-123   
emb|CDP01675.1|  unnamed protein product                                377   4e-123   
ref|XP_007015808.1|  Cytochrome c oxidase assembly protein CtaG /...    374   3e-122   
ref|XP_006471485.1|  PREDICTED: cytochrome c oxidase assembly pro...    371   7e-121   
gb|KDO57190.1|  hypothetical protein CISIN_1g023783mg                   370   2e-120   
ref|XP_010095969.1|  Cytochrome c oxidase assembly protein COX11        370   3e-120   
ref|XP_010032743.1|  PREDICTED: cytochrome c oxidase assembly pro...    369   7e-120   
gb|EYU30876.1|  hypothetical protein MIMGU_mgv1a010830mg                366   8e-119   
gb|EYU30877.1|  hypothetical protein MIMGU_mgv1a010830mg                365   1e-118   
gb|KDP46796.1|  hypothetical protein JCGZ_11167                         364   2e-118   
ref|XP_004146871.1|  PREDICTED: cytochrome c oxidase assembly pro...    366   3e-118   
ref|XP_010681297.1|  PREDICTED: cytochrome c oxidase assembly pro...    362   1e-117   
ref|XP_008453793.1|  PREDICTED: cytochrome c oxidase assembly pro...    364   2e-117   
ref|XP_008453787.1|  PREDICTED: cytochrome c oxidase assembly pro...    364   3e-117   
ref|XP_003553055.1|  PREDICTED: cytochrome c oxidase assembly pro...    360   2e-116   
ref|XP_004306674.1|  PREDICTED: cytochrome c oxidase assembly pro...    358   5e-116   
ref|XP_010032745.1|  PREDICTED: cytochrome c oxidase assembly pro...    353   2e-115   
ref|XP_008244142.1|  PREDICTED: cytochrome c oxidase assembly pro...    356   4e-115   
ref|XP_008230641.1|  PREDICTED: cytochrome c oxidase assembly pro...    356   4e-115   
ref|XP_009361928.1|  PREDICTED: cytochrome c oxidase assembly pro...    354   2e-114   
ref|XP_011026708.1|  PREDICTED: cytochrome c oxidase assembly pro...    353   3e-114   
ref|XP_007163355.1|  hypothetical protein PHAVU_001G227800g             353   3e-114   
emb|CDY55307.1|  BnaC08g49630D                                          353   6e-114   
ref|XP_009355117.1|  PREDICTED: cytochrome c oxidase assembly pro...    352   1e-113   
ref|XP_010542835.1|  PREDICTED: cytochrome c oxidase assembly pro...    353   1e-113   
gb|KEH33905.1|  cytochrome C oxidase assembly protein CtaG/COX11        352   2e-113   
ref|XP_008346526.1|  PREDICTED: cytochrome c oxidase assembly pro...    351   4e-113   
emb|CDY32464.1|  BnaA09g51320D                                          351   4e-113   
ref|XP_010480954.1|  PREDICTED: cytochrome c oxidase assembly pro...    351   5e-113   
ref|XP_002277478.1|  PREDICTED: cytochrome c oxidase assembly pro...    350   8e-113   Vitis vinifera
ref|XP_007202655.1|  hypothetical protein PRUPE_ppa012273mg             346   1e-112   
ref|XP_010457216.1|  PREDICTED: cytochrome c oxidase assembly pro...    350   2e-112   
ref|XP_010474659.1|  PREDICTED: cytochrome c oxidase assembly pro...    348   4e-112   
gb|KHN24158.1|  Cytochrome c oxidase assembly protein COX11, mito...    342   3e-111   
ref|XP_010274439.1|  PREDICTED: cytochrome c oxidase assembly pro...    345   1e-110   
ref|XP_009118769.1|  PREDICTED: cytochrome c oxidase assembly pro...    342   1e-109   
ref|XP_002889401.1|  cytochrome c oxidase assembly protein CtaG         342   1e-109   
ref|XP_007015810.1|  Cytochrome c oxidase assembly protein CtaG /...    340   1e-109   
ref|XP_006305482.1|  hypothetical protein CARUB_v10009922mg             342   2e-109   
ref|XP_006418343.1|  hypothetical protein EUTSA_v10008363mg             342   2e-109   
ref|NP_001170515.1|  uncharacterized protein LOC100384526               339   3e-109   Zea mays [maize]
ref|XP_009595498.1|  PREDICTED: cytochrome c oxidase assembly pro...    337   4e-109   
gb|AAG00893.1|AC064879_11  Similar to cytochrome-c oxidase assemb...    337   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171743.1|  cytochrome c oxidase assembly protein CtaG / Cox11    338   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004503187.1|  PREDICTED: cytochrome c oxidase assembly pro...    337   8e-108   
ref|XP_009111199.1|  PREDICTED: cytochrome c oxidase assembly pro...    337   1e-107   
gb|ABF98570.1|  Cytochrome c oxidase assembly protein ctaG, putat...    335   2e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009389647.1|  PREDICTED: cytochrome c oxidase assembly pro...    335   3e-107   
gb|ABR21990.1|  avirulence protein-interacting protein                  335   4e-107   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006850996.1|  hypothetical protein AMTR_s00025p00215310          336   6e-107   
ref|XP_004981968.1|  PREDICTED: cytochrome c oxidase assembly pro...    333   1e-106   
emb|CDY61607.1|  BnaC03g71360D                                          334   1e-106   
ref|XP_007015811.1|  Cytochrome c oxidase assembly protein CtaG /...    332   3e-106   
emb|CDY15430.1|  BnaA08g27140D                                          332   8e-106   
ref|XP_002463984.1|  hypothetical protein SORBIDRAFT_01g010010          330   1e-105   Sorghum bicolor [broomcorn]
ref|XP_003560576.1|  PREDICTED: cytochrome c oxidase assembly pro...    328   4e-105   
ref|XP_010936849.1|  PREDICTED: cytochrome c oxidase assembly pro...    330   5e-105   
gb|ABS18735.1|  zinc finger-like protein                                330   5e-105   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008798202.1|  PREDICTED: cytochrome c oxidase assembly pro...    328   1e-104   
gb|EMT15700.1|  Cytochrome c oxidase assembly protein ctaG              327   1e-104   
ref|XP_009119634.1|  PREDICTED: cytochrome c oxidase assembly pro...    328   3e-104   
emb|CDY15242.1|  BnaC05g01210D                                          321   3e-102   
gb|KCW52200.1|  hypothetical protein EUGRSUZ_J01628                     317   1e-100   
ref|XP_006650503.1|  PREDICTED: cytochrome c oxidase assembly pro...    315   1e-100   
ref|XP_001771985.1|  predicted protein                                  305   2e-96    
gb|EAZ28386.1|  hypothetical protein OsJ_12366                          306   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|EPS69466.1|  hypothetical protein M569_05299                         299   1e-94    
emb|CDY64998.1|  BnaC04g02490D                                          292   2e-90    
ref|XP_007215852.1|  hypothetical protein PRUPE_ppa010362mg             289   1e-89    
ref|XP_003600661.1|  Cytochrome c oxidase assembly protein ctaG         289   3e-89    
ref|XP_002977639.1|  hypothetical protein SELMODRAFT_107801             284   1e-88    
ref|XP_002979635.1|  hypothetical protein SELMODRAFT_110960             283   2e-88    
gb|AES70912.2|  cytochrome C oxidase assembly protein CtaG/COX11        276   2e-85    
ref|XP_010274440.1|  PREDICTED: cytochrome c oxidase assembly pro...    265   1e-81    
ref|XP_009780093.1|  PREDICTED: cytochrome c oxidase assembly pro...    267   4e-81    
ref|XP_009389648.1|  PREDICTED: cytochrome c oxidase assembly pro...    262   2e-80    
ref|XP_006432692.1|  hypothetical protein CICLE_v100021202mg            237   2e-71    
ref|XP_005846291.1|  hypothetical protein CHLNCDRAFT_31751              236   3e-70    
ref|XP_002528151.1|  cytochrome C oxidase assembly protein cox11,...    235   9e-70    Ricinus communis
ref|XP_005646193.1|  cytochrome c oxidase assembly protein CtaG/C...    236   2e-69    
ref|XP_002499665.1|  cytochrome c oxidase                               235   4e-68    Micromonas commoda
gb|KEH33906.1|  cytochrome C oxidase assembly protein CtaG/COX11        232   6e-68    
ref|XP_002297920.2|  hypothetical protein POPTR_0001s11910g             231   6e-68    Populus trichocarpa [western balsam poplar]
ref|XP_011026709.1|  PREDICTED: cytochrome c oxidase assembly pro...    228   1e-66    
ref|XP_008356787.1|  PREDICTED: cytochrome c oxidase assembly pro...    227   5e-66    
ref|XP_007513386.1|  predicted protein                                  229   2e-65    
ref|XP_003080420.1|  putative cytochrome c oxidase assembly prote...    226   3e-65    
ref|XP_001418742.1|  cox 11/CtaG family of cytochrome oxidase ass...    221   3e-64    Ostreococcus lucimarinus CCE9901
ref|YP_007890656.1|  heme biosynthesis protein                          220   3e-64    
ref|XP_001700235.1|  cytochrome c oxidase assembly protein              224   3e-64    Chlamydomonas reinhardtii
ref|YP_007890805.1|  heme biosynthesis protein                          214   7e-62    
ref|XP_006418344.1|  hypothetical protein EUTSA_v10008363mg             216   1e-61    
ref|XP_001628890.1|  predicted protein                                  211   1e-60    Nematostella vectensis
gb|KDD74724.1|  cytochrome c oxidase assembly protein CtaG/Cox11        210   1e-60    
ref|YP_007890550.1|  heme biosynthesis protein                          210   1e-60    
ref|XP_002948467.1|  hypothetical protein VOLCADRAFT_80232              213   3e-60    
ref|XP_003058158.1|  predicted protein                                  208   6e-60    
gb|EWM22617.1|  cox11 cytochrome c oxidase assembly protein             212   1e-59    
ref|XP_005715775.1|  unnamed protein product                            212   2e-59    
ref|XP_003388301.1|  PREDICTED: cytochrome c oxidase assembly pro...    209   5e-59    
ref|XP_004342654.1|  cytochrome c oxidase assembly protein COX11        210   5e-59    
gb|EFW42921.2|  cytochrome c oxidase assembly protein COX11             211   9e-59    
gb|ETI34836.1|  hypothetical protein F443_18735                         207   2e-58    
gb|KFH63971.1|  cytochrome c oxidase subunit XI assembly protein        207   3e-58    
gb|ETL81801.1|  hypothetical protein L917_17935                         206   3e-58    
ref|XP_004989205.1|  cytochrome c oxidase assembly protein COX11        207   7e-58    
ref|XP_002427059.1|  cytochrome c oxidase assembly protein COX11,...    205   9e-58    Pediculus humanus corporis [human body lice]
ref|XP_008867627.1|  hypothetical protein H310_04871                    203   2e-57    
ref|XP_002901677.1|  cytochrome c oxidase assembly protein COX11,...    204   2e-57    
ref|XP_008913468.1|  hypothetical protein PPTG_17565                    204   2e-57    
gb|KFM79068.1|  Cytochrome c oxidase assembly protein COX11, mito...    204   3e-57    
ref|NP_044755.1|  component involved in Haem biosynthesis               201   3e-57    Reclinomonas americana
gb|AGH24332.1|  heme biosynthesis protein                               201   5e-57    
emb|CCI42784.1|  unnamed protein product                                201   7e-57    
gb|AGH24265.1|  heme biosynthesis protein                               199   1e-56    
emb|CCA25445.1|  cytochrome c oxidase assembly protein COX11 puta...    199   3e-56    
gb|ELU16788.1|  hypothetical protein CAPTEDRAFT_205254                  199   5e-56    
ref|XP_002109752.1|  hypothetical protein TRIADDRAFT_37145              199   6e-56    Trichoplax adhaerens
ref|XP_004522467.1|  PREDICTED: cytochrome c oxidase assembly pro...    199   7e-56    
gb|EFN84286.1|  Cytochrome c oxidase assembly protein COX11, mito...    199   1e-55    
ref|XP_009516673.1|  hypothetical protein PHYSODRAFT_322923             199   1e-55    
ref|XP_005833946.1|  hypothetical protein GUITHDRAFT_107319             197   2e-55    
ref|XP_002734867.1|  PREDICTED: cytochrome c oxidase assembly pro...    200   4e-55    Saccoglossus kowalevskii
ref|XP_009825281.1|  hypothetical protein H257_03068                    197   5e-55    
ref|XP_005177657.1|  PREDICTED: cytochrome c oxidase assembly pro...    197   6e-55    
ref|XP_001951177.2|  PREDICTED: cytochrome c oxidase assembly pro...    197   7e-55    Acyrthosiphon pisum
gb|EHJ78858.1|  cytochrome c oxidase assembly protein cox11             194   1e-54    
gb|EWY38415.1|  cytochrome C oxidase assembly protein                   195   1e-54    
gb|EWC47569.1|  hypothetical protein DRE_03189                          197   1e-54    
ref|XP_007738671.1|  cytochrome c oxidase assembly protein subuni...    196   1e-54    
ref|XP_003707566.1|  PREDICTED: cytochrome c oxidase assembly pro...    196   2e-54    
ref|XP_007429857.1|  PREDICTED: cytochrome c oxidase assembly pro...    196   2e-54    
dbj|GAA95603.1|  hypothetical protein E5Q_02259                         197   3e-54    
ref|WP_037457231.1|  cytochrome C oxidase assembly protein              193   3e-54    
ref|YP_007890481.1|  heme biosynthesis protein                          193   3e-54    
ref|XP_008605065.1|  hypothetical protein SDRG_01325                    194   4e-54    
gb|KDR12674.1|  Cytochrome c oxidase assembly protein COX11, mito...    195   4e-54    
ref|WP_035693154.1|  cytochrome C oxidase assembly protein              193   5e-54    
ref|XP_002404242.1|  cytochrome C oxidase assembly protein COX11,...    194   5e-54    Ixodes scapularis [blacklegged tick]
gb|EFX74136.1|  hypothetical protein DAPPUDRAFT_307441                  195   6e-54    
ref|XP_003675509.1|  hypothetical protein NCAS_0C01520                  196   6e-54    
ref|XP_007418976.1|  hypothetical protein MELLADRAFT_73700              196   6e-54    
gb|EFZ17766.1|  hypothetical protein SINV_10549                         194   7e-54    
ref|XP_011123345.1|  hypothetical protein AOL_s00081g226                195   7e-54    
ref|XP_002934512.1|  PREDICTED: cytochrome c oxidase assembly pro...    194   7e-54    
ref|XP_008543198.1|  PREDICTED: cytochrome c oxidase assembly pro...    194   9e-54    
gb|EXX73953.1|  Cox11p                                                  195   1e-53    
ref|NP_001076427.1|  COX11 homolog, cytochrome c oxidase assembly...    194   1e-53    Danio rerio [leopard danio]
gb|EGI66518.1|  Cytochrome c oxidase assembly protein COX11, mito...    192   1e-53    
ref|XP_784389.2|  PREDICTED: cytochrome c oxidase assembly protei...    197   1e-53    Strongylocentrotus purpuratus [purple urchin]
ref|XP_011052777.1|  PREDICTED: cytochrome c oxidase assembly pro...    193   2e-53    
ref|XP_004707453.1|  PREDICTED: cytochrome c oxidase assembly pro...    194   2e-53    
ref|XP_003738904.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   3e-53    
gb|KGO73904.1|  Cytochrome c oxidase assembly protein CtaG/Cox11        193   3e-53    
ref|XP_003492651.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   3e-53    
gb|EGT37204.1|  hypothetical protein CAEBREN_24455                      193   3e-53    
gb|KFY56838.1|  hypothetical protein V496_06629                         191   4e-53    
ref|XP_010753659.1|  PREDICTED: cytochrome c oxidase assembly pro...    193   4e-53    
ref|XP_003397507.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   4e-53    
ref|XP_003224322.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   4e-53    
gb|KFY87309.1|  hypothetical protein V498_07225                         191   5e-53    
ref|XP_623232.1|  PREDICTED: cytochrome c oxidase assembly protei...    192   5e-53    Apis mellifera [bee]
ref|XP_003449497.1|  PREDICTED: cytochrome c oxidase assembly pro...    193   5e-53    
ref|XP_004933673.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   5e-53    
emb|CAF90980.1|  unnamed protein product                                193   5e-53    Tetraodon nigroviridis
gb|KFY45179.1|  hypothetical protein V494_01104                         191   5e-53    
ref|XP_011107029.1|  hypothetical protein H072_1037                     193   5e-53    
ref|XP_008207587.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   6e-53    
ref|XP_005526904.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   6e-53    
ref|XP_001608008.2|  PREDICTED: cytochrome c oxidase assembly pro...    191   6e-53    Nasonia vitripennis
ref|XP_003414440.1|  PREDICTED: cytochrome c oxidase assembly pro...    193   6e-53    
ref|XP_006608609.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   6e-53    
ref|XP_008297340.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   7e-53    
emb|CDM37149.1|  Cytochrome c oxidase assembly protein CtaG/Cox11       192   7e-53    
ref|XP_006278604.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   7e-53    
ref|XP_006635437.1|  PREDICTED: cytochrome c oxidase assembly pro...    195   8e-53    
ref|XP_003679130.1|  hypothetical protein TDEL_0A05870                  192   8e-53    
gb|ETN76752.1|  cytochrome C oxidase assembly protein CtaG family...    191   9e-53    
ref|XP_002485454.1|  cytochrome c oxidase assembly protein Cox11,...    191   9e-53    Talaromyces stipitatus ATCC 10500
gb|KFY71023.1|  hypothetical protein V499_08761                         192   1e-52    
ref|XP_005944824.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   1e-52    
ref|XP_005752827.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   1e-52    
gb|KFY37055.1|  hypothetical protein V495_07417                         192   1e-52    
gb|KFY23142.1|  hypothetical protein V493_06057                         191   1e-52    
gb|ELR08139.1|  hypothetical protein GMDG_02961                         191   1e-52    
ref|XP_006793363.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   1e-52    
gb|KGO49011.1|  Cytochrome c oxidase assembly protein CtaG/Cox11        191   1e-52    
dbj|BAE59874.1|  unnamed protein product                                190   1e-52    Aspergillus oryzae
gb|EFA00450.1|  hypothetical protein TcasGA2_TC003306                   190   2e-52    
ref|XP_007004010.1|  hypothetical protein TREMEDRAFT_43811              190   2e-52    
ref|XP_007342985.1|  hypothetical protein AURDEDRAFT_85449              190   2e-52    
ref|XP_007292478.1|  cytochrome-c oxidase assembly protein              191   2e-52    
ref|XP_974674.2|  PREDICTED: cytochrome c oxidase assembly protei...    190   2e-52    Tribolium castaneum [rust-red flour beetle]
ref|XP_001208527.1|  cytochrome c oxidase assembly protein COX11,...    191   2e-52    Aspergillus terreus NIH2624
ref|XP_006000003.1|  PREDICTED: cytochrome c oxidase assembly pro...    192   2e-52    
ref|XP_003108120.1|  hypothetical protein CRE_10286                     192   2e-52    
ref|XP_007947843.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   2e-52    
ref|XP_007889223.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   2e-52    
ref|NP_001279426.1|  cytochrome c oxidase assembly protein COX11,...    191   2e-52    
gb|AEE61980.1|  unknown                                                 190   2e-52    
gb|EPS28277.1|  hypothetical protein PDE_03223                          191   2e-52    
ref|XP_004565328.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   3e-52    
gb|ELK01685.1|  Cytochrome c oxidase assembly protein COX11, mito...    191   3e-52    
ref|XP_001545817.1|  cytochrome-c oxidase assembly protein              191   3e-52    Botrytis cinerea B05.10
gb|ESA20821.1|  hypothetical protein GLOINDRAFT_125808                  188   3e-52    
ref|XP_003690238.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   3e-52    
gb|ACI69748.1|  Cytochrome c oxidase assembly protein COX11, mito...    191   3e-52    Salmo salar
ref|XP_005806787.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   3e-52    
ref|XP_001821876.2|  cytochrome c oxidase assembly protein Cox11        190   3e-52    Aspergillus oryzae RIB40
ref|XP_007565296.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   4e-52    
ref|XP_002563935.1|  Pc20g14590                                         189   4e-52    Penicillium rubens Wisconsin 54-1255
ref|XP_007725820.1|  cytochrome c oxidase assembly protein subuni...    190   4e-52    
ref|XP_010898004.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   4e-52    
dbj|GAA82261.1|  cytochrome c oxidase assembly protein COX11, mit...    190   4e-52    
dbj|GAK45017.1|  cytochrome c oxidase assembly protein CtaG/Cox11       188   4e-52    
gb|EFN71398.1|  Cytochrome c oxidase assembly protein COX11, mito...    188   4e-52    
ref|XP_008145970.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   5e-52    
ref|XP_003800071.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   5e-52    
gb|ENN76046.1|  hypothetical protein YQE_07419                          189   5e-52    
gb|EEQ87541.1|  mitochondrial cytochrome c oxidase assembly facto...    190   5e-52    Blastomyces dermatitidis ER-3
emb|CDQ80861.1|  unnamed protein product                                191   5e-52    
tpe|CBF69758.1|  TPA: cytochrome c oxidase assembly protein Cox11...    190   5e-52    
gb|EYC44261.1|  hypothetical protein Y032_0466g1958                     190   5e-52    
ref|XP_002624084.1|  mitochondrial cytochrome c oxidase assembly ...    190   5e-52    Blastomyces gilchristii SLH14081
emb|CCE26916.1|  probable cytochrome-c oxidase assembly protein (...    190   5e-52    
gb|EMS21220.1|  cytochrome c oxidase assembly protein COX11             191   5e-52    
ref|XP_008072662.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   5e-52    
ref|XP_311504.3|  AGAP010443-PA                                         189   5e-52    Anopheles gambiae str. PEST
gb|ETE70619.1|  Cytochrome c oxidase assembly protein COX11, mito...    189   5e-52    
ref|XP_002583428.1|  cytochrome c oxidase assembly protein ctaG         189   5e-52    Uncinocarpus reesii 1704
ref|XP_007694500.1|  hypothetical protein COCSADRAFT_194937             190   6e-52    
ref|XP_010355739.1|  PREDICTED: cytochrome c oxidase assembly pro...    191   6e-52    
gb|KDE02595.1|  hypothetical protein MVLG_06857                         192   6e-52    
gb|EGU11323.1|  Cytochrome c oxidase assembly protein COX11             191   6e-52    
gb|EYC44262.1|  hypothetical protein Y032_0466g1958                     189   6e-52    
ref|XP_008435904.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   6e-52    
ref|XP_006095640.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   6e-52    
ref|XP_008313204.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   6e-52    
ref|XP_004669996.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   7e-52    
ref|XP_002748455.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   7e-52    Callithrix jacchus [common marmoset]
ref|XP_001275506.1|  cytochrome c oxidase assembly protein Cox11,...    189   7e-52    Aspergillus clavatus NRRL 1
ref|XP_003977280.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   7e-52    
ref|NP_001076872.1|  cytochrome c oxidase assembly protein COX11,...    190   7e-52    Bos taurus [bovine]
ref|NP_001182369.1|  COX11 homolog, cytochrome c oxidase assembly...    190   8e-52    
emb|CEJ93958.1|  Putative Cytochrome-c oxidase assembly protein         190   8e-52    
ref|XP_004271851.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome c...    190   8e-52    
gb|EMD96215.1|  hypothetical protein COCHEDRAFT_1221819                 189   8e-52    
gb|EYE97708.1|  putative cytochrome c oxidase assembly protein Cox11    189   8e-52    
ref|XP_001865568.1|  cytochrome c oxidase assembly protein COX11,...    189   8e-52    Culex quinquefasciatus
ref|XP_010898003.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   8e-52    
gb|EHH57976.1|  hypothetical protein EGM_07733                          190   8e-52    
ref|XP_005583821.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   9e-52    
ref|XP_005706970.1|  cytochrome c oxidase subunit XI assembly pro...    188   9e-52    
ref|NP_502547.2|  Protein JC8.5                                         189   9e-52    Caenorhabditis elegans [roundworm]
ref|XP_006095639.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   9e-52    
ref|XP_005872619.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   9e-52    
gb|ESZ90066.1|  cytochrome c oxidase assembly protein COX11             187   1e-51    
ref|XP_003295633.1|  hypothetical protein PTT_01989                     187   1e-51    
ref|NP_001051089.2|  Os03g0718600                                       183   1e-51    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA19212.1|  TPA: cytochrome c oxidase assembly protein COX11...    190   1e-51    
ref|XP_003483070.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   1e-51    
ref|XP_008583371.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   1e-51    
ref|XP_003912824.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   1e-51    
ref|XP_007710891.1|  hypothetical protein COCCADRAFT_35589              189   1e-51    
ref|XP_004208324.1|  PREDICTED: multiple epidermal growth factor-...    200   1e-51    
gb|ETN61161.1|  cytochrome c oxidase assembly protein COX11, mito...    188   1e-51    
ref|NP_001103045.1|  cytochrome c oxidase assembly protein 11           189   1e-51    Rattus norvegicus [brown rat]
gb|KFB44178.1|  AGAP010443-PA-like protein                              188   1e-51    
gb|EJU04793.1|  hypothetical protein DACRYDRAFT_20412                   190   1e-51    
ref|XP_004415958.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_001584740.1|  hypothetical protein SS1G_14353                    187   2e-51    Sclerotinia sclerotiorum 1980 UF-70
emb|CCD43665.1|  similar to cytochrome oxidase assembly factor Cox11    189   2e-51    
ref|XP_866470.2|  PREDICTED: cytochrome c oxidase assembly protei...    190   2e-51    Canis lupus familiaris [dogs]
ref|XP_002719330.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_005394146.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|NP_723086.1|  CG31648                                               188   2e-51    
ref|XP_008836639.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_005901359.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_002925582.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome c...    189   2e-51    
ref|XP_006744716.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_007686922.1|  hypothetical protein COCMIDRAFT_92429              189   2e-51    
ref|XP_001503322.2|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_008009607.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_004897528.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
gb|EGC46545.1|  mitochondrial cytochrome c oxidase assembly factor      188   2e-51    
ref|XP_006753229.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   2e-51    
ref|XP_004080792.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   3e-51    
emb|CCK72233.1|  hypothetical protein KNAG_0J01520                      189   3e-51    
ref|XP_002827408.1|  PREDICTED: cytochrome c oxidase assembly pro...    189   3e-51    
ref|XP_004591064.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   3e-51    
ref|XP_005075876.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   3e-51    
ref|XP_004645358.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   4e-51    
ref|XP_005350586.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   4e-51    
ref|XP_006972073.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   4e-51    
ref|XP_009032866.1|  hypothetical protein AURANDRAFT_6303               185   4e-51    
ref|XP_003817471.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   4e-51    
gb|EDL15888.1|  COX11 homolog, cytochrome c oxidase assembly prot...    188   4e-51    
ref|XP_006080520.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   4e-51    
ref|XP_001160768.2|  PREDICTED: cytochrome c oxidase assembly pro...    188   4e-51    
ref|XP_001658032.1|  cytochrome c oxidase assembly protein cox11        187   5e-51    
ref|XP_009153858.1|  cytochrome c oxidase subunit XI assembly pro...    187   5e-51    
gb|KIH69124.1|  cytidine and deoxycytidylate deaminase zinc-bindi...    188   5e-51    
ref|XP_009065341.1|  hypothetical protein LOTGIDRAFT_155552             186   5e-51    
ref|XP_010618641.1|  PREDICTED: cytochrome c oxidase assembly pro...    190   5e-51    
gb|AAX43073.1|  COX11-like cytochrome c oxidase assembly protein        188   6e-51    
ref|NP_004366.1|  cytochrome c oxidase assembly protein COX11, mi...    188   6e-51    
gb|AAX36778.1|  COX11-like cytochrome c oxidase assembly protein        188   6e-51    
ref|XP_003467083.2|  PREDICTED: cytochrome c oxidase assembly pro...    188   6e-51    
ref|XP_007259402.1|  PREDICTED: cytochrome c oxidase assembly pro...    187   6e-51    
ref|NP_950173.1|  cytochrome c oxidase assembly protein COX11, mi...    187   6e-51    
gb|AAX41440.1|  COX11-like cytochrome c oxidase assembly protein        187   6e-51    
emb|CDG24132.1|  Protein COX-11, isoform b                              185   7e-51    
ref|XP_003768023.1|  PREDICTED: cytochrome c oxidase assembly pro...    185   7e-51    
ref|XP_004434799.1|  PREDICTED: cytochrome c oxidase assembly pro...    187   7e-51    
ref|XP_001399569.2|  cytochrome c oxidase assembly protein Cox11        187   7e-51    
ref|XP_004041359.1|  PREDICTED: cytochrome c oxidase assembly pro...    187   7e-51    
ref|XP_010988672.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   8e-51    
gb|KHJ94800.1|  cytidine and deoxycytidylate deaminase zinc-bindi...    191   9e-51    
emb|CAK37571.1|  unnamed protein product                                185   9e-51    
ref|XP_002553162.1|  KLTH0D10406p                                       186   9e-51    
ref|XP_002078244.1|  GD23348                                            186   9e-51    
ref|XP_008021737.1|  hypothetical protein SETTUDRAFT_145315             187   1e-50    
gb|EKG21772.1|  hypothetical protein MPH_00895                          184   1e-50    
ref|WP_014240851.1|  cytochrome C oxidase assembly protein              184   1e-50    
ref|XP_003996722.2|  PREDICTED: LOW QUALITY PROTEIN: cytochrome c...    187   1e-50    
ref|XP_007762252.1|  cytochrome c oxidase assembly protein subuni...    184   1e-50    
ref|XP_004012430.1|  PREDICTED: cytochrome c oxidase assembly pro...    187   1e-50    
ref|XP_010949400.1|  PREDICTED: cytochrome c oxidase assembly pro...    188   1e-50    
emb|CCU77181.1|  Cox11/cytochrome-c oxidase assembly protein            186   1e-50    
ref|XP_010577052.1|  PREDICTED: cytochrome c oxidase assembly pro...    186   1e-50    
gb|EZA61331.1|  Cytochrome c oxidase assembly protein COX11, mito...    185   2e-50    
ref|XP_008599495.1|  cytochrome c oxidase assembly protein CtaG/C...    186   2e-50    
ref|XP_009266044.1|  hypothetical protein J056_000371                   184   2e-50    
ref|WP_032112397.1|  cytochrome C oxidase assembly protein              183   2e-50    
ref|XP_006667709.1|  cytochrome-c oxidase assembly protein              186   2e-50    
ref|XP_001245788.1|  hypothetical protein CIMG_05229                    186   2e-50    
gb|AAH05895.1|  COX11 homolog, cytochrome c oxidase assembly prot...    186   2e-50    
ref|XP_007531477.1|  PREDICTED: cytochrome c oxidase assembly pro...    186   2e-50    
ref|XP_003670286.1|  hypothetical protein NDAI_0E02260                  187   2e-50    
ref|XP_006019861.1|  PREDICTED: cytochrome c oxidase assembly pro...    182   2e-50    
ref|XP_003333692.1|  cytochrome c oxidase subunit XI assembly pro...    187   2e-50    
ref|XP_007751097.1|  cytochrome c oxidase assembly protein subuni...    183   2e-50    
gb|ERG82461.1|  cytochrome c oxidase assembly protein                   186   3e-50    
ref|XP_006960088.1|  hypothetical protein WALSEDRAFT_61269              183   3e-50    
ref|XP_005282851.1|  PREDICTED: cytochrome c oxidase assembly pro...    182   3e-50    
gb|AEY95624.1|  FACR106Cp                                               186   3e-50    
ref|XP_453373.1|  hypothetical protein                                  185   3e-50    
gb|KFY07442.1|  hypothetical protein V492_07136                         186   4e-50    
ref|XP_009240475.1|  PREDICTED: cytochrome c oxidase assembly pro...    186   4e-50    
ref|NP_983508.1|  ACR106Cp                                              185   4e-50    
gb|KID88836.1|  cytochrome-c oxidase assembly protein                   185   4e-50    
gb|EPE07798.1|  cytochrome c oxidase assembly protein cox11             185   4e-50    
ref|XP_003958805.1|  hypothetical protein KAFR_0H02610                  186   4e-50    
emb|CDH52668.1|  cytochrome c oxidase assembly protein cox11            184   4e-50    
ref|XP_007582329.1|  putative cytochrome c oxidase assembly prote...    184   4e-50    
ref|XP_003648421.1|  hypothetical protein Ecym_8326                     185   4e-50    
ref|XP_003736141.1|  GA16364                                            184   4e-50    
ref|WP_035674792.1|  cytochrome C oxidase assembly protein              183   4e-50    
ref|WP_008889199.1|  cytochrome C oxidase assembly protein              182   6e-50    
ref|XP_003686240.1|  hypothetical protein TPHA_0F03250                  186   6e-50    
gb|KFO34982.1|  Cytochrome c oxidase assembly protein COX11, mito...    181   6e-50    
emb|CDS09923.1|  Putative Cytochrome c oxidase assembly proteinFT...    184   6e-50    
gb|EPB87979.1|  cytochrome c oxidase assembly protein subunit 11        182   6e-50    
ref|XP_010762531.1|  hypothetical protein PADG_07058                    184   7e-50    
gb|EEH22999.1|  hypothetical protein PABG_05210                         184   7e-50    
dbj|BAP70767.1|  ctaG Cox11 super family                                184   7e-50    
dbj|BAO39256.1|  ctaG_Cox11 super family                                184   7e-50    
ref|XP_002797655.1|  cytochrome c oxidase assembly protein ctaG         184   8e-50    
ref|XP_004608706.1|  PREDICTED: cytochrome c oxidase assembly pro...    181   8e-50    
gb|EFQ31664.1|  cytochrome c oxidase assembly protein CtaG/Cox11        184   8e-50    
ref|XP_002148779.1|  cytochrome c oxidase assembly protein Cox11,...    184   8e-50    
ref|XP_003856662.1|  hypothetical protein MYCGRDRAFT_67205              182   9e-50    
emb|CDR38397.1|  CYFA0S02e01222g1_1                                     185   9e-50    
gb|AGO11357.1|  AaceriACR106Cp                                          184   1e-49    
emb|CDO93598.1|  unnamed protein product                                183   1e-49    
dbj|BAG57249.1|  unnamed protein product                                181   1e-49    
ref|XP_007918208.1|  hypothetical protein UCRPA7_7487                   181   1e-49    
ref|XP_008077453.1|  Ctag/Cox11                                         184   1e-49    
ref|WP_014247774.1|  cytochrome C oxidase assembly protein              182   1e-49    
emb|CAH92164.1|  hypothetical protein                                   184   1e-49    
emb|CCF51218.1|  probable COX11-cytochrome-c oxidase assembly pro...    185   1e-49    
ref|XP_002634234.1|  Hypothetical protein CBG01804                      188   1e-49    
gb|EPQ62902.1|  Mitochondrial inner membrane protein                    183   1e-49    
ref|WP_033067825.1|  cytochrome C oxidase assembly protein              181   2e-49    
ref|XP_003350712.1|  hypothetical protein SMAC_02384                    185   2e-49    
sp|Q5R7U6.2|COX11_PONAB  RecName: Full=Cytochrome c oxidase assem...    184   2e-49    
ref|XP_002184365.1|  predicted protein                                  181   2e-49    
ref|XP_756873.1|  hypothetical protein UM00726.1                        186   2e-49    
ref|WP_039718565.1|  cytochrome C oxidase assembly protein              181   2e-49    
dbj|GAC99487.1|  cytochrome c oxidase assembly protein COX11            184   2e-49    
ref|WP_012973848.1|  cytochrome C oxidase assembly protein              181   3e-49    
gb|EME48551.1|  cytochrome c oxidase assembly-like protein              182   3e-49    
gb|EIE85319.1|  hypothetical protein RO3G_10029                         180   3e-49    
ref|XP_008715137.1|  hypothetical protein HMPREF1541_02560              182   3e-49    
ref|XP_007677582.1|  hypothetical protein BAUCODRAFT_72622              181   3e-49    
gb|KEQ83592.1|  hypothetical protein M438DRAFT_346529                   182   4e-49    
gb|ABU46289.1|  mitochondrial cytochrome c oxidase assembly facto...    182   4e-49    
ref|XP_007919865.1|  hypothetical protein MYCFIDRAFT_28394              181   4e-49    
emb|CDI51659.1|  probable COX11-cytochrome-c oxidase assembly pro...    184   4e-49    
ref|XP_006432693.1|  hypothetical protein CICLE_v100021202mg            176   4e-49    
ref|XP_007383003.1|  hypothetical protein PUNSTDRAFT_120104             181   4e-49    
gb|EZF31790.1|  hypothetical protein H101_04615                         181   5e-49    
ref|XP_006432691.1|  hypothetical protein CICLE_v100021202mg            176   5e-49    
ref|WP_033405419.1|  cytochrome C oxidase assembly protein              180   6e-49    
emb|CDH08746.1|  related to Cytochrome c oxidase assembly protein...    182   6e-49    
emb|CCX05189.1|  Similar to Cytochrome c oxidase assembly protein...    182   6e-49    
emb|CEF63678.1|  Cytochrome b5 reductase 4                              191   7e-49    
ref|XP_008492804.1|  PREDICTED: cytochrome c oxidase assembly pro...    179   7e-49    
ref|WP_007092273.1|  cytochrome C oxidase assembly protein              179   7e-49    
ref|XP_003047986.1|  predicted protein                                  181   7e-49    
emb|CAA39263.1|  unnamed protein product                                182   7e-49    
ref|XP_003236560.1|  cytochrome c oxidase assembly protein              181   7e-49    
emb|CDF91017.1|  ZYBA0S09-02938g1_1                                     182   7e-49    
gb|KDQ14401.1|  hypothetical protein BOTBODRAFT_55541                   179   8e-49    
gb|EHM99873.1|  Cox11p                                                  182   8e-49    
gb|EGD93761.1|  cytochrome c oxidase assembly protein                   181   8e-49    
gb|ENH78947.1|  cytochrome c oxidase assembly protein                   179   8e-49    
gb|EHA22857.1|  hypothetical protein ASPNIDRAFT_174098                  180   8e-49    
ref|WP_035530949.1|  cytochrome C oxidase assembly protein              179   8e-49    
gb|KFG81783.1|  cytochrome-c oxidase assembly protein                   182   8e-49    
gb|KHN99198.1|  cytochrome-c oxidase assembly protein                   181   9e-49    
ref|XP_636275.1|  cytochrome c oxidase assembly protein                 183   9e-49    
gb|EXK38057.1|  cytochrome c oxidase assembly protein subunit 11        181   9e-49    
gb|EJT44094.1|  COX11-like protein                                      182   9e-49    
ref|XP_391022.1|  hypothetical protein FG10846.1                        181   1e-48    
ref|WP_011477199.1|  cysteine synthase                                  178   1e-48    
ref|XP_002491116.1|  Mitochondrial inner membrane protein require...    181   1e-48    
ref|XP_007818810.1|  cytochrome-c oxidase assembly protein              181   1e-48    
emb|CCH44242.1|  Cytochrome c oxidase assembly protein COX11,mito...    182   1e-48    
ref|XP_003174824.1|  cytochrome c oxidase assembly protein ctaG         181   1e-48    
emb|CCA68883.1|  probable COX11-cytochrome-c oxidase assembly pro...    180   1e-48    
gb|KID76677.1|  cytochrome-c oxidase assembly protein                   181   1e-48    
ref|WP_012568759.1|  cytochrome C oxidase assembly protein              179   1e-48    
ref|XP_004350816.1|  cytochrome c oxidase assembly protein              182   1e-48    
dbj|GAM37583.1|  DNA clamp loader                                       188   1e-48    
ref|XP_009656301.1|  cytochrome c oxidase assembly protein COX11        180   1e-48    
ref|XP_007595767.1|  cytochrome c oxidase assembly protein CtaG/C...    181   1e-48    
gb|EWG93017.1|  Cox11p                                                  182   2e-48    
ref|XP_006674947.1|  hypothetical protein BATDEDRAFT_7884               179   2e-48    
gb|KEQ60623.1|  hypothetical protein M437DRAFT_68156                    181   2e-48    
ref|XP_011105788.1|  cox11p                                             182   2e-48    
ref|XP_001260684.1|  cytochrome c oxidase assembly protein Cox11,...    179   2e-48    
gb|EGA56520.1|  Cox11p                                                  182   2e-48    
ref|NP_015193.1|  Cox11p                                                182   2e-48    
gb|KHN74510.1|  Cytochrome c oxidase assembly protein COX11, mito...    181   2e-48    
ref|XP_449463.1|  hypothetical protein                                  181   2e-48    
ref|WP_037987151.1|  cytochrome C oxidase assembly protein              178   2e-48    
gb|EQB52568.1|  cytochrome c oxidase assembly protein CtaG/Cox11        180   2e-48    
ref|XP_002846515.1|  cytochrome c oxidase assembly protein COX11        179   2e-48    
ref|WP_033193371.1|  cytochrome C oxidase assembly protein              177   3e-48    
ref|XP_007872435.1|  hypothetical protein PNEG_00544                    179   3e-48    
ref|XP_004747421.1|  PREDICTED: cytochrome c oxidase assembly pro...    180   3e-48    
ref|XP_009261251.1|  hypothetical protein FPSE_09859                    180   3e-48    
gb|EST06658.1|  cytochrome oxidase assembly factor COX11                177   3e-48    
gb|EHK45417.1|  hypothetical protein TRIATDRAFT_151269                  180   3e-48    
emb|CCT71558.1|  probable cytochrome-c oxidase assembly protein (...    179   3e-48    
gb|KDQ57321.1|  hypothetical protein JAAARDRAFT_131178                  179   3e-48    
gb|KIE02582.1|  cytochrome-c oxidase assembly protein                   180   4e-48    
emb|CDJ04288.1|  Cytochrome c oxidase assembly protein COX11            178   4e-48    
ref|XP_003027146.1|  hypothetical protein SCHCODRAFT_44963              178   4e-48    
ref|XP_009168710.1|  hypothetical protein T265_05439                    179   4e-48    
ref|XP_007273825.1|  cytochrome-c oxidase assembly protein              179   4e-48    
emb|CCF46323.1|  cytochrome c oxidase assembly protein CtaG/Cox11       177   5e-48    
gb|EMF17111.1|  cytochrome c oxidase assembly protein-like protein      178   5e-48    
gb|EPX74762.1|  cytochrome c oxidase assembly protein COX11             189   5e-48    
gb|KDB13861.1|  amine oxidase                                           185   5e-48    
emb|CDS23648.1|  Cytochrome c oxidase assembly protein COX11            178   5e-48    
gb|EAA27043.2|  cytochrome-c oxidase assembly protein                   181   6e-48    
ref|XP_009852057.1|  hypothetical protein NEUTE1DRAFT_130413            181   6e-48    
ref|XP_002497482.1|  ZYRO0F06534p                                       179   6e-48    
gb|KFA67121.1|  hypothetical protein S40285_02976                       179   6e-48    
gb|EEH11562.1|  conserved hypothetical protein                          187   6e-48    
gb|ESW97037.1|  Cytochrome c oxidase assembly protein COX11, mito...    179   7e-48    
ref|XP_004684449.1|  PREDICTED: cytochrome c oxidase assembly pro...    179   7e-48    
gb|EXL43180.1|  cytochrome c oxidase assembly protein subunit 11        179   8e-48    
gb|EMT73242.1|  Cytochrome c oxidase assembly protein COX11, mito...    179   8e-48    
emb|CBQ68150.1|  probable COX11-cytochrome-c oxidase assembly pro...    181   8e-48    
ref|XP_007836172.1|  hypothetical protein PFICI_09400                   179   8e-48    
ref|XP_007879067.1|  hypothetical protein PFL1_03359                    177   9e-48    
ref|XP_009562222.1|  PREDICTED: cytochrome c oxidase assembly pro...    175   1e-47    
ref|WP_035725603.1|  cytochrome C oxidase assembly protein              176   1e-47    
gb|KFO78435.1|  hypothetical protein N303_15664                         175   1e-47    
ref|XP_001644195.1|  hypothetical protein Kpol_1059p27                  179   1e-47    
gb|KEQ93170.1|  hypothetical protein AUEXF2481DRAFT_67826               176   1e-47    
gb|EUB56028.1|  Cytochrome c oxidase assembly protein COX11             177   1e-47    
gb|KEY66917.1|  hypothetical protein S7711_06868                        182   1e-47    
gb|EGU74378.1|  hypothetical protein FOXB_15112                         178   1e-47    
ref|XP_007393602.1|  hypothetical protein PHACADRAFT_117099             177   1e-47    
ref|XP_007318504.1|  hypothetical protein SERLADRAFT_369737             177   1e-47    
gb|EPT05550.1|  hypothetical protein FOMPIDRAFT_1021359                 177   1e-47    
ref|WP_038463237.1|  cytochrome C oxidase assembly protein              175   1e-47    
gb|EUC57122.1|  cytochrome C oxidase assembly protein COX11             178   1e-47    
gb|KFA46286.1|  hypothetical protein S40293_06491                       182   1e-47    
ref|XP_004182557.1|  hypothetical protein TBLA_0J00380                  177   1e-47    



>ref|XP_009595496.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009595497.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nicotiana tomentosiformis]
Length=287

 Score =   398 bits (1022),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 207/298 (69%), Positives = 222/298 (74%), Gaps = 15/298 (5%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLM  548
             MS  R+ GR     S   T     S SR+ L I+  +       +    ++   GC    
Sbjct  1     MSLSRLSGRLNLFLSLNRTHYYPLSASRDYLGIVVSKDRNRGPIDIRHGQLFGLGCRGFT  60

Query  549   PRCEFRSVVDSN---IPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGL  719
              RCEF+     N   +PF  L   ST R+  MLN  H YAT+A  TEKKSKKML YLTGL
Sbjct  61    SRCEFKRSTLHNCKGLPF--LRGQSTVRAWPMLNLHHHYATQATATEKKSKKMLFYLTGL  118

Query  720   VFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADV  899
             VFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DG V++REI VQFNADV
Sbjct  119   VFAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGRVTSREIAVQFNADV  178

Query  900   ADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKA  1079
             ADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKA
Sbjct  179   ADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKA  228

Query  1080  AVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             AVYFNKIQCFCFEEQ+LLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD
Sbjct  229   AVYFNKIQCFCFEEQKLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  286



>ref|XP_004239062.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Solanum lycopersicum]
Length=287

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 203/297 (68%), Positives = 219/297 (74%), Gaps = 11/297 (4%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLM  548
             MS FR+  R   L S   T     STSR  L+I+A +     V NN   ++  FG     
Sbjct  1     MSLFRLSRRVNPLLSLNRTHHYPLSTSREYLEIVASKDINLGVINNKYGQIFGFGYRGFT  60

Query  549   PRCEFRSVVDSNIPFSNLGR-HSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVF  725
              RCE       N    +  R  ST  S  +LN  H YAT+A  TE KS+KML YL GLVF
Sbjct  61    SRCELNKSTLHNCKGPSFLRGQSTVTSWPVLNLHHHYATQATATENKSRKMLFYLVGLVF  120

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             AMVG SYAAVPLYRRFCQATGYGGT+QR+ESVEEKIARH  DG V++REI VQFNADVAD
Sbjct  121   AMVGASYAAVPLYRRFCQATGYGGTIQRRESVEEKIARHEKDGRVTSREIAVQFNADVAD  180

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
             GMPWKF PTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV
Sbjct  181   GMPWKFTPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  230

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKVSD+
Sbjct  231   YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSDK  287



>ref|XP_009780090.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009780091.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009780092.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nicotiana sylvestris]
Length=287

 Score =   394 bits (1013),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 205/296 (69%), Positives = 222/296 (75%), Gaps = 11/296 (4%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLM  548
             MS  R+ GR     S   T     STSR+ L+I+  +   F   +    ++         
Sbjct  1     MSLSRLSGRVNLFLSSNRTCCYPLSTSRDYLEIVVSKDRNFGAIDIRHGQLFGLRYRGFT  60

Query  549   PRCEF-RSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVF  725
              RCE  +S + +    S L   ST RS  MLN +H YAT+A  TEKKSKKML YLTGLVF
Sbjct  61    SRCELNKSTLHNCERLSFLRGQSTVRSWPMLNLRHHYATQATATEKKSKKMLFYLTGLVF  120

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DG  ++REI VQFNADVAD
Sbjct  121   AMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGRATSREIAVQFNADVAD  180

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
             GMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV
Sbjct  181   GMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  230

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             YFNKIQCFCFEEQ+LLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD
Sbjct  231   YFNKIQCFCFEEQKLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  286



>ref|XP_006348705.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Solanum tuberosum]
Length=287

 Score =   394 bits (1011),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 201/297 (68%), Positives = 218/297 (73%), Gaps = 11/297 (4%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLM  548
             MS FR+  R   L S         STSR  L+I+A +       NN   ++  FG     
Sbjct  1     MSLFRLSRRVNPLLSLNRNHHYPLSTSREYLEIVASKDINLGAINNKYGQIFGFGYRGFT  60

Query  549   PRCEFRSVVDSNIPFSNLGR-HSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVF  725
              RCE       N    +  R  ST +S  +LN  H YAT+A  TE KS+KML YL GLVF
Sbjct  61    SRCELNKSTLHNCKGPSFLRGQSTVKSWPVLNHHHHYATQATATENKSRKMLFYLVGLVF  120

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             AMVG SYAAVPLYRRFCQATGYGGT+QR+ESVEEKIARH  DG V++REI VQFNADVAD
Sbjct  121   AMVGASYAAVPLYRRFCQATGYGGTIQRRESVEEKIARHEKDGRVTSREIAVQFNADVAD  180

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
             GMPWKF PTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV
Sbjct  181   GMPWKFTPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  230

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKVSD+
Sbjct  231   YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSDK  287



>ref|XP_011085890.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Sesamum indicum]
Length=275

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 199/297 (67%), Positives = 218/297 (73%), Gaps = 24/297 (8%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNG-RWKVSSFGCGSL  545
             MSF R F  T+   S   +  L    SR+ L  +  RY+     +N  R +   F C   
Sbjct  1     MSFSRCFRGTRIFSSISNSRNLGPFLSRHLLDGVGSRYNFVGASDNIIRGQRFGFQCRGF  60

Query  546   MPRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVF  725
             M +  ++S            R  T  +    +F  QYAT A   EKKSKKML YLTGLVF
Sbjct  61    MSKRGYKS------------RSYTLENLVSTSFNRQYATHAT-PEKKSKKMLFYLTGLVF  107

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             AMVGCSYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARH  DGTV++REIVVQFNADVAD
Sbjct  108   AMVGCSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHVKDGTVTSREIVVQFNADVAD  167

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
             GMPWKF+PTQREV          RVKPGESALAFYTAENRSS PITGVSTYNVTPMKAA+
Sbjct  168   GMPWKFVPTQREV----------RVKPGESALAFYTAENRSSAPITGVSTYNVTPMKAAI  217

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKVS+E
Sbjct  218   YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE  274



>ref|XP_007015809.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
3 [Theobroma cacao]
 gb|EOY33428.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
3 [Theobroma cacao]
Length=279

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/303 (68%), Positives = 224/303 (74%), Gaps = 31/303 (10%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGS--  542
             MS+ R+  R   L+      Q  S  SR     + PRY  F          +S GCG+  
Sbjct  1     MSWSRLSSRISFLNQ-----QFLSRESRFLPDALYPRYKFFE---------ASIGCGNNA  46

Query  543   --LMPRCEFRS-VVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYT--EKKSKKMLLY  707
                MPRC+F +  +  +  F   G     R  S  + Q  YA+ A++   EKKSKK LLY
Sbjct  47    WGSMPRCDFSTRPLTKSFDFHPYGSQCFGR-LSPFSIQRHYASHASHASKEKKSKKTLLY  105

Query  708   LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQF  887
             LT LVFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGTV+TREIVVQF
Sbjct  106   LTALVFAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGTVATREIVVQF  165

Query  888   NADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVT  1067
             NADVADGMPWKFIPTQREV         VRVKPGESALAFYTAENRSSTPITGVSTYNVT
Sbjct  166   NADVADGMPWKFIPTQREV---------VRVKPGESALAFYTAENRSSTPITGVSTYNVT  216

Query  1068  PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV
Sbjct  217   PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKV  276

Query  1248  SDE  1256
             S+E
Sbjct  277   SEE  279



>ref|XP_007015807.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
1 [Theobroma cacao]
 gb|EOY33426.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
1 [Theobroma cacao]
Length=278

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 223/303 (74%), Gaps = 32/303 (11%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGS--  542
             MS+ R+  R   L+      Q  S  SR     + PRY  F          +S GCG+  
Sbjct  1     MSWSRLSSRISFLNQ-----QFLSRESRFLPDALYPRYKFFE---------ASIGCGNNA  46

Query  543   --LMPRCEFRS-VVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYT--EKKSKKMLLY  707
                MPRC+F +  +  +  F   G     R  S  + Q  YA+ A++   EKKSKK LLY
Sbjct  47    WGSMPRCDFSTRPLTKSFDFHPYGSQCFGR-LSPFSIQRHYASHASHASKEKKSKKTLLY  105

Query  708   LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQF  887
             LT LVFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGTV+TREIVVQF
Sbjct  106   LTALVFAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGTVATREIVVQF  165

Query  888   NADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVT  1067
             NADVADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVT
Sbjct  166   NADVADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVT  215

Query  1068  PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV
Sbjct  216   PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKV  275

Query  1248  SDE  1256
             S+E
Sbjct  276   SEE  278



>emb|CDP01675.1| unnamed protein product [Coffea canephora]
Length=286

 Score =   377 bits (968),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/304 (66%), Positives = 225/304 (74%), Gaps = 26/304 (9%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNG---RWKVSSFGC-  536
             MS  R+ GRT           + +S SRN    I   Y+   + +      + +++  C 
Sbjct  1     MSLSRLSGRT-------IFFPVLASFSRNCTGAIGESYNFVGISHASYRQSFGINNVSCR  53

Query  537   ---GSLMPRCEFRSVVDSNIP-FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLL  704
                  L+PR E R ++ S     S  G  +  R  S+LN +  YAT A  TE+KS+K L+
Sbjct  54    PSLNCLLPRYEVRRLLFSKCSGVSPFGNQNIGRPYSVLNSRRSYATHAT-TERKSQKTLM  112

Query  705   YLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQ  884
             YLTGLVFAMVG SYAAVPLYRRFCQATGYGGTVQR+E+VEEKIARHA DGTV+TREIVVQ
Sbjct  113   YLTGLVFAMVGLSYAAVPLYRRFCQATGYGGTVQRRETVEEKIARHAKDGTVTTREIVVQ  172

Query  885   FNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNV  1064
             FNADVADGMPWKF+PTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNV
Sbjct  173   FNADVADGMPWKFVPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNV  222

Query  1065  TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFK
Sbjct  223   TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFK  282

Query  1245  VSDE  1256
             V DE
Sbjct  283   VPDE  286



>ref|XP_007015808.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
2 [Theobroma cacao]
 gb|EOY33427.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
2 [Theobroma cacao]
Length=269

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 191/252 (76%), Positives = 206/252 (82%), Gaps = 18/252 (7%)
 Frame = +3

Query  522   SSFGCGS----LMPRCEFRSV-VDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYT--E  680
             +S GCG+     MPRC+F +  +  +  F   G     R  S  + Q  YA+ A++   E
Sbjct  29    ASIGCGNNAWGSMPRCDFSTRPLTKSFDFHPYGSQCFGR-LSPFSIQRHYASHASHASKE  87

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KKSKK LLYLT LVFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGTV
Sbjct  88    KKSKKTLLYLTALVFAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGTV  147

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
             +TREIVVQFNADVADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPI
Sbjct  148   ATREIVVQFNADVADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPI  197

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
             TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+
Sbjct  198   TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNL  257

Query  1221  ILSYTFFKVSDE  1256
             ILSYTFFKVS+E
Sbjct  258   ILSYTFFKVSEE  269



>ref|XP_006471485.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Citrus sinensis]
 ref|XP_006471486.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Citrus sinensis]
Length=277

 Score =   371 bits (952),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 184/243 (76%), Positives = 204/243 (84%), Gaps = 12/243 (5%)
 Frame = +3

Query  531   GCGSLMPRCEFRS-VVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLY  707
             G   LMPRC + S + +      + G     +S S  +FQ  YA+ A+ TE+KS+KMLLY
Sbjct  46    GVWGLMPRCGYGSNMTNGYRKPQSFGSGCLWKSNSFSSFQRHYASHAS-TEQKSRKMLLY  104

Query  708   LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQF  887
             LT LVFAMVG +YAAVPLYRRFCQATGYGGTVQRKE+VEEKIARH+ DGTV+TRE+VVQF
Sbjct  105   LTALVFAMVGSTYAAVPLYRRFCQATGYGGTVQRKETVEEKIARHSKDGTVTTREVVVQF  164

Query  888   NADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVT  1067
             NADVADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVT
Sbjct  165   NADVADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVT  214

Query  1068  PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV
Sbjct  215   PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKV  274

Query  1248  SDE  1256
             +++
Sbjct  275   NED  277



>gb|KDO57190.1| hypothetical protein CISIN_1g023783mg [Citrus sinensis]
Length=277

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 183/239 (77%), Positives = 203/239 (85%), Gaps = 12/239 (5%)
 Frame = +3

Query  543   LMPRCEFRS-VVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGL  719
             LMPRC + S + +      + G     +S S  +FQ  YA+ A+ TE+KS+KMLLYLT L
Sbjct  50    LMPRCGYGSNMTNGYRKPQSFGSGCLWKSNSFSSFQRHYASHAS-TEQKSRKMLLYLTAL  108

Query  720   VFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADV  899
             VFAMVG +YAAVPLYRRFCQATGYGGTVQRKE+VEEKIARH+ DGTV+TRE+VVQFNADV
Sbjct  109   VFAMVGSTYAAVPLYRRFCQATGYGGTVQRKETVEEKIARHSKDGTVTTREVVVQFNADV  168

Query  900   ADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKA  1079
             ADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKA
Sbjct  169   ADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKA  218

Query  1080  AVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             AVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKV+++
Sbjct  219   AVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVNED  277



>ref|XP_010095969.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis]
 gb|EXB62662.1| Cytochrome c oxidase assembly protein COX11 [Morus notabilis]
Length=282

 Score =   370 bits (949),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 190/266 (71%), Positives = 212/266 (80%), Gaps = 16/266 (6%)
 Frame = +3

Query  465   IIAPRYSLFSVGNNGRWKVSSFGCGSLMPRCEFRSVVDSNIPFSNLGRHSTA--RSCSML  638
             +++  YS F+ GNNG W+   +         EF +   S   +  +  H+T   R    L
Sbjct  31    LVSSSYS-FTRGNNGYWRPVGYNIWRTELIHEFST--GSFDKYRQVSAHATKCFRKPYSL  87

Query  639   NFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKES  818
               QH YA+ A+  ++KS+KMLLYLT LVFAMVGCSYAAVPLYRRFCQATGYGGT+QR+ES
Sbjct  88    FSQHHYASVAS-NDQKSRKMLLYLTALVFAMVGCSYAAVPLYRRFCQATGYGGTIQRRES  146

Query  819   VEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESA  998
             VEEKIARHA DGTV+TREIVVQFNADVADGMPW+FIPTQREV          RVKPGESA
Sbjct  147   VEEKIARHANDGTVTTREIVVQFNADVADGMPWRFIPTQREV----------RVKPGESA  196

Query  999   LAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  1178
             LAFYTAENRSST ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP
Sbjct  197   LAFYTAENRSSTAITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  256

Query  1179  EFETDPKMDGINNIILSYTFFKVSDE  1256
             EFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  257   EFETDPRMDGINNLILSYTFFKVSEE  282



>ref|XP_010032743.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Eucalyptus grandis]
 ref|XP_010032744.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Eucalyptus grandis]
 gb|KCW52198.1| hypothetical protein EUGRSUZ_J01628 [Eucalyptus grandis]
 gb|KCW52199.1| hypothetical protein EUGRSUZ_J01628 [Eucalyptus grandis]
Length=284

 Score =   369 bits (946),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 186/256 (73%), Positives = 207/256 (81%), Gaps = 14/256 (5%)
 Frame = +3

Query  492   SVGNNGRWKVSSFGCGSLMPRCEFRSVV-DSNIPFSNLGRHSTARSCSMLNFQHQYATKA  668
             SV   G   VS   C  L+ RC F +   + +  F N+  +S  +  S+ N    YA+ A
Sbjct  42    SVSGYGGPSVSDVYC--LLRRCRFSTWSPNKSYEFPNVSVYSR-KPNSIFNTHRHYASHA  98

Query  669   AYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAI  848
             + TE+KS+KMLLYLT LV AMVGCSYAAVPLYRRFCQATGYGGT+QR+E+VEEKIARHA 
Sbjct  99    SSTEQKSQKMLLYLTALVLAMVGCSYAAVPLYRRFCQATGYGGTIQRRETVEEKIARHAN  158

Query  849   DGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
             DGTV+TREI VQFNADVADGMPWKF PTQREV          RVKPGESALAFYTAENRS
Sbjct  159   DGTVATREIAVQFNADVADGMPWKFTPTQREV----------RVKPGESALAFYTAENRS  208

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
             STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDG
Sbjct  209   STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG  268

Query  1209  INNIILSYTFFKVSDE  1256
             INN++LSYTFFKVS++
Sbjct  269   INNLVLSYTFFKVSED  284



>gb|EYU30876.1| hypothetical protein MIMGU_mgv1a010830mg [Erythranthe guttata]
Length=300

 Score =   366 bits (940),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 194/222 (87%), Gaps = 15/222 (7%)
 Frame = +3

Query  603   GRHSTARSCSMLNFQHQYATK----AAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             G  S   SCS +NF  +Y+T     AA  EKKS KMLLYLTGLVFAMVGCSYAAVPLYRR
Sbjct  89    GLISNNGSCS-VNFGRRYSTHNNAAAASMEKKSNKMLLYLTGLVFAMVGCSYAAVPLYRR  147

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQR+ESVEEKIARH+ DGTV++REIVVQFNADVADGMPWKF+PTQREV  
Sbjct  148   FCQATGYGGTVQRRESVEEKIARHSKDGTVASREIVVQFNADVADGMPWKFVPTQREV--  205

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAEN+S+ PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  206   --------RVKPGESALAFYTAENKSAAPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  257

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKVS+E
Sbjct  258   LPGEQIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEE  299



>gb|EYU30877.1| hypothetical protein MIMGU_mgv1a010830mg [Erythranthe guttata]
Length=292

 Score =   365 bits (938),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/222 (82%), Positives = 194/222 (87%), Gaps = 15/222 (7%)
 Frame = +3

Query  603   GRHSTARSCSMLNFQHQYATK----AAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             G  S   SCS +NF  +Y+T     AA  EKKS KMLLYLTGLVFAMVGCSYAAVPLYRR
Sbjct  81    GLISNNGSCS-VNFGRRYSTHNNAAAASMEKKSNKMLLYLTGLVFAMVGCSYAAVPLYRR  139

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQR+ESVEEKIARH+ DGTV++REIVVQFNADVADGMPWKF+PTQREV  
Sbjct  140   FCQATGYGGTVQRRESVEEKIARHSKDGTVASREIVVQFNADVADGMPWKFVPTQREV--  197

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAEN+S+ PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  198   --------RVKPGESALAFYTAENKSAAPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  249

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDPKM+GINN+ILSYTFFKVS+E
Sbjct  250   LPGEQIDMPVFFYIDPEFETDPKMEGINNLILSYTFFKVSEE  291



>gb|KDP46796.1| hypothetical protein JCGZ_11167 [Jatropha curcas]
Length=265

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 194/282 (69%), Positives = 212/282 (75%), Gaps = 28/282 (10%)
 Frame = +3

Query  417   KTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLMPR--CEFRSVVDSNIP  590
             +T+  L S    + LQ  A  Y   S  +   W   SFG  + +PR  CEF +       
Sbjct  10    RTSFHLKSIPQNHPLQSRANSYKTTSTSH--YWP--SFGSYNRIPRPRCEFNT-------  58

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
              S +G H     C   NF       A+ TE+KS+K L+YLTGLV AMVG SYAAVPLYRR
Sbjct  59    -SPIG-HWHGNGCIKKNFS---TYNASSTEQKSRKTLIYLTGLVIAMVGSSYAAVPLYRR  113

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGT+QR+ESVEEKI RH+ +GTV+TREIVVQFNADVADGMPWKFIPTQREV  
Sbjct  114   FCQATGYGGTIQRRESVEEKIVRHSKEGTVTTREIVVQFNADVADGMPWKFIPTQREV--  171

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  172   --------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  223

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKVSDE
Sbjct  224   LPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSDE  265



>ref|XP_004146871.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004168008.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Cucumis sativus]
 gb|KGN53222.1| hypothetical protein Csa_4G028460 [Cucumis sativus]
Length=333

 Score =   366 bits (940),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/222 (81%), Positives = 188/222 (85%), Gaps = 12/222 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             FS L      R  S+ N Q  Y+T A   E+KSK ML YL  LV  MVGCSYAAVPLYRR
Sbjct  124   FSPLSTRYIGRYSSLHNIQRSYSTAA--IERKSKNMLFYLVALVLTMVGCSYAAVPLYRR  181

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQR+ESVEEKIARHA DGTV+TR+IVVQFNADVADGMPWKFIPTQREV  
Sbjct  182   FCQATGYGGTVQRRESVEEKIARHAKDGTVTTRDIVVQFNADVADGMPWKFIPTQREV--  239

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAA+YFNKIQCFCFEEQRL
Sbjct  240   --------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAIYFNKIQCFCFEEQRL  291

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKVS+E
Sbjct  292   LPGEQIDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE  333



>ref|XP_010681297.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=271

 Score =   362 bits (930),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 188/297 (63%), Positives = 218/297 (73%), Gaps = 27/297 (9%)
 Frame = +3

Query  369   MSFFRVFGRTQAL-HSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSL  545
             MS +++  R Q L H FK   Q+ +S  +   Q I P        +N   +  S+    +
Sbjct  1     MSIYKLSRRIQILPHLFKHNTQIPNSQFQRIFQAIEP-------SSNEIRRRYSYSSWPI  53

Query  546   MPRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVF  725
                C+F +        SN+      R+  +   +  Y++ A   EKKS+KML+YLT LVF
Sbjct  54    TRCCQFSA--------SNVHNFQKYRA-GVFESRRLYSSTAVVQEKKSRKMLIYLTALVF  104

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
              MVGCSYAAVPLYRRFCQATGYGGTVQR+E+VE+KIARH+ DGTV+TREIVVQFNADVAD
Sbjct  105   GMVGCSYAAVPLYRRFCQATGYGGTVQRRETVEDKIARHSKDGTVTTREIVVQFNADVAD  164

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
             GMPWKF PTQREV          RVKPGESALAFYTAENRSSTPI GVSTYNVTPMKAAV
Sbjct  165   GMPWKFTPTQREV----------RVKPGESALAFYTAENRSSTPIVGVSTYNVTPMKAAV  214

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             YFNKIQCFCFEEQRLLPGEQ+DMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS++
Sbjct  215   YFNKIQCFCFEEQRLLPGEQVDMPVFFYIDPEFETDPRMDGINNMILSYTFFKVSED  271



>ref|XP_008453793.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Cucumis melo]
 ref|XP_008453794.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Cucumis melo]
 ref|XP_008453795.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Cucumis melo]
Length=334

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 207/277 (75%), Gaps = 16/277 (6%)
 Frame = +3

Query  429   QLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLMPRCEFRS-VVDSNIPFSNLG  605
              +H+S + N L  +   YSL    N  +       CG  M  C F S     +  FS L 
Sbjct  73    HVHASLTSNFL--LQSTYSLSRTCNVYKRGYGLDVCGLKMG-CGFHSQSFQKSHWFSPLS  129

Query  606   RHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQAT  785
                  R  S+ N Q  Y T A   E+KSK ML YL  LV  MVGCSYAAVPLYRRFCQAT
Sbjct  130   TRYIGRYSSLHNIQRSYCTAA--IERKSKNMLFYLVALVLTMVGCSYAAVPLYRRFCQAT  187

Query  786   GYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHH  965
             GYGGTVQR+ESVEEKIARHA DGTV+TR+IVVQFNADVADGMPWKFIPTQREV       
Sbjct  188   GYGGTVQRRESVEEKIARHAKDGTVTTRDIVVQFNADVADGMPWKFIPTQREV-------  240

Query  966   RPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQ  1145
                RVKPGESALAFYTAEN+SSTPITGVSTYNVTPMKAA+YFNKIQCFCFEEQRLLPGEQ
Sbjct  241   ---RVKPGESALAFYTAENKSSTPITGVSTYNVTPMKAAIYFNKIQCFCFEEQRLLPGEQ  297

Query  1146  IDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             IDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKVS+E
Sbjct  298   IDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE  334



>ref|XP_008453787.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Cucumis melo]
 ref|XP_008453788.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Cucumis melo]
 ref|XP_008453789.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Cucumis melo]
 ref|XP_008453790.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Cucumis melo]
 ref|XP_008453791.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Cucumis melo]
 ref|XP_008453792.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Cucumis melo]
Length=337

 Score =   364 bits (934),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 192/277 (69%), Positives = 207/277 (75%), Gaps = 16/277 (6%)
 Frame = +3

Query  429   QLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLMPRCEFRS-VVDSNIPFSNLG  605
              +H+S + N L  +   YSL    N  +       CG  M  C F S     +  FS L 
Sbjct  76    HVHASLTSNFL--LQSTYSLSRTCNVYKRGYGLDVCGLKMG-CGFHSQSFQKSHWFSPLS  132

Query  606   RHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQAT  785
                  R  S+ N Q  Y T A   E+KSK ML YL  LV  MVGCSYAAVPLYRRFCQAT
Sbjct  133   TRYIGRYSSLHNIQRSYCTAA--IERKSKNMLFYLVALVLTMVGCSYAAVPLYRRFCQAT  190

Query  786   GYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHH  965
             GYGGTVQR+ESVEEKIARHA DGTV+TR+IVVQFNADVADGMPWKFIPTQREV       
Sbjct  191   GYGGTVQRRESVEEKIARHAKDGTVTTRDIVVQFNADVADGMPWKFIPTQREV-------  243

Query  966   RPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQ  1145
                RVKPGESALAFYTAEN+SSTPITGVSTYNVTPMKAA+YFNKIQCFCFEEQRLLPGEQ
Sbjct  244   ---RVKPGESALAFYTAENKSSTPITGVSTYNVTPMKAAIYFNKIQCFCFEEQRLLPGEQ  300

Query  1146  IDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             IDMPVFFYIDPEFETDPKMDGINN+ILSYTFFKVS+E
Sbjct  301   IDMPVFFYIDPEFETDPKMDGINNLILSYTFFKVSEE  337



>ref|XP_003553055.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Glycine max]
 gb|KHN08785.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Glycine 
soja]
Length=284

 Score =   360 bits (923),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 190/221 (86%), Gaps = 12/221 (5%)
 Frame = +3

Query  594   SNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRF  773
             S L      +SCSM  F+H   +  A  E+KS+KMLLYLTGLVFAMVGC+YAAVPLYRRF
Sbjct  76    SALASQYVGKSCSMPGFRH--FSSHASKEQKSRKMLLYLTGLVFAMVGCTYAAVPLYRRF  133

Query  774   CQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*  953
             CQATGYGGTV R+E+VEEKIARH  + TV+TREIVVQFNAD+ADGM WKF+PTQREV   
Sbjct  134   CQATGYGGTVTRRETVEEKIARHDSNNTVTTREIVVQFNADIADGMQWKFVPTQREV---  190

Query  954   CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  1133
                    RVKPGESALAFYTAEN+SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL
Sbjct  191   -------RVKPGESALAFYTAENKSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  243

Query  1134  PGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             PGEQIDMPVFFYIDPEFETDPKM+GINNIILSYTFFKVS+E
Sbjct  244   PGEQIDMPVFFYIDPEFETDPKMNGINNIILSYTFFKVSEE  284



>ref|XP_004306674.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=266

 Score =   358 bits (918),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 175/222 (79%), Positives = 190/222 (86%), Gaps = 11/222 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             F    +H    + S+L  Q  Y+T+AA T++KS+K L+YLTGLVFAMV  SYAAVPLYRR
Sbjct  56    FDKCSQHQPFAAQSLLRIQRLYSTQAA-TQEKSRKTLVYLTGLVFAMVAASYAAVPLYRR  114

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGT+QR+ESVE+KIARHA DGTV+ REIVVQFNADVADGM WKF PTQREV  
Sbjct  115   FCQATGYGGTIQRRESVEQKIARHAKDGTVTKREIVVQFNADVADGMQWKFTPTQREV--  172

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAENRSSTPI GVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  173   --------RVKPGESALAFYTAENRSSTPIVGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  224

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKVS+E
Sbjct  225   LPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE  266



>ref|XP_010032745.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Eucalyptus grandis]
Length=197

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 178/193 (92%), Gaps = 10/193 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             E+KS+KMLLYLT LV AMVGCSYAAVPLYRRFCQATGYGGT+QR+E+VEEKIARHA DGT
Sbjct  15    EQKSQKMLLYLTALVLAMVGCSYAAVPLYRRFCQATGYGGTIQRRETVEEKIARHANDGT  74

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V+TREI VQFNADVADGMPWKF PTQREV          RVKPGESALAFYTAENRSSTP
Sbjct  75    VATREIAVQFNADVADGMPWKFTPTQREV----------RVKPGESALAFYTAENRSSTP  124

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN
Sbjct  125   ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINN  184

Query  1218  IILSYTFFKVSDE  1256
             ++LSYTFFKVS++
Sbjct  185   LVLSYTFFKVSED  197



>ref|XP_008244142.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Prunus mume]
 ref|XP_008244143.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Prunus mume]
Length=271

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/222 (80%), Positives = 190/222 (86%), Gaps = 11/222 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             F   G+     S S+L  Q  Y+ +A  T++KS+KMLLYL GLVFAMV  SYAAVPLYRR
Sbjct  61    FDKCGQLPPFASQSLLRIQRPYSAQAI-TQQKSRKMLLYLMGLVFAMVASSYAAVPLYRR  119

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQR+ESVE+KIARHA DGTV+TREIVVQFNADVADGM WKFIPTQREV  
Sbjct  120   FCQATGYGGTVQRRESVEQKIARHAKDGTVTTREIVVQFNADVADGMQWKFIPTQREV--  177

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAEN+SSTPI GVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  178   --------RVKPGESALAFYTAENQSSTPIVGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  229

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKVS+E
Sbjct  230   LPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSEE  271



>ref|XP_008230641.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Prunus mume]
 ref|XP_008230642.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Prunus mume]
 ref|XP_008230643.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Prunus mume]
Length=271

 Score =   356 bits (913),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 190/221 (86%), Gaps = 11/221 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             F   G+     S S+L  Q  Y+++A  +++KS+KMLLYLTGLVFAMV  +YAAVPLYRR
Sbjct  62    FEKCGQLPPLASQSLLRIQRPYSSQAT-SQQKSRKMLLYLTGLVFAMVASTYAAVPLYRR  120

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQR+ESVE+KIARH  DGTV+TREIVVQFNADVADGM WKFIPTQRE+  
Sbjct  121   FCQATGYGGTVQRRESVEQKIARHTKDGTVTTREIVVQFNADVADGMQWKFIPTQREI--  178

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAENRSSTPI GVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  179   --------RVKPGESALAFYTAENRSSTPIVGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  230

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             LPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFKVS+
Sbjct  231   LPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFKVSE  271



>ref|XP_009361928.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Pyrus x bretschneideri]
Length=277

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 172/204 (84%), Positives = 183/204 (90%), Gaps = 11/204 (5%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
             Q  Y++ AA T++KS+KML YLTGLVFAMV  SYAAVPLYRRFCQATGYGGT+QR+ESVE
Sbjct  85    QRPYSSLAA-TQRKSRKMLYYLTGLVFAMVAASYAAVPLYRRFCQATGYGGTIQRRESVE  143

Query  825   EKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALA  1004
             +KIARHA DGTV+ REIVVQFNADVADGM WKFIPTQREV          RVKPGESALA
Sbjct  144   QKIARHAKDGTVTNREIVVQFNADVADGMQWKFIPTQREV----------RVKPGESALA  193

Query  1005  FYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  1184
             FYTAENRSSTPI GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF
Sbjct  194   FYTAENRSSTPIVGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  253

Query  1185  ETDPKMDGINNIILSYTFFKVSDE  1256
             ETDP+MDGINNIILSYTFFKVS+E
Sbjct  254   ETDPRMDGINNIILSYTFFKVSEE  277



>ref|XP_011026708.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Populus euphratica]
Length=250

 Score =   353 bits (905),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 176/193 (91%), Gaps = 10/193 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             E+KSKK L+YLTGLV AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGT
Sbjct  68    EQKSKKTLIYLTGLVVAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHANDGT  127

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V+TREI VQFNADV DGMPWKF PTQREV          RVKPGESALAFYTAEN+SSTP
Sbjct  128   VATREIAVQFNADVGDGMPWKFAPTQREV----------RVKPGESALAFYTAENQSSTP  177

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN
Sbjct  178   ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINN  237

Query  1218  IILSYTFFKVSDE  1256
             IILSYTFFKVS+E
Sbjct  238   IILSYTFFKVSEE  250



>ref|XP_007163355.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris]
 ref|XP_007163356.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris]
 gb|ESW35349.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris]
 gb|ESW35350.1| hypothetical protein PHAVU_001G227800g [Phaseolus vulgaris]
Length=268

 Score =   353 bits (907),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 187/221 (85%), Gaps = 12/221 (5%)
 Frame = +3

Query  594   SNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRF  773
             S     +  +S SM  F+H   +  A  E+KS+KMLLYLTGLVFAMVGC+YAAVPLYRR 
Sbjct  60    SAFATQNVGKSSSMPGFRH--FSSHASKEQKSQKMLLYLTGLVFAMVGCTYAAVPLYRRL  117

Query  774   CQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*  953
             CQATGYGGTV R+E+VEEKIARH  + TVSTREIVVQFNAD+ADGM WKF+P QREV   
Sbjct  118   CQATGYGGTVARRETVEEKIARHDSNNTVSTREIVVQFNADIADGMQWKFVPAQREV---  174

Query  954   CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  1133
                    RVKPGESALAFYTAEN+SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL
Sbjct  175   -------RVKPGESALAFYTAENKSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  227

Query  1134  PGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             PGEQIDMPVFFYIDPEFETDPKM+GINNI+LSYTFFKVS+E
Sbjct  228   PGEQIDMPVFFYIDPEFETDPKMNGINNIVLSYTFFKVSEE  268



>emb|CDY55307.1| BnaC08g49630D [Brassica napus]
Length=286

 Score =   353 bits (906),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 188/231 (81%), Gaps = 10/231 (4%)
 Frame = +3

Query  564   RSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCS  743
             R++  S+  F  L  HS A    +L   H+  +  + TE KSKKML YLTG+VF MVG +
Sbjct  48    RALWGSSSSFFPLNSHSAAAKSMLLGGAHRQYSTQSITETKSKKMLYYLTGVVFGMVGLT  107

Query  744   YAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKF  923
             YAAVPLYR FCQATGYGGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF
Sbjct  108   YAAVPLYRTFCQATGYGGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKF  167

Query  924   IPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQ  1103
              PTQREV          RVKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQ
Sbjct  168   TPTQREV----------RVKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQ  217

Query  1104  CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             CFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  218   CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  268



>ref|XP_009355117.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Pyrus x bretschneideri]
 ref|XP_009355119.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Pyrus x bretschneideri]
Length=277

 Score =   352 bits (904),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 179/244 (73%), Positives = 192/244 (79%), Gaps = 16/244 (7%)
 Frame = +3

Query  525   SFGCGSLMPRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLL  704
             S G  ++  R E  S        S     S  R       Q  Y++ A  T++KS+KML 
Sbjct  50    SHGGKNMWRRIELSSFNQCGSQLSPFASQSLVR-----RIQRPYSSLAT-TQRKSRKMLY  103

Query  705   YLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQ  884
             YLTGLVFAMV  SYAAVPLYRRFCQATGYGGT+QR+ESVE+KIARHA DGTV+ REIVVQ
Sbjct  104   YLTGLVFAMVAASYAAVPLYRRFCQATGYGGTIQRRESVEQKIARHAKDGTVTNREIVVQ  163

Query  885   FNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNV  1064
             FNADVADGM WKFIPTQREV          RVKPGESALAFYTAENRSSTPI GVSTYNV
Sbjct  164   FNADVADGMQWKFIPTQREV----------RVKPGESALAFYTAENRSSTPIVGVSTYNV  213

Query  1065  TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYTFFK
Sbjct  214   TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYTFFK  273

Query  1245  VSDE  1256
             VS+E
Sbjct  274   VSEE  277



>ref|XP_010542835.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Tarenaya hassleriana]
Length=301

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 181/208 (87%), Gaps = 11/208 (5%)
 Frame = +3

Query  633   MLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRK  812
             +L  Q  YAT++  TE KS+KML YLT LVF MVG +YAAVPLYR FCQATGYGGTVQRK
Sbjct  87    LLGMQRHYATQSP-TETKSRKMLYYLTALVFGMVGLTYAAVPLYRTFCQATGYGGTVQRK  145

Query  813   ESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGE  992
             ESVEEKIARHA  GTV+ REIVVQFNADVADGMPWKF+PTQREV          RVKPGE
Sbjct  146   ESVEEKIARHADAGTVTQREIVVQFNADVADGMPWKFVPTQREV----------RVKPGE  195

Query  993   SALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYI  1172
             SALAFYTAENRSS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFYI
Sbjct  196   SALAFYTAENRSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYI  255

Query  1173  DPEFETDPKMDGINNIILSYTFFKVSDE  1256
             DPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  256   DPEFETDPRMDGINNLILSYTFFKVSEE  283



>gb|KEH33905.1| cytochrome C oxidase assembly protein CtaG/COX11 [Medicago truncatula]
Length=285

 Score =   352 bits (903),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 185/221 (84%), Gaps = 10/221 (5%)
 Frame = +3

Query  594   SNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRF  773
             S     +  R CSM  F+H  +   A TEKKS+KML+YLTGLVF MVG SYAAVPLYRRF
Sbjct  75    SAFASQNVGRLCSMPGFRHFSSHAYASTEKKSQKMLMYLTGLVFGMVGLSYAAVPLYRRF  134

Query  774   CQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*  953
             CQATGYGGTV R+ESVEEKIARH  + TV++REIVVQFNAD+ADGM WKF+PTQREV   
Sbjct  135   CQATGYGGTVTRRESVEEKIARHDSNQTVTSREIVVQFNADIADGMQWKFVPTQREV---  191

Query  954   CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  1133
                    RVKPGESALAFYTAEN+SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL
Sbjct  192   -------RVKPGESALAFYTAENQSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  244

Query  1134  PGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             PGE+IDMPVFFYIDPE E DPKMDGINNIILSYTFFK S+E
Sbjct  245   PGEKIDMPVFFYIDPEIEDDPKMDGINNIILSYTFFKASEE  285



>ref|XP_008346526.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Malus domestica]
 ref|XP_008346534.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Malus domestica]
 ref|XP_008346541.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Malus domestica]
 ref|XP_008344480.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Malus domestica]
 ref|XP_008344481.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Malus domestica]
 ref|XP_008344482.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Malus domestica]
Length=277

 Score =   351 bits (900),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 170/204 (83%), Positives = 182/204 (89%), Gaps = 11/204 (5%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
             Q  Y++ AA T++KS+KML YL GLVFAMV  SYAAVPLYRRFCQATGYGGT+QR+ESVE
Sbjct  85    QRPYSSLAA-TQRKSRKMLYYLXGLVFAMVAASYAAVPLYRRFCQATGYGGTIQRRESVE  143

Query  825   EKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALA  1004
             +KIARHA DGTV+ REIVVQFNADVADGM WKFIPTQREV          RV+PGESALA
Sbjct  144   QKIARHAKDGTVTNREIVVQFNADVADGMQWKFIPTQREV----------RVRPGESALA  193

Query  1005  FYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  1184
             FYTAENRSSTPI GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF
Sbjct  194   FYTAENRSSTPIVGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  253

Query  1185  ETDPKMDGINNIILSYTFFKVSDE  1256
             ETDP+MDGINNIILSYTFFKVS+E
Sbjct  254   ETDPRMDGINNIILSYTFFKVSEE  277



>emb|CDY32464.1| BnaA09g51320D [Brassica napus]
Length=286

 Score =   351 bits (901),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 187/231 (81%), Gaps = 10/231 (4%)
 Frame = +3

Query  564   RSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCS  743
             R +  S+  F  L  HS A    +L+  H+  +  + TE KSKKML YLT +VF MVG +
Sbjct  48    RGIWGSSSSFFPLNSHSAAAKSMLLSGAHRQYSTQSITETKSKKMLYYLTAVVFGMVGLT  107

Query  744   YAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKF  923
             YAAVPLYR FCQATGYGGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF
Sbjct  108   YAAVPLYRTFCQATGYGGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKF  167

Query  924   IPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQ  1103
              PTQREV          RVKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQ
Sbjct  168   TPTQREV----------RVKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQ  217

Query  1104  CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             CFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  218   CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  268



>ref|XP_010480954.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Camelina sativa]
 ref|XP_010480959.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Camelina sativa]
Length=283

 Score =   351 bits (900),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 187/227 (82%), Gaps = 11/227 (5%)
 Frame = +3

Query  576   DSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAV  755
             D  + + +L  HS A    +L    QY+T +  TE KS+KML YLT LVF MVG +YAAV
Sbjct  49    DKRVFWGSLNPHSAAAKSMLLGTHRQYSTHSP-TETKSQKMLYYLTALVFGMVGLTYAAV  107

Query  756   PLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQ  935
             PLYR FCQATGYGGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQ
Sbjct  108   PLYRTFCQATGYGGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQ  167

Query  936   REVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCF  1115
             REV          RVKPGESALAFYTAEN+SS+PITGVSTYNVTPMKA VYFNKIQCFCF
Sbjct  168   REV----------RVKPGESALAFYTAENKSSSPITGVSTYNVTPMKAGVYFNKIQCFCF  217

Query  1116  EEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             EEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  218   EEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  264



>ref|XP_002277478.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Vitis vinifera]
 emb|CBI26538.3| unnamed protein product [Vitis vinifera]
Length=285

 Score =   350 bits (899),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 219/303 (72%), Gaps = 26/303 (9%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLH-SSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGS-  542
             MS+FRV  +T  L   K +   H  S SR+      P  S+ +  N G+    + GC + 
Sbjct  1     MSWFRVSRKTLLLPCLKNSQSPHFGSVSRH-----IPDKSIGANANYGQ----NLGCTNR  51

Query  543   -LMPRCEFRS-VVDSNIPFSNLGRHSTARS--CSMLNFQHQYATKA-AYTEKKSKKMLLY  707
              LM +CEF S + D    FS +    + R   CS+L+F+  Y   A A   +KSKKML+Y
Sbjct  52    LLMQKCEFHSGLFDKRRQFSPVDLRYSGRPSYCSVLDFRRHYVVDASAEQARKSKKMLMY  111

Query  708   LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQF  887
             LT +VFAMV  SYAAVPLY+RFCQATGYGGTV R+E+VEEKIARH  DGT S REIVVQF
Sbjct  112   LTAVVFAMVAGSYAAVPLYQRFCQATGYGGTVHRRETVEEKIARHDEDGTASLREIVVQF  171

Query  888   NADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVT  1067
             NADVADGM WKFIPTQRE+          RVKPGESALAFYTAEN+SSTPITGVSTYNVT
Sbjct  172   NADVADGMQWKFIPTQREI----------RVKPGESALAFYTAENQSSTPITGVSTYNVT  221

Query  1068  PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             PM+AA+YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPE E DPKMD + N++LSYTFFK 
Sbjct  222   PMRAALYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEIENDPKMDNVYNLVLSYTFFKS  281

Query  1248  SDE  1256
             S+E
Sbjct  282   SEE  284



>ref|XP_007202655.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica]
 gb|EMJ03854.1| hypothetical protein PRUPE_ppa012273mg [Prunus persica]
Length=177

 Score =   346 bits (887),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/187 (89%), Positives = 172/187 (92%), Gaps = 10/187 (5%)
 Frame = +3

Query  696   MLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREI  875
             MLLYLTGLVFAMV  SYAAVPLYRRFCQATGYGGTVQR+ESVE+KIARHA DGTV+TREI
Sbjct  1     MLLYLTGLVFAMVASSYAAVPLYRRFCQATGYGGTVQRRESVEQKIARHAKDGTVTTREI  60

Query  876   VVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVST  1055
             VVQFNADVADGM WKFIPTQREV          RVKPGESALAFYTAENRSSTPI GVST
Sbjct  61    VVQFNADVADGMQWKFIPTQREV----------RVKPGESALAFYTAENRSSTPIVGVST  110

Query  1056  YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYT  1235
             YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINNIILSYT
Sbjct  111   YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNIILSYT  170

Query  1236  FFKVSDE  1256
             FFKVS+E
Sbjct  171   FFKVSEE  177



>ref|XP_010457216.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Camelina sativa]
 ref|XP_010457217.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Camelina sativa]
 ref|XP_010457219.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Camelina sativa]
 ref|XP_010457220.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Camelina sativa]
Length=283

 Score =   350 bits (897),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 185/222 (83%), Gaps = 11/222 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             + +L  HS   +  +L    QY+T +  TE KS+KML YLT LVF MVG +YAAVPLYR 
Sbjct  54    WGSLNSHSATANSMLLGVHRQYSTHSP-TETKSQKMLYYLTALVFGMVGLTYAAVPLYRT  112

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV  
Sbjct  113   FCQATGYGGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV--  170

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAEN+SS+PITGVSTYNVTPMKA VYFNKIQCFCFEEQRL
Sbjct  171   --------RVKPGESALAFYTAENKSSSPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRL  222

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  223   LPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  264



>ref|XP_010474659.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Camelina sativa]
Length=283

 Score =   348 bits (894),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 169/222 (76%), Positives = 184/222 (83%), Gaps = 11/222 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             + +L  HS      +L    QY+T +  TE KS+KML YLT LVF MVG +YAAVPLYR 
Sbjct  54    WGSLNSHSATAKSMLLGTHRQYSTHSP-TETKSQKMLYYLTALVFGMVGLTYAAVPLYRT  112

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV  
Sbjct  113   FCQATGYGGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV--  170

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     RVKPGESALAFYTAEN+SS+PITGVSTYNVTPMKA VYFNKIQCFCFEEQRL
Sbjct  171   --------RVKPGESALAFYTAENKSSSPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRL  222

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             LPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  223   LPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  264



>gb|KHN24158.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Glycine 
soja]
Length=177

 Score =   342 bits (878),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/187 (87%), Positives = 173/187 (93%), Gaps = 10/187 (5%)
 Frame = +3

Query  696   MLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREI  875
             MLLYLTGLVFAMVGC+YAAVPLYRRFCQATGYGGTV R+E+VEEKIARH  + TV+TREI
Sbjct  1     MLLYLTGLVFAMVGCTYAAVPLYRRFCQATGYGGTVTRRETVEEKIARHDTNNTVTTREI  60

Query  876   VVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVST  1055
             VVQFNAD+ADGMPWKF+PTQR+V          RVKPGESALAFYTAEN+SSTPITGVST
Sbjct  61    VVQFNADIADGMPWKFVPTQRQV----------RVKPGESALAFYTAENKSSTPITGVST  110

Query  1056  YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYT  1235
             YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM+GINNIILSYT
Sbjct  111   YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMNGINNIILSYT  170

Query  1236  FFKVSDE  1256
             FFKVS+E
Sbjct  171   FFKVSEE  177



>ref|XP_010274439.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=288

 Score =   345 bits (885),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 184/220 (84%), Gaps = 10/220 (5%)
 Frame = +3

Query  597   NLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFC  776
             NL R S++     +   +   T  A  E+KSKK L+YLT +   MVGC+YAAVPLYRRFC
Sbjct  79    NLPRCSSSTVGPWVRRGYTTQTAQAARERKSKKTLVYLTAVACVMVGCTYAAVPLYRRFC  138

Query  777   QATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*C  956
             QATGYGGTVQR+E+VEEKIARHA DG+  TRE+VVQFNADVADGMPWKF+PTQREV    
Sbjct  139   QATGYGGTVQRRETVEEKIARHAQDGSAPTREVVVQFNADVADGMPWKFVPTQREV----  194

Query  957   SHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLP  1136
                   RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLP
Sbjct  195   ------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLP  248

Query  1137  GEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             GEQIDMPVFFYIDPEFETDP+MDG+NN+ILSYTFFKV +E
Sbjct  249   GEQIDMPVFFYIDPEFETDPRMDGVNNLILSYTFFKVGEE  288



>ref|XP_009118769.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Brassica rapa]
Length=286

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 184/231 (80%), Gaps = 10/231 (4%)
 Frame = +3

Query  564   RSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCS  743
             R++  S+  F  L  HS A    +L   H+  +  + TE KSKKML YLT +VF MVG +
Sbjct  48    RALWGSSSSFFPLNSHSAAAKSMLLGGAHRQYSTQSITETKSKKMLYYLTAVVFGMVGLT  107

Query  744   YAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKF  923
             YAA PLYR FCQATGYGGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM  K 
Sbjct  108   YAAAPLYRTFCQATGYGGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQRKL  167

Query  924   IPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQ  1103
              PTQREV          RVKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQ
Sbjct  168   TPTQREV----------RVKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQ  217

Query  1104  CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             CFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  218   CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  268



>ref|XP_002889401.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65660.1| cytochrome c oxidase assembly protein CtaG [Arabidopsis lyrata 
subsp. lyrata]
Length=287

 Score =   342 bits (878),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 183/214 (86%), Gaps = 12/214 (6%)
 Frame = +3

Query  618   ARSCSMLNFQH-QYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYG  794
             A + SML   H QY+T++  TE KS+KML YLT +VF MVG +YAAVPLYR FCQATGYG
Sbjct  67    ATAKSMLVSAHRQYSTQSP-TETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYG  125

Query  795   GTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPV  974
             GTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV          
Sbjct  126   GTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV----------  175

Query  975   RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDM  1154
             RVKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDM
Sbjct  176   RVKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDM  235

Query  1155  PVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             PVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  236   PVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  269



>ref|XP_007015810.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
4 [Theobroma cacao]
 gb|EOY33429.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
4 [Theobroma cacao]
Length=249

 Score =   340 bits (873),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 173/224 (77%), Positives = 184/224 (82%), Gaps = 14/224 (6%)
 Frame = +3

Query  546   MPRCEFRSV-VDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYT--EKKSKKMLLYLTG  716
             MPRC+F +  +  +  F   G     R  S  + Q  YA+ A++   EKKSKK LLYLT 
Sbjct  1     MPRCDFSTRPLTKSFDFHPYGSQCFGR-LSPFSIQRHYASHASHASKEKKSKKTLLYLTA  59

Query  717   LVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNAD  896
             LVFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGTV+TREIVVQFNAD
Sbjct  60    LVFAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGTVATREIVVQFNAD  119

Query  897   VADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  1076
             VADGMPWKFIPTQRE          VRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK
Sbjct  120   VADGMPWKFIPTQRE----------VRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  169

Query  1077  AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
             AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDG
Sbjct  170   AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG  213



>ref|XP_006305482.1| hypothetical protein CARUB_v10009922mg [Capsella rubella]
 gb|EOA38380.1| hypothetical protein CARUB_v10009922mg [Capsella rubella]
Length=287

 Score =   342 bits (877),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 168/215 (78%), Positives = 183/215 (85%), Gaps = 12/215 (6%)
 Frame = +3

Query  612   STARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGY  791
             +TA+S  +L    QY+T +  TE KS+KML YLT +VF MVG +YAAVPLYR FCQATGY
Sbjct  67    ATAKSM-LLGAHRQYSTHSP-TETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGY  124

Query  792   GGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRP  971
             GGTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV         
Sbjct  125   GGTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV---------  175

Query  972   VRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQID  1151
              RVKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQID
Sbjct  176   -RVKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQID  234

Query  1152  MPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             MPVFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  235   MPVFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  269



>ref|XP_006418343.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum]
 ref|XP_006418345.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum]
 gb|ESQ36696.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum]
 gb|ESQ36698.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum]
Length=291

 Score =   342 bits (876),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 180/213 (85%), Gaps = 10/213 (5%)
 Frame = +3

Query  618   ARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGG  797
             A S SML   H+  +  + TE KS+KML YLT +VF MVG +YAAVPLYR FCQATGYGG
Sbjct  71    AISKSMLLGAHRQYSTHSPTETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGG  130

Query  798   TVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVR  977
             TVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV          R
Sbjct  131   TVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV----------R  180

Query  978   VKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMP  1157
             VKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMP
Sbjct  181   VKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMP  240

Query  1158  VFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             VFFYIDPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  241   VFFYIDPEFETDPRMDGINNLILSYTFFKVSEE  273



>ref|NP_001170515.1| uncharacterized protein LOC100384526 [Zea mays]
 gb|ACG32461.1| cytochrome c oxidase assembly protein ctaG [Zea mays]
 gb|ACR33935.1| unknown [Zea mays]
 tpg|DAA51052.1| TPA: cytochrome c oxidase assembly protein ctaG [Zea mays]
Length=233

 Score =   339 bits (870),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 182/227 (80%), Gaps = 17/227 (7%)
 Frame = +3

Query  594   SNLGRHSTAR-------SCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAA  752
             S L RHST R       +  +       +  AA  EK S++ L YL G+  AMVG SYAA
Sbjct  16    SLLHRHSTRRGWPPASDAAFLWRGLASSSPSAAGREKSSRRTLGYLLGVAVAMVGASYAA  75

Query  753   VPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPT  932
             VPLYRRFCQATGYGGTVQR+ESVEEKI+RHA DGT ++REI+VQFNADVADGMPWKFIPT
Sbjct  76    VPLYRRFCQATGYGGTVQRRESVEEKISRHARDGTTTSREIIVQFNADVADGMPWKFIPT  135

Query  933   QREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFC  1112
             QREV          RVKPGESALAFYTAENRSS PITGVSTYNV PMKAA+YFNKIQCFC
Sbjct  136   QREV----------RVKPGESALAFYTAENRSSAPITGVSTYNVAPMKAAIYFNKIQCFC  185

Query  1113  FEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             FEEQ LLPGEQIDMPVFFYIDPEFETDPKMDG+NNI+LSYTFFKV+D
Sbjct  186   FEEQTLLPGEQIDMPVFFYIDPEFETDPKMDGVNNIVLSYTFFKVND  232



>ref|XP_009595498.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Nicotiana tomentosiformis]
Length=185

 Score =   337 bits (864),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 166/180 (92%), Gaps = 10/180 (6%)
 Frame = +3

Query  714   GLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNA  893
             GLVFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DG V++REI VQFNA
Sbjct  15    GLVFAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGRVTSREIAVQFNA  74

Query  894   DVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPM  1073
             DVADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPM
Sbjct  75    DVADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPM  124

Query  1074  KAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             KAAVYFNKIQCFCFEEQ+LLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD
Sbjct  125   KAAVYFNKIQCFCFEEQKLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  184



>gb|AAG00893.1|AC064879_11 Similar to cytochrome-c oxidase assembly protein [Arabidopsis 
thaliana]
Length=216

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 178/207 (86%), Gaps = 12/207 (6%)
 Frame = +3

Query  633   MLNFQH-QYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQR  809
             ML+  H QY+T +  +E KS+KML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQR
Sbjct  1     MLDSAHRQYSTHSP-SETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQR  59

Query  810   KESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPG  989
             KE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV          RVKPG
Sbjct  60    KETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV----------RVKPG  109

Query  990   ESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFY  1169
             ESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFY
Sbjct  110   ESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFY  169

Query  1170  IDPEFETDPKMDGINNIILSYTFFKVS  1250
             IDPEFETDP+MDGINN+ILSYTFFKVS
Sbjct  170   IDPEFETDPRMDGINNLILSYTFFKVS  196



>ref|NP_171743.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis 
thaliana]
 sp|Q8GWR0.1|COX11_ARATH RecName: Full=Cytochrome c oxidase assembly protein COX11, mitochondrial; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAC43281.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63344.1| At1g02410 [Arabidopsis thaliana]
 gb|AEE27427.1| cytochrome c oxidase assembly protein CtaG / Cox11 [Arabidopsis 
thaliana]
Length=287

 Score =   338 bits (867),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 181/212 (85%), Gaps = 12/212 (6%)
 Frame = +3

Query  618   ARSCSMLNFQH-QYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYG  794
             A + SML+  H QY+T +  +E KS+KML YLT +VF MVG +YAAVPLYR FCQATGYG
Sbjct  67    ATAKSMLDSAHRQYSTHSP-SETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYG  125

Query  795   GTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPV  974
             GTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV          
Sbjct  126   GTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV----------  175

Query  975   RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDM  1154
             RVKPGESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDM
Sbjct  176   RVKPGESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDM  235

Query  1155  PVFFYIDPEFETDPKMDGINNIILSYTFFKVS  1250
             PVFFYIDPEFETDP+MDGINN+ILSYTFFKVS
Sbjct  236   PVFFYIDPEFETDPRMDGINNLILSYTFFKVS  267



>ref|XP_004503187.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Cicer arietinum]
Length=261

 Score =   337 bits (863),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 165/211 (78%), Positives = 180/211 (85%), Gaps = 20/211 (9%)
 Frame = +3

Query  651   QYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEK  830
             Q+++ A+ TE+KS+KMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTV R+ESVEEK
Sbjct  62    QFSSHAS-TEQKSQKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVTRRESVEEK  120

Query  831   IARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFY  1010
             IARH  + T ++REIVVQFNAD+ADGM WKF+PTQRE          VRVKPGESALAFY
Sbjct  121   IARHDSNKTATSREIVVQFNADIADGMQWKFVPTQRE----------VRVKPGESALAFY  170

Query  1011  TAENRSSTPITGVSTYNVTPMKAAV---------YFNKIQCFCFEEQRLLPGEQIDMPVF  1163
             TAEN+SSTPITGVSTYNVTPMK  +         YFNKIQCFCFEEQRLLPGEQIDMPVF
Sbjct  171   TAENKSSTPITGVSTYNVTPMKLPLDSSNHRSIFYFNKIQCFCFEEQRLLPGEQIDMPVF  230

Query  1164  FYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             FYIDPE E DPKMDGINNIILSYTFFKVS+E
Sbjct  231   FYIDPEIEDDPKMDGINNIILSYTFFKVSEE  261



>ref|XP_009111199.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Brassica rapa]
Length=281

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 175/204 (86%), Gaps = 11/204 (5%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
               QY+T +  TE KSKKML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQRKE+VE
Sbjct  70    HRQYSTHSI-TETKSKKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRKETVE  128

Query  825   EKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALA  1004
             EKIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV          RVKPGESALA
Sbjct  129   EKIARHSDSGTVTEREIVVQFNADVADGMQWKFTPTQREV----------RVKPGESALA  178

Query  1005  FYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  1184
             FYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF
Sbjct  179   FYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  238

Query  1185  ETDPKMDGINNIILSYTFFKVSDE  1256
             ETD +MDGINN+ILSYTFFKVS+E
Sbjct  239   ETDSRMDGINNLILSYTFFKVSEE  262



>gb|ABF98570.1| Cytochrome c oxidase assembly protein ctaG, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY91665.1| hypothetical protein OsI_13305 [Oryza sativa Indica Group]
Length=244

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 170/192 (89%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK S++ L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKI+RHA DGT
Sbjct  62    EKSSRRTLAYLLGVAAAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKISRHARDGT  121

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              ++REI+VQFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS P
Sbjct  122   TTSREIIVQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSSAP  171

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKM+G+NN
Sbjct  172   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMEGVNN  231

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV+D
Sbjct  232   IVLSYTFFKVND  243



>ref|XP_009389647.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 173/193 (90%), Gaps = 10/193 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++ S+  L+YL GLV AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA +GT
Sbjct  69    DRSSRNTLVYLLGLVAAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAQEGT  128

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              ++RE+VVQFNADVADGMPWKF PTQREV          RVK GESALAFYTAENRSSTP
Sbjct  129   KTSRELVVQFNADVADGMPWKFTPTQREV----------RVKLGESALAFYTAENRSSTP  178

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN
Sbjct  179   ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  238

Query  1218  IILSYTFFKVSDE  1256
             IILSYTFFKV+++
Sbjct  239   IILSYTFFKVNED  251



>gb|ABR21990.1| avirulence protein-interacting protein [Oryza sativa Japonica 
Group]
Length=259

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 170/192 (89%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK S++ L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKI+RHA DGT
Sbjct  62    EKSSRRTLAYLLGVAAAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKISRHARDGT  121

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              ++REI+VQFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS P
Sbjct  122   TTSREIIVQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSSAP  171

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKM+G+NN
Sbjct  172   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMEGVNN  231

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV+D
Sbjct  232   IVLSYTFFKVND  243



>ref|XP_006850996.1| hypothetical protein AMTR_s00025p00215310 [Amborella trichopoda]
 gb|ERN12577.1| hypothetical protein AMTR_s00025p00215310 [Amborella trichopoda]
Length=302

 Score =   336 bits (861),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 160/217 (74%), Positives = 178/217 (82%), Gaps = 14/217 (6%)
 Frame = +3

Query  606   RHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQAT  785
             + S +R+     FQ     +      KS+ MLLYL  LV AMVGC+YAAVPLYRRFCQAT
Sbjct  100   KSSVSRNMGRSGFQSSQVLQGG----KSQAMLLYLVALVVAMVGCTYAAVPLYRRFCQAT  155

Query  786   GYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHH  965
             GYGGTVQ +E+VEEKIARHA DGT ++RE+VVQFNADVADGMPWKFIPTQ+EV       
Sbjct  156   GYGGTVQLRETVEEKIARHAQDGTTTSRELVVQFNADVADGMPWKFIPTQKEV-------  208

Query  966   RPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQ  1145
                +VKPGESALAFYTAEN SSTPITGVSTYNVTPMKAA+YFNKIQCFCFEEQRLLPGEQ
Sbjct  209   ---KVKPGESALAFYTAENNSSTPITGVSTYNVTPMKAAIYFNKIQCFCFEEQRLLPGEQ  265

Query  1146  IDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             IDMPVFFYIDPEFETDPKM  +NN+ILSYTFFK+ +E
Sbjct  266   IDMPVFFYIDPEFETDPKMASVNNLILSYTFFKIGEE  302



>ref|XP_004981968.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Setaria italica]
Length=237

 Score =   333 bits (853),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 169/192 (88%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK S++ L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKI+RHA DGT
Sbjct  55    EKSSRRTLGYLLGVAVAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKISRHARDGT  114

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              + REI+VQFNADVADGMPWKFIPTQREV          RVKPGESALAFYTAENRSS P
Sbjct  115   TTAREIIVQFNADVADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSAP  164

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKM+G+NN
Sbjct  165   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMEGVNN  224

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV+D
Sbjct  225   IVLSYTFFKVND  236



>emb|CDY61607.1| BnaC03g71360D [Brassica napus]
Length=281

 Score =   334 bits (857),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 177/209 (85%), Gaps = 11/209 (5%)
 Frame = +3

Query  633   MLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRK  812
             +L   H++ +  + TE KSKKML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQRK
Sbjct  64    LLGGAHRHYSTHSITESKSKKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRK  123

Query  813   ESVEEKIARHAIDGTVSTR-EIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPG  989
             E+VEEKIARH+  GTV+ R EIVVQFNADVADGM WKF PTQREV          RVKPG
Sbjct  124   ETVEEKIARHSESGTVTERWEIVVQFNADVADGMQWKFTPTQREV----------RVKPG  173

Query  990   ESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFY  1169
             ESALAFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFY
Sbjct  174   ESALAFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFY  233

Query  1170  IDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             IDPEFETD +MDGINN+ILSYTFFKVS+E
Sbjct  234   IDPEFETDSRMDGINNLILSYTFFKVSEE  262



>ref|XP_007015811.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
5 [Theobroma cacao]
 gb|EOY33430.1| Cytochrome c oxidase assembly protein CtaG / Cox11 family isoform 
5 [Theobroma cacao]
Length=245

 Score =   332 bits (850),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 180/224 (80%), Gaps = 18/224 (8%)
 Frame = +3

Query  546   MPRCEFRSV-VDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYT--EKKSKKMLLYLTG  716
             MPRC+F +  +  +  F   G     R  S  + Q  YA+ A++   EKKSKK LLYLT 
Sbjct  1     MPRCDFSTRPLTKSFDFHPYGSQCFGR-LSPFSIQRHYASHASHASKEKKSKKTLLYLTA  59

Query  717   LVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNAD  896
             LVFAMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGTV+TREIVVQFNAD
Sbjct  60    LVFAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGTVATREIVVQFNAD  119

Query  897   VADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  1076
             VADGMPWKFIPTQRE              PGESALAFYTAENRSSTPITGVSTYNVTPMK
Sbjct  120   VADGMPWKFIPTQRE--------------PGESALAFYTAENRSSTPITGVSTYNVTPMK  165

Query  1077  AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
             AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDG
Sbjct  166   AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDG  209



>emb|CDY15430.1| BnaA08g27140D [Brassica napus]
Length=282

 Score =   332 bits (852),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 164/205 (80%), Positives = 175/205 (85%), Gaps = 12/205 (6%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
               QY+T +  TE KSKKML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQRKE+VE
Sbjct  70    HRQYSTHSI-TETKSKKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRKETVE  128

Query  825   EKIARHAIDGTVSTR-EIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESAL  1001
             EKIARH+  GTV+ R EIVVQFNADVADGM WKF PTQREV          RVKPGESAL
Sbjct  129   EKIARHSESGTVTERWEIVVQFNADVADGMQWKFTPTQREV----------RVKPGESAL  178

Query  1002  AFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPE  1181
             AFYTAEN+SS PITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPE
Sbjct  179   AFYTAENKSSAPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPE  238

Query  1182  FETDPKMDGINNIILSYTFFKVSDE  1256
             FETD +MDGINN+ILSYTFFKVS+E
Sbjct  239   FETDSRMDGINNLILSYTFFKVSEE  263



>ref|XP_002463984.1| hypothetical protein SORBIDRAFT_01g010010 [Sorghum bicolor]
 gb|EER90982.1| hypothetical protein SORBIDRAFT_01g010010 [Sorghum bicolor]
Length=237

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 170/192 (89%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK+S++ L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQ +ESVE+KI+RHA DGT
Sbjct  55    EKRSRRTLGYLLGVAVAMVGASYAAVPLYRRFCQATGYGGTVQIRESVEQKISRHARDGT  114

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              ++REI+VQFNADVADGMPW+FIPTQREV          RVKPGESALAFYTAENRSS P
Sbjct  115   TTSREIIVQFNADVADGMPWRFIPTQREV----------RVKPGESALAFYTAENRSSAP  164

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKMDG+NN
Sbjct  165   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMDGVNN  224

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV+D
Sbjct  225   IVLSYTFFKVND  236



>ref|XP_003560576.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Brachypodium distachyon]
Length=233

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 168/192 (88%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK S++ L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKI+RHA DGT
Sbjct  52    EKSSRRTLGYLLGVAAAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKISRHARDGT  111

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
               +REI++QFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS P
Sbjct  112   TPSREIIIQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSSAP  161

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKMDG+NN
Sbjct  162   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMDGVNN  221

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV +
Sbjct  222   IVLSYTFFKVKE  233



>ref|XP_010936849.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Elaeis guineensis]
Length=271

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/187 (84%), Positives = 169/187 (90%), Gaps = 10/187 (5%)
 Frame = +3

Query  696   MLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREI  875
             +L+YL  +V AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA +GT ++REI
Sbjct  93    ILMYLLAVVTAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAREGTTTSREI  152

Query  876   VVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVST  1055
             VVQFNADVADGMPWKF PTQREV          RVKPGESALAFYTAENRSSTPITGVST
Sbjct  153   VVQFNADVADGMPWKFTPTQREV----------RVKPGESALAFYTAENRSSTPITGVST  202

Query  1056  YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYT  1235
             YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM GINN+ILSYT
Sbjct  203   YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMVGINNLILSYT  262

Query  1236  FFKVSDE  1256
             FFKV+++
Sbjct  263   FFKVNED  269



>gb|ABS18735.1| zinc finger-like protein [Oryza sativa Japonica Group]
Length=274

 Score =   330 bits (845),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 168/192 (88%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK S++ L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKI+RHA DGT
Sbjct  62    EKSSRRTLAYLLGVAAAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKISRHARDGT  121

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              ++REI+VQFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS P
Sbjct  122   TTSREIIVQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSSAP  171

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYI PEFETDPKM+G+ N
Sbjct  172   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIHPEFETDPKMEGVKN  231

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV+D
Sbjct  232   IVLSYTFFKVND  243



>ref|XP_008798202.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Phoenix dactylifera]
Length=267

 Score =   328 bits (842),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 157/187 (84%), Positives = 169/187 (90%), Gaps = 10/187 (5%)
 Frame = +3

Query  696   MLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREI  875
             +L+YL  +V AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA +GT ++REI
Sbjct  89    ILMYLLAVVAAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAREGTTASREI  148

Query  876   VVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVST  1055
             VVQFNADVADGMPWKF PTQREV          RVKPGESALAFYTAENRSSTPITGVST
Sbjct  149   VVQFNADVADGMPWKFTPTQREV----------RVKPGESALAFYTAENRSSTPITGVST  198

Query  1056  YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYT  1235
             YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM G+NN+ILSYT
Sbjct  199   YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMVGVNNLILSYT  258

Query  1236  FFKVSDE  1256
             FFKV+++
Sbjct  259   FFKVNED  265



>gb|EMT15700.1| Cytochrome c oxidase assembly protein ctaG [Aegilops tauschii]
Length=234

 Score =   327 bits (838),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 167/192 (87%), Gaps = 10/192 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             EK S+K L YL G+  AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKI+RHA  GT
Sbjct  53    EKSSRKTLGYLVGVAVAMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKISRHARVGT  112

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
               +REIV+QFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS P
Sbjct  113   TPSREIVIQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSSAP  162

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKMDG+NN
Sbjct  163   ITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMDGVNN  222

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFFKV +
Sbjct  223   IVLSYTFFKVKE  234



>ref|XP_009119634.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Brassica rapa]
 emb|CDX89971.1| BnaA10g01110D [Brassica napus]
Length=281

 Score =   328 bits (841),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 172/203 (85%), Gaps = 10/203 (5%)
 Frame = +3

Query  648   HQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEE  827
             H+  +  + TE KSKKML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQRKE+VEE
Sbjct  78    HREYSTHSITETKSKKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRKETVEE  137

Query  828   KIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAF  1007
             KIARH+  GTV+ REIVVQFNADVADGM WKF PTQREV          RVKPGES LAF
Sbjct  138   KIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQREV----------RVKPGESVLAF  187

Query  1008  YTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFE  1187
             YTAEN+SS  ITG+STYNVTPMKA VYFNKIQCFC+EEQRLLPGE+ID+PV FYIDPEFE
Sbjct  188   YTAENKSSASITGISTYNVTPMKAGVYFNKIQCFCYEEQRLLPGEKIDVPVLFYIDPEFE  247

Query  1188  TDPKMDGINNIILSYTFFKVSDE  1256
             TDP+MDGINN+ILSYTFFKVS+E
Sbjct  248   TDPRMDGINNLILSYTFFKVSEE  270



>emb|CDY15242.1| BnaC05g01210D [Brassica napus]
Length=218

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 172/208 (83%), Gaps = 15/208 (7%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
               QY T++  TE KSKKML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQRKE+VE
Sbjct  7     HRQYYTQSI-TETKSKKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYGGTVQRKETVE  65

Query  825   EKIARH---AIDGTVS-TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGE  992
             EKIARH   A   +VS  REIV QFNADVADGM WKF PTQREV          RVKPGE
Sbjct  66    EKIARHSEVAYYSSVSKNREIVAQFNADVADGMQWKFTPTQREV----------RVKPGE  115

Query  993   SALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYI  1172
             S LAFYTAEN+SS PITGVSTYNV PMKA VYFNKIQCFC+EEQRLLPGEQID+PVFFYI
Sbjct  116   SVLAFYTAENKSSAPITGVSTYNVIPMKAGVYFNKIQCFCYEEQRLLPGEQIDVPVFFYI  175

Query  1173  DPEFETDPKMDGINNIILSYTFFKVSDE  1256
             DPEFETDP+MDGINN+ILSYTFFKVS+E
Sbjct  176   DPEFETDPRMDGINNLILSYTFFKVSEE  203



>gb|KCW52200.1| hypothetical protein EUGRSUZ_J01628 [Eucalyptus grandis]
Length=221

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/172 (87%), Positives = 159/172 (92%), Gaps = 10/172 (6%)
 Frame = +3

Query  741   SYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWK  920
             SYAAVPLYRRFCQATGYGGT+QR+E+VEEKIARHA DGTV+TREI VQFNADVADGMPWK
Sbjct  60    SYAAVPLYRRFCQATGYGGTIQRRETVEEKIARHANDGTVATREIAVQFNADVADGMPWK  119

Query  921   FIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKI  1100
             F PTQREV          RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKI
Sbjct  120   FTPTQREV----------RVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKI  169

Query  1101  QCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             QCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN++LSYTFFKVS++
Sbjct  170   QCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLVLSYTFFKVSED  221



>ref|XP_006650503.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Oryza brachyantha]
Length=176

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 161/182 (88%), Gaps = 10/182 (5%)
 Frame = +3

Query  699   LLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIV  878
             + YL G+  AMVG SYAAVPLYRR CQATGYGGTVQR+ESVE+KI+RHA DGT ++REI+
Sbjct  1     MAYLIGVAAAMVGASYAAVPLYRRVCQATGYGGTVQRRESVEDKISRHARDGTTTSREII  60

Query  879   VQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTY  1058
             VQFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS PITGVSTY
Sbjct  61    VQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSSAPITGVSTY  110

Query  1059  NVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTF  1238
             NV PMKAA+YFNKIQCFCFEEQ LLPGE+IDMPVFFYIDPEFETDPKM+G+NNI+LSYTF
Sbjct  111   NVAPMKAAIYFNKIQCFCFEEQTLLPGEKIDMPVFFYIDPEFETDPKMEGVNNIVLSYTF  170

Query  1239  FK  1244
             FK
Sbjct  171   FK  172



>ref|XP_001771985.1| predicted protein [Physcomitrella patens]
 gb|EDQ63246.1| predicted protein [Physcomitrella patens]
Length=193

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 161/190 (85%), Gaps = 10/190 (5%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             KS+ ML+YL  +V AMVG +YAAVPLYR+FCQATGYGGTVQRKE+VEEKIARH  +   S
Sbjct  1     KSEAMLMYLVAMVTAMVGITYAAVPLYRKFCQATGYGGTVQRKETVEEKIARHKGEEAES  60

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
             +RE+VVQFNADVADGMPWKF P QRE+          RV+PG+S LAFYTAEN SS PIT
Sbjct  61    SRELVVQFNADVADGMPWKFTPCQREI----------RVRPGQSTLAFYTAENTSSVPIT  110

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             GVSTYNVTPMKA +YFNKIQCFCFEEQRLLPGE+IDMPVFF+IDPEF TDPKM GIN++I
Sbjct  111   GVSTYNVTPMKAGLYFNKIQCFCFEEQRLLPGEKIDMPVFFFIDPEFATDPKMKGINSLI  170

Query  1224  LSYTFFKVSD  1253
             LSYTFFKV +
Sbjct  171   LSYTFFKVEE  180



>gb|EAZ28386.1| hypothetical protein OsJ_12366 [Oryza sativa Japonica Group]
Length=245

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 162/194 (84%), Gaps = 13/194 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVP--LYRRFCQATGYGGTVQRKESVEEKIARHAID  851
             EK S++ L YL G V A  G      P   YRRFCQATGYGGTVQR+ESVEEKI+RHA D
Sbjct  62    EKSSRRTLAYLLG-VAAANGRRILRRPSRFYRRFCQATGYGGTVQRRESVEEKISRHARD  120

Query  852   GTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSS  1031
             GT ++REI+VQFNADVADGMPWKFIPTQREV          +VKPGESALAFYTAENRSS
Sbjct  121   GTTTSREIIVQFNADVADGMPWKFIPTQREV----------KVKPGESALAFYTAENRSS  170

Query  1032  TPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGI  1211
              PITGVSTYNV PMKAA+YFNKIQCFCFEEQ LLPGEQIDMPVFFYIDPEFETDPKM+G+
Sbjct  171   APITGVSTYNVAPMKAAIYFNKIQCFCFEEQTLLPGEQIDMPVFFYIDPEFETDPKMEGV  230

Query  1212  NNIILSYTFFKVSD  1253
             NNI+LSYTFFKV+D
Sbjct  231   NNIVLSYTFFKVND  244



>gb|EPS69466.1| hypothetical protein M569_05299, partial [Genlisea aurea]
Length=164

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 154/175 (88%), Gaps = 11/175 (6%)
 Frame = +3

Query  636   LNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKE  815
             L+  H YAT AA TEKKSKKML YLTGLVFAMVG SYAAVPLYRRFCQATGYGGTVQRKE
Sbjct  1     LSVGHHYATLAA-TEKKSKKMLFYLTGLVFAMVGASYAAVPLYRRFCQATGYGGTVQRKE  59

Query  816   SVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGES  995
             SVEEKIARH  DGT+++REIVVQFNADVADGMPWKFIPTQR+          VRVKPGES
Sbjct  60    SVEEKIARHERDGTMASREIVVQFNADVADGMPWKFIPTQRQ----------VRVKPGES  109

Query  996   ALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPV  1160
             ALAFYTAEN SSTPITGVSTYNVTPMKA VYFNKIQCFCFEEQRLLPGEQ+DMPV
Sbjct  110   ALAFYTAENLSSTPITGVSTYNVTPMKAGVYFNKIQCFCFEEQRLLPGEQVDMPV  164



>emb|CDY64998.1| BnaC04g02490D [Brassica napus]
Length=279

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 156/191 (82%), Gaps = 14/191 (7%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
               QY+T +  TE KSKKML YLT +VF MVG +YAAVPLYR FCQATGYGGTVQRKE+VE
Sbjct  70    HRQYSTHSI-TETKSKKMLYYLTAVVFGMVGLNYAAVPLYRTFCQATGYGGTVQRKETVE  128

Query  825   EKIARHAIDGTVST---REIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGES  995
             EKIARH+  GTV+    R+IVVQFNADVADGM WKF PTQREV          RVKPGE 
Sbjct  129   EKIARHSESGTVTEKVPRDIVVQFNADVADGMLWKFTPTQREV----------RVKPGER  178

Query  996   ALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYID  1175
              LAFYTAEN+SS PITGVSTYNVT MKA VYFNKIQCFCFEEQRLLPGEQIDMPVFFYID
Sbjct  179   TLAFYTAENKSSAPITGVSTYNVTAMKAGVYFNKIQCFCFEEQRLLPGEQIDMPVFFYID  238

Query  1176  PEFETDPKMDG  1208
             P+FETD +MDG
Sbjct  239   PKFETDSRMDG  249



>ref|XP_007215852.1| hypothetical protein PRUPE_ppa010362mg [Prunus persica]
 gb|EMJ17051.1| hypothetical protein PRUPE_ppa010362mg [Prunus persica]
Length=252

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/189 (76%), Positives = 157/189 (83%), Gaps = 11/189 (6%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             F   G+  +  S S+L  Q  Y+++A   ++KS+KMLLYLTGLVFAMV  +YAAVPLYRR
Sbjct  62    FEKCGQLPSLASQSLLRIQRPYSSQAT-AQQKSRKMLLYLTGLVFAMVASTYAAVPLYRR  120

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FCQATGYGGTVQR+ESVE+KIARH  DGTV+TREIVVQFNADVADGM WKFIPTQRE   
Sbjct  121   FCQATGYGGTVQRRESVEQKIARHTKDGTVTTREIVVQFNADVADGMQWKFIPTQRE---  177

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                    +RVKPGESALAFYTAENRSS PI GVSTYNVTPMKAAVYFNKIQCFCFEEQRL
Sbjct  178   -------IRVKPGESALAFYTAENRSSIPIVGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  230

Query  1131  LPGEQIDMP  1157
             LPGEQIDMP
Sbjct  231   LPGEQIDMP  239



>ref|XP_003600661.1| Cytochrome c oxidase assembly protein ctaG [Medicago truncatula]
Length=279

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 165/214 (77%), Gaps = 22/214 (10%)
 Frame = +3

Query  651   QYATKAAYTEKKSKKMLLYLTGLVFAM-VGCSYAAVPLYRRFCQATGYGGTVQRKESVEE  827
             Q+    A TEKKSK M + LTGL F M V   +A+ PLYR FCQAT Y GTV R+E VEE
Sbjct  76    QHFPYHASTEKKSKMMRMCLTGLAFGMGVLTIFASPPLYRTFCQATSYDGTVTRRERVEE  135

Query  828   KIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAF  1007
             KIARH  + TV++REIVVQFNAD++DGMPWKF+PTQREV          RVKPGESALAF
Sbjct  136   KIARHDSNQTVTSREIVVQFNADISDGMPWKFLPTQREV----------RVKPGESALAF  185

Query  1008  YTAENRSSTPITGVSTYNVTPMKAAV---------YFNKIQCFCFEEQRLLPGEQIDMPV  1160
             YT EN+SSTPITGVSTYNVTPMK  +         YFNKIQCFCFEEQRLLPGE+IDMPV
Sbjct  186   YTVENQSSTPITGVSTYNVTPMKLPLNSSLHRSIFYFNKIQCFCFEEQRLLPGEKIDMPV  245

Query  1161  FFYIDPEFETDPKMDGINNIILSYTFF--KVSDE  1256
             FFYIDPE E DPKM+GINNIILSYTFF  KVS+E
Sbjct  246   FFYIDPEIEDDPKMNGINNIILSYTFFKDKVSEE  279



>ref|XP_002977639.1| hypothetical protein SELMODRAFT_107801, partial [Selaginella 
moellendorffii]
 gb|EFJ20977.1| hypothetical protein SELMODRAFT_107801, partial [Selaginella 
moellendorffii]
Length=180

 Score =   284 bits (726),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 155/190 (82%), Gaps = 10/190 (5%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             K++  L+YL+ +V  MVG +YA+VPLYRRFCQATGYGGT+QRKESVEEKIARHA +    
Sbjct  1     KTQTTLMYLSAVVIGMVGLTYASVPLYRRFCQATGYGGTIQRKESVEEKIARHAKEDAPV  60

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
             TREIVVQFN DV+D + W+F P QR V          +V+PGES+LAF+TAEN SS PIT
Sbjct  61    TREIVVQFNTDVSDKLQWRFTPCQRTV----------KVRPGESSLAFFTAENLSSEPIT  110

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             GVSTYNV PM+AAVYFNKIQCFCFEEQRL PGE+IDMPVFFY+DPEF TDP+MD I N++
Sbjct  111   GVSTYNVVPMQAAVYFNKIQCFCFEEQRLQPGEKIDMPVFFYVDPEFATDPRMDDITNLV  170

Query  1224  LSYTFFKVSD  1253
             LSYTFFKV +
Sbjct  171   LSYTFFKVDE  180



>ref|XP_002979635.1| hypothetical protein SELMODRAFT_110960, partial [Selaginella 
moellendorffii]
 gb|EFJ19524.1| hypothetical protein SELMODRAFT_110960, partial [Selaginella 
moellendorffii]
Length=180

 Score =   283 bits (724),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 155/190 (82%), Gaps = 10/190 (5%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             K++  L+YL+ +V  MVG +YA+VPLYRRFCQATGYGGT+QRKESVEEKIARHA +    
Sbjct  1     KTQTTLMYLSTVVIGMVGLTYASVPLYRRFCQATGYGGTIQRKESVEEKIARHAKEDAPV  60

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
             TREIVVQFN DV+D + W+F P QR V          +V+PGES+LAF+TAEN SS PIT
Sbjct  61    TREIVVQFNTDVSDKLQWRFTPCQRTV----------KVRPGESSLAFFTAENLSSEPIT  110

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             GVSTYNV PM+AAVYFNKIQCFCFEEQRL PGE+IDMPVFFY+DPEF TDP+MD I N++
Sbjct  111   GVSTYNVVPMQAAVYFNKIQCFCFEEQRLQPGEKIDMPVFFYVDPEFATDPRMDDITNLV  170

Query  1224  LSYTFFKVSD  1253
             LSYTFFKV +
Sbjct  171   LSYTFFKVDE  180



>gb|AES70912.2| cytochrome C oxidase assembly protein CtaG/COX11 [Medicago truncatula]
Length=192

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 156/201 (78%), Gaps = 24/201 (12%)
 Frame = +3

Query  696   MLLYLTGLVFAM-VGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTRE  872
             M + LTGL F M V   +A+ PLYR FCQAT Y GTV R+E VEEKIARH  + TV++RE
Sbjct  2     MRMCLTGLAFGMGVLTIFASPPLYRTFCQATSYDGTVTRRERVEEKIARHDSNQTVTSRE  61

Query  873   IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVS  1052
             IVVQFNAD++DGMPWKF+PTQREV          RVKPGESALAFYT EN+SSTPITGVS
Sbjct  62    IVVQFNADISDGMPWKFLPTQREV----------RVKPGESALAFYTVENQSSTPITGVS  111

Query  1053  TYNVTPMKAA-----------VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPK  1199
             TYNVTPMK             +YFNKIQCFCFEEQRLLPGE+IDMPVFFYIDPE E DPK
Sbjct  112   TYNVTPMKVLTTEEYSILYNRIYFNKIQCFCFEEQRLLPGEKIDMPVFFYIDPEIEDDPK  171

Query  1200  MDGINNIILSYTFF--KVSDE  1256
             M+GINNIILSYTFF  KVS+E
Sbjct  172   MNGINNIILSYTFFKDKVSEE  192



>ref|XP_010274440.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=166

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 134/148 (91%), Gaps = 10/148 (7%)
 Frame = +3

Query  813   ESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGE  992
             ++VEEKIARHA DG+  TRE+VVQFNADVADGMPWKF+PTQREV          RVKPGE
Sbjct  29    QTVEEKIARHAQDGSAPTREVVVQFNADVADGMPWKFVPTQREV----------RVKPGE  78

Query  993   SALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYI  1172
             SALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYI
Sbjct  79    SALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYI  138

Query  1173  DPEFETDPKMDGINNIILSYTFFKVSDE  1256
             DPEFETDP+MDG+NN+ILSYTFFKV +E
Sbjct  139   DPEFETDPRMDGVNNLILSYTFFKVGEE  166



>ref|XP_009780093.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Nicotiana sylvestris]
Length=243

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 147/237 (62%), Positives = 163/237 (69%), Gaps = 11/237 (5%)
 Frame = +3

Query  369   MSFFRVFGRTQALHSFKTTLQLHSSTSRNSLQIIAPRYSLFSVGNNGRWKVSSFGCGSLM  548
             MS  R+ GR     S   T     STSR+ L+I+  +   F   +    ++         
Sbjct  1     MSLSRLSGRVNLFLSSNRTCCYPLSTSRDYLEIVVSKDRNFGAIDIRHGQLFGLRYRGFT  60

Query  549   PRCEF-RSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVF  725
              RCE  +S + +    S L   ST RS  MLN +H YAT+A  TEKKSKKML YLTGLVF
Sbjct  61    SRCELNKSTLHNCERLSFLRGQSTVRSWPMLNLRHHYATQATATEKKSKKMLFYLTGLVF  120

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DG  ++REI VQFNADVAD
Sbjct  121   AMVGASYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHAKDGRATSREIAVQFNADVAD  180

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  1076
             GMPWKFIPTQRE          VRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK
Sbjct  181   GMPWKFIPTQRE----------VRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  227



>ref|XP_009389648.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=151

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 136/155 (88%), Gaps = 10/155 (6%)
 Frame = +3

Query  792   GGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRP  971
              G  +  +SVEEKIARHA +GT ++RE+VVQFNADVADGMPWKF PTQREV         
Sbjct  7     AGRNESLQSVEEKIARHAQEGTKTSRELVVQFNADVADGMPWKFTPTQREV---------  57

Query  972   VRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQID  1151
              RVK GESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQID
Sbjct  58    -RVKLGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQID  116

Query  1152  MPVFFYIDPEFETDPKMDGINNIILSYTFFKVSDE  1256
             MPVFFYIDPEFETDPKMDGINNIILSYTFFKV+++
Sbjct  117   MPVFFYIDPEFETDPKMDGINNIILSYTFFKVNED  151



>ref|XP_006432692.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina]
 gb|ESR45932.1| hypothetical protein CICLE_v100021202mg, partial [Citrus clementina]
Length=119

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 119/129 (92%), Gaps = 10/129 (8%)
 Frame = +3

Query  870   EIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGV  1049
             E+VVQFNADVADGMPWKFIPTQREV          RVKPGESALAFYTAENRSSTPITGV
Sbjct  1     EVVVQFNADVADGMPWKFIPTQREV----------RVKPGESALAFYTAENRSSTPITGV  50

Query  1050  STYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILS  1229
             STYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP+MDGINN+ILS
Sbjct  51    STYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPRMDGINNLILS  110

Query  1230  YTFFKVSDE  1256
             YTFFKV+++
Sbjct  111   YTFFKVNED  119



>ref|XP_005846291.1| hypothetical protein CHLNCDRAFT_31751 [Chlorella variabilis]
 gb|EFN54189.1| hypothetical protein CHLNCDRAFT_31751 [Chlorella variabilis]
Length=193

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 134/179 (75%), Gaps = 16/179 (9%)
 Frame = +3

Query  729   MVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARH------AIDGTVSTREIVVQFN  890
             MVG +YAAVPLYR FCQATGYGGTV   ++VE+KI R       A++   + R++ V FN
Sbjct  1     MVGATYAAVPLYRMFCQATGYGGTVIEGKAVEDKIRRREQSPDAAVEAAAAARQVTVYFN  60

Query  891   ADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTP  1070
             +DVADGMPW+F+PTQR V          R+ PG+S LAFYTAENR    +TGVSTYNV P
Sbjct  61    SDVADGMPWRFVPTQRSV----------RLHPGQSTLAFYTAENRCDRAVTGVSTYNVAP  110

Query  1071  MKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
              +A  YFNKIQCFCFEEQ+L PGE+IDMPVFFYIDPEF TDPKM GIN I LSYTFFKV
Sbjct  111   QQAGQYFNKIQCFCFEEQKLRPGEKIDMPVFFYIDPEFATDPKMTGINTITLSYTFFKV  169



>ref|XP_002528151.1| cytochrome C oxidase assembly protein cox11, putative [Ricinus 
communis]
 gb|EEF34242.1| cytochrome C oxidase assembly protein cox11, putative [Ricinus 
communis]
Length=199

 Score =   235 bits (600),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 133/161 (83%), Gaps = 13/161 (8%)
 Frame = +3

Query  627   CSMLNFQH--QYATKAA-YTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGG  797
             C +++ +H   Y  KA+  TE+KS+K L+YLTGLVFAMVG SYAAVPLYRRFCQATGYGG
Sbjct  48    CEVIHKRHYANYNNKASNATEQKSRKTLMYLTGLVFAMVGSSYAAVPLYRRFCQATGYGG  107

Query  798   TVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVR  977
             TVQR+ESVEEKIARH+ +GTV+TREIVVQFNADVADGMPWKFIPTQRE          +R
Sbjct  108   TVQRRESVEEKIARHSKEGTVATREIVVQFNADVADGMPWKFIPTQRE----------LR  157

Query  978   VKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKI  1100
             VKPGESALAFYTAENRS TPITGVSTYNVTPMK     ++I
Sbjct  158   VKPGESALAFYTAENRSKTPITGVSTYNVTPMKINFLVSRI  198



>ref|XP_005646193.1| cytochrome c oxidase assembly protein CtaG/Cox11 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21649.1| cytochrome c oxidase assembly protein CtaG/Cox11 [Coccomyxa subellipsoidea 
C-169]
Length=232

 Score =   236 bits (601),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 140/200 (70%), Gaps = 17/200 (9%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIAR------  839
             +KK+ +  LYL  +V  MVG +YA+VPLYR FCQATG+GGTV+   SVEEK+ +      
Sbjct  17    QKKASEQGLYLVAMVVGMVGLTYASVPLYRMFCQATGFGGTVKEGRSVEEKMRQREENRD  76

Query  840   HAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAE  1019
              A++   + R+I V FNADV+DGMPW+F+P QR V          +V PG+S L FYTA 
Sbjct  77    EAVEAAAAQRQITVSFNADVSDGMPWRFVPAQRSV----------KVHPGQSTLVFYTAH  126

Query  1020  NRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGE-QIDMPVFFYIDPEFETDP  1196
             N S   ITGVSTYNV P +A  YFNKIQCFCFEEQ+L PG  +IDMPVFFYIDPEF TD 
Sbjct  127   NLSDKAITGVSTYNVAPQQAGYYFNKIQCFCFEEQKLRPGMFKIDMPVFFYIDPEFATDD  186

Query  1197  KMDGINNIILSYTFFKVSDE  1256
             ++  IN++ LSYTFF V +E
Sbjct  187   RLKSINHLTLSYTFFNVDEE  206



>ref|XP_002499665.1| cytochrome c oxidase [Micromonas sp. RCC299]
 gb|ACO60923.1| cytochrome c oxidase [Micromonas sp. RCC299]
Length=308

 Score =   235 bits (599),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 141/189 (75%), Gaps = 16/189 (8%)
 Frame = +3

Query  702   LYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARH-----AIDGTVST  866
             LYL  L   MVG +YA+VPLYR FCQATG+GGT +R+ ++E+K+A       ++    + 
Sbjct  79    LYLAALAVGMVGVTYASVPLYRMFCQATGFGGTTRRR-TLEDKLAEQRNLPESVKAAAAN  137

Query  867   REIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITG  1046
             RE+V+ FNADVA+GMPW+F+PTQ+ V          RV+PGE+ LAF+TA+NRS+  ITG
Sbjct  138   REVVISFNADVAEGMPWRFVPTQKSV----------RVRPGETTLAFFTAKNRSNRDITG  187

Query  1047  VSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIIL  1226
             V+TYNV P KA  +FNK+QCFCFEEQRL  GE++DMPVFFY+DPEF +DP M  +N+++L
Sbjct  188   VATYNVQPNKAGSHFNKVQCFCFEEQRLRAGEEVDMPVFFYLDPEFASDPAMVDVNDVML  247

Query  1227  SYTFFKVSD  1253
             SYTFF+  D
Sbjct  248   SYTFFRSDD  256



>gb|KEH33906.1| cytochrome C oxidase assembly protein CtaG/COX11 [Medicago truncatula]
Length=230

 Score =   232 bits (591),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 128/161 (80%), Gaps = 10/161 (6%)
 Frame = +3

Query  594   SNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRF  773
             S     +  R CSM  F+H  +   A TEKKS+KML+YLTGLVF MVG SYAAVPLYRRF
Sbjct  75    SAFASQNVGRLCSMPGFRHFSSHAYASTEKKSQKMLMYLTGLVFGMVGLSYAAVPLYRRF  134

Query  774   CQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*  953
             CQATGYGGTV R+ESVEEKIARH  + TV++REIVVQFNAD+ADGM WKF+PTQRE    
Sbjct  135   CQATGYGGTVTRRESVEEKIARHDSNQTVTSREIVVQFNADIADGMQWKFVPTQRE----  190

Query  954   CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  1076
                   VRVKPGESALAFYTAEN+SSTPITGVSTYNVTPMK
Sbjct  191   ------VRVKPGESALAFYTAENQSSTPITGVSTYNVTPMK  225



>ref|XP_002297920.2| hypothetical protein POPTR_0001s11910g [Populus trichocarpa]
 gb|EEE82725.2| hypothetical protein POPTR_0001s11910g [Populus trichocarpa]
Length=215

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 124/163 (76%), Gaps = 18/163 (11%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             E+KSKK L+YLTGLV AMVG +YAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGT
Sbjct  68    EQKSKKTLIYLTGLVVAMVGSTYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHANDGT  127

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V+TREI VQFNADV DGMPWKF PTQRE          VRVKPGESALAFYTAENRSSTP
Sbjct  128   VATREIAVQFNADVGDGMPWKFAPTQRE----------VRVKPGESALAFYTAENRSSTP  177

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFF  1166
             ITGVSTYNVTPMK         C  F  QR+      D   FF
Sbjct  178   ITGVSTYNVTPMKT--------CLDFGNQRISSQSNRDSFFFF  212



>ref|XP_011026709.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Populus euphratica]
Length=204

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 118/138 (86%), Gaps = 10/138 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             E+KSKK L+YLTGLV AMVG SYAAVPLYRRFCQATGYGGTVQR+ESVEEKIARHA DGT
Sbjct  68    EQKSKKTLIYLTGLVVAMVGSSYAAVPLYRRFCQATGYGGTVQRRESVEEKIARHANDGT  127

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V+TREI VQFNADV DGMPWKF PTQRE          VRVKPGESALAFYTAEN+SSTP
Sbjct  128   VATREIAVQFNADVGDGMPWKFAPTQRE----------VRVKPGESALAFYTAENQSSTP  177

Query  1038  ITGVSTYNVTPMKAAVYF  1091
             ITGVSTYNVTPMK  + +
Sbjct  178   ITGVSTYNVTPMKVLILY  195



>ref|XP_008356787.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Malus domestica]
Length=231

 Score =   227 bits (578),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 123/145 (85%), Gaps = 11/145 (8%)
 Frame = +3

Query  642   FQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESV  821
              Q  Y++ AA T++KS+KML YLTGLVFAMV  SYAAVPLYRRFCQATGYGGT+QR+ESV
Sbjct  84    IQRPYSSLAA-TQRKSRKMLYYLTGLVFAMVAASYAAVPLYRRFCQATGYGGTIQRRESV  142

Query  822   EEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESAL  1001
             E+KIARHA DGTV+ REIVVQFNADVADGM WKFIPTQRE          VRVKPGESAL
Sbjct  143   EQKIARHAKDGTVTNREIVVQFNADVADGMQWKFIPTQRE----------VRVKPGESAL  192

Query  1002  AFYTAENRSSTPITGVSTYNVTPMK  1076
             AFYTAENRSSTPI GVSTYNVTPMK
Sbjct  193   AFYTAENRSSTPIVGVSTYNVTPMK  217



>ref|XP_007513386.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15911.1| predicted protein [Bathycoccus prasinos]
Length=349

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 140/195 (72%), Gaps = 16/195 (8%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIA-RHAIDGTV  860
             K++ ML YL  +    VG SYA+VPLYR FC+ATG+GGT QRK S+E+K+  R  +D ++
Sbjct  119   KNQNMLYYLLAVTSFTVGASYASVPLYRAFCRATGFGGTTQRK-SIEDKMEERDQMDKSI  177

Query  861   ----STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                   R I + FNADVA+G+PWKF PTQ++V           V PGE+ LAFYTAEN S
Sbjct  178   LEKAKKRSIEITFNADVAEGLPWKFTPTQKKVT----------VTPGETVLAFYTAENTS  227

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
             S+ ITGV+TYNV P KA  YFNKIQCFCFEEQRL   E++DMPVFFY+DPEF +D  M+ 
Sbjct  228   SSAITGVATYNVQPGKAGQYFNKIQCFCFEEQRLRAKEKVDMPVFFYLDPEFASDRGMED  287

Query  1209  INNIILSYTFFKVSD  1253
             +N+++LSYTFF+  D
Sbjct  288   VNSLVLSYTFFQSED  302



>ref|XP_003080420.1| putative cytochrome c oxidase assembly protein (ISS) [Ostreococcus 
tauri]
 emb|CAL54587.1| Cytochrome c oxidase assembly protein CtaG/Cox11, domain [Ostreococcus 
tauri]
Length=281

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 135/185 (73%), Gaps = 17/185 (9%)
 Frame = +3

Query  705   YLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKI-----ARHAIDGTVSTR  869
             YL  +V A+VG +YA+VPLYR FCQATG+GGT  R+ ++EEK+     ++ A D   S R
Sbjct  68    YLGAMVVAVVGATYASVPLYRMFCQATGFGGTT-RRATLEEKLESEAWSKEARD-EASKR  125

Query  870   EIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGV  1049
             EI + FNADVA+GMPW+F PTQ+ V           V+PGESALAFYTA+N SSTP+TGV
Sbjct  126   EIKIYFNADVAEGMPWRFRPTQKSVT----------VRPGESALAFYTAKNNSSTPVTGV  175

Query  1050  STYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILS  1229
             +TYNV P K   YFNK+QCFCFEEQRL   E++DMPV FY+DPEF  DP M  + +++LS
Sbjct  176   ATYNVQPNKVGQYFNKVQCFCFEEQRLRGKEEVDMPVLFYVDPEFARDPAMRDVRSLVLS  235

Query  1230  YTFFK  1244
             YTFFK
Sbjct  236   YTFFK  240



>ref|XP_001418742.1| cox 11/CtaG family of cytochrome oxidase assembly protein-like 
protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97035.1| cox 11/CtaG family of cytochrome oxidase assembly protein-like 
protein, partial [Ostreococcus lucimarinus CCE9901]
Length=219

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 132/187 (71%), Gaps = 15/187 (8%)
 Frame = +3

Query  705   YLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAID----GTVSTRE  872
             YL  LV  +VG +YA+VPLYR FCQATG+GGT  R+ ++E+K+   A           RE
Sbjct  44    YLFALVVGVVGATYASVPLYRMFCQATGFGGTT-RRATLEDKLKSDAWSEARRDEARGRE  102

Query  873   IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVS  1052
             I + FNADVA+GMPW+F PTQ+ +          +V+PGESALAFYTA+N + TP+TGV+
Sbjct  103   ITIYFNADVAEGMPWRFTPTQKSI----------KVRPGESALAFYTAKNLTKTPVTGVA  152

Query  1053  TYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSY  1232
             TYNV P K   YFNK+QCFCFEEQRL   E++DMPV FYIDPEF +DP M  + ++ILSY
Sbjct  153   TYNVQPNKCGAYFNKVQCFCFEEQRLRGKEEVDMPVLFYIDPEFASDPNMRDVKSLILSY  212

Query  1233  TFFKVSD  1253
             TFFK  D
Sbjct  213   TFFKSDD  219



>ref|YP_007890656.1| heme biosynthesis protein (mitochondrion) [Jakoba bahamiensis]
 gb|AGH24150.1| heme biosynthesis protein (mitochondrion) [Jakoba bahamiensis]
Length=183

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 128/189 (68%), Gaps = 12/189 (6%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K  K + + +  +V  M G SY +VPLYR FCQ TG+GGT Q  +SV E +  H+    +
Sbjct  3     KDKKSIGIAILSIVIGMAGLSYGSVPLYRLFCQVTGFGGTTQVSDSVSEVLTEHS--NEI  60

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V+FNADV+D MPWKF P Q+E+          RV  GE+ALAFYTAEN +   I
Sbjct  61    QNRLITVRFNADVSDSMPWKFYPMQQEI----------RVLVGETALAFYTAENPTDESI  110

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GVSTYNV P +A +YFNKIQCFCFEEQRL P E IDMPVFF+IDPEF  DPKM  +++I
Sbjct  111   VGVSTYNVNPQQAGIYFNKIQCFCFEEQRLKPHESIDMPVFFFIDPEFLEDPKMSEVDSI  170

Query  1221  ILSYTFFKV  1247
              LSYTFF V
Sbjct  171   TLSYTFFDV  179



>ref|XP_001700235.1| cytochrome c oxidase assembly protein [Chlamydomonas reinhardtii]
 gb|EDO98350.1| cytochrome c oxidase assembly protein [Chlamydomonas reinhardtii]
Length=314

 Score =   224 bits (572),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/207 (56%), Positives = 137/207 (66%), Gaps = 20/207 (10%)
 Frame = +3

Query  657   ATKAAYTEKKSK----KMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
              T++A++   +K    ++ LY       MVG SYA+VPLY+ FC ATGYGGTV+  ESVE
Sbjct  66    GTRSAHSRSSTKYTPAELGLYWGAAAVFMVGVSYASVPLYKLFCAATGYGGTVRAGESVE  125

Query  825   EKIARH------AIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKP  986
             EK+ R        ++   S RE+ V FNADVAD MPW F PTQ  V          RV+P
Sbjct  126   EKLQRRRDAPNAKVEEAASKRELRVWFNADVADDMPWDFRPTQEYV----------RVRP  175

Query  987   GESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFF  1166
             G+S L F+TA N+S  P+TG S YNVTP KAA YFNKIQCFCFEEQRL PGEQ+DMPVFF
Sbjct  176   GQSTLVFFTAHNKSDKPVTGYSLYNVTPDKAAFYFNKIQCFCFEEQRLRPGEQLDMPVFF  235

Query  1167  YIDPEFETDPKMDGINNIILSYTFFKV  1247
             Y+DPEF TD     IN+I LSY F KV
Sbjct  236   YVDPEFATDWNCRNINDITLSYVFNKV  262



>ref|YP_007890805.1| heme biosynthesis protein (mitochondrion) [Seculamonas ecuadoriensis]
 gb|AGH24500.1| heme biosynthesis protein (mitochondrion) [Seculamonas ecuadoriensis]
Length=176

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 128/189 (68%), Gaps = 15/189 (8%)
 Frame = +3

Query  690   KKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTR  869
             K +   L  LV  M+G SYAAVP YR FCQ TG+GGT Q  + +EE +     D T +TR
Sbjct  3     KSLGWILAVLVILMIGMSYAAVPAYRIFCQLTGFGGTTQVNDGIEENL-----DITTNTR  57

Query  870   EIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGV  1049
              I + FNADV+  MPWKF P Q+ +          +V  GES+LAFY AEN +   I GV
Sbjct  58    YITINFNADVSSSMPWKFHPMQKSM----------KVMVGESSLAFYEAENPTDNTIIGV  107

Query  1050  STYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILS  1229
             STYNVTP +A  YFNKIQCFCFEEQRL P E IDMPVFF++DP+   DPKMD I++I LS
Sbjct  108   STYNVTPAQAGPYFNKIQCFCFEEQRLKPHESIDMPVFFFLDPDLLEDPKMDEIDSITLS  167

Query  1230  YTFFKVSDE  1256
             YTFFKVS+E
Sbjct  168   YTFFKVSEE  176



>ref|XP_006418344.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum]
 gb|ESQ36697.1| hypothetical protein EUTSA_v10008363mg [Eutrema salsugineum]
Length=252

 Score =   216 bits (549),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 123/154 (80%), Gaps = 12/154 (8%)
 Frame = +3

Query  618   ARSCSMLNFQH-QYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYG  794
             A S SML   H QY+T +  TE KS+KML YLT +VF MVG +YAAVPLYR FCQATGYG
Sbjct  71    AISKSMLLGAHRQYSTHSP-TETKSQKMLYYLTAVVFGMVGLTYAAVPLYRTFCQATGYG  129

Query  795   GTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPV  974
             GTVQRKE+VEEKIARH+  GTV+ REIVVQFNADVADGM WKF PTQRE          V
Sbjct  130   GTVQRKETVEEKIARHSESGTVTEREIVVQFNADVADGMQWKFTPTQRE----------V  179

Query  975   RVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  1076
             RVKPGESALAFYTAEN+SS PITGVSTYNVTPMK
Sbjct  180   RVKPGESALAFYTAENKSSAPITGVSTYNVTPMK  213



>ref|XP_001628890.1| predicted protein [Nematostella vectensis]
 gb|EDO36827.1| predicted protein [Nematostella vectensis]
Length=182

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 128/189 (68%), Gaps = 18/189 (10%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE--EKIARHAIDGT  857
             ++K   +Y+  +   ++GCSYAAVPLYR +CQA+G GGTV++ ES E  EK+ R      
Sbjct  1     RNKTTSIYIAAVAVTVLGCSYAAVPLYRLYCQASGLGGTVKQAESGEKLEKMERK-----  55

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                R + ++FNAD +  M WKF P Q EV          RV PGE+ALAFYTA N + T 
Sbjct  56    -PERSLRIRFNADTSSTMQWKFKPQQSEV----------RVAPGETALAFYTATNATDTA  104

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITG+STYNV P +A  YFNKIQCFCFEEQRL P EQ+DMPVFFYIDPEF  DP M  ++ 
Sbjct  105   ITGISTYNVIPFEAGQYFNKIQCFCFEEQRLNPNEQVDMPVFFYIDPEFTEDPAMAKVDT  164

Query  1218  IILSYTFFK  1244
             I LSYTFF+
Sbjct  165   ITLSYTFFE  173



>gb|KDD74724.1| cytochrome c oxidase assembly protein CtaG/Cox11 [Helicosporidium 
sp. ATCC 50920]
Length=179

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 129/182 (71%), Gaps = 16/182 (9%)
 Frame = +3

Query  729   MVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHA------IDGTVSTREIVVQFN  890
             M+G +YAAVPLYR FC ATG GGT+Q   +VE K+   A      ++   + R + V+FN
Sbjct  1     MLGLTYAAVPLYRMFCAATGIGGTLQEGATVEAKMRARAERPNAEVEAAAAARRVTVRFN  60

Query  891   ADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTP  1070
             ADV++G+PW F+PTQR V           V+PG+S LAFYTA N S   ITGVSTYNV P
Sbjct  61    ADVSEGLPWTFVPTQRSV----------EVRPGQSTLAFYTAHNSSDRTITGVSTYNVIP  110

Query  1071  MKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVS  1250
              +A  YFNKIQCFCFEEQRL PGE+IDMP+FFY+DPEF TD  +  ++N+ LSYTFFKVS
Sbjct  111   AQAGQYFNKIQCFCFEEQRLRPGEKIDMPIFFYLDPEFATDKALRHVDNLTLSYTFFKVS  170

Query  1251  DE  1256
             +E
Sbjct  171   EE  172



>ref|YP_007890550.1| heme biosynthesis protein (mitochondrion) [Histiona aroides]
 gb|AGH24044.1| heme biosynthesis protein (mitochondrion) [Histiona aroides]
Length=182

 Score =   210 bits (535),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/191 (53%), Positives = 125/191 (65%), Gaps = 12/191 (6%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K +K + +  T    AMVG SY +VPLY+ FCQ TG+GGT Q  +     ++    D   
Sbjct  3     KNNKSIAILFTAASIAMVGLSYGSVPLYQIFCQVTGFGGTTQVSDLTTNSLS--ITDEIK  60

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I + F+ DV+D MPWKF P Q+E+          ++  GE+ALAFYTAEN +  PI
Sbjct  61    ENRVITIHFSGDVSDTMPWKFQPIQQEI----------KLMVGETALAFYTAENPTDKPI  110

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A +YFNKIQCFCFEEQRL P E IDMPVFFYIDPEF  DPKM  I++I
Sbjct  111   VGISTYNVNPQQAGIYFNKIQCFCFEEQRLKPHEVIDMPVFFYIDPEFLDDPKMSDIDSI  170

Query  1221  ILSYTFFKVSD  1253
              LSYTFF V D
Sbjct  171   TLSYTFFDVED  181



>ref|XP_002948467.1| hypothetical protein VOLCADRAFT_80232 [Volvox carteri f. nagariensis]
 gb|EFJ50342.1| hypothetical protein VOLCADRAFT_80232 [Volvox carteri f. nagariensis]
Length=295

 Score =   213 bits (543),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 138/227 (61%), Gaps = 23/227 (10%)
 Frame = +3

Query  582   NIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPL  761
             N PF   G  S + +   L  Q     K   TE     + LY       M+G SYA+VPL
Sbjct  50    NFPFGVAG--SVSGAIRGLTSQSNRRLKLTPTE-----LGLYWGAAAVFMIGVSYASVPL  102

Query  762   YRRFCQATGYGGTVQRKESVEEKIARH------AIDGTVSTREIVVQFNADVADGMPWKF  923
             YR FC ATGYGGTV+  ++VEEK+ R        ++   + REI V FNADV++ MPW+F
Sbjct  103   YRLFCAATGYGGTVRAGQTVEEKLKRRMEAPDAKVEEAAAAREIRVWFNADVSEKMPWEF  162

Query  924   IPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQ  1103
              PTQ  V          RV+PG+S L F+TA N+S  P+TG S YNVTP KAA YFNKIQ
Sbjct  163   WPTQEYV----------RVRPGQSTLVFFTAHNKSDKPVTGYSLYNVTPDKAAFYFNKIQ  212

Query  1104  CFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             CFCFEEQRL  GE IDMPVFFYIDPEF TD     IN+I LSY F K
Sbjct  213   CFCFEEQRLRGGETIDMPVFFYIDPEFATDWNCRNINDITLSYMFHK  259



>ref|XP_003058158.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH58109.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=170

 Score =   208 bits (530),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 126/176 (72%), Gaps = 22/176 (13%)
 Frame = +3

Query  717   LVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNAD  896
             +   MVG +YA+VPLYR FCQATG+GGT +RK +VEEK+A             V+ FNAD
Sbjct  1     MTIGMVGLTYASVPLYRMFCQATGFGGTTRRK-TVEEKLAAQ-----------VISFNAD  48

Query  897   VADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMK  1076
             VA+G+PW+F PTQ+ V           V+PGE+ LAF+TA+N S+  +TGV+TYNV P K
Sbjct  49    VAEGLPWRFTPTQKSVV----------VRPGETTLAFFTAKNESARDVTGVATYNVQPNK  98

Query  1077  AAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             A  +FNK+QCFCFEEQRL  GE++DMPVFFY+DPEF TD  M  +N++ LSYTFF+
Sbjct  99    AGSHFNKVQCFCFEEQRLRAGEEVDMPVFFYLDPEFATDAAMADVNDVTLSYTFFR  154



>gb|EWM22617.1| cox11 cytochrome c oxidase assembly protein [Nannochloropsis 
gaditana]
Length=297

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/233 (47%), Positives = 147/233 (63%), Gaps = 16/233 (7%)
 Frame = +3

Query  555   CEFRSVVDSNIPFSNLGRH-STARSCSMLNFQHQYATKAAYTE--KKSKKMLLYLTGLVF  725
             C  R  + S +P S L  H S A      +F  + A  A   E  +K+K++ LY   +V 
Sbjct  39    CVRRRPLPSALPLSRLSVHFSRAWQPCRRSFSQKSARAAQARELSEKNKRLGLYAISIVI  98

Query  726   AMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             A+ G SYA+VPLY+ FCQ TG+GGT +R +S+E  +     +    +R I + FNADV+D
Sbjct  99    AVTGVSYASVPLYKVFCQTTGFGGTTKRADSLESVVGTAPAE---KSRPIKIVFNADVSD  155

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
               PWKF PTQ ++           V PGE+ALAF+T +N++   + GV+TYNV P KA +
Sbjct  156   TTPWKFYPTQPDI----------LVVPGETALAFFTVKNKTDKAVIGVATYNVFPPKAGL  205

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             YFNKIQCFCF+EQRL P E++DMPVFF++DPE   DP MD ++ I LSYTFFK
Sbjct  206   YFNKIQCFCFDEQRLKPREEVDMPVFFFVDPEMLNDPSMDNVHEITLSYTFFK  258



>ref|XP_005715775.1| unnamed protein product [Chondrus crispus]
 emb|CDF35956.1| unnamed protein product [Chondrus crispus]
Length=310

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 131/199 (66%), Gaps = 12/199 (6%)
 Frame = +3

Query  663   KAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRK--ESVEEKIA  836
             + A   +K+K    ++  +    +G SYA+VPLYR FCQ TG+GGTV+R   E  +E + 
Sbjct  106   REAAIREKNKSFAAWMLAIALGTMGLSYASVPLYRVFCQVTGFGGTVRRGDGEETDEFVT  165

Query  837   RHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTA  1016
                    V  R I ++FNADV+  MPW+F P+Q E+           V PGE+ALAFY A
Sbjct  166   GIEEAKIVEDRPITIRFNADVSAKMPWRFTPSQAEIV----------VLPGETALAFYVA  215

Query  1017  ENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP  1196
             +N S  PITG++TYNVTP KA +YFNK+QCFCF+EQRL PGE +DMP+FF+IDPEF  D 
Sbjct  216   KNESKEPITGIATYNVTPAKAGIYFNKVQCFCFDEQRLKPGEALDMPIFFFIDPEFAQDE  275

Query  1197  KMDGINNIILSYTFFKVSD  1253
              M  + +I+LSYTFF+  D
Sbjct  276   NMADVKDIMLSYTFFRAED  294



>ref|XP_003388301.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Amphimedon queenslandica]
Length=253

 Score =   209 bits (531),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 128/189 (68%), Gaps = 14/189 (7%)
 Frame = +3

Query  687   SKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVST  866
             +++ L Y+  +  A+ G SYAAVPLYR +CQA+GYGGTV +  S  +KI +      V  
Sbjct  65    NRQTLTYMAAIAVAVTGLSYAAVPLYRLYCQASGYGGTVSKATS-GDKIEKME---PVEE  120

Query  867   REIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITG  1046
             R I V+F++ ++ GM WKF+P QRE+          ++ PGE+ALAFYTA N +  PITG
Sbjct  121   RAITVKFSSSISSGMRWKFVPQQREI----------KLLPGETALAFYTATNPTDIPITG  170

Query  1047  VSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIIL  1226
             ++TYNV P  A  YFNKIQCFCFEEQRL P EQ+DMPVFFYIDPEF  DP M  ++ I L
Sbjct  171   IATYNVLPFDAGQYFNKIQCFCFEEQRLNPHEQVDMPVFFYIDPEFVEDPAMINVHTITL  230

Query  1227  SYTFFKVSD  1253
             SYT F+  D
Sbjct  231   SYTLFEAKD  239



>ref|XP_004342654.1| cytochrome c oxidase assembly protein COX11 [Capsaspora owczarzaki 
ATCC 30864]
Length=292

 Score =   210 bits (534),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 132/208 (63%), Gaps = 19/208 (9%)
 Frame = +3

Query  645   QHQYATKAAYTE--KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQ----  806
             Q ++   AA+ E  +++K M +Y+  +     G +YAAVPLYR FC ATGYGG V+    
Sbjct  61    QRRHTGNAAHEENRRRNKSMGMYVAAVGLLTAGLAYAAVPLYRMFCMATGYGGYVRTDTH  120

Query  807   ---RKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVR  977
                  +  E  +AR      V  R I +QFNAD A  M WKF P QRE+          +
Sbjct  121   GGGEDDDGESAVARAERFTPVKERIIKIQFNADTAASMQWKFHPVQREI----------Q  170

Query  978   VKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMP  1157
             V PGE ALAFY+A N +  PI G+STYNV P +A VYFNKIQCFCFEEQRL P EQ+DMP
Sbjct  171   VIPGEPALAFYSATNPTDKPIVGISTYNVLPYEAGVYFNKIQCFCFEEQRLGPHEQVDMP  230

Query  1158  VFFYIDPEFETDPKMDGINNIILSYTFF  1241
             VFF+IDPEF+ DP M GI+ I LSYTFF
Sbjct  231   VFFFIDPEFDKDPAMLGIDTITLSYTFF  258



>gb|EFW42921.2| cytochrome c oxidase assembly protein COX11 [Capsaspora owczarzaki 
ATCC 30864]
Length=355

 Score =   211 bits (538),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 132/208 (63%), Gaps = 19/208 (9%)
 Frame = +3

Query  645   QHQYATKAAYTE--KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQ----  806
             Q ++   AA+ E  +++K M +Y+  +     G +YAAVPLYR FC ATGYGG V+    
Sbjct  124   QRRHTGNAAHEENRRRNKSMGMYVAAVGLLTAGLAYAAVPLYRMFCMATGYGGYVRTDTH  183

Query  807   ---RKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVR  977
                  +  E  +AR      V  R I +QFNAD A  M WKF P QRE+          +
Sbjct  184   GGGEDDDGESAVARAERFTPVKERIIKIQFNADTAASMQWKFHPVQREI----------Q  233

Query  978   VKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMP  1157
             V PGE ALAFY+A N +  PI G+STYNV P +A VYFNKIQCFCFEEQRL P EQ+DMP
Sbjct  234   VIPGEPALAFYSATNPTDKPIVGISTYNVLPYEAGVYFNKIQCFCFEEQRLGPHEQVDMP  293

Query  1158  VFFYIDPEFETDPKMDGINNIILSYTFF  1241
             VFF+IDPEF+ DP M GI+ I LSYTFF
Sbjct  294   VFFFIDPEFDKDPAMLGIDTITLSYTFF  321



>gb|ETI34836.1| hypothetical protein F443_18735 [Phytophthora parasitica P1569]
Length=238

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 131/192 (68%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++++++ ++YL G   A VG SYAAVPLY+ FCQ TG+GGT QR   VEE +A   +   
Sbjct  51    KQRNRRAVMYLAGTAIAWVGISYAAVPLYKIFCQMTGFGGTTQR---VEEFVA-DKLTPR  106

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                + I V F+  V+  MPW F P QR++           + PGE+ALAFYTA+N++   
Sbjct  107   EDAKPIRVTFDGGVSANMPWVFRPQQRDL----------LLVPGETALAFYTAKNKTDKA  156

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGV+TYNV P  A VYFNKIQCFCFEEQRL P E+IDMPVFF+IDPE   DP M+G++N
Sbjct  157   ITGVATYNVYPPSAGVYFNKIQCFCFEEQRLKPNEEIDMPVFFFIDPEICDDPSMNGVHN  216

Query  1218  IILSYTFFKVSD  1253
             I LSYTFFK  D
Sbjct  217   ITLSYTFFKTDD  228



>gb|KFH63971.1| cytochrome c oxidase subunit XI assembly protein [Mortierella 
verticillata NRRL 6337]
Length=272

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 13/190 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             + K+  +LLY T ++ A +G SYAAVPLYR FC ATG GG     E+   K A   +   
Sbjct  77    KHKNNDLLLYTTSILIATLGLSYAAVPLYRMFCSATGLGGAPMVGET---KFAPERLVPR  133

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
              + R I ++FNAD +  + W F+P QR+V          +V PGE+ALAFYTA+N+S   
Sbjct  134   DNHRRIKIKFNADTSTSLQWSFVPQQRQV----------QVLPGETALAFYTAKNKSQED  183

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             + G++TYNVTP K A YFNKIQCFCFEEQ+L+ GEQ+DMP+FF++DPEF TDP M  ++ 
Sbjct  184   VIGIATYNVTPSKVAPYFNKIQCFCFEEQKLMAGEQVDMPIFFFLDPEFATDPNMSDVDT  243

Query  1218  IILSYTFFKV  1247
             ++LSYTFFK 
Sbjct  244   VVLSYTFFKA  253



>gb|ETL81801.1| hypothetical protein L917_17935 [Phytophthora parasitica]
 gb|ETO63579.1| hypothetical protein F444_18733 [Phytophthora parasitica P1976]
 gb|ETP32824.1| hypothetical protein F442_18548 [Phytophthora parasitica P10297]
Length=238

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 131/192 (68%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++++++ ++YL G   A VG SYAAVPLY+ FCQ TG+GGT QR   VEE +A   +   
Sbjct  51    KQRNRRAVMYLAGTAIAWVGISYAAVPLYKIFCQMTGFGGTTQR---VEEFVA-DKLTPR  106

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                + I + F+  V+  MPW F P QR++           + PGE+ALAFYTA+N++   
Sbjct  107   EDAKPIRITFDGGVSANMPWVFRPQQRDL----------LLVPGETALAFYTAKNKTDKA  156

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGV+TYNV P  A VYFNKIQCFCFEEQRL P E+IDMPVFF+IDPE   DP M+G++N
Sbjct  157   ITGVATYNVYPPSAGVYFNKIQCFCFEEQRLKPNEEIDMPVFFFIDPEICDDPSMNGVHN  216

Query  1218  IILSYTFFKVSD  1253
             I LSYTFFK  D
Sbjct  217   ITLSYTFFKTDD  228



>ref|XP_004989205.1| cytochrome c oxidase assembly protein COX11 [Salpingoeca rosetta]
 gb|EGD79120.1| cytochrome c oxidase assembly protein COX11 [Salpingoeca rosetta]
Length=282

 Score =   207 bits (526),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/194 (53%), Positives = 128/194 (66%), Gaps = 16/194 (8%)
 Frame = +3

Query  672   YTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQA---TGYGGTVQRKESVEEKIARH  842
             ++   +K   +Y T  +  ++G SYAAVPLYR FCQA   TGYGGTV + ++ ++K+   
Sbjct  78    FSRGDNKATAIYATAWIIMILGFSYAAVPLYRAFCQAWRATGYGGTVNKHDNDKKKVEDM  137

Query  843   AIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAEN  1022
                  V  R+I V+FNAD +  MPW F P Q+ V           V PGE+ALAF+TA N
Sbjct  138   V---PVEDRQITVRFNADTSATMPWSFKPQQKAV----------TVVPGETALAFFTASN  184

Query  1023  RSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM  1202
              +   ITG+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP +
Sbjct  185   PTDEAITGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPNEEVDMPVFFYIDPEFAEDPNL  244

Query  1203  DGINNIILSYTFFK  1244
               IN+I LSYTFFK
Sbjct  245   MRINDITLSYTFFK  258



>ref|XP_002427059.1| cytochrome c oxidase assembly protein COX11, putative [Pediculus 
humanus corporis]
 gb|EEB14321.1| cytochrome c oxidase assembly protein COX11, putative [Pediculus 
humanus corporis]
Length=241

 Score =   205 bits (521),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 113/221 (51%), Positives = 140/221 (63%), Gaps = 24/221 (11%)
 Frame = +3

Query  579   SNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVP  758
             +NI FSN  ++S          + QY     + EKK K +  Y   +    +G S+AAVP
Sbjct  32    ANILFSNNRQYSQ---------KIQYPRNLDFIEKK-KSVRNYAVAIGILTLGVSFAAVP  81

Query  759   LYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQR  938
             LYR FCQ+TGYGG+V R +   EKI    ID    +R I V+FN+DV   M W+F P Q+
Sbjct  82    LYRIFCQSTGYGGSV-RHDIGGEKIQNLKID---RSRPIKVKFNSDVGSKMSWQFKPQQK  137

Query  939   EVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFE  1118
             ++           V PGE+ALAFYTA N +  PITG+STYN+ P  AA YFNKIQCFCFE
Sbjct  138   DL----------LVYPGETALAFYTATNPTDVPITGISTYNILPFNAAPYFNKIQCFCFE  187

Query  1119  EQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFF  1241
             EQ+L P EQ+DMPVFFYIDPEF  DP+M+ IN IILSYT F
Sbjct  188   EQQLNPNEQVDMPVFFYIDPEFCDDPQMENINEIILSYTIF  228



>ref|XP_008867627.1| hypothetical protein H310_04871 [Aphanomyces invadans]
 gb|ETW03398.1| hypothetical protein H310_04871 [Aphanomyces invadans]
Length=221

 Score =   203 bits (517),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 139/224 (62%), Gaps = 20/224 (9%)
 Frame = +3

Query  600   LGRHSTA---RSCSMLNFQHQYATKAAYT---EKKSKKMLLYLTGLVFAMVGCSYAAVPL  761
             L R +TA   +S ++   Q   ++KAAY    ++K++++L Y +G+V    G +YAAVPL
Sbjct  5     LLRRATALPRQSSALPLLQRSMSSKAAYAKQLQEKNRRILYYTSGVVILFFGGAYAAVPL  64

Query  762   YRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQRE  941
             Y+ FCQ TG+GGT QR +     +A   +        I + F+  V   MPW F P QR+
Sbjct  65    YKVFCQMTGFGGTTQRSDI----LAAEKLSPVEGAHPIRITFDGGVGGAMPWTFKPVQRD  120

Query  942   VPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEE  1121
             +           + PGE+ALAFYTA N S   +TGV+TYNV P KA +YFNKIQCFCFEE
Sbjct  121   L----------IIVPGETALAFYTATNNSDKAVTGVATYNVHPPKAGLYFNKIQCFCFEE  170

Query  1122  QRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             QRL   E+IDMPVFF+IDP+   DP M  ++NI LSYTFFK  D
Sbjct  171   QRLKAREEIDMPVFFFIDPDIVDDPSMQNVSNITLSYTFFKTDD  214



>ref|XP_002901677.1| cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Phytophthora infestans T30-4]
 gb|EEY58733.1| cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Phytophthora infestans T30-4]
Length=244

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 129/189 (68%), Gaps = 14/189 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++++++ ++YL G   A VG SYAAVPLY+ FCQ TG+GGT QR   VEE +A   +   
Sbjct  51    KQRNRRAVMYLAGTAIAWVGISYAAVPLYKIFCQMTGFGGTTQR---VEEFVA-DKLTPR  106

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                + I + F+  V+  MPW F P QR++           + PGE+ALAFYTA N++   
Sbjct  107   EDAKPIRITFDGGVSANMPWVFRPQQRDL----------LLVPGETALAFYTARNKTDKA  156

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGV+TYNV P  A VYFNKIQCFCFEEQRL P E+IDMPVFF+IDPE   DP M+G++N
Sbjct  157   ITGVATYNVYPPSAGVYFNKIQCFCFEEQRLKPNEEIDMPVFFFIDPEICDDPSMNGVHN  216

Query  1218  IILSYTFFK  1244
             I LSYTFFK
Sbjct  217   ITLSYTFFK  225



>ref|XP_008913468.1| hypothetical protein PPTG_17565 [Phytophthora parasitica INRA-310]
 gb|ETK75121.1| hypothetical protein L915_18217 [Phytophthora parasitica]
 gb|ETL28547.1| hypothetical protein L916_18121 [Phytophthora parasitica]
 gb|ETM35009.1| hypothetical protein L914_18021 [Phytophthora parasitica]
 gb|ETN01141.1| hypothetical protein PPTG_17565 [Phytophthora parasitica INRA-310]
 gb|ETP04676.1| hypothetical protein F441_18594 [Phytophthora parasitica CJ01A1]
Length=238

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 130/189 (69%), Gaps = 14/189 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++++++ ++YL G   A VG SYAAVPLY+ FCQ TG+GGT QR   VEE +A   +   
Sbjct  51    KQRNRRAVMYLAGTAIAWVGISYAAVPLYKIFCQMTGFGGTTQR---VEEFVA-DKLTPR  106

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                + I + F+  V+  MPW F P QR++           + PGE+ALAFYTA+N++   
Sbjct  107   EDAKPIRITFDGGVSANMPWVFRPQQRDL----------LLVPGETALAFYTAKNKTDKA  156

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITGV+TYNV P  A VYFNKIQCFCFEEQRL P E+IDMPVFF+IDPE   DP M+G++N
Sbjct  157   ITGVATYNVYPPSAGVYFNKIQCFCFEEQRLKPNEEIDMPVFFFIDPEICDDPSMNGVHN  216

Query  1218  IILSYTFFK  1244
             I LSYTFFK
Sbjct  217   ITLSYTFFK  225



>gb|KFM79068.1| Cytochrome c oxidase assembly protein COX11, mitochondrial, partial 
[Stegodyphus mimosarum]
Length=258

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 139/220 (63%), Gaps = 16/220 (7%)
 Frame = +3

Query  591   FSNLGRHS--TARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLY  764
             FSNL + +    +S  ++ FQH+Y T++     K++  L YL+     + GC+YA+V LY
Sbjct  43    FSNLKQENKKVTKSTQLIFFQHRYYTRSTELNTKNRTTLYYLSAFTILVGGCTYASVLLY  102

Query  765   RRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREV  944
             R +CQ TG GG     E+  EKIA       +  R I V FNAD    M W F P Q  +
Sbjct  103   RLYCQTTGKGGQAVVDEA-GEKIAEMK---PIKKRNITVNFNADTNSTMMWNFKPQQPYI  158

Query  945   PS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQ  1124
                       +V PGE+ALAFYTA N +  PITGV+TYNV P +A  YFNKIQCFCFEEQ
Sbjct  159   ----------KVSPGETALAFYTAINPTDKPITGVATYNVLPFEAGKYFNKIQCFCFEEQ  208

Query  1125  RLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             +L P E++DMPVFFY+DPE+  DP+++ +++IILSYTFF+
Sbjct  209   QLNPHEEVDMPVFFYLDPEYAEDPRLETVDDIILSYTFFE  248



>ref|NP_044755.1| component involved in Haem biosynthesis (mitochondrion) [Reclinomonas 
americana]
 sp|O21243.1|COXZ_RECAM RecName: Full=Cytochrome c oxidase assembly protein ctaG (mitochondrion) 
[Reclinomonas americana]
 gb|AAD11870.1| component involved in Haem biosynthesis (mitochondrion) [Reclinomonas 
americana]
Length=182

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 124/191 (65%), Gaps = 12/191 (6%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K  K + + +  +   M+G SY +VPLYR FCQ TG+GGT Q  + +E  I     D   
Sbjct  3     KNRKSIAILIAAVSITMIGFSYGSVPLYRIFCQVTGFGGTTQVAD-LESDILTLK-DEQQ  60

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V+FN DV+D MPWKF P Q+E+          +V  GE+ALAFY+AEN + + I
Sbjct  61    ENRIITVRFNGDVSDTMPWKFHPIQQEI----------KVMVGETALAFYSAENPTDSSI  110

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A +YFNKIQCFCFEEQRL P E IDMPVFF+IDP    DPKM  I++I
Sbjct  111   IGISTYNVNPQQAGIYFNKIQCFCFEEQRLKPHETIDMPVFFFIDPAILDDPKMSDIDSI  170

Query  1221  ILSYTFFKVSD  1253
              LSYTFF V D
Sbjct  171   TLSYTFFNVED  181



>gb|AGH24332.1| heme biosynthesis protein (mitochondrion) [Reclinomonas americana 
ATCC 50283]
Length=182

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 124/191 (65%), Gaps = 12/191 (6%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K  K + +++  +   M+G SY +VPLYR FCQ TG+GGT Q  + +E  I +   +   
Sbjct  3     KNRKSIAIFIAAMSITMIGFSYGSVPLYRIFCQVTGFGGTTQIAD-LESDILQIK-NEEQ  60

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FN DV+D MPWKF P Q+E+          +V  GE+ALAFY+AEN +   I
Sbjct  61    ENRIITVHFNGDVSDTMPWKFHPIQQEI----------KVMVGETALAFYSAENPTDKSI  110

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A +YFNKIQCFCFEEQRL P E IDMPVFF+IDP    DPKM  I++I
Sbjct  111   IGISTYNVNPQQAGIYFNKIQCFCFEEQRLKPHESIDMPVFFFIDPAILDDPKMSDIDSI  170

Query  1221  ILSYTFFKVSD  1253
              LSYTFF V D
Sbjct  171   TLSYTFFNVED  181



>emb|CCI42784.1| unnamed protein product [Albugo candida]
Length=205

 Score =   201 bits (512),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 102/195 (52%), Positives = 129/195 (66%), Gaps = 18/195 (9%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRK--ESVEEKIARHAI  848
             T +K+++ L+YLTG   + +G SYAAVPLY+ FCQ TG+GGT QR   E VE+   R   
Sbjct  24    TREKNRRALIYLTGFAISWLGISYAAVPLYKVFCQMTGFGGTTQRATLEKVEKLTPREG-  82

Query  849   DGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                   + I + F+A V+  + W F P QR+V           V PGE+ALAFYTA+N++
Sbjct  83    -----AKPIKITFDAGVSSVLEWSFRPQQRDV----------VVLPGETALAFYTAKNKT  127

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PITGV+TYNV P +A VYFNKIQCFCF+EQRL   E+IDMPV F+IDPE   DP +  
Sbjct  128   EKPITGVATYNVYPPQAGVYFNKIQCFCFDEQRLKAKEEIDMPVLFFIDPEICEDPSLAN  187

Query  1209  INNIILSYTFFKVSD  1253
             I+NI LSYTFFK  D
Sbjct  188   ISNITLSYTFFKTDD  202



>gb|AGH24265.1| heme biosynthesis protein (mitochondrion) [Reclinomonas americana 
ATCC 50633]
 gb|AGH24399.1| heme biosynthesis protein (mitochondrion) [Reclinomonas americana 
ATCC 50284]
Length=182

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 123/191 (64%), Gaps = 12/191 (6%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K  K + + +  +   M+G SY +VPLYR FCQ TG+GGT Q  + +E  I +   +   
Sbjct  3     KNRKSIAILIAAMSITMIGFSYGSVPLYRIFCQVTGFGGTTQIAD-LESDILQIK-NEEQ  60

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FN DV+D MPWKF P Q+E+          +V  GE+ALAFY+AEN +   I
Sbjct  61    ENRIITVHFNGDVSDTMPWKFHPIQQEI----------KVMVGETALAFYSAENPTDKSI  110

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A +YFNKIQCFCFEEQRL P E IDMPVFF+IDP    DPKM  I++I
Sbjct  111   IGISTYNVNPQQAGIYFNKIQCFCFEEQRLKPHESIDMPVFFFIDPTILDDPKMSDIDSI  170

Query  1221  ILSYTFFKVSD  1253
              LSYTFF V D
Sbjct  171   TLSYTFFNVED  181



>emb|CCA25445.1| cytochrome c oxidase assembly protein COX11 putative [Albugo 
laibachii Nc14]
Length=205

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 129/195 (66%), Gaps = 18/195 (9%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQR--KESVEEKIARHAI  848
             T +K+++ L+YLTG   + +G SYAAVPLY+ FCQ TG+GGT QR   E +E+   R   
Sbjct  24    TREKNRRALIYLTGFAISWLGISYAAVPLYKVFCQMTGFGGTTQRPTAEKMEKLTPREG-  82

Query  849   DGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                   + I + F+A V+  + W F P QR+V           V PGE+ALAFYTA+N++
Sbjct  83    -----AKPIKITFDAGVSSVLEWSFRPQQRDV----------VVIPGETALAFYTAKNKT  127

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PITGV+TYNV P +A VYFNKIQCFCF+EQRL   E+IDMPV F+IDPE   DP +  
Sbjct  128   EKPITGVATYNVYPPQAGVYFNKIQCFCFDEQRLSAKEEIDMPVLFFIDPEICDDPSLAN  187

Query  1209  INNIILSYTFFKVSD  1253
             I+NI LSYTFFK  D
Sbjct  188   ISNITLSYTFFKTDD  202



>gb|ELU16788.1| hypothetical protein CAPTEDRAFT_205254 [Capitella teleta]
Length=206

 Score =   199 bits (506),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 122/199 (61%), Gaps = 14/199 (7%)
 Frame = +3

Query  657   ATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIA  836
             A ++   E K + ++ Y + ++  M+G  YAAVPLY+ FCQ  G GG    + S    I+
Sbjct  2     AQRSPQLEYKKRTIIYYTSAIIITMIGAGYAAVPLYKIFCQVQGLGG----QASTGHDIS  57

Query  837   RHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTA  1016
             +      V  R I V FNAD A  M W F P QREV           + PGE+ALAFYTA
Sbjct  58    KVTTMAPVKERSIKVIFNADTASAMQWNFKPQQREV----------NLLPGETALAFYTA  107

Query  1017  ENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP  1196
             +N +  PI G+STYNV P  AA YFNKIQCFCFEEQRL P EQ+DMPVFFYIDP+F  DP
Sbjct  108   KNPTDKPIIGISTYNVLPYDAAQYFNKIQCFCFEEQRLNPKEQVDMPVFFYIDPDFVEDP  167

Query  1197  KMDGINNIILSYTFFKVSD  1253
              +   + I LSYTFF+  D
Sbjct  168   ALSNTDTIYLSYTFFEAKD  186



>ref|XP_002109752.1| hypothetical protein TRIADDRAFT_37145 [Trichoplax adhaerens]
 gb|EDV27918.1| hypothetical protein TRIADDRAFT_37145 [Trichoplax adhaerens]
Length=208

 Score =   199 bits (505),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 127/193 (66%), Gaps = 14/193 (7%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             ++ K++  ++Y+  L  A++G SYAAVPLYR FCQA+G+GGT  R     EKIA      
Sbjct  21    SKGKNRTTMIYVIALAIAVIGLSYAAVPLYRVFCQASGFGGTTSRVID-PEKIAEME---  76

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
              V  R + ++FNAD    M W F P Q+E+          ++ PGE+ALAFY A+N +  
Sbjct  77    AVPERPLTIRFNADTGATMRWNFRPKQKEI----------QLIPGETALAFYAAKNPTDE  126

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
             PI G+STYNV P +A +YFNK+QCFCFEEQRL P E++DMPVFFYIDPE   DP +  I+
Sbjct  127   PIIGISTYNVIPFEAGLYFNKVQCFCFEEQRLNPHEEVDMPVFFYIDPEIMNDPALARID  186

Query  1215  NIILSYTFFKVSD  1253
              I LSYTFF+  D
Sbjct  187   TITLSYTFFESKD  199



>ref|XP_004522467.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Ceratitis capitata]
Length=229

 Score =   199 bits (507),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 127/193 (66%), Gaps = 16/193 (8%)
 Frame = +3

Query  678   EKKSKKMLLYLT-GLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             +K+SK  L YLT G +FA  G SYAAVPLYR FCQA  YGGT  +    ++      ID 
Sbjct  37    KKRSKSTLYYLTAGGIFA-AGASYAAVPLYRMFCQAYSYGGTTTQGHDADKVETMEKIDD  95

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
                 R + ++FNAD+A  M W F P Q E+          +V PGE+ALAFYTA N +  
Sbjct  96    ----RILKIRFNADIAASMRWNFKPQQYEI----------KVVPGETALAFYTARNPTDH  141

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
             P+ G+STYNV P +A  YFNKIQCFCFEEQ+L P E++DMPVFFYIDPE+  DPK++ ++
Sbjct  142   PVIGISTYNVLPFEAGAYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEYTKDPKLENVD  201

Query  1215  NIILSYTFFKVSD  1253
              I LSYTFF+  +
Sbjct  202   TITLSYTFFEAKE  214



>gb|EFN84286.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Harpegnathos 
saltator]
Length=229

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/202 (52%), Positives = 126/202 (62%), Gaps = 16/202 (8%)
 Frame = +3

Query  639   NFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKES  818
             N   QY+      EKK +   LY TGL   +VG SY+AVPLYR FCQA  YGGTV    +
Sbjct  24    NLMKQYSDSTF--EKKLRSTALYWTGLGVLVVGLSYSAVPLYRMFCQAYSYGGTV----T  77

Query  819   VEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESA  998
             V    ++      +  R+I ++F AD A  M W F P Q E+           V PGE+A
Sbjct  78    VGHDTSKIDTMSPIKNRKIKIKFTADTAASMQWNFKPQQIEI----------TVVPGETA  127

Query  999   LAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  1178
             LAFYTA N +   I G+STYNV P +   YFNKIQCFCFEEQ L P EQ+DMPVFFYIDP
Sbjct  128   LAFYTATNPTDKQIIGISTYNVIPYEVGQYFNKIQCFCFEEQMLNPHEQVDMPVFFYIDP  187

Query  1179  EFETDPKMDGINNIILSYTFFK  1244
             EF  DPKM+ I++IILSYTFF+
Sbjct  188   EFTEDPKMEFIDDIILSYTFFE  209



>ref|XP_009516673.1| hypothetical protein PHYSODRAFT_322923 [Phytophthora sojae]
 gb|EGZ29398.1| hypothetical protein PHYSODRAFT_322923 [Phytophthora sojae]
Length=236

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 127/187 (68%), Gaps = 14/187 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++++ ++YL G   A VG SYAAVPLY+ FCQ TG+GGT QR   VEE +A   +    +
Sbjct  51    RNRRAVMYLAGTAIAWVGISYAAVPLYKIFCQMTGFGGTTQR---VEEFVA-DKLTPREN  106

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              + I + F+  V+  MPW F P QR++           + PGE+ALAFYTA+N++   IT
Sbjct  107   AKPIRITFDGGVSANMPWVFRPQQRDL----------LLVPGETALAFYTAKNKTDKAIT  156

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             GV+TYNV P  A VYFNKIQCFCFEEQRL   E+IDMPVFF+IDPE   DP M G++NI 
Sbjct  157   GVATYNVYPPSAGVYFNKIQCFCFEEQRLKAKEEIDMPVFFFIDPEICDDPSMSGVHNIT  216

Query  1224  LSYTFFK  1244
             LSYTFFK
Sbjct  217   LSYTFFK  223



>ref|XP_005833946.1| hypothetical protein GUITHDRAFT_107319 [Guillardia theta CCMP2712]
 gb|EKX46966.1| hypothetical protein GUITHDRAFT_107319 [Guillardia theta CCMP2712]
Length=194

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 122/184 (66%), Gaps = 13/184 (7%)
 Frame = +3

Query  702   LYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVV  881
             +Y+ G+    +  +Y +VPLYR FC  TG+ GTV+  + V+ +     I G    R + +
Sbjct  1     MYMGGVTLFTISFTYLSVPLYRLFCAKTGFAGTVKPADMVDYESKAKPISGK---RVLKI  57

Query  882   QFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYN  1061
             +FNAD +D MPWKFIP Q E+          +V PGE+ALAFYTAENR+   I GV++YN
Sbjct  58    KFNADTSDSMPWKFIPQQYEI----------KVLPGEAALAFYTAENRTDKAIIGVASYN  107

Query  1062  VTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFF  1241
             + P  AA+YFNKIQCFCFEEQ L P E+IDMPVFF+IDP+F  D  M+ ++ I LSYTFF
Sbjct  108   IQPEGAALYFNKIQCFCFEEQMLKPNEKIDMPVFFFIDPDFLMDKNMNAVDTITLSYTFF  167

Query  1242  KVSD  1253
             K  D
Sbjct  168   KAGD  171



>ref|XP_002734867.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Saccoglossus kowalevskii]
Length=302

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 128/192 (67%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++K+K +++Y+T +   +VG SYAAVPLY  FCQATG GG    + ++     +      
Sbjct  109   QQKNKTVMIYITSIAVLIVGLSYAAVPLYTLFCQATGLGG----QATIGHDTEKVETMEK  164

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V+TR+I+++FNAD+A  M W F P   EV          RV PGE+ALAFY A+N +  P
Sbjct  165   VATRQILIKFNADLASSMRWNFKPQMGEV----------RVHPGETALAFYKAKNPTDKP  214

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             I G++TYN+ P +A  YFNKIQCFCFEEQ L P E++DMPVFFYIDP+F  DPKM  I+ 
Sbjct  215   IIGIATYNILPFEAGQYFNKIQCFCFEEQILNPHEEVDMPVFFYIDPDFAEDPKMLNIDT  274

Query  1218  IILSYTFFKVSD  1253
             + LSYTFF+  +
Sbjct  275   LTLSYTFFEAKE  286



>ref|XP_009825281.1| hypothetical protein H257_03068 [Aphanomyces astaci]
 gb|ETV85263.1| hypothetical protein H257_03068 [Aphanomyces astaci]
Length=222

 Score =   197 bits (500),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/226 (47%), Positives = 140/226 (62%), Gaps = 22/226 (10%)
 Frame = +3

Query  600   LGRHSTA--RSCSML--NFQHQ-YATKAAYT---EKKSKKMLLYLTGLVFAMVGCSYAAV  755
             L R  TA  R  SM+     H+  ++KAAY    ++K++++L Y +G+V    G +YAAV
Sbjct  4     LLRRVTAVPRQSSMMFPMLHHRSMSSKAAYARQLKEKNRRILYYTSGVVILFFGGAYAAV  63

Query  756   PLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQ  935
             PLY+ FCQ TG+GGT QR +     +A   +        I + F+  V+  +PW F P Q
Sbjct  64    PLYKVFCQMTGFGGTTQRSDI----LAADKLSPVEGAHPIRITFDGGVSGALPWTFKPVQ  119

Query  936   REVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCF  1115
             R++           + PGE+ALAFYTA N +   ITGV+TYNV P KA +YFNKIQCFCF
Sbjct  120   RDL----------IIVPGETALAFYTAMNNTDKAITGVATYNVYPPKAGLYFNKIQCFCF  169

Query  1116  EEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             EEQRL   E+IDMPVFF+IDP+   DP M  ++NI LSYTFFK  D
Sbjct  170   EEQRLKAQEEIDMPVFFFIDPDIVDDPSMQNVSNITLSYTFFKTDD  215



>ref|XP_005177657.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Musca domestica]
Length=235

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 123/190 (65%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             K +  L Y+T     +VG SYAAVPLYR FCQA  YGGT  +    E+          V 
Sbjct  43    KVRSTLYYVTAGGVLIVGLSYAAVPLYRMFCQAYSYGGTTSQGHDAEKVETME----KVK  98

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V+FNADVA  M W F P Q E+          +V PGE+ALAFYTA+N +  P+ 
Sbjct  99    DRIIKVRFNADVASSMRWNFRPQQYEI----------KVAPGETALAFYTAKNPTDHPVI  148

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P +A  YFNKIQCFCFEEQ+L P E++DMPVFFYIDPE+  DPK++ +++I 
Sbjct  149   GISTYNVVPFEAGAYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEYVKDPKLENVDSIT  208

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  209   LSYTFFEARE  218



>ref|XP_001951177.2| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Acyrthosiphon pisum]
Length=224

 Score =   197 bits (500),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 130/212 (61%), Gaps = 28/212 (13%)
 Frame = +3

Query  630   SMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQR  809
             S+ N +    +  +  +K+ +  + YL+ L    VG SYAAVPLY+ FCQA  YGGT+  
Sbjct  21    SLFNKRLHNTSSNSAQKKRIRSTVYYLSSLGVLTVGLSYAAVPLYKMFCQAFSYGGTLN-  79

Query  810   KESVEEKIARHAI-DGTVST------REIVVQFNADVADGMPWKFIPTQREVPS*CSHHR  968
                       H I D  V T      REI V F AD +  M W F P Q E+        
Sbjct  80    ----------HNIEDSKVETMKPNRNREIKVHFTADTSSSMQWSFKPLQNEI--------  121

Query  969   PVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQI  1148
               RV PGE+ALAFYTA+N     ITG+STYNV P +A  YFNKIQCFCFEEQ+L P E++
Sbjct  122   --RVAPGETALAFYTAKNPLDKAITGISTYNVVPFEAGQYFNKIQCFCFEEQQLNPNEEV  179

Query  1149  DMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             DMPVFF+IDPE+ TDPKM+ I++I LSYTFF+
Sbjct  180   DMPVFFFIDPEYTTDPKMENIDDITLSYTFFE  211



>gb|EHJ78858.1| cytochrome c oxidase assembly protein cox11 [Danaus plexippus]
Length=179

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 119/182 (65%), Gaps = 14/182 (8%)
 Frame = +3

Query  708   LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQF  887
             +  L    VG SYAAVPLYR FCQA  YGGT  + E+  E I++      V  R I ++F
Sbjct  1     MIALGVMTVGLSYAAVPLYRIFCQAYSYGGTTAQAEA-NETISKM---NAVKERPIKIRF  56

Query  888   NADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVT  1067
             NADVA  M W F P Q ++           V PGE+ALAFYTA N +  P+ G+STYNV 
Sbjct  57    NADVASSMQWNFKPQQVDI----------TVVPGETALAFYTARNPTDKPVIGISTYNVI  106

Query  1068  PMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             P  A  YFNKIQCFCFEEQ+L P EQ+DMPVFFYIDPEF  DPKM+ ++ I+LSYTFF+ 
Sbjct  107   PFDAGQYFNKIQCFCFEEQQLNPHEQVDMPVFFYIDPEFMEDPKMEFVDEIVLSYTFFEA  166

Query  1248  SD  1253
              +
Sbjct  167   KE  168



>gb|EWY38415.1| cytochrome C oxidase assembly protein [Skermanella stibiiresistens 
SB22]
Length=190

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 123/196 (63%), Gaps = 21/196 (11%)
 Frame = +3

Query  675   TEKKSKKMLLY--LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAI  848
             ++ + K ++L   L GLVF M+G S+AAVPLY  FCQ TG+GGT QR E           
Sbjct  3     SDPRRKNLILMGGLFGLVFGMIGLSFAAVPLYSLFCQVTGFGGTTQRAEGPA--------  54

Query  849   DGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
              G +  R + V+FNADV   MPW F P   E+           V+ GE AL  Y A N S
Sbjct  55    -GPILDRTVKVRFNADVNAAMPWGFKPDVHEM----------TVRLGEPALTSYHAVNHS  103

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
              TP+TG +TYNVTP KA +YFNKIQCFCF EQRL PG+ +DMPV+F++DP    DPK++ 
Sbjct  104   DTPVTGTATYNVTPDKAGIYFNKIQCFCFTEQRLEPGQAVDMPVYFFVDPAMADDPKLND  163

Query  1209  INNIILSYTFFKVSDE  1256
             ++ I LSYTFF+  D+
Sbjct  164   VDTITLSYTFFRAHDD  179



>gb|EWC47569.1| hypothetical protein DRE_03189 [Drechslerella stenobrocha 248]
Length=262

 Score =   197 bits (501),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 126/191 (66%), Gaps = 11/191 (6%)
 Frame = +3

Query  672   YTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAID  851
             + +K+++ +L Y   ++  + G SYAAVP YR  CQ TGYGGT    ++         +D
Sbjct  66    FYKKRNRSILYYSISIIVGVTGFSYAAVPFYRAICQRTGYGGTPITDQTRFTPDKLVPVD  125

Query  852   GTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSS  1031
               +  R + V FN  V+D + WKF P QREV          RV PGE+ALAFYTA N+SS
Sbjct  126   PLLH-RRLRVTFNGAVSDALQWKFTPQQREV----------RVLPGETALAFYTATNKSS  174

Query  1032  TPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGI  1211
               I GV+TY+VTP + A YF+KIQCFCFEEQ+LL GE +DMPVFF+IDPEF  DP+M GI
Sbjct  175   EDIVGVATYSVTPAQVAPYFSKIQCFCFEEQKLLSGETVDMPVFFFIDPEFVKDPQMKGI  234

Query  1212  NNIILSYTFFK  1244
             + I LSYTFFK
Sbjct  235   DTITLSYTFFK  245



>ref|XP_007738671.1| cytochrome c oxidase assembly protein subunit 11 [Capronia epimyces 
CBS 606.96]
 gb|EXJ77233.1| cytochrome c oxidase assembly protein subunit 11 [Capronia epimyces 
CBS 606.96]
Length=228

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 139/233 (60%), Gaps = 28/233 (12%)
 Frame = +3

Query  549   PRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFA  728
             PR + R+VV +    SN  R++T           Q+    A  ++K++  + Y   +   
Sbjct  4     PRIQIRTVVQT----SNKARYAT-----------QWDAARAEAKQKNRTTMFYGLSVGIT  48

Query  729   MVGCSYAAVPLYRRFCQATGYGGT-VQRKESVEEKIARHAIDGTVSTREIVVQFNADVAD  905
             +V  SYA+VPLY+  CQ TG+ G  V+  ES  +   R  +      R + + FN  V+D
Sbjct  49    LVALSYASVPLYKMICQQTGWSGQPVKAHESNGDPALR--LRPVQDHRRLRITFNGSVSD  106

Query  906   GMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAV  1085
              +PWKF P QREV          RV PGE+ALAFYTA N+S   I GV+TY+VTP + A 
Sbjct  107   ILPWKFTPQQREV----------RVLPGETALAFYTATNKSEADIIGVATYSVTPAQVAP  156

Query  1086  YFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             YF+KIQCFCFEEQRL  GE +DMPVFF+IDPEF  DP M GI+ I LSYTFFK
Sbjct  157   YFSKIQCFCFEEQRLNAGETVDMPVFFFIDPEFVKDPAMKGIDTITLSYTFFK  209



>ref|XP_003707566.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Megachile rotundata]
Length=224

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 127/202 (63%), Gaps = 16/202 (8%)
 Frame = +3

Query  648   HQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEE  827
             +QY   A     +S +   Y +G    ++G +YAAVPLYR FCQ+T YGGTV    S+  
Sbjct  27    NQYYNAAHKQRIRSSR--FYWSGGGILILGLTYAAVPLYRVFCQSTSYGGTV----SLNH  80

Query  828   KIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAF  1007
                + +    +  R + ++FNAD A  M W F P Q  +          +V PGE+ALAF
Sbjct  81    DNTKVSTMKPIKDRVLTIKFNADTAATMQWNFKPQQNSI----------KVLPGETALAF  130

Query  1008  YTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFE  1187
             YTA N   TP+TGVSTYNV P +   YFNKIQCFCFEEQ+L P E++DMPVFFYIDP+F 
Sbjct  131   YTATNPLDTPVTGVSTYNVVPYEVGQYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPDFV  190

Query  1188  TDPKMDGINNIILSYTFFKVSD  1253
              DP+M+ IN I+LSYTFF+  D
Sbjct  191   EDPRMENINEIVLSYTFFEAKD  212



>ref|XP_007429857.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Python bivittatus]
Length=245

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 135/223 (61%), Gaps = 29/223 (13%)
 Frame = +3

Query  603   GRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQA  782
             G     RS ++  F+ Q   +    +++++ +L YL   V  M G SYAAVPLYR +CQA
Sbjct  36    GEQRGERSEALAAFRRQQEQQ---WKRRNRTVLTYLAAGVVGMAGLSYAAVPLYRLYCQA  92

Query  783   TGYGGTVQRKESVEEKIARHAIDGTVSTRE------IVVQFNADVADGMPWKFIPTQREV  944
             TG GG+          IA H+  G + T E      I V FN+DV   + W F P Q EV
Sbjct  93    TGLGGST---------IAGHS-SGQIETMEPVKDRIIKVTFNSDVHSSLQWNFKPQQTEV  142

Query  945   PS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQ  1124
                        V PGE+ALAFY A+N +  PI G+STYNV P +A  YFNKIQCFCFEEQ
Sbjct  143   ----------YVVPGETALAFYKAKNPTDKPIIGISTYNVLPPEAGQYFNKIQCFCFEEQ  192

Query  1125  RLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             RL P E++DMPVFF+IDPEF  DPKM+ +N IILSYTFF+  +
Sbjct  193   RLNPHEEVDMPVFFFIDPEFVEDPKMEKVNLIILSYTFFEAKE  235



>dbj|GAA95603.1| hypothetical protein E5Q_02259 [Mixia osmundae IAM 14324]
 gb|KEI41505.1| hypothetical protein L969DRAFT_15525 [Mixia osmundae IAM 14324]
Length=275

 Score =   197 bits (500),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/214 (47%), Positives = 135/214 (63%), Gaps = 14/214 (7%)
 Frame = +3

Query  612   STARSCSMLNFQHQYATKA--AYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQAT  785
             ST R+ + L       TK   AY  ++++ + LY +  V   +G +YAAVPLYR FC AT
Sbjct  55    STTRNTAWLQAIQSERTKQQRAYYGQRNRNLFLYTSATVILGIGVTYAAVPLYRAFCSAT  114

Query  786   GYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHH  965
             G+ GT     S E   A   +    S+R + V+FNAD +D +PW F P QREV       
Sbjct  115   GFAGTPL--TSKEYTSADRLVPAEGSSRRLRVRFNADCSDALPWSFSPQQREV-------  165

Query  966   RPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQ  1145
                RV PGE+ALAFYTA N S   I G++TYNVTP + A YF K++CFCF+EQR+L GE+
Sbjct  166   ---RVLPGETALAFYTATNHSDKDIIGIATYNVTPDRIAPYFAKVECFCFDEQRILAGEE  222

Query  1146  IDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             +D+PVFF+ID ++  DP M  +++I+LSYTFFK 
Sbjct  223   VDLPVFFFIDRDYLEDPLMRDVDDIVLSYTFFKA  256



>ref|WP_037457231.1| cytochrome C oxidase assembly protein, partial [Skermanella stibiiresistens]
Length=178

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 122/195 (63%), Gaps = 21/195 (11%)
 Frame = +3

Query  675   TEKKSKKMLLY--LTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAI  848
             ++ + K ++L   L GLVF M+G S+AAVPLY  FCQ TG+GGT QR E           
Sbjct  3     SDPRRKNLILMGGLFGLVFGMIGLSFAAVPLYSLFCQVTGFGGTTQRAEGPA--------  54

Query  849   DGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
              G +  R + V+FNADV   MPW F P   E+           V+ GE AL  Y A N S
Sbjct  55    -GPILDRTVKVRFNADVNAAMPWGFKPDVHEM----------TVRLGEPALTSYHAVNHS  103

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
              TP+TG +TYNVTP KA +YFNKIQCFCF EQRL PG+ +DMPV+F++DP    DPK++ 
Sbjct  104   DTPVTGTATYNVTPDKAGIYFNKIQCFCFTEQRLEPGQAVDMPVYFFVDPAMADDPKLND  163

Query  1209  INNIILSYTFFKVSD  1253
             ++ I LSYTFF+  D
Sbjct  164   VDTITLSYTFFRAHD  178



>ref|YP_007890481.1| heme biosynthesis protein (mitochondrion) [Andalucia godoyi]
 gb|AGH23975.1| heme biosynthesis protein (mitochondrion) [Andalucia godoyi]
Length=178

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 120/186 (65%), Gaps = 16/186 (9%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             + K + LYL  ++  M   SYA+VPLYR FCQ TGYGGT Q  + V        +D  + 
Sbjct  4     EKKTIFLYLIAMILFMFALSYASVPLYRVFCQVTGYGGTAQILDYVP------LVDEELP  57

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R + ++FNADV   MPWKF P Q+E+          +V  GESALAFY A N +   + 
Sbjct  58    KRILTIRFNADVGVEMPWKFAPIQKEM----------KVLVGESALAFYEATNPTDHDLI  107

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNVTP +A +YFNKIQCFCF+EQ L   E IDMPVFF+IDP+F  DP+M+ I+ I 
Sbjct  108   GISTYNVTPQQAGIYFNKIQCFCFDEQMLKSQESIDMPVFFFIDPDFLEDPRMNEIDTIT  167

Query  1224  LSYTFF  1241
             LSYTFF
Sbjct  168   LSYTFF  173



>ref|XP_008605065.1| hypothetical protein SDRG_01325 [Saprolegnia diclina VS20]
 gb|EQC41351.1| hypothetical protein SDRG_01325 [Saprolegnia diclina VS20]
 gb|KDO34916.1| hypothetical protein SPRG_00977 [Saprolegnia parasitica CBS 223.65]
Length=216

 Score =   194 bits (494),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/200 (50%), Positives = 132/200 (66%), Gaps = 19/200 (10%)
 Frame = +3

Query  657   ATKAAY---TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESV-E  824
             AT+++Y    ++K+K+++LY         G +YAAVPLY+ FCQ TG+GGT QR + +  
Sbjct  22    ATRSSYQRNLDEKNKRIMLYTASTALLFFGAAYAAVPLYKIFCQMTGFGGTTQRSDILTA  81

Query  825   EKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALA  1004
             EK++   ++G    R   V F+  VA  MPW F P QR++           + PGE+ALA
Sbjct  82    EKLS--PVEGAHPIR---VTFDGGVAGAMPWSFRPIQRDL----------VIVPGETALA  126

Query  1005  FYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  1184
             FYTA+N +   ITGV+TYNV P KA +YFNKIQCFCFEEQRL   E+IDMPVFF+IDP+ 
Sbjct  127   FYTAKNPTEKAITGVATYNVHPPKAGLYFNKIQCFCFEEQRLKANEEIDMPVFFFIDPDI  186

Query  1185  ETDPKMDGINNIILSYTFFK  1244
               DP M  ++NI LSYTFFK
Sbjct  187   VDDPSMTNVSNITLSYTFFK  206



>gb|KDR12674.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Zootermopsis 
nevadensis]
Length=247

 Score =   195 bits (496),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 114/244 (47%), Positives = 137/244 (56%), Gaps = 24/244 (10%)
 Frame = +3

Query  528   FGCGSLMPRCEFRSVVDSNIPFSNLGRH-STARSCSMLNFQHQYATKAAYTE--KKSKKM  698
               C  L+      SV      F  L  H S  RS   L  Q      A +TE  KK +  
Sbjct  6     LSCQHLLRTAYGNSVALPRQQFVKLQFHTSVLRS---LKEQQNVKETAGWTERQKKLRST  62

Query  699   LLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE--EKIARHAIDGTVSTRE  872
             + Y+       +G SYAAVPLYR FCQA  YGGT       +  EK+ +      V  R 
Sbjct  63    VHYVVATAVLTIGLSYAAVPLYRMFCQAYSYGGTTAIGHDADKVEKMLK------VQDRV  116

Query  873   IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVS  1052
             I V+FNAD A  M W F P Q E+          +V PGE+ALAFYTA N +  P+TG+S
Sbjct  117   ISVRFNADTAASMRWNFRPQQAEI----------KVVPGETALAFYTACNPTDVPVTGIS  166

Query  1053  TYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSY  1232
             TYNV P +A  YFNKIQCFCFEEQ L P EQ+DMPVFFYIDPEF  DPKM+ ++ + LSY
Sbjct  167   TYNVIPFEAGQYFNKIQCFCFEEQLLNPHEQVDMPVFFYIDPEFAEDPKMETVDLLTLSY  226

Query  1233  TFFK  1244
             TFF+
Sbjct  227   TFFE  230



>ref|WP_035693154.1| cytochrome C oxidase assembly protein, partial [Azospirillum 
halopraeferens]
Length=185

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 122/193 (63%), Gaps = 19/193 (10%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             T ++++K+L+ L GLV  M+G +YA+VPLY  FCQ TG+GGT QR ++  +         
Sbjct  5     TRRRNRKLLISLFGLVAGMIGLAYASVPLYALFCQVTGFGGTTQRADAAPD---------  55

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
             TV  R I V+FNAD    +PW F P +REV           VK GE+ +  Y A NR  +
Sbjct  56    TVLERTIKVRFNADTNRALPWSFRPVEREV----------TVKVGETHITSYRAANRGES  105

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
             P  G + YNVTP KA +YFNKI+CFCF EQ L PGE++DMPV F++DP   +DPKM  ++
Sbjct  106   PTVGTAVYNVTPDKAGIYFNKIECFCFTEQVLHPGEEVDMPVAFFVDPAIASDPKMGDVS  165

Query  1215  NIILSYTFFKVSD  1253
              I LSYTFF+  D
Sbjct  166   TITLSYTFFRAKD  178



>ref|XP_002404242.1| cytochrome C oxidase assembly protein COX11, putative [Ixodes 
scapularis]
 gb|EEC11808.1| cytochrome C oxidase assembly protein COX11, putative [Ixodes 
scapularis]
Length=222

 Score =   194 bits (493),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 124/192 (65%), Gaps = 18/192 (9%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE--EKIARHAIDGT  857
             ++K +LLY++ L   + G SYAAVPLYR FCQ+TG GG     ES E  EK+ +      
Sbjct  37    RNKTVLLYVSSLAVLVGGLSYAAVPLYRLFCQSTGRGGRAFADESAEKIEKMQK------  90

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V  R I + F AD A GM W F P Q +V          RV PGE+ LAFYTA N    P
Sbjct  91    VGHRLIRINFAADTASGMRWNFKPRQSDV----------RVAPGETVLAFYTARNPGDKP  140

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             I G++TYN+ P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPE+  DP ++ +++
Sbjct  141   IDGIATYNIVPYEAGKYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEYAEDPLLENVHD  200

Query  1218  IILSYTFFKVSD  1253
             + LSYTFF+  +
Sbjct  201   LTLSYTFFEAKE  212



>gb|EFX74136.1| hypothetical protein DAPPUDRAFT_307441 [Daphnia pulex]
Length=247

 Score =   195 bits (495),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 124/193 (64%), Gaps = 18/193 (9%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             +K++  + Y+  L   + G SYAAVPLYR FCQ+  YGGT     + E       ++  V
Sbjct  60    EKNRSTVYYVVALGVLVGGLSYAAVPLYRLFCQSYSYGGTTSSTHNPE------GLEKLV  113

Query  861   STRE--IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
               RE  I V+FNAD +  + W F P Q E+          +V  GE+ALAFYTA NR+S 
Sbjct  114   PNRERIIKVRFNADTSSSLTWDFKPQQSEL----------KVALGETALAFYTATNRTSK  163

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
             PI GVSTYNV P +A  YFNKIQCFCFEEQRL P EQ+DMPVFFYIDP+F  DP+M+ I 
Sbjct  164   PIDGVSTYNVVPFEAGQYFNKIQCFCFEEQRLNPNEQVDMPVFFYIDPDFGEDPRMENIE  223

Query  1215  NIILSYTFFKVSD  1253
             +I LSYTFF+  +
Sbjct  224   SITLSYTFFEAKE  236



>ref|XP_003675509.1| hypothetical protein NCAS_0C01520 [Naumovozyma castellii CBS 
4309]
 emb|CCC69142.1| hypothetical protein NCAS_0C01520 [Naumovozyma castellii CBS 
4309]
Length=291

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 142/223 (64%), Gaps = 22/223 (10%)
 Frame = +3

Query  582   NIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPL  761
              IP  ++ + S A    + +F+HQ  TK      K++ + LY + +    +G SYAAVP+
Sbjct  58    KIPKFDISKLSKAEIQRLRDFKHQEDTKM-----KNRTIALYFSSMAVLFLGLSYAAVPI  112

Query  762   YRRFCQATGYGGT--VQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQ  935
             YR  C  TG+GG     R++  ++K+    +D   + + I + F ++V+  +PWKF+P Q
Sbjct  113   YRALCARTGFGGIPITDRRKFTDDKLI--PVD---TEKRIKISFTSEVSQILPWKFVPQQ  167

Query  936   REVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCF  1115
             REV           V PGE+ALAFY A+N S   I G++TY+++P +AA YFNKIQCFCF
Sbjct  168   REV----------YVLPGETALAFYKAKNHSDKDIIGMATYSISPGEAAQYFNKIQCFCF  217

Query  1116  EEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             EEQ+L  GE+IDMPVFF+IDP+F +DP M  I++IIL YTFFK
Sbjct  218   EEQKLAAGEEIDMPVFFFIDPDFASDPAMRNIDDIILHYTFFK  260



>ref|XP_007418976.1| hypothetical protein MELLADRAFT_73700 [Melampsora larici-populina 
98AG31]
 gb|EGF97758.1| hypothetical protein MELLADRAFT_73700 [Melampsora larici-populina 
98AG31]
Length=297

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 136/219 (62%), Gaps = 11/219 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             FSN  R  + +    +  Q++   +  Y + +++ ++LY   L    +G SYAAVPLYR 
Sbjct  70    FSNFSRLRSGQPQRTIIDQYRDRHRTNY-KARNRSLMLYTLSLGILTLGLSYAAVPLYRV  128

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             FC  TGY GT   K+    K +   I   +  + I V+FNAD +D + WKF P Q+ V  
Sbjct  129   FCSVTGYNGTPLTKQEGNGKFSADRISRPIGEKSITVRFNADKSDTLNWKFWPCQKSV--  186

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                     +VKPGE+ LAFY A+N S   I GV+TYNVTP + A YF K++CFCF+EQRL
Sbjct  187   --------KVKPGETVLAFYKAKNLSDKDILGVATYNVTPGQVAPYFAKVECFCFDEQRL  238

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             + GE++D+P+FF+ID +F  DP M+ I++IILSYTFFK 
Sbjct  239   MAGEEVDLPIFFFIDKDFMEDPLMNDIDDIILSYTFFKA  277



>gb|EFZ17766.1| hypothetical protein SINV_10549 [Solenopsis invicta]
Length=228

 Score =   194 bits (493),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 121/188 (64%), Gaps = 14/188 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK +    Y  G+   +VG SY+AVPLYR FCQ+  YGGTV    S     ++ +    +
Sbjct  36    KKLRSTAFYWAGVGVLVVGLSYSAVPLYRMFCQSYSYGGTV----SAGHDASKVSTMTPI  91

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R++ ++FNADVA  M W F P QRE+           + PGE+ALAFYTA N +   +
Sbjct  92    KNRKLKIKFNADVATSMQWNFKPQQREI----------TIIPGETALAFYTATNPTDHQV  141

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +   YFNKIQCFCFEEQ L P EQ+DMPVFFYIDPEF  DPKM+ ++ I
Sbjct  142   VGISTYNVLPFEVGQYFNKIQCFCFEEQMLNPHEQVDMPVFFYIDPEFMEDPKMEFVDEI  201

Query  1221  ILSYTFFK  1244
             ILSYTFF+
Sbjct  202   ILSYTFFE  209



>ref|XP_011123345.1| hypothetical protein AOL_s00081g226 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX47899.1| hypothetical protein AOL_s00081g226 [Arthrobotrys oligospora 
ATCC 24927]
Length=265

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 123/189 (65%), Gaps = 11/189 (6%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K++  +L Y   ++  + G SYAAVP YR  CQ TGYGGT    +S         +D  
Sbjct  71    KKRNTSILYYSISIIVGVTGFSYAAVPFYRAICQRTGYGGTPITDQSRFTPDKLVPVDPL  130

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             +  R + + FN  V+D + WKF P QREV          RV PGE+ALAFYTA N+S   
Sbjct  131   LH-RRLRITFNGSVSDALQWKFTPQQREV----------RVLPGETALAFYTATNKSDED  179

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             I GV+TY+VTP + A YF+KIQCFCFEEQ+LL GE +DMPVFF+IDPEF  DP+M GI+ 
Sbjct  180   IVGVATYSVTPAQVAPYFSKIQCFCFEEQKLLKGETVDMPVFFFIDPEFVKDPQMKGIDT  239

Query  1218  IILSYTFFK  1244
             I LSYTFFK
Sbjct  240   ITLSYTFFK  248



>ref|XP_002934512.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Xenopus (Silurana) tropicalis]
Length=234

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 121/190 (64%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++K +L Y+   V  MVG SYAAVPLYR +CQATG GGT     S E+  A       V 
Sbjct  49    RNKTVLTYVAAAVVGMVGMSYAAVPLYRLYCQATGLGGTAVAGHSSEQIEAMEP----VK  104

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N +  P+ 
Sbjct  105   DRVIKVTFNADVHASLHWNFRPQQGEI----------YVVPGETALAFYKAKNSTENPVI  154

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFF+IDPEF  DP+M  ++ I 
Sbjct  155   GISTYNVVPYEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFFIDPEFADDPRMAKVDTIT  214

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  215   LSYTFFEAKE  224



>ref|XP_008543198.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Microplitis demolitor]
Length=225

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 119/180 (66%), Gaps = 16/180 (9%)
 Frame = +3

Query  705   YLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQ  884
             Y+T L    +G +YAAVPLYR FCQAT YGGTV    S+ + +        V+ R++ V 
Sbjct  44    YVTALGVISIGLAYAAVPLYRVFCQATSYGGTVGHDASMVDTMK------PVNDRKVRVI  97

Query  885   FNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNV  1064
             F AD A  M W F P Q+E+          ++ PGE+ALAFYTA N +  PI G+STYNV
Sbjct  98    FTADTAAAMIWDFKPQQKEI----------KILPGETALAFYTATNPTDKPIVGISTYNV  147

Query  1065  TPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
              P +A  YFNKIQCFCFEEQ+L P EQ+DMPVFFYIDPEF  DP M+  ++I LSYTFF+
Sbjct  148   VPFEAGQYFNKIQCFCFEEQQLNPHEQVDMPVFFYIDPEFAEDPLMENCSDITLSYTFFE  207



>gb|EXX73953.1| Cox11p [Rhizophagus irregularis DAOM 197198w]
 gb|EXX79756.1| Cox11p [Rhizophagus irregularis DAOM 197198w]
Length=264

 Score =   195 bits (495),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 132/217 (61%), Gaps = 19/217 (9%)
 Frame = +3

Query  594   SNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRF  773
             +N+ + +T+ +CS     +Q          ++K  L+Y T ++   +G +YA+VPLYR F
Sbjct  52    TNIQKSTTSNTCSKPLNPYQKRID------RNKSFLMYTTAILICGIGFTYASVPLYRMF  105

Query  774   CQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*  953
             CQ TG+ GT     S   K     +     +R I V FNAD +  + W FIP QREV   
Sbjct  106   CQTTGFSGTPITNSS---KFGPERLVPAKESRRIRVHFNADTSLALDWSFIPQQREV---  159

Query  954   CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  1133
                     V PGE+ALAFYTA+N+S   I G++TYNVTP KA  YFNKIQCFCFEEQ+L 
Sbjct  160   -------YVLPGETALAFYTAKNKSDQDIIGLATYNVTPNKAGQYFNKIQCFCFEEQKLQ  212

Query  1134  PGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
              GE +DMPVFF+IDPEF  DP M  ++ I LSYTFFK
Sbjct  213   AGEAVDMPVFFFIDPEFPEDPSMRDVDTITLSYTFFK  249



>ref|NP_001076427.1| COX11 homolog, cytochrome c oxidase assembly protein [Danio rerio]
 ref|XP_009305048.1| PREDICTED: COX11 homolog, cytochrome c oxidase assembly protein 
isoform X1 [Danio rerio]
 gb|AAI33934.1| Zgc:162286 protein [Danio rerio]
Length=259

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 125/203 (62%), Gaps = 14/203 (7%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
             + ++ ++A   +KK+K +L Y+      M+G SYAAVPLYR +CQATG GG        E
Sbjct  61    KRKHQSQADDWKKKNKTILTYIAAAGVGMIGMSYAAVPLYRLYCQATGLGGAAVAGHDTE  120

Query  825   EKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALA  1004
             +     A    V  R I V FNAD    + W F P Q E+           V PGE+ALA
Sbjct  121   QV----ATMKPVRDRIIKVTFNADTHASIQWNFRPQQSEI----------YVVPGETALA  166

Query  1005  FYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  1184
             FY A N +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF
Sbjct  167   FYRARNPTDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEF  226

Query  1185  ETDPKMDGINNIILSYTFFKVSD  1253
             + DP+M  ++ I LSYTFF+  +
Sbjct  227   DEDPRMARVDTITLSYTFFEAKE  249



>gb|EGI66518.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Acromyrmex 
echinatior]
Length=203

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 121/188 (64%), Gaps = 14/188 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK +    Y +G+   +VG SY+AVPLYR FCQ+  YGGT+    S     ++ +    +
Sbjct  11    KKLRSTAFYWSGVGVLVVGLSYSAVPLYRMFCQSYSYGGTL----SAGHDASKVSTMTPI  66

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R+I + FNADVA  M W F P Q+E+           + PGE+ALAFYTA N +   I
Sbjct  67    RNRKIKIMFNADVASSMQWNFKPQQKEI----------TIIPGETALAFYTATNPTDNQI  116

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +   YFNKIQCFCFEEQ L P EQ+DMPVFF+IDPEF  DPKM+ +N I
Sbjct  117   VGISTYNVLPFEVGQYFNKIQCFCFEEQMLNPHEQVDMPVFFFIDPEFIEDPKMEFVNEI  176

Query  1221  ILSYTFFK  1244
             +LSYTFF+
Sbjct  177   VLSYTFFE  184



>ref|XP_784389.2| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Strongylocentrotus purpuratus]
Length=340

 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 123/188 (65%), Gaps = 14/188 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             +++K ++LY+      +VG SYAAVPLY  FCQATG GG        E+      + G  
Sbjct  152   ERNKSVMLYVVAGAVLVVGFSYAAVPLYTVFCQATGLGGQATAGHDTEKVETMAPVRG--  209

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               RE+V++FNAD A  M W F P Q EV          ++ PGE+ALAFY+A N +  PI
Sbjct  210   --RELVIRFNADTAASMRWNFRPQQSEV----------KLVPGETALAFYSAMNPTDKPI  257

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P  A  YFNKIQCFCFEEQRL P EQ+DMPVFFYIDP+F+ DPKM  +NNI
Sbjct  258   VGISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEQVDMPVFFYIDPDFDEDPKMAKVNNI  317

Query  1221  ILSYTFFK  1244
              LSYTFF+
Sbjct  318   TLSYTFFE  325



>ref|XP_011052777.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Acromyrmex echinatior]
Length=228

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 95/188 (51%), Positives = 121/188 (64%), Gaps = 14/188 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK +    Y +G+   +VG SY+AVPLYR FCQ+  YGGT+    S     ++ +    +
Sbjct  36    KKLRSTAFYWSGVGVLVVGLSYSAVPLYRMFCQSYSYGGTL----SAGHDASKVSTMTPI  91

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R+I + FNADVA  M W F P Q+E+           + PGE+ALAFYTA N +   I
Sbjct  92    RNRKIKIMFNADVASSMQWNFKPQQKEI----------TIIPGETALAFYTATNPTDNQI  141

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +   YFNKIQCFCFEEQ L P EQ+DMPVFF+IDPEF  DPKM+ +N I
Sbjct  142   VGISTYNVLPFEVGQYFNKIQCFCFEEQMLNPHEQVDMPVFFFIDPEFIEDPKMEFVNEI  201

Query  1221  ILSYTFFK  1244
             +LSYTFF+
Sbjct  202   VLSYTFFE  209



>ref|XP_004707453.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Echinops telfairi]
Length=275

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y++    AM+G SYAAVPLYR +CQ TG GG+          +A H  D   
Sbjct  89    RRNKTVLTYMSAAAVAMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHGSDQIE  139

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  140   NMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  189

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DPKM 
Sbjct  190   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPKMV  249

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  D
Sbjct  250   NVDLITLSYTFFEAKD  265



>ref|XP_003738904.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Metaseiulus occidentalis]
Length=228

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 119/187 (64%), Gaps = 11/187 (6%)
 Frame = +3

Query  687   SKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQ-RKESVEEKIARHAIDGTVS  863
             ++  + Y T LV  + G SYAAVPLYR +CQA G GG       S E+  ++      V 
Sbjct  39    NRTAVYYTTSLVLVVGGLSYAAVPLYRIYCQAAGTGGQAAFLGPSTEDAGSKVETMTAVK  98

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V F AD A GM W F P Q  V          R++PGE+ LAFY+A+N    P+ 
Sbjct  99    HRTITVSFQADTASGMRWNFKPQQSSV----------RLRPGETVLAFYSAKNPFDKPVD  148

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G++TYNV P +A  YFNKIQCFCFEEQRL PGE++DMPVFFYIDPE+  DPKM+ ++ I 
Sbjct  149   GIATYNVMPFEAGKYFNKIQCFCFEEQRLNPGEEVDMPVFFYIDPEYAEDPKMENVDQIT  208

Query  1224  LSYTFFK  1244
             LSYTFF+
Sbjct  209   LSYTFFE  215



>gb|KGO73904.1| Cytochrome c oxidase assembly protein CtaG/Cox11 [Penicillium 
italicum]
Length=252

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/190 (48%), Positives = 119/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             ++K++   L Y   L+   V  +Y +VPLY+  CQ TG+GG       V +      +  
Sbjct  59    SQKRNTSTLYYTISLILGTVALAYGSVPLYKMICQQTGWGGQPILTHRVGDGDTSARVTP  118

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
                +R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N+   
Sbjct  119   VTDSRRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATNKGPQ  168

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
              I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFF+IDP+F TDP M GI+
Sbjct  169   DIIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFIDPDFATDPNMQGID  228

Query  1215  NIILSYTFFK  1244
              I LSYTFFK
Sbjct  229   TITLSYTFFK  238



>ref|XP_003492651.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Bombus impatiens]
Length=224

 Score =   192 bits (488),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/219 (46%), Positives = 134/219 (61%), Gaps = 17/219 (8%)
 Frame = +3

Query  597   NLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFC  776
             N  R     + S + F   Y    A  +++ +   LY +G    +VG +YA+VPLYR FC
Sbjct  11    NYYRRQVHTNVSRVLFNQYYD---ATHKRRMRSSRLYWSGFGILVVGFTYASVPLYRIFC  67

Query  777   QATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*C  956
             Q+  YGGTV       +    H++   +  R I ++FNAD A  M W F P Q  +    
Sbjct  68    QSYNYGGTVSTNH---DNSKVHSMK-PIKDRVIKIKFNADTAAMMQWNFKPQQNFI----  119

Query  957   SHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLP  1136
                   +V PGE+ALAFYTA+N  + P+TG+STYNV P +AA YFNKIQCFCFEEQ+L P
Sbjct  120   ------KVVPGETALAFYTAKNPLNVPVTGISTYNVVPYEAAQYFNKIQCFCFEEQQLNP  173

Query  1137  GEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
              E++DMPVFFY+DPEF  DPKM+ +  I+LSYTFF+  +
Sbjct  174   HEEVDMPVFFYVDPEFVDDPKMENVEEIVLSYTFFEAKE  212



>gb|EGT37204.1| hypothetical protein CAEBREN_24455 [Caenorhabditis brenneri]
 gb|EGT48016.1| hypothetical protein CAEBREN_18161 [Caenorhabditis brenneri]
Length=260

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/221 (44%), Positives = 135/221 (61%), Gaps = 16/221 (7%)
 Frame = +3

Query  588   PFSNLGRHSTARSCSMLNFQHQYATKAAYTEK--KSKKMLLYLTGLVFAMVGCSYAAVPL  761
             PFS++           +    Q++ K +  +K   +K    Y+  LV   +GC++AA+P 
Sbjct  23    PFSSIASFQKRGKVLSVQIVRQFSKKPSRIDKSADTKNYTYYVMSLVIVAIGCTFAAIPA  82

Query  762   YRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQRE  941
             YR FC+ T +GG  Q  +  E KI+          R I VQFN+DV   M W+F P Q E
Sbjct  83    YRIFCEQTSFGGLTQVAKDFE-KISNMK---KCEDRLIRVQFNSDVPSSMRWEFKPQQHE  138

Query  942   VPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEE  1121
             +           V PGE+ALAFYTA N +  PI G+S+YN+TP +AA YFNKIQCFCFEE
Sbjct  139   I----------YVHPGETALAFYTARNPTDKPIIGISSYNLTPFQAAYYFNKIQCFCFEE  188

Query  1122  QRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             Q L PGEQ+D+PVFFYIDP++  DP ++ +++I+LSYTFF+
Sbjct  189   QILNPGEQVDLPVFFYIDPDYVNDPALEYLDSILLSYTFFE  229



>gb|KFY56838.1| hypothetical protein V496_06629 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=202

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  10    KKNTSTMFYTLSIILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  69

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  70    GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  119

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  120   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFMNDPNMKGIEQV  179

Query  1221  ILSYTFFK  1244
              LSYTFFK
Sbjct  180   TLSYTFFK  187



>ref|XP_010753659.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Larimichthys crocea]
 ref|XP_010753660.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Larimichthys crocea]
 ref|XP_010753661.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Larimichthys crocea]
Length=258

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 121/195 (62%), Gaps = 24/195 (12%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT--  857
             ++K +L Y+      M+G SYAAVPLYR +CQA+G GGT          +A H +D    
Sbjct  71    RNKTVLTYIAAAGVGMIGLSYAAVPLYRLYCQASGLGGTA---------VAGHDVDQVET  121

Query  858   ---VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                V  R I + FNAD    M W F P Q E+           V PGE+ALAFY A+N +
Sbjct  122   MTPVKERIIKITFNADRHASMQWNFKPQQTEI----------FVVPGETALAFYRAKNPT  171

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PI G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  
Sbjct  172   DKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDEDPRMAR  231

Query  1209  INNIILSYTFFKVSD  1253
             ++ I LSYTFF+  +
Sbjct  232   VDTITLSYTFFEAKE  246



>ref|XP_003397507.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Bombus terrestris]
Length=224

 Score =   192 bits (487),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 94/192 (49%), Positives = 126/192 (66%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +++ +   LY +G    ++G +YA+VPLYR FCQ+  YGGTV       +    H++   
Sbjct  35    KRRMRSSRLYWSGFGILVIGFTYASVPLYRIFCQSYNYGGTVSTNH---DNSKVHSMK-P  90

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             +  R I ++FNAD A  M W F P Q  +          +V PGE+ALAFYTA+N  + P
Sbjct  91    IKDRVIKIKFNADTAAMMQWNFKPQQNFI----------KVVPGETALAFYTAKNPLNVP  140

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             +TG+STYNV P +AA YFNKIQCFCFEEQ+L P E++DMPVFFYIDPEF  DPKM+ +  
Sbjct  141   VTGISTYNVVPYEAAQYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEFVDDPKMENVEE  200

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFF+  +
Sbjct  201   IVLSYTFFEAKE  212



>ref|XP_003224322.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Anolis carolinensis]
Length=245

 Score =   192 bits (489),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 101/196 (52%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L YL   V  M G SYAAVPLYR +CQATG GGT          +A H  D   
Sbjct  59    RRNKTVLTYLAAGVVGMAGLSYAAVPLYRLYCQATGLGGTA---------VAGHGSDQIE  109

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q EV           V PGE+ALAFY A+N 
Sbjct  110   TMEPVKDRIIKVTFNADVHASLQWNFRPQQTEV----------YVVPGETALAFYKAKNP  159

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  PI G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFF+IDPEF  DP+M 
Sbjct  160   TDKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFFIDPEFAEDPRMA  219

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  220   NVDLITLSYTFFEAKE  235



>gb|KFY87309.1| hypothetical protein V498_07225 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
 gb|KFZ17190.1| hypothetical protein V502_04697 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=202

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  10    KKNTSTMFYTLSIILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  69

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  70    GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  119

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  120   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFVNDPNMKGIEQV  179

Query  1221  ILSYTFFK  1244
              LSYTFFK
Sbjct  180   TLSYTFFK  187



>ref|XP_623232.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoformX2 [Apis mellifera]
 ref|XP_006567403.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X3 [Apis mellifera]
 ref|XP_006567404.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X4 [Apis mellifera]
Length=224

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 123/192 (64%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K+ +   LY +G    ++G +YA+VPLYR FCQ+  YGGT+    SV     +      
Sbjct  35    KKRIRSSRLYWSGFGILVIGFTYASVPLYRIFCQSYNYGGTL----SVNHDNTKVQSMKP  90

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             +  R I ++FNAD+   M W F P Q  +          +V PGE+ALAFY A+N    P
Sbjct  91    IKDRVIKIKFNADIGAMMQWNFKPQQNFI----------KVMPGETALAFYRAQNPLDIP  140

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITG+STYNV P +AA YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DPKM+ +  
Sbjct  141   ITGISTYNVVPYEAAQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFVNDPKMEDVEE  200

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFF+  +
Sbjct  201   IVLSYTFFEAKE  212



>ref|XP_003449497.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Oreochromis niloticus]
 ref|XP_005471610.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Oreochromis niloticus]
Length=257

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++K  L Y+      M+G +YAAVPLYR +CQATG GGT       E+     A+   V 
Sbjct  70    RNKTALTYIAAAGVGMIGLAYAAVPLYRLYCQATGLGGTAVAGHDTEQV----AMMTPVK  125

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V FNAD    M W F P Q E+           V PGE+ALAFY A+N +  PI 
Sbjct  126   ERVIKVTFNADTHASMQWNFRPQQTEI----------FVVPGETALAFYRAKNPTDKPII  175

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I 
Sbjct  176   GISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDNDPRMARVDTIT  235

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  236   LSYTFFEAKE  245



>ref|XP_004933673.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Bombyx mori]
Length=241

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 127/200 (64%), Gaps = 19/200 (10%)
 Frame = +3

Query  663   KAAYTEK-KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIAR  839
             ++A+ +K K +  L Y+  L    VG SYAAVPLYR FCQA  YGGT  + E      A 
Sbjct  46    RSAHDQKEKIRSTLNYMIALGIMTVGLSYAAVPLYRIFCQAYSYGGTTGQIE------AN  99

Query  840   HAIDG--TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYT  1013
              A+    T+  R I V+ NAD A  M W F P Q ++           V PGE+ALAFYT
Sbjct  100   KAVGNMKTIKDRPIKVRLNADTASSMQWNFKPQQPDI----------TVLPGETALAFYT  149

Query  1014  AENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETD  1193
             A N +   +TG+STYNV P +A  YFNKIQCFCFEEQ+L P EQ+DMPVFFYIDPE+  D
Sbjct  150   AVNPTDKAVTGISTYNVIPFEAGQYFNKIQCFCFEEQQLNPHEQVDMPVFFYIDPEYIED  209

Query  1194  PKMDGINNIILSYTFFKVSD  1253
             PKM+ I+ I+LSYTFF+  +
Sbjct  210   PKMEFIDEIVLSYTFFEAKE  229



>emb|CAF90980.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=263

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 121/195 (62%), Gaps = 24/195 (12%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT--  857
             ++K +L Y+      M+G SYAAVPLYR +CQA+G GGT          +A H  D    
Sbjct  78    RNKTILTYIAAAGVGMIGLSYAAVPLYRLYCQASGLGGTA---------VAGHNADQVET  128

Query  858   ---VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                V  R I V FNAD    M W F P Q EV           V PGE+ALAFY A+N +
Sbjct  129   MKPVPERVIKVTFNADRHASMQWNFRPQQTEV----------FVVPGETALAFYKAKNPT  178

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PITG+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  
Sbjct  179   DKPITGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDEDPRMAR  238

Query  1209  INNIILSYTFFKVSD  1253
             ++ I LSYTFF+  +
Sbjct  239   VDTITLSYTFFEAKE  253



>gb|KFY45179.1| hypothetical protein V494_01104 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=202

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  10    KKNTSTMFYTLSIILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  69

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  70    GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  119

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  120   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFVNDPNMKGIEQV  179

Query  1221  ILSYTFFK  1244
              LSYTFFK
Sbjct  180   TLSYTFFK  187



>ref|XP_011107029.1| hypothetical protein H072_1037 [Dactylellina haptotyla CBS 200.50]
 gb|EPS45063.1| hypothetical protein H072_1037 [Dactylellina haptotyla CBS 200.50]
Length=265

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 107/232 (46%), Positives = 135/232 (58%), Gaps = 19/232 (8%)
 Frame = +3

Query  555   CEFRSVVDSNIPFSNLGRHSTARSCSMLNFQ--HQYATKAAYTEKKSKKMLLYLTGLVFA  728
             C+ RS+     P S     S  R      FQ  + Y       +K +  +L Y   ++  
Sbjct  34    CQHRSLQPGTQPTSRFFTTSQPR------FQRPNAYPDYNKVFKKGNTSILYYSISIIVG  87

Query  729   MVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADG  908
             + G SYAAVP YR  CQ TGYGGT    ++         +D  +  R + + FN  V+D 
Sbjct  88    VTGFSYAAVPFYRAICQRTGYGGTPITDQTRFTPDKLVPVDPLLH-RRLRITFNGSVSDA  146

Query  909   MPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVY  1088
             + WKF P QREV          RV PGE+ALAFYTA N+S   I GV+TY+VTP + A Y
Sbjct  147   LQWKFSPQQREV----------RVLPGETALAFYTATNKSDEDIVGVATYSVTPAQVAPY  196

Query  1089  FNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             F+KIQCFCFEEQ+LL GE +DMPVFF+IDPEF  DP+M GI+ I LSYTFFK
Sbjct  197   FSKIQCFCFEEQKLLKGESVDMPVFFFIDPEFVKDPQMKGIDTITLSYTFFK  248



>ref|XP_008207587.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Nasonia vitripennis]
 ref|XP_008207588.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Nasonia vitripennis]
Length=214

 Score =   191 bits (485),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 120/191 (63%), Gaps = 16/191 (8%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK +  L Y+T +    +G +YAAVPLYR FCQA  YGGT     S+   +        V
Sbjct  26    KKIRTTLNYVTAVGVLTLGLTYAAVPLYRIFCQAFSYGGTTGHDTSIVADMK------PV  79

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R + ++F AD A  M W F P Q E+          R+ PGE+ALAFYTA N +  PI
Sbjct  80    KDRVLRIKFTADTAAQMAWNFQPQQNEI----------RLVPGETALAFYTATNPTDVPI  129

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GVSTYN+ P +A  YFNKIQCFCFEEQ L P EQ+DMPVFF+IDPEF  DPKM+ ++ +
Sbjct  130   CGVSTYNIVPFEAGQYFNKIQCFCFEEQMLAPHEQVDMPVFFFIDPEFNEDPKMEMVDEL  189

Query  1221  ILSYTFFKVSD  1253
             +LSYTFF+  +
Sbjct  190   VLSYTFFEAKE  200



>ref|XP_005526904.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Pseudopodoces humilis]
Length=227

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 120/191 (63%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             ++++  + Y+      MVG SYAAVPLYR +CQATG GGT    E   E+I R      V
Sbjct  41    RRNRSAVGYIAAAAVGMVGLSYAAVPLYRLYCQATGLGGTAG-TERDAERIERME---PV  96

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FNAD    + W F P Q E+           V PGE+ALAFY A+N +  PI
Sbjct  97    RDRRIRVTFNADTHASIQWNFKPQQSEI----------YVVPGETALAFYKAKNPTDKPI  146

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DPKM  ++ I
Sbjct  147   IGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPKMAKVDLI  206

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  207   TLSYTFFEAKE  217



>ref|XP_001608008.2| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X1 [Nasonia vitripennis]
Length=226

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 120/191 (63%), Gaps = 16/191 (8%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK +  L Y+T +    +G +YAAVPLYR FCQA  YGGT     S+   +        V
Sbjct  38    KKIRTTLNYVTAVGVLTLGLTYAAVPLYRIFCQAFSYGGTTGHDTSIVADMK------PV  91

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R + ++F AD A  M W F P Q E+          R+ PGE+ALAFYTA N +  PI
Sbjct  92    KDRVLRIKFTADTAAQMAWNFQPQQNEI----------RLVPGETALAFYTATNPTDVPI  141

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GVSTYN+ P +A  YFNKIQCFCFEEQ L P EQ+DMPVFF+IDPEF  DPKM+ ++ +
Sbjct  142   CGVSTYNIVPFEAGQYFNKIQCFCFEEQMLAPHEQVDMPVFFFIDPEFNEDPKMEMVDEL  201

Query  1221  ILSYTFFKVSD  1253
             +LSYTFF+  +
Sbjct  202   VLSYTFFEAKE  212



>ref|XP_003414440.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Loxodonta africana]
Length=275

 Score =   193 bits (490),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y+      M+G SYAAVPLYR +CQATG GG+V         +A HA D   
Sbjct  89    RRNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQATGLGGSV---------VAGHASDQIE  139

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  140   TMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVMPGETALAFYKAKNP  189

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  190   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMV  249

Query  1206  GINNIILSYTFFKVSD  1253
              +  I LSYTFF+  +
Sbjct  250   NVELITLSYTFFEAKE  265



>ref|XP_006608609.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Apis dorsata]
Length=224

 Score =   191 bits (486),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 122/192 (64%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K+ +   LY +G    ++G +YA+VPLYR FCQ+  YGGT+    SV     +      
Sbjct  35    KKRIRSSRLYWSGFGILVMGFTYASVPLYRIFCQSYNYGGTL----SVNHDNTKIQSMKP  90

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                R I ++FNAD A  M W F P Q  +          +V PGE+ALAFY A+N    P
Sbjct  91    FKDRVIKIKFNADTAAMMQWNFKPQQNFI----------KVMPGETALAFYKAQNPLDVP  140

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             ITG+STYNV P +AA YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M+ +  
Sbjct  141   ITGISTYNVVPYEAAQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFVNDPRMEDVKE  200

Query  1218  IILSYTFFKVSD  1253
             I+LSYTFF+  D
Sbjct  201   IVLSYTFFEAKD  212



>ref|XP_008297340.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Stegastes partitus]
Length=249

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 119/192 (62%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             ++++K +L Y+      M+G SYAAVPLYR +CQA G GGT       E+     A    
Sbjct  60    QRRNKTVLTYIAAAGVGMIGLSYAAVPLYRLYCQAAGLGGTAVAGHDTEQV----ATMTP  115

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
             V  R I V FNAD    M W F P Q E+           V PGE+ALAFY A+N +  P
Sbjct  116   VKERVIKVTFNADTHASMQWNFRPQQTEI----------FVVPGETALAFYRAKNPTDKP  165

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             I G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  +  
Sbjct  166   IIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDEDPRMARVET  225

Query  1218  IILSYTFFKVSD  1253
             I LSYTFF+  +
Sbjct  226   ITLSYTFFEAKE  237



>emb|CDM37149.1| Cytochrome c oxidase assembly protein CtaG/Cox11 [Penicillium 
roqueforti FM164]
Length=252

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             ++K++   L Y   ++   V  +Y +VPLY+  CQ TG+GG       + +      +  
Sbjct  59    SQKRNNSTLYYTISMILGTVALAYGSVPLYKMICQQTGWGGQPILTHRIGDGDTSARVTP  118

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
                +R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N+   
Sbjct  119   VTDSRRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATNKGPQ  168

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
              I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFF+IDP+F TDP M GI+
Sbjct  169   DIIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFIDPDFATDPNMKGID  228

Query  1215  NIILSYTFFK  1244
              I LSYTFFK
Sbjct  229   TITLSYTFFK  238



>ref|XP_006278604.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Alligator mississippiensis]
Length=204

 Score =   191 bits (484),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 119/196 (61%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             ++++  L Y+      MVG +YAAVPLYR +CQ TG GG+          +A H  D   
Sbjct  18    RRNRTALTYVAATAVGMVGLAYAAVPLYRLYCQTTGLGGSA---------VAGHGSDHIE  68

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  69    TMEPVKDRIIKVTFNADVHASLHWNFRPQQNEI----------YVVPGETALAFYKAKNS  118

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DPKM 
Sbjct  119   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFAEDPKMA  178

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  D
Sbjct  179   KVDLITLSYTFFQAKD  194



>ref|XP_006635437.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Lepisosteus oculatus]
Length=345

 Score =   195 bits (495),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 119/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K++K +L Y+      M+G SYAAVPLYR +CQA+G GGT       E      A    V
Sbjct  157   KRNKTILTYIVAAGVGMIGMSYAAVPLYRLYCQASGLGGTAVAGHDTEHV----ATMKPV  212

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FNADV   + W F P Q E+           + PGE+ALAFY A+N +  PI
Sbjct  213   RERVIKVTFNADVHASLQWNFRPQQTEI----------YLVPGETALAFYKAKNPTDKPI  262

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  +  I
Sbjct  263   IGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPNEEVDMPVFFYIDPEFDEDPRMARVKTI  322

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  323   TLSYTFFEAKE  333



>ref|XP_003679130.1| hypothetical protein TDEL_0A05870 [Torulaspora delbrueckii]
 emb|CCE89919.1| hypothetical protein TDEL_0A05870 [Torulaspora delbrueckii]
Length=268

 Score =   192 bits (489),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 106/247 (43%), Positives = 141/247 (57%), Gaps = 27/247 (11%)
 Frame = +3

Query  513   WKVSSFGCGSLMPRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEK-KS  689
             W VS F     +          SNI F  L R            ++    K A   K KS
Sbjct  14    WNVSRFSVSRQVGLARGVRFQSSNINFDKLTRAE---------IKYLREQKIAKERKLKS  64

Query  690   KKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGT--VQRKESVEEKIARHAIDGTVS  863
             + +  Y + +    +G +YAAVPLYR  C  TGYGG     R++  ++K+     D    
Sbjct  65    RTIAFYFSSIAIVFLGLAYAAVPLYRAICARTGYGGIPITDRRKFTDDKLIPVNTD----  120

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              + I V F ++V+  +PWKFIP QREV           V+PGE+ALAFY A+N S   I 
Sbjct  121   -KRIRVAFTSEVSQILPWKFIPEQREV----------YVQPGETALAFYKAKNNSDKDII  169

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G++TY++TP +AA YFNKIQCFCFEEQ+L  GE+IDMPVFF+IDP+F +DP M  I++II
Sbjct  170   GMATYSITPGEAAPYFNKIQCFCFEEQKLAAGEEIDMPVFFFIDPDFVSDPAMRNIDDII  229

Query  1224  LSYTFFK  1244
             L YTFF+
Sbjct  230   LHYTFFR  236



>gb|ETN76752.1| cytochrome C oxidase assembly protein CtaG family protein [Necator 
americanus]
Length=231

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 127/195 (65%), Gaps = 14/195 (7%)
 Frame = +3

Query  687   SKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVST  866
             ++ ++ Y+  L    VG ++AA+P YR FC+ T +GG  Q  +  E KIA+      V  
Sbjct  11    NRDVMYYVVSLGVVAVGVTFAAIPAYRIFCEKTSFGGLTQIAKDFE-KIAKMK---KVED  66

Query  867   REIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITG  1046
             R I VQFN+DV   M W+F P Q E+           V PGE+ALAFYTA N +  PI G
Sbjct  67    RLIRVQFNSDVPSSMRWEFKPQQHEM----------YVHPGETALAFYTARNPTDRPIVG  116

Query  1047  VSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIIL  1226
             +S+YN+TP +AA YFNKIQCFCFEEQ L PGEQ+D+PVFFYIDP++  DP ++ ++NI+L
Sbjct  117   ISSYNLTPFQAAYYFNKIQCFCFEEQILNPGEQVDLPVFFYIDPDYANDPALEYLDNILL  176

Query  1227  SYTFFKVSDE*QFYS  1271
             SYTFF+   + Q  S
Sbjct  177   SYTFFEAKSDLQLPS  191



>ref|XP_002485454.1| cytochrome c oxidase assembly protein Cox11, putative [Talaromyces 
stipitatus ATCC 10500]
 gb|EED15501.1| cytochrome c oxidase assembly protein Cox11, putative [Talaromyces 
stipitatus ATCC 10500]
Length=242

 Score =   191 bits (486),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 95/220 (43%), Positives = 130/220 (59%), Gaps = 11/220 (5%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKA-AYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYR  767
             F+ L  + T R     N + Q +T   A T++K+   L Y   ++   +  +Y +VPLY+
Sbjct  21    FNQLTTNGTRRFSQQSNLRQQASTNDHAGTKQKNTSTLYYTASIIVGTLALAYGSVPLYK  80

Query  768   RFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVP  947
               CQ TG+ G   +     +      +     +R + + FN  V+D +PWKF P QREV 
Sbjct  81    MICQQTGWNGQPVQVHKAGDGDTASRLKPVTDSRRLRITFNGSVSDVLPWKFTPQQREV-  139

Query  948   S*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQR  1127
                      RV PGE+ALAFYTA N+ ++ I GV+TY+VTP + A YF+KIQCFCFEEQ+
Sbjct  140   ---------RVLPGETALAFYTATNKGTSDIIGVATYSVTPAQVAPYFSKIQCFCFEEQK  190

Query  1128  LLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             L  GE +DMPVFF+IDP+F  DP M  I+ I LSYTFFK 
Sbjct  191   LNAGESVDMPVFFFIDPDFAKDPSMKNIDTITLSYTFFKA  230



>gb|KFY71023.1| hypothetical protein V499_08761 [Pseudogymnoascus pannorum VKM 
F-103]
Length=247

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 116/189 (61%), Gaps = 10/189 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  55    KKNTSTMFYTLSIILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  114

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  115   GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  164

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  165   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFVNDPNMKGIEQV  224

Query  1221  ILSYTFFKV  1247
              LSYTFFK 
Sbjct  225   TLSYTFFKA  233



>ref|XP_005944824.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Haplochromis burtoni]
 ref|XP_005944825.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Haplochromis burtoni]
 ref|XP_005944826.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X3 [Haplochromis burtoni]
Length=257

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++K  L Y+      M+G +YAAVPLYR +CQATG GGT      +E+     A    V 
Sbjct  70    RNKTALTYIAAAGVGMIGLAYAAVPLYRLYCQATGLGGTAVAGHDMEQV----ATMTPVK  125

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V FNAD    M W F P Q E+           V PGE+ALAFY A+N +  PI 
Sbjct  126   ERVIKVTFNADTHASMQWNFRPQQTEI----------FVVPGETALAFYRAKNPTDKPII  175

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I 
Sbjct  176   GISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDNDPRMARVDTIT  235

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  236   LSYTFFEAKE  245



>ref|XP_005752827.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Pundamilia nyererei]
Length=257

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++K  L Y+      M+G +YAAVPLYR +CQATG GGT      +E+     A    V 
Sbjct  70    RNKTALTYIAAAGVGMIGLAYAAVPLYRLYCQATGLGGTAVAGHDMEQV----ATMTPVK  125

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V FNAD    M W F P Q E+           V PGE+ALAFY A+N +  PI 
Sbjct  126   ERVIKVTFNADTHASMQWNFRPQQTEI----------FVVPGETALAFYRAKNPTDKPII  175

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I 
Sbjct  176   GISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDNDPRMARVDTIT  235

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  236   LSYTFFEAKE  245



>gb|KFY37055.1| hypothetical protein V495_07417 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY60435.1| hypothetical protein V497_03613 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=251

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  59    KKNTSTMFYTLSIILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  118

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  119   GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  168

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  169   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFVNDPNMKGIEQV  228

Query  1221  ILSYTFFK  1244
              LSYTFFK
Sbjct  229   TLSYTFFK  236



>gb|KFY23142.1| hypothetical protein V493_06057 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=251

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  59    KKNTSTMFYTLSIILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  118

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  119   GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  168

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  169   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFVNDPNMKGIEQV  228

Query  1221  ILSYTFFK  1244
              LSYTFFK
Sbjct  229   TLSYTFFK  236



>gb|ELR08139.1| hypothetical protein GMDG_02961 [Pseudogymnoascus destructans 
20631-21]
Length=246

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             KK+   + Y   ++   V  SY +VPLY+  C  TG+GG   +  +        ++   V
Sbjct  54    KKNTSTMFYTLSVILGTVALSYGSVPLYKMICATTGFGGQPIKSAAHNTDDPSKSLRPVV  113

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               + I V FN  V+D +PW F P QREV          RV PGE+ALAFYTA N+SS  I
Sbjct  114   GAKRIRVTFNGSVSDVLPWSFTPQQREV----------RVLPGETALAFYTATNKSSEDI  163

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              GV+TY+VTP + A +F+KIQCFCFEEQRL  GE +DMPVFFYIDPEF  DP M GI  +
Sbjct  164   IGVATYSVTPGQVAPHFSKIQCFCFEEQRLNAGETVDMPVFFYIDPEFVNDPNMKGIEQV  223

Query  1221  ILSYTFFK  1244
              LSYTFFK
Sbjct  224   TLSYTFFK  231



>ref|XP_006793363.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Neolamprologus brichardi]
 ref|XP_006793364.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Neolamprologus brichardi]
 ref|XP_006793365.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X3 [Neolamprologus brichardi]
Length=257

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 117/190 (62%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++   L Y+      M+G +YAAVPLYR +CQATG GGT      VE+     A    V 
Sbjct  70    RNNTALTYIAAAGVGMIGLAYAAVPLYRLYCQATGLGGTAVAGHDVEQV----ATMTPVK  125

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V FNAD    M W F P Q E+           V PGE+ALAFY A+N +  PI 
Sbjct  126   ERVIKVTFNADTHASMQWNFRPQQTEI----------FVVPGETALAFYRAKNPTDKPII  175

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I 
Sbjct  176   GISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDNDPRMARVDTIT  235

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  236   LSYTFFEAKE  245



>gb|KGO49011.1| Cytochrome c oxidase assembly protein CtaG/Cox11 [Penicillium 
expansum]
 gb|KGO57709.1| Cytochrome c oxidase assembly protein CtaG/Cox11 [Penicillium 
expansum]
 gb|KGO63707.1| Cytochrome c oxidase assembly protein CtaG/Cox11 [Penicillium 
expansum]
Length=252

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 119/190 (63%), Gaps = 10/190 (5%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             ++K++   + Y   ++   V  +Y +VPLY+  CQ TG+GG       V +      +  
Sbjct  59    SQKRNTSTMYYTISMILGTVALAYGSVPLYKMICQQTGWGGQPILTHRVGDGDTSARVTP  118

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
                +R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N+   
Sbjct  119   VTDSRRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATNKGPQ  168

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
              I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFF+IDP+F TDP M GI+
Sbjct  169   DIIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFIDPDFATDPNMQGID  228

Query  1215  NIILSYTFFK  1244
              I LSYTFFK
Sbjct  229   TITLSYTFFK  238



>dbj|BAE59874.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=224

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/189 (48%), Positives = 117/189 (62%), Gaps = 10/189 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K++   L Y   L+   V  +Y +VPLY+  CQ TG+GG         +      +   
Sbjct  31    QKRNASTLYYTASLILGTVALAYGSVPLYKMICQQTGWGGQPILTHRGGDADTASRVTPV  90

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N+  + 
Sbjct  91    TDARRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATNKGPSD  140

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFFYIDP+F  DP+M GI+ 
Sbjct  141   IIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFYIDPDFTKDPQMKGIDT  200

Query  1218  IILSYTFFK  1244
             I LSYTFFK
Sbjct  201   ITLSYTFFK  209



>gb|EFA00450.1| hypothetical protein TcasGA2_TC003306 [Tribolium castaneum]
Length=223

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 119/192 (62%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K+ +  L Y+T       G SYAAVPLYR FCQA  YGGT Q      +     +I   
Sbjct  35    KKRIRSTLYYVTAAGVVTAGLSYAAVPLYRLFCQAYSYGGTTQAGHDANKVETMPSI---  91

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                R + ++FNAD A  M W F P Q E+           V PGE+ALAFYTA+N +  P
Sbjct  92    -KHRLLKIKFNADTAASMRWNFHPQQTEI----------TVHPGETALAFYTAKNPTDKP  140

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             + G+STYNV P +A  YFNKIQCFCFEEQ+L P E++DMPVFFYIDPEF  DP M+ I+ 
Sbjct  141   VIGISTYNVVPFEAGQYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEFVDDPLMEFIDE  200

Query  1218  IILSYTFFKVSD  1253
             I LSYTFF+  +
Sbjct  201   ITLSYTFFEAKE  212



>ref|XP_007004010.1| hypothetical protein TREMEDRAFT_43811 [Tremella mesenterica DSM 
1558]
 gb|EIW70195.1| hypothetical protein TREMEDRAFT_43811 [Tremella mesenterica DSM 
1558]
Length=224

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 126/201 (63%), Gaps = 14/201 (7%)
 Frame = +3

Query  645   QHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVE  824
             Q  YA +A    K+S+ ++LY  G +   +G +YAAVPLYR FC ATGY GT     S  
Sbjct  4     QKMYAERA----KQSRSVMLYGAGTIILAIGLTYAAVPLYRAFCSATGYSGTPMTDRSRF  59

Query  825   EKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALA  1004
                  +    T + + I V+F A  +D +PWKF P QR V          RV PGE+ALA
Sbjct  60    SPDRLYTTPETETRKRITVRFEATSSDALPWKFEPQQRSV----------RVLPGETALA  109

Query  1005  FYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEF  1184
             FY A N S   + G++TYN+TP K A YF K++CFCFEEQ++  GE++D+PVFF+ID + 
Sbjct  110   FYKARNDSDRDLIGIATYNMTPDKIAPYFAKVECFCFEEQKIRSGEEVDLPVFFFIDKDI  169

Query  1185  ETDPKMDGINNIILSYTFFKV  1247
               DP +DG+++++LSYTFFK 
Sbjct  170   MDDPSLDGVDDVVLSYTFFKA  190



>ref|XP_007342985.1| hypothetical protein AURDEDRAFT_85449 [Auricularia delicata TFB-10046 
SS5]
 gb|EJD49086.1| hypothetical protein AURDEDRAFT_85449 [Auricularia delicata TFB-10046 
SS5]
Length=227

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 127/192 (66%), Gaps = 21/192 (11%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV-  860
             +++ +L+Y T  + A+VG +YAAVPLYR FC ATG+ GT Q        + + A +  V 
Sbjct  11    RNRSLLMYSTAFIIAIVGVTYAAVPLYRAFCAATGFAGTPQ------TGVGKFAPERLVP  64

Query  861   ----STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                 + R I V FNAD +D +PW F P Q+ V           V PG++ALAFYTA NRS
Sbjct  65    ASDENARRIKVNFNADTSDALPWGFFPQQKYV----------YVVPGQTALAFYTARNRS  114

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
             +  I G++TY+V P KAA YF K++CFCFEEQ+LL GE++D+P+FF+ID +F  DP M  
Sbjct  115   ANDIIGIATYSVMPAKAAPYFAKVECFCFEEQKLLAGEEVDLPLFFFIDKDFLDDPLMRD  174

Query  1209  INNIILSYTFFK  1244
             +++I+LSYTFF+
Sbjct  175   VDDIVLSYTFFR  186



>ref|XP_007292478.1| cytochrome-c oxidase assembly protein [Marssonina brunnea f. 
sp. 'multigermtubi' MB_m1]
 gb|EKD17012.1| cytochrome-c oxidase assembly protein [Marssonina brunnea f. 
sp. 'multigermtubi' MB_m1]
Length=261

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/224 (45%), Positives = 127/224 (57%), Gaps = 21/224 (9%)
 Frame = +3

Query  588   PFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYR  767
             P SN  +     + SM   +  +A K   T       L Y   ++   V  SY +VP+Y+
Sbjct  43    PISNSSKTQANVAPSMEQLRAPFAQKNVST-------LYYAISIIMGTVAFSYGSVPMYK  95

Query  768   RFCQATGYGGTVQRKE----SVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQ  935
               CQ TG+GG   +      + +       +    S + I + FN  V+D MPWKF+P Q
Sbjct  96    MICQTTGWGGQPIKASGHGTTDDGGDPSSRLKPVTSAKRIRITFNGSVSDVMPWKFVPQQ  155

Query  936   REVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCF  1115
             REV          RV PGE+ALAFYTA NRS   I GV+TY+VTP + A YF+KIQCFCF
Sbjct  156   REV----------RVLPGETALAFYTATNRSDDDIIGVATYSVTPAQVAPYFSKIQCFCF  205

Query  1116  EEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
             EEQRL  GE +DMPVFFYIDP+F  DP M GI  + LSYTFFK 
Sbjct  206   EEQRLNAGETVDMPVFFYIDPDFANDPNMRGIEQVTLSYTFFKA  249



>ref|XP_974674.2| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Tribolium castaneum]
Length=228

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 119/192 (62%), Gaps = 14/192 (7%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K+ +  L Y+T       G SYAAVPLYR FCQA  YGGT Q      +     +I   
Sbjct  40    KKRIRSTLYYVTAAGVVTAGLSYAAVPLYRLFCQAYSYGGTTQAGHDANKVETMPSI---  96

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                R + ++FNAD A  M W F P Q E+           V PGE+ALAFYTA+N +  P
Sbjct  97    -KHRLLKIKFNADTAASMRWNFHPQQTEI----------TVHPGETALAFYTAKNPTDKP  145

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             + G+STYNV P +A  YFNKIQCFCFEEQ+L P E++DMPVFFYIDPEF  DP M+ I+ 
Sbjct  146   VIGISTYNVVPFEAGQYFNKIQCFCFEEQQLNPHEEVDMPVFFYIDPEFVDDPLMEFIDE  205

Query  1218  IILSYTFFKVSD  1253
             I LSYTFF+  +
Sbjct  206   ITLSYTFFEAKE  217



>ref|XP_001208527.1| cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Aspergillus terreus NIH2624]
 gb|EAU37919.1| cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Aspergillus terreus NIH2624]
Length=248

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 137/244 (56%), Gaps = 15/244 (6%)
 Frame = +3

Query  519   VSSFGCGSLMPRCEFRSVVDSNIPFSNLG-RHSTARSCSMLNFQHQYATKAAYTEKKSKK  695
              SS+G  S    C  RS        S++G R+ T  SC   N    + T    ++K++  
Sbjct  6     ASSWGVPSSGTAC--RSAARMQSRCSDMGKRYFTRNSCLRQNASAPFNTPQ--SQKRNAS  61

Query  696   MLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREI  875
              + Y   L+   V  +Y +VPLY+  CQ TG+ G         +      +     +R +
Sbjct  62    TMYYTASLILGTVALAYGSVPLYKMICQQTGWNGQPVLTHRGGDNDTSSRVTPVTDSRRL  121

Query  876   VVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVST  1055
              + FN  V+D +PWKF+P QREV          RV PGE+ALAFYTA N+    I GV+T
Sbjct  122   RITFNGSVSDVLPWKFVPQQREV----------RVLPGETALAFYTATNKGPADIIGVAT  171

Query  1056  YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYT  1235
             Y+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFF+IDP+F  DP M GI+ I LSYT
Sbjct  172   YSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFIDPDFAKDPAMKGIDTITLSYT  231

Query  1236  FFKV  1247
             FFK 
Sbjct  232   FFKA  235



>ref|XP_006000003.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Latimeria chalumnae]
 ref|XP_006000004.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Latimeria chalumnae]
Length=273

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 120/191 (63%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K++K +  Y+      M+G SYAAVPLYR +CQATG GGT     + ++ +        V
Sbjct  87    KRNKTIFTYIMATAIGMIGMSYAAVPLYRLYCQATGLGGTAVTGHNTDQVLTMEP----V  142

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FNADV   + W F P Q ++           V PGE+ALAFY A+N +  P+
Sbjct  143   KDRIIKVTFNADVHASLQWNFRPQQTDI----------YVVPGETALAFYKAKNPTDKPV  192

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M  ++ I
Sbjct  193   IGISTYNVLPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMARVDTI  252

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  253   TLSYTFFEAKE  263



>ref|XP_003108120.1| hypothetical protein CRE_10286 [Caenorhabditis remanei]
 gb|EFO92920.1| hypothetical protein CRE_10286 [Caenorhabditis remanei]
Length=275

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/234 (44%), Positives = 141/234 (60%), Gaps = 12/234 (5%)
 Frame = +3

Query  567   SVVDSNI-PFSNLGRHSTARSCSMLNFQHQYATKA--AYTEKKSKKMLLYLTGLVFAMVG  737
             SV+  +I PFS L       S   +    Q++ K         +K    Y+  LV   +G
Sbjct  15    SVISVSISPFSTLASLQRKTSVVHVQIVRQFSKKPNRKIESADTKNYTYYVMSLVIVAIG  74

Query  738   CSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPW  917
             C++AA+P YR FC+ T +GG  Q  +  + KIA          R I VQFN+DV   M W
Sbjct  75    CTFAAIPAYRIFCEQTSFGGLTQVAKDFD-KIANM---KKCEDRLIRVQFNSDVPSSMRW  130

Query  918   KFIPTQREVPS*C-----SHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAA  1082
             +F P Q EV +       +    + V PGE+ALAFYTA N ++ PI G+S+YN+TP +AA
Sbjct  131   EFKPQQHEVNNSIESVFFNSFFQIYVHPGETALAFYTARNPTNKPIIGISSYNLTPFQAA  190

Query  1083  VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
              YFNKIQCFCFEEQ L PGEQ+D+PVFFYIDP++  DP ++ +++I+LSYTFF+
Sbjct  191   YYFNKIQCFCFEEQILNPGEQVDLPVFFYIDPDYVNDPALEYLDSILLSYTFFE  244



>ref|XP_007947843.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Orycteropus afer afer]
Length=275

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y+T     M+G SYAAVPLYR +CQ TG GG+          +A HA D   
Sbjct  89    RRNKTVLTYVTAAAVGMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHASDQIE  139

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  140   TMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  189

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  190   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRML  249

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  250   NVDLITLSYTFFEAKE  265



>ref|XP_007889223.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Callorhinchus milii]
Length=268

 Score =   191 bits (486),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 118/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             +++K +L Y+      M+G SYAAVPLYR +CQATG GG      +VE+          V
Sbjct  82    RRNKTVLTYVAAAAIGMIGMSYAAVPLYRLYCQATGLGGAAVAGHNVEQV----ETMTPV  137

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N +  P+
Sbjct  138   KDRIIKVAFNADVHASLHWNFRPQQSEI----------YVVPGETALAFYKAKNPTDKPV  187

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M  +  I
Sbjct  188   IGISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFAEDPRMARVETI  247

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  248   TLSYTFFEAKE  258



>ref|NP_001279426.1| cytochrome c oxidase assembly protein COX11, mitochondrial [Callorhinchus 
milii]
 gb|AFK11522.1| Cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Callorhinchus milii]
Length=254

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 118/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             +++K +L Y+      M+G SYAAVPLYR +CQATG GG      +VE+          V
Sbjct  68    RRNKTVLTYVAAAAIGMIGMSYAAVPLYRLYCQATGLGGAAVAGHNVEQV----ETMTPV  123

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N +  P+
Sbjct  124   KDRIIKVAFNADVHASLHWNFRPQQSEI----------YVVPGETALAFYKAKNPTDKPV  173

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M  +  I
Sbjct  174   IGISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFAEDPRMARVETI  233

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  234   TLSYTFFEAKE  244



>gb|AEE61980.1| unknown [Dendroctonus ponderosae]
Length=240

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 117/191 (61%), Gaps = 14/191 (7%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             + K+ +  L Y+T      VG SYAAVPLYR FCQA  YGGT  +        ++     
Sbjct  50    SRKRMRSTLYYMTAAGIVTVGMSYAAVPLYRMFCQAYSYGGTTAQGHDC----SKVETMK  105

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
             +  TR I V+FNAD A  M W F P Q E+           V PGE+ALAFYTA N +  
Sbjct  106   SNKTRAIKVKFNADKASNMRWNFKPQQNEI----------TVYPGETALAFYTARNPTDQ  155

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
              + G+STYNV P +A  YFNKIQCFCFEEQ L P EQ+DMPVFFYIDPEF  DP ++  N
Sbjct  156   SVVGISTYNVIPFEAGQYFNKIQCFCFEEQMLNPQEQVDMPVFFYIDPEFAEDPYLEFCN  215

Query  1215  NIILSYTFFKV  1247
              IILSYTFF+ 
Sbjct  216   EIILSYTFFEA  226



>gb|EPS28277.1| hypothetical protein PDE_03223 [Penicillium oxalicum 114-2]
Length=250

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 126/206 (61%), Gaps = 15/206 (7%)
 Frame = +3

Query  642   FQH-QYATKAAY----TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQ  806
             FQH Q+A+ A +    ++ ++   + Y   ++   V  +Y +VPLY+  C  TG+GG   
Sbjct  41    FQHEQHASAAPFNTPQSQHRNASTMYYTISVILGTVALAYGSVPLYKMICTQTGWGGQPI  100

Query  807   RKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKP  986
                   +      +     +R + + FN  V+D +PWKF P QREV          RV P
Sbjct  101   LTHRTGDGDTASRVTPVTDSRRLRITFNGSVSDVLPWKFTPQQREV----------RVLP  150

Query  987   GESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFF  1166
             GE+ALAFYTA N+S   I G++TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFF
Sbjct  151   GETALAFYTATNKSPHDIIGIATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFF  210

Query  1167  YIDPEFETDPKMDGINNIILSYTFFK  1244
             YIDP+F TDP M GI+ I LSYTFFK
Sbjct  211   YIDPDFATDPTMKGIDTITLSYTFFK  236



>ref|XP_004565328.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X1 [Maylandia zebra]
 ref|XP_004565329.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Maylandia zebra]
Length=257

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 96/190 (51%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             ++K  L Y+      M+G +YAAVPLYR +CQA+G GGT      +E+     A    V 
Sbjct  70    RNKTALTYIAAAGVGMIGLAYAAVPLYRLYCQASGLGGTAVAGHDMEQV----ATMTPVK  125

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I V FNAD    M W F P Q E+           V PGE+ALAFY A+N +  PI 
Sbjct  126   ERVIKVTFNADTHASMQWNFRPQQTEI----------FVVPGETALAFYRAKNPTDKPII  175

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I 
Sbjct  176   GISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDNDPRMARVDTIT  235

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  +
Sbjct  236   LSYTFFEAKE  245



>gb|ELK01685.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Pteropus 
alecto]
Length=275

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y+      M+G SYAAVPLYR +CQ TG GG+V         +A HA D   
Sbjct  89    RRNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQTTGLGGSV---------VAGHASDQIE  139

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  140   NMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  189

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  190   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMV  249

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  250   NVDLITLSYTFFEAKE  265



>ref|XP_001545817.1| cytochrome-c oxidase assembly protein [Botrytis cinerea B05.10]
Length=279

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/262 (41%), Positives = 142/262 (54%), Gaps = 24/262 (9%)
 Frame = +3

Query  474   PRYSLFSVGNNGRWKVSSFGCGSLMPRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQ  653
             PR S      N  W  +S           F+  ++ +I  ++  R + A +   L     
Sbjct  5     PRISRALSSKNANWICTSCAKAKRTNTPFFKPSINRSISNNSTPRGNVAPTMEQL-----  59

Query  654   YATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRK-----ES  818
                +A +++K S  M  Y   ++   V  SY +VP+Y+  CQ TG+GG   +        
Sbjct  60    ---RAPFSQKNSSTMY-YTLSIILGTVAFSYGSVPMYKMICQTTGWGGQPIKAPGHGGSG  115

Query  819   VEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESA  998
             VE +     +    S + I V FN  V+D +PWKF P QREV          RV PGE+A
Sbjct  116   VEGEDPSERLRPVTSAKRIRVTFNGSVSDVLPWKFTPQQREV----------RVLPGETA  165

Query  999   LAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  1178
             LAFYTA N+S   I GV+TY+VTP + A YF+KIQCFCFEEQRL  GE +DMPVFFYIDP
Sbjct  166   LAFYTATNKSDEDIIGVATYSVTPGQVAPYFSKIQCFCFEEQRLNAGETVDMPVFFYIDP  225

Query  1179  EFETDPKMDGINNIILSYTFFK  1244
             +F  DP M GI  + LSYTFFK
Sbjct  226   DFVNDPNMRGIEQVTLSYTFFK  247



>gb|ESA20821.1| hypothetical protein GLOINDRAFT_125808 [Rhizophagus irregularis 
DAOM 181602]
Length=183

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 116/181 (64%), Gaps = 13/181 (7%)
 Frame = +3

Query  702   LYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVV  881
             +Y T ++   +G +YA+VPLYR FCQ TG+ GT     S   K     +     +R I V
Sbjct  1     MYTTAILICGIGFTYASVPLYRMFCQTTGFSGTPITNSS---KFGPERLVPAKESRRIRV  57

Query  882   QFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYN  1061
              FNAD +  + W FIP QREV           V PGE+ALAFYTA+N+S   I G++TYN
Sbjct  58    HFNADTSLALDWSFIPQQREV----------YVLPGETALAFYTAKNKSDQDIIGLATYN  107

Query  1062  VTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFF  1241
             VTP KA  YFNKIQCFCFEEQ+L  GE +DMPVFF+IDPEF  DP M  ++ I LSYTFF
Sbjct  108   VTPNKAGQYFNKIQCFCFEEQKLQAGEAVDMPVFFFIDPEFPEDPSMRDVDTITLSYTFF  167

Query  1242  K  1244
             K
Sbjct  168   K  168



>ref|XP_003690238.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Apis florea]
Length=224

 Score =   189 bits (481),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 119/184 (65%), Gaps = 14/184 (8%)
 Frame = +3

Query  702   LYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVV  881
             LY +G    ++G +YA+VPLYR FCQ+  YGGT+    SV     +      +  R + +
Sbjct  43    LYWSGFGILVIGFTYASVPLYRIFCQSYNYGGTL----SVNHDNTKIQSMKPIKDRVLKI  98

Query  882   QFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYN  1061
              FNAD+   M W F P Q  +          +V PGE+ALAFY A+N  + PITG+STYN
Sbjct  99    TFNADIGAMMQWNFKPQQNFI----------KVLPGETALAFYRAQNPLNVPITGISTYN  148

Query  1062  VTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFF  1241
             V P +AA YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DPKM+ +  I+LSYTFF
Sbjct  149   VVPYEAAQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFVNDPKMEDVKEIVLSYTFF  208

Query  1242  KVSD  1253
             +  +
Sbjct  209   EAKE  212



>gb|ACI69748.1| Cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Salmo salar]
Length=271

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 119/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K++K +L Y+      M+G SYAAVPLYR +CQA+G GGT       E+          V
Sbjct  79    KRNKTVLTYIVAAGVGMIGMSYAAVPLYRLYCQASGLGGTAVAGHDAEQVETMTP----V  134

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R I + FNAD    M W F P Q E+           V PGE+ALAFY A+N +  P+
Sbjct  135   MDRIIKITFNADTHASMQWNFRPQQSEI----------YVVPGETALAFYRAKNPTDKPV  184

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I
Sbjct  185   IGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPKEEVDMPVFFYIDPEFDEDPRMARVDTI  244

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  245   TLSYTFFEAKE  255



>ref|XP_005806787.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Xiphophorus maculatus]
Length=252

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 133/246 (54%), Gaps = 27/246 (11%)
 Frame = +3

Query  531   GCGSLMPRCEFRSVVDSNIPFSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYL  710
             GC S +P    R+++       +L R   A      N   +   +      ++K +L Y+
Sbjct  17    GCVSALPGSSQRTLLSQG---EHLLRRRPASRLPTRNHSRKSRGQEEEWRTRNKTVLTYI  73

Query  711   TGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-----VSTREI  875
                   M+G SYA+VPLYR +CQ TG GG           +A H  D       V  R I
Sbjct  74    AAAGVGMIGLSYASVPLYRLYCQTTGLGGAA---------VAGHDTDQVETMKPVKERII  124

Query  876   VVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVST  1055
              V FNAD    + W F P Q E+           V PGE+ALAFY A+N +  PI G+ST
Sbjct  125   KVTFNADTHASIQWNFRPQQTEI----------YVVPGETALAFYRAKNPTDKPIIGIST  174

Query  1056  YNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYT  1235
             YNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I LSYT
Sbjct  175   YNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDDDPRMARVDTITLSYT  234

Query  1236  FFKVSD  1253
             FF+  +
Sbjct  235   FFEAKE  240



>ref|XP_001821876.2| cytochrome c oxidase assembly protein Cox11 [Aspergillus oryzae 
RIB40]
Length=250

 Score =   190 bits (483),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 117/190 (62%), Gaps = 10/190 (5%)
 Frame = +3

Query  678   EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT  857
             +K++   L Y   L+   V  +Y +VPLY+  CQ TG+GG         +      +   
Sbjct  57    QKRNASTLYYTASLILGTVALAYGSVPLYKMICQQTGWGGQPILTHRGGDADTASRVTPV  116

Query  858   VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTP  1037
                R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N+  + 
Sbjct  117   TDARRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATNKGPSD  166

Query  1038  ITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINN  1217
             I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFFYIDP+F  DP+M GI+ 
Sbjct  167   IIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFYIDPDFTKDPQMKGIDT  226

Query  1218  IILSYTFFKV  1247
             I LSYTFFK 
Sbjct  227   ITLSYTFFKA  236



>ref|XP_007565296.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Poecilia formosa]
 ref|XP_007565297.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Poecilia formosa]
Length=252

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 119/195 (61%), Gaps = 24/195 (12%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT--  857
             ++K +L Y+      M+G SYA+VPLYR +CQATG GGT          +A H  D    
Sbjct  65    RNKTVLTYIAAAGVGMIGLSYASVPLYRLYCQATGLGGTA---------VAGHDTDQVET  115

Query  858   ---VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                V  R I V FNAD    + W F P Q E+           V PGE+ALAFY A+N +
Sbjct  116   MKPVKERIIKVTFNADTHASIQWNFRPQQTEI----------YVVPGETALAFYRAKNPT  165

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PI G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  
Sbjct  166   DKPIIGISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDDDPRMAR  225

Query  1209  INNIILSYTFFKVSD  1253
             ++ I LSYTFF+  +
Sbjct  226   VDTITLSYTFFEAKE  240



>ref|XP_002563935.1| Pc20g14590 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP86788.1| Pc20g14590 [Penicillium rubens Wisconsin 54-1255]
Length=237

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/219 (43%), Positives = 130/219 (59%), Gaps = 14/219 (6%)
 Frame = +3

Query  597   NLGRHSTARSCSMLNFQHQYATKAAY----TEKKSKKMLLYLTGLVFAMVGCSYAAVPLY  764
             +LGR     S + L  + + ++ A +    ++K++   + Y   ++   V  +Y +VPLY
Sbjct  8     SLGRSRRYFSRNFLLHEQRNSSAAPFNTPESQKRNTSTMYYTISMILGTVALAYGSVPLY  67

Query  765   RRFCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREV  944
             +  CQ TG+GG         +      +     +R + + FN  V+D +PWKF P QREV
Sbjct  68    KMICQQTGWGGQPILTHRTGDGDTSARVTPVTDSRRLRITFNGSVSDVLPWKFTPQQREV  127

Query  945   PS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQ  1124
                       RV PGE+ALAFYTA N+    I GV+TY+VTP + A YF+KIQCFCFEEQ
Sbjct  128   ----------RVLPGETALAFYTATNKGPNDIIGVATYSVTPGQVAPYFSKIQCFCFEEQ  177

Query  1125  RLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFF  1241
             +L  GE +DMPVFF+IDP+F TDP M GI+ I LSYTFF
Sbjct  178   KLNAGESVDMPVFFFIDPDFATDPNMKGIDTITLSYTFF  216



>ref|XP_007725820.1| cytochrome c oxidase assembly protein subunit 11 [Capronia coronata 
CBS 617.96]
 gb|EXJ83134.1| cytochrome c oxidase assembly protein subunit 11 [Capronia coronata 
CBS 617.96]
Length=258

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 110/235 (47%), Positives = 134/235 (57%), Gaps = 19/235 (8%)
 Frame = +3

Query  561   FRSVVDSNIPFSNLGRHSTARSC--SMLNFQHQYATKAAYTEKKSKKMLLYLTGLV--FA  728
              RS     IP     +    RS   S  N QH     AA  E K K       GL     
Sbjct  19    LRSSPGHEIPSRTSRQRMQTRSIAQSAQNPQHATPWDAARAEAKQKNRTTMYYGLSVGIT  78

Query  729   MVGCSYAAVPLYRRFCQATGYGGT-VQRKESVEEKIAR-HAIDGTVSTREIVVQFNADVA  902
             ++  SYA+VPLY+  CQ TG+ G  V+  +S  +   R   ++G    R + + FN  V+
Sbjct  79    LIALSYASVPLYKMICQQTGWSGQPVKAHDSDGDPALRLKPVEGH---RRLRITFNGSVS  135

Query  903   DGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAA  1082
             D +PWKF P QREV          RV PGE+ALAFYTA N+S   I GV+TY+VTP + A
Sbjct  136   DILPWKFTPQQREV----------RVLPGETALAFYTATNKSDADIIGVATYSVTPAQVA  185

Query  1083  VYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
              YF+KIQCFCFEEQRL  GE +DMPVFF+IDPEF  DP M GI+ I LSYTFFK 
Sbjct  186   PYFSKIQCFCFEEQRLNAGETVDMPVFFFIDPEFIKDPTMKGIDTITLSYTFFKA  240



>ref|XP_010898004.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Esox lucius]
Length=269

 Score =   191 bits (484),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 120/191 (63%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K++K +L Y+      M+G SYAAVPLYR +CQA+G GGT     + E+          V
Sbjct  77    KRNKTVLTYIAAAGVGMIGLSYAAVPLYRLYCQASGLGGTAVAGHNAEQV----ETMAPV  132

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R + + FNAD    + W F P Q E+           V PGE+ALAFY A+N +  P+
Sbjct  133   KDRVLKITFNADTHASIQWNFRPQQSEI----------YVVPGETALAFYRAKNPTDKPV  182

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I
Sbjct  183   IGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPKEEVDMPVFFYIDPEFDEDPRMARVDTI  242

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  243   TLSYTFFEAKE  253



>dbj|GAA82261.1| cytochrome c oxidase assembly protein COX11, mitochondrial precursor 
[Aspergillus kawachii IFO 4308]
Length=250

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 125/213 (59%), Gaps = 12/213 (6%)
 Frame = +3

Query  606   RHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQAT  785
             R  T  SC   N    + T  +  +K++   + Y   L+   V  +Y +VPLY+  CQ T
Sbjct  35    RFFTRNSCLRQNINAPFNTPQS--KKRNASTMYYTASLILGTVALAYGSVPLYKMICQQT  92

Query  786   GYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHH  965
             G+ G       V +      +     +R + + FN  V+D +PWKF P QREV       
Sbjct  93    GWNGQPVATHRVGDGDTSSRVTPVTDSRRLRITFNGSVSDVLPWKFTPQQREV-------  145

Query  966   RPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQ  1145
                RV PGE+ALAF+TA N+  T I GV+TY+VTP + A YF+KIQCFCF+EQ+L  GE 
Sbjct  146   ---RVLPGETALAFFTATNKGPTDIIGVATYSVTPGQVAPYFSKIQCFCFDEQKLNAGES  202

Query  1146  IDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
             +DMPVFF+IDP+F  DP M GI+ I LSYTFFK
Sbjct  203   VDMPVFFFIDPDFANDPAMKGIDTITLSYTFFK  235



>dbj|GAK45017.1| cytochrome c oxidase assembly protein CtaG/Cox11 [alpha proteobacterium 
MA2]
Length=191

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 120/198 (61%), Gaps = 20/198 (10%)
 Frame = +3

Query  651   QYATKAAYTEKKSK-KMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEE  827
             Q  T AAY  +    K+ L   G+   MVG SYAAVPLY+ FCQ TGYGGT  R ++   
Sbjct  5     QGMTAAAYENRTGGLKIALLCAGVAAGMVGLSYAAVPLYQIFCQVTGYGGTTNRADTAS-  63

Query  828   KIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAF  1007
                      +V  R+I ++F+ +V+  +PW F P             PV +K GE+ LAF
Sbjct  64    --------ASVLDRQITIRFDGNVSKDIPWDFKPV----------SEPVTLKVGETGLAF  105

Query  1008  YTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFE  1187
             Y A N S  PI G +T+NVTP +A  YFNKI+CFCF EQRL PG+++DMPV F+IDPE  
Sbjct  106   YEAYNNSDKPIVGTATFNVTPQQAGYYFNKIECFCFTEQRLEPGQRVDMPVTFFIDPEIA  165

Query  1188  TDPKMDGINNIILSYTFF  1241
              DP++D I  I LSYTFF
Sbjct  166   DDPQLDSIKTITLSYTFF  183



>gb|EFN71398.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Camponotus 
floridanus]
Length=202

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 117/188 (62%), Gaps = 15/188 (8%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K  +    Y  G+    VG SY+AVPLYR FCQ+  YGGT+       +      I+   
Sbjct  11    KNIRSTTFYWAGIGILAVGLSYSAVPLYRIFCQSYSYGGTISAGHDTSKVSTMSPIN---  67

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R+I V+F+AD A  M W F P Q E+           V PGE+ALAFYTA N ++  +
Sbjct  68    --RKIKVKFSADTAASMQWNFKPQQTEI----------TVVPGETALAFYTATNPTNKQV  115

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +   YFNKIQCFCFEEQ L P EQ+DMPVFFYIDPEF+ DPKM+ +N +
Sbjct  116   VGISTYNVIPFEVGQYFNKIQCFCFEEQMLNPHEQVDMPVFFYIDPEFDDDPKMEFVNEV  175

Query  1221  ILSYTFFK  1244
             ILSYTFF+
Sbjct  176   ILSYTFFE  183



>ref|XP_008145970.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Eptesicus fuscus]
Length=275

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 123/193 (64%), Gaps = 18/193 (9%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             +++K +L Y+      M+G SYAAVPLYR +CQ TG GG+V    S ++      I+  V
Sbjct  89    RRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTGLGGSVAAGHSSDQ------IENMV  142

Query  861   STRE--IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
               ++  I V FNADV   + W F P Q E+           V PGE+ALAFY A+N +  
Sbjct  143   PVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNPTDK  192

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
             PI G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M  ++
Sbjct  193   PIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVD  252

Query  1215  NIILSYTFFKVSD  1253
              I LSYTFF+  +
Sbjct  253   LITLSYTFFEAKE  265



>ref|XP_003800071.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Otolemur garnettii]
Length=278

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y+      M+G SYAAVPLYR +CQATG GG+          +A H+ D   
Sbjct  92    RRNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQATGLGGSA---------VAGHSSDQIE  142

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  143   NMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  192

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DPKM 
Sbjct  193   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPKMV  252

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  253   NVDLITLSYTFFEAKE  268



>gb|ENN76046.1| hypothetical protein YQE_07419, partial [Dendroctonus ponderosae]
 gb|ERL90734.1| hypothetical protein D910_08081 [Dendroctonus ponderosae]
Length=240

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 117/191 (61%), Gaps = 14/191 (7%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDG  854
             + K+ +  L Y+T      VG SYAAVPLYR FCQA  YGGT  +        ++     
Sbjct  50    SRKRMRSTLYYMTAAGIVTVGMSYAAVPLYRMFCQAYSYGGTTAQGHDG----SKVETMK  105

Query  855   TVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
             +  TR I V+FNAD A  M W F P Q E+           V PGE+ALAFYTA N +  
Sbjct  106   SNKTRAIKVKFNADKASNMRWNFKPQQNEI----------TVYPGETALAFYTARNPTDQ  155

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
              + G+STYNV P +A  YFNKIQCFCFEEQ L P EQ+DMPVFFYIDPEF  DP ++  N
Sbjct  156   SVVGISTYNVIPFEAGQYFNKIQCFCFEEQMLNPQEQVDMPVFFYIDPEFAEDPYLEFCN  215

Query  1215  NIILSYTFFKV  1247
              IILSYTFF+ 
Sbjct  216   EIILSYTFFEA  226



>gb|EEQ87541.1| mitochondrial cytochrome c oxidase assembly factor Cox11p [Blastomyces 
dermatitidis ER-3]
 gb|EGE77869.1| mitochondrial cytochrome c oxidase assembly factor Cox11p [Blastomyces 
dermatitidis ATCC 18188]
 gb|EQL38162.1| cytochrome c oxidase assembly protein subunit 11 [Blastomyces 
dermatitidis ATCC 26199]
Length=250

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 119/194 (61%), Gaps = 13/194 (7%)
 Frame = +3

Query  663   KAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARH  842
             K +Y   +S   L Y   L+   V  SY +VP+Y+  CQ TG+ G   +    EE  A  
Sbjct  51    KLSYGSNQSA--LYYAISLIIGTVALSYGSVPMYKMICQQTGWNGQPVQTHRTEENPASR  108

Query  843   AIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAEN  1022
              +    S+R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N
Sbjct  109   -LKPVTSSRRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATN  157

Query  1023  RSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM  1202
                  I GV+TY+VTP K + YF+KIQCFCFEEQRL  GE +DMPVFF+IDP+F TDP M
Sbjct  158   EGPDDIIGVATYSVTPAKVSPYFSKIQCFCFEEQRLSAGESVDMPVFFFIDPDFHTDPAM  217

Query  1203  DGINNIILSYTFFK  1244
               I+ I LSYTFFK
Sbjct  218   RNIDTITLSYTFFK  231



>emb|CDQ80861.1| unnamed protein product [Oncorhynchus mykiss]
Length=271

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 119/191 (62%), Gaps = 14/191 (7%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             K++K +L Y+      M+G SYAAVPLYR +CQA+G GGT       E+          V
Sbjct  79    KRNKTVLTYIAAAGVGMIGMSYAAVPLYRLYCQASGLGGTAVAGHDAEQVETMTP----V  134

Query  861   STREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPI  1040
               R + + FNAD    M W F P Q E+           V PGE+ALAFY A+N +  P+
Sbjct  135   MDRIVKITFNADTHASMQWNFRPQQSEI----------YVVPGETALAFYRAKNPTDKPV  184

Query  1041  TGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNI  1220
              G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  ++ I
Sbjct  185   IGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPKEEVDMPVFFYIDPEFDEDPRMARVDTI  244

Query  1221  ILSYTFFKVSD  1253
              LSYTFF+  +
Sbjct  245   TLSYTFFEAKE  255



>tpe|CBF69758.1| TPA: cytochrome c oxidase assembly protein Cox11, putative (AFU_orthologue; 
AFUA_2G12260) [Aspergillus nidulans FGSC A4]
Length=250

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 126/215 (59%), Gaps = 11/215 (5%)
 Frame = +3

Query  603   GRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQA  782
             GR   +R+ S LN           ++K++   + Y   ++   V  +Y +VPLY+  CQ 
Sbjct  33    GRRYFSRN-SWLNQSPSAPFNTPQSQKRNASTMYYTISIILGTVSLAYGSVPLYKMICQQ  91

Query  783   TGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSH  962
             TG+ G         +      +     +R + + FN  V+D +PWKF P QREV      
Sbjct  92    TGWNGQPVLTHRAGDGDTSSRVTPVTDSRRLRITFNGSVSDVLPWKFTPQQREV------  145

Query  963   HRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGE  1142
                 RV PGE+ALAFYTA N+  T I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE
Sbjct  146   ----RVLPGETALAFYTATNKGPTDIIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGE  201

Query  1143  QIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKV  1247
              +DMPVFF+IDP+F TDP M GI+ I LSYTFFK 
Sbjct  202   SVDMPVFFFIDPDFVTDPAMKGIDTITLSYTFFKA  236



>gb|EYC44261.1| hypothetical protein Y032_0466g1958 [Ancylostoma ceylanicum]
Length=248

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 126/196 (64%), Gaps = 14/196 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             +++ ++ Y+  +    +G ++AA+P YR FC+ T +GG  Q    + +   R A    V 
Sbjct  46    RNRDVMYYVVSIGVVAIGVTFAAIPAYRIFCEKTSFGGLTQ----IAKDFERIAKMKKVE  101

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I VQFN+DV   M W+F P Q E+           V PGE+ALAFYTA N +  PI 
Sbjct  102   DRLIRVQFNSDVPSSMRWEFKPQQHEM----------YVHPGETALAFYTARNPTDRPIV  151

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+S+YN+TP +AA YFNKIQCFCFEEQ L PGEQ+D+PVFFYIDP++  DP ++ ++NI+
Sbjct  152   GISSYNLTPFQAAYYFNKIQCFCFEEQILNPGEQVDLPVFFYIDPDYANDPALEYLDNIL  211

Query  1224  LSYTFFKVSDE*QFYS  1271
             LSYTFF+   + Q  S
Sbjct  212   LSYTFFEAKSDLQLPS  227



>ref|XP_002624084.1| mitochondrial cytochrome c oxidase assembly factor Cox11p [Blastomyces 
dermatitidis SLH14081]
 gb|EEQ70599.1| mitochondrial cytochrome c oxidase assembly factor Cox11p [Blastomyces 
dermatitidis SLH14081]
Length=250

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 119/194 (61%), Gaps = 13/194 (7%)
 Frame = +3

Query  663   KAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARH  842
             K +Y   +S   L Y   L+   V  SY +VP+Y+  CQ TG+ G   +    EE  A  
Sbjct  51    KLSYGSNQSA--LYYAISLIIGTVALSYGSVPMYKMICQQTGWNGQPVQTHRTEENPASR  108

Query  843   AIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAEN  1022
              +    S+R + + FN  V+D +PWKF P QREV          RV PGE+ALAFYTA N
Sbjct  109   -LKPVTSSRRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGETALAFYTATN  157

Query  1023  RSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM  1202
                  I GV+TY+VTP K + YF+KIQCFCFEEQRL  GE +DMPVFF+IDP+F TDP M
Sbjct  158   EGPDDIIGVATYSVTPAKVSPYFSKIQCFCFEEQRLSAGESVDMPVFFFIDPDFHTDPAM  217

Query  1203  DGINNIILSYTFFK  1244
               I+ I LSYTFFK
Sbjct  218   RNIDTITLSYTFFK  231



>emb|CCE26916.1| probable cytochrome-c oxidase assembly protein (COX11) [Claviceps 
purpurea 20.1]
Length=270

 Score =   190 bits (483),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 124/197 (63%), Gaps = 15/197 (8%)
 Frame = +3

Query  669   AYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKE----SVEEKIA  836
             A   KKS+    Y   ++   +  SYA+VPLY+  CQ TG+GG   R      S ++ +A
Sbjct  71    AERRKKSRSAAYYTISVIVGTLALSYASVPLYKMICQTTGWGGQPIRAHGGPSSDDDSLA  130

Query  837   RHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTA  1016
                +  T S + I V FNA V+D +PWKF P QREV          RV PGE+ALAFY A
Sbjct  131   SRLVPVT-SAKRIKVNFNACVSDDLPWKFTPQQREV----------RVLPGETALAFYKA  179

Query  1017  ENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP  1196
             +NR    I GV+TY+VTP ++A YF+KIQCFCFEEQRL  GE++DMPVFFY+DP+   D 
Sbjct  180   KNRGDRDIIGVATYSVTPAQSAAYFSKIQCFCFEEQRLNAGEEVDMPVFFYLDPDLLNDL  239

Query  1197  KMDGINNIILSYTFFKV  1247
              M G++ + L+YTFFK 
Sbjct  240   NMQGVDQVTLNYTFFKA  256



>gb|EMS21220.1| cytochrome c oxidase assembly protein COX11 [Rhodosporidium toruloides 
NP11]
 emb|CDR39682.1| RHTO0S04e07778g1_1 [Rhodosporidium toruloides]
Length=277

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 125/203 (62%), Gaps = 19/203 (9%)
 Frame = +3

Query  648   HQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKES---  818
             +Q A +  Y +++++ +LLY    V  +   SY AVPLYR FC  TGYGGT     S   
Sbjct  67    YQRARQEHY-KQRNRSLLLYSAATVLVVTAGSYLAVPLYRVFCSTTGYGGTPDTDSSKFT  125

Query  819   VEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESA  998
              +  I R  +D     R I V FNAD +D +PW F P Q+EV          RV PGE+A
Sbjct  126   PDRLIPRTDLD-----RRIRVTFNADASDALPWSFEPQQKEV----------RVLPGETA  170

Query  999   LAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  1178
             LAFYTA N SS  I G++TYNVTP   A YF K++CFCFEEQRLL GE++D+PVFF+ID 
Sbjct  171   LAFYTATNHSSEDIIGIATYNVTPQNIAPYFAKVECFCFEEQRLLAGEEVDLPVFFFIDR  230

Query  1179  EFETDPKMDGINNIILSYTFFKV  1247
             +F  DP M  +  + LSYTFF+ 
Sbjct  231   DFVDDPLMKDVREVTLSYTFFRA  253



>ref|XP_008072662.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Tarsius syrichta]
Length=273

 Score =   191 bits (484),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y+      M+G SYAAVPLYR +CQ TG GG+          +A HA D   
Sbjct  87    RRNKTVLTYVAAAAVGMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHASDQIE  137

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  138   NMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  187

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  188   TDKPVIGISTYNVIPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMV  247

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  D
Sbjct  248   NVDLITLSYTFFEAKD  263



>ref|XP_311504.3| AGAP010443-PA [Anopheles gambiae str. PEST]
 gb|EAA07179.3| AGAP010443-PA [Anopheles gambiae str. PEST]
Length=235

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 121/190 (64%), Gaps = 14/190 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             K +  + Y+       VG SYAAVPLYR FCQA  YGGT  +    E+  +       V 
Sbjct  46    KIRSTVYYVAAAGVLTVGLSYAAVPLYRMFCQAYSYGGTTSQGHDGEKVESMQK----VK  101

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I ++FNAD+   M W F P Q E+          RV PGE+ALAFY+A+N +  P+ 
Sbjct  102   DRVIKIKFNADIGASMRWNFKPQQTEI----------RVVPGETALAFYSAKNPTDHPVV  151

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+STYNV P +A  YFNKIQCFCFEEQ+L P E++D+PVFFYIDP+F  DPKM+ +++I 
Sbjct  152   GISTYNVIPFEAGAYFNKIQCFCFEEQQLNPHEEVDLPVFFYIDPDFIEDPKMELVDSIT  211

Query  1224  LSYTFFKVSD  1253
             LSYTFF+  D
Sbjct  212   LSYTFFESKD  221



>gb|ETE70619.1| Cytochrome c oxidase assembly protein COX11, mitochondrial [Ophiophagus 
hannah]
Length=245

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/218 (48%), Positives = 127/218 (58%), Gaps = 19/218 (9%)
 Frame = +3

Query  591   FSNLGRHSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRR  770
             F    R  TA   +    + +   K      +++ +L YL   V  M G SYAAVPLYR 
Sbjct  34    FRGDQRQKTAEPVAAFRREQEQQWK-----DRNRTVLTYLAAGVVGMAGLSYAAVPLYRL  88

Query  771   FCQATGYGGTVQRKESVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS  950
             +CQATG GG+     S E+          V  R I V FN+DV   + W F P Q EV  
Sbjct  89    YCQATGLGGSALDGHSSEQIETMEP----VKDRIIKVTFNSDVHSSLQWNFKPQQTEV--  142

Query  951   *CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRL  1130
                      V PGE+ALAFY A+N +  PI G+STYNV P +A  YFNKIQCFCFEEQRL
Sbjct  143   --------YVVPGETALAFYKAKNPTDRPIIGISTYNVLPPEAGQYFNKIQCFCFEEQRL  194

Query  1131  LPGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFK  1244
              P E++DMPVFF+IDPEF  DPKM+ +N I LSYTFF+
Sbjct  195   NPHEEVDMPVFFFIDPEFVEDPKMERVNLITLSYTFFE  232



>ref|XP_002583428.1| cytochrome c oxidase assembly protein ctaG [Uncinocarpus reesii 
1704]
 gb|EEP81530.1| cytochrome c oxidase assembly protein ctaG [Uncinocarpus reesii 
1704]
Length=249

 Score =   189 bits (481),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 91/196 (46%), Positives = 121/196 (62%), Gaps = 10/196 (5%)
 Frame = +3

Query  657   ATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIA  836
             A + A++ K++   L Y   L+   +  +Y +VP+Y+  CQ TG+ G       V  +  
Sbjct  49    AMRNAFSAKQNTTTLYYTISLIVGTLALAYGSVPMYKMICQQTGWNGQPVSSHLVNGENT  108

Query  837   RHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTA  1016
                +     +R + + FNA V+D +PWKF P QREV          RV PGE+ALAFYTA
Sbjct  109   ASRLIPVTDSRRLRITFNASVSDVLPWKFTPQQREV----------RVLPGETALAFYTA  158

Query  1017  ENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDP  1196
              N+    I GV+TY+VTP + + YF+KIQCFCFEEQRL  GE +DMPVFF+IDP+F  DP
Sbjct  159   TNKGDNDIIGVATYSVTPAQVSPYFSKIQCFCFEEQRLNAGETVDMPVFFFIDPDFVNDP  218

Query  1197  KMDGINNIILSYTFFK  1244
              M GI+ I LSYTFFK
Sbjct  219   AMRGIDTITLSYTFFK  234



>ref|XP_007694500.1| hypothetical protein COCSADRAFT_194937 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD69059.1| hypothetical protein COCSADRAFT_194937 [Bipolaris sorokiniana 
ND90Pr]
Length=262

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 125/202 (62%), Gaps = 27/202 (13%)
 Frame = +3

Query  669   AYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAI  848
             A  + K++ ++ Y+  ++   V  +Y +VP+Y+  CQ TG+GG          K A H  
Sbjct  63    AQYKMKNRTVMNYVFSVIVGFVAITYGSVPMYKMICQQTGWGGQ-------PIKSAAHGG  115

Query  849   DGTVSTRE----------IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESA  998
             D +VS  E          I + FN  V+D +PWKF+P QREV          RV PGE+A
Sbjct  116   DSSVSPAERLKPVTNHPRIRITFNGSVSDVLPWKFVPQQREV----------RVLPGETA  165

Query  999   LAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  1178
             LAFYTA N+S   I GV+TY+VTP + A YF+KIQCFCFEEQRL  GE +DMPVFFYIDP
Sbjct  166   LAFYTATNKSPEDIIGVATYSVTPGQVAPYFSKIQCFCFEEQRLNAGETVDMPVFFYIDP  225

Query  1179  EFETDPKMDGINNIILSYTFFK  1244
             EF TDP M GI  + LSYTFFK
Sbjct  226   EFVTDPNMKGIETVTLSYTFFK  247



>ref|XP_010355739.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
isoform X2 [Rhinopithecus roxellana]
Length=276

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K  L Y+  +  AM+G SYAAVPLYR +CQ TG GG+          +A HA D   
Sbjct  90    QRNKTTLTYVAAVAVAMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHASDQIE  140

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I + FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  141   NMVPVKDRIIKISFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYRAKNP  190

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  191   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMI  250

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  251   NVDLITLSYTFFEAKE  266



>gb|KDE02595.1| hypothetical protein MVLG_06857 [Microbotryum violaceum p1A1 
Lamole]
Length=311

 Score =   192 bits (487),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 125/194 (64%), Gaps = 12/194 (6%)
 Frame = +3

Query  663   KAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARH  842
             + A+ +++++ +LLY +  +  +   SY AVPLYR FC ATGYGGT    +S     A  
Sbjct  112   RKAHYQQRNRSLLLYSSATIVLVTTASYLAVPLYRVFCSATGYGGTPATDKS--RFGAER  169

Query  843   AIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAEN  1022
              I    + R I VQFNAD +D +PW F P Q+EV          RV PGE+ALAFY A+N
Sbjct  170   LIPVVETERRIRVQFNADSSDSLPWTFTPQQKEV----------RVLPGETALAFYRAKN  219

Query  1023  RSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKM  1202
              S+  I G++TYNVTP   A YF K++CFCFEEQR+L GE++D+PVFF+ID +F  DP M
Sbjct  220   NSTEDIVGIATYNVTPNNIAPYFAKVECFCFEEQRILAGEEVDLPVFFFIDKDFLEDPLM  279

Query  1203  DGINNIILSYTFFK  1244
               +  + LSYTFF+
Sbjct  280   RDVQEVTLSYTFFR  293



>gb|EGU11323.1| Cytochrome c oxidase assembly protein COX11 [Rhodotorula glutinis 
ATCC 204091]
Length=277

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 125/202 (62%), Gaps = 19/202 (9%)
 Frame = +3

Query  648   HQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKES---  818
             +Q A +  Y +++++ +LLY    V  +   SY AVPLYR FC  TGYGGT     S   
Sbjct  67    YQRAREEHY-KQRNRSLLLYSAATVLVVTAGSYLAVPLYRVFCSTTGYGGTPDTDSSKFT  125

Query  819   VEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESA  998
              +  I R  +D     R I V FNAD +D +PW F P Q+EV          RV PGE+A
Sbjct  126   PDRLIPRTDLD-----RRIRVTFNADASDALPWSFEPQQKEV----------RVLPGETA  170

Query  999   LAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDP  1178
             LAFYTA N SS  I G++TYNVTP   A YF K++CFCFEEQRLL GE++D+PVFF+ID 
Sbjct  171   LAFYTATNHSSEDIIGIATYNVTPQNIAPYFAKVECFCFEEQRLLAGEEVDLPVFFFIDR  230

Query  1179  EFETDPKMDGINNIILSYTFFK  1244
             +F  DP M  +  + LSYTFF+
Sbjct  231   DFVDDPLMKDVREVTLSYTFFR  252



>gb|EYC44262.1| hypothetical protein Y032_0466g1958 [Ancylostoma ceylanicum]
Length=232

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 128/196 (65%), Gaps = 14/196 (7%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTVS  863
             +++ ++ Y+  +    +G ++AA+P YR FC+ T +GG  Q  +  E +IA+      V 
Sbjct  30    RNRDVMYYVVSIGVVAIGVTFAAIPAYRIFCEKTSFGGLTQIAKDFE-RIAKMK---KVE  85

Query  864   TREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSSTPIT  1043
              R I VQFN+DV   M W+F P Q E+           V PGE+ALAFYTA N +  PI 
Sbjct  86    DRLIRVQFNSDVPSSMRWEFKPQQHEM----------YVHPGETALAFYTARNPTDRPIV  135

Query  1044  GVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGINNII  1223
             G+S+YN+TP +AA YFNKIQCFCFEEQ L PGEQ+D+PVFFYIDP++  DP ++ ++NI+
Sbjct  136   GISSYNLTPFQAAYYFNKIQCFCFEEQILNPGEQVDLPVFFYIDPDYANDPALEYLDNIL  195

Query  1224  LSYTFFKVSDE*QFYS  1271
             LSYTFF+   + Q  S
Sbjct  196   LSYTFFEAKSDLQLPS  211



>ref|XP_008435904.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Poecilia reticulata]
Length=253

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 119/195 (61%), Gaps = 24/195 (12%)
 Frame = +3

Query  684   KSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT--  857
             ++K +L Y+      M+G SYA+VPLYR +CQATG GGT          +A H  D    
Sbjct  66    RNKTVLTYIAAAGVGMIGLSYASVPLYRLYCQATGLGGTA---------VAGHDTDQVET  116

Query  858   ---VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                V  R I V FNAD    + W F P Q E+           V PGE+ALAFY A+N +
Sbjct  117   MKPVKERIIKVTFNADTHASIQWNFRPQQTEI----------YVVPGETALAFYRAKNPT  166

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PI G+STYNV P  A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  
Sbjct  167   DKPIIGISTYNVVPFDAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDDDPRMAR  226

Query  1209  INNIILSYTFFKVSD  1253
             ++ I LSYTFF+  +
Sbjct  227   VDTITLSYTFFEAKE  241



>ref|XP_006095640.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
isoform X2 [Myotis lucifugus]
Length=275

 Score =   190 bits (483),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 123/193 (64%), Gaps = 18/193 (9%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGTV  860
             +++K +L Y+      M+G SYAAVPLYR +CQ TG GG+V    S ++      I+  V
Sbjct  89    QRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTGLGGSVAAGHSSDQ------IENMV  142

Query  861   STRE--IVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRSST  1034
               ++  I V FNADV   + W F P Q E+           V PGE+ALAFY A+N +  
Sbjct  143   PVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVMPGETALAFYKAKNPTDK  192

Query  1035  PITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDGIN  1214
             P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M  ++
Sbjct  193   PVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMVNVD  252

Query  1215  NIILSYTFFKVSD  1253
              I LSYTFF+  +
Sbjct  253   LITLSYTFFEAKE  265



>ref|XP_008313204.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Cynoglossus semilaevis]
Length=259

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 121/195 (62%), Gaps = 18/195 (9%)
 Frame = +3

Query  675   TEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGG--TVQRKESVEEKIARHAI  848
             T+ +++ +L Y+      M+G SYA+VPLYR +CQATG GG        SV E +     
Sbjct  69    TKTRNRTVLTYIAAAGVGMIGLSYASVPLYRLYCQATGLGGAAVAGHDTSVVETMK----  124

Query  849   DGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENRS  1028
                V  R + V FNAD    M W F P Q E+           + PGE+ALAFY A+N +
Sbjct  125   --PVKERVLKVLFNADTHASMQWNFRPQQTEI----------YLVPGETALAFYRAKNPT  172

Query  1029  STPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMDG  1208
               PI G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF+ DP+M  
Sbjct  173   DKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPHEEVDMPVFFYIDPEFDEDPRMAR  232

Query  1209  INNIILSYTFFKVSD  1253
             +N I LSYTFF+  +
Sbjct  233   VNTITLSYTFFEAKE  247



>ref|XP_004669996.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Jaculus jaculus]
Length=253

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             ++++ +L Y+      M+G SYAAVPLYR +CQ TG GG+          +A HA D   
Sbjct  67    RRNRTLLTYVAAAAVGMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHASDQIE  117

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  118   NMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  167

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  PI G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  168   TDKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMV  227

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  228   NVDLITLSYTFFEAKE  243



>ref|XP_002748455.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Callithrix jacchus]
Length=276

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K  L Y+  +   M+G SYAAVPLYR +CQ TG GG+V         +A HA D   
Sbjct  90    RRNKTALTYVAAVAVGMLGVSYAAVPLYRLYCQTTGLGGSV---------VAGHASDQIE  140

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I V FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  141   NMVPVKDRIIKVTFNADVHASLQWNFRPQQTEI----------FVVPGETALAFYKAKNP  190

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  191   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMI  250

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  251   KVDVITLSYTFFEAKE  266



>ref|XP_001275506.1| cytochrome c oxidase assembly protein Cox11, putative [Aspergillus 
clavatus NRRL 1]
 gb|EAW14080.1| cytochrome c oxidase assembly protein Cox11, putative [Aspergillus 
clavatus NRRL 1]
Length=240

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 122/203 (60%), Gaps = 14/203 (7%)
 Frame = +3

Query  648   HQYATKAAYT----EKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKE  815
             HQ  + A +     +K++  ++ Y   L    +  +YA+VPLY+  CQ  G+ G      
Sbjct  33    HQSGSSAPFNTPQAQKRNASVMYYTASLFLGTLALAYASVPLYKMICQQMGWNGQPVLTH  92

Query  816   SVEEKIARHAIDGTVSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGES  995
                +    + +      R + + FN  V+D +PWKF P QREV          RV PGE+
Sbjct  93    RAGDGDTSNRVTPVTDARRLRITFNGSVSDVLPWKFTPQQREV----------RVLPGET  142

Query  996   ALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYID  1175
             ALAFYTA N+  T I GV+TY+VTP + A YF+KIQCFCFEEQ+L  GE +DMPVFF+ID
Sbjct  143   ALAFYTATNKGPTDIIGVATYSVTPGQVAPYFSKIQCFCFEEQKLNAGESVDMPVFFFID  202

Query  1176  PEFETDPKMDGINNIILSYTFFK  1244
             P+F TDP M GI+ I LSYTFFK
Sbjct  203   PDFATDPAMKGIDTITLSYTFFK  225



>ref|XP_003977280.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial-like 
[Takifugu rubripes]
Length=263

 Score =   190 bits (482),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 128/220 (58%), Gaps = 26/220 (12%)
 Frame = +3

Query  609   HSTARSCSMLNFQHQYATKAAYTEKKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATG  788
             HS  R     N   ++  +    + ++K +L Y+      M+G SYAAVPLYR +CQA+G
Sbjct  55    HSQVRGVKSRN--GKFKGQEEEWKARNKTVLTYIAAAGVGMIGLSYAAVPLYRLYCQASG  112

Query  789   YGGTVQRKESVEEKIARHAIDGT-----VSTREIVVQFNADVADGMPWKFIPTQREVPS*  953
              GG           +A H  D       V  R I + FNAD    M W F P Q EV   
Sbjct  113   LGGMA---------VAGHDADQVETMKPVPERVIKITFNADRHASMQWNFRPQQTEV---  160

Query  954   CSHHRPVRVKPGESALAFYTAENRSSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLL  1133
                     V PGE+ALAFY A+N +  PITG+STYNV P +A  YFNKIQCFCFEEQRL 
Sbjct  161   -------FVVPGETALAFYRAKNPTDKPITGISTYNVVPFEAGQYFNKIQCFCFEEQRLN  213

Query  1134  PGEQIDMPVFFYIDPEFETDPKMDGINNIILSYTFFKVSD  1253
             P E++DMPVFFYIDPEF+ DP+M  ++ I LSYTFF+  +
Sbjct  214   PHEEVDMPVFFYIDPEFDEDPRMARVDTITLSYTFFEAKE  253



>ref|NP_001076872.1| cytochrome c oxidase assembly protein COX11, mitochondrial [Bos 
taurus]
 ref|XP_010835791.1| PREDICTED: cytochrome c oxidase assembly protein COX11, mitochondrial 
[Bison bison bison]
 sp|A3KMZ6.1|COX11_BOVIN RecName: Full=Cytochrome c oxidase assembly protein COX11, mitochondrial; 
Flags: Precursor [Bos taurus]
 gb|AAI33445.1| COX11 protein [Bos taurus]
Length=282

 Score =   190 bits (483),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/196 (49%), Positives = 121/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K +L Y+      M+G SYAAVPLYR +CQ TG GG+          +A HA D   
Sbjct  85    RRNKTVLTYMAAAAVGMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHASDQIE  135

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R I + FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  136   NMVPVKDRIIKITFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYKAKNP  185

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  P+ G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  186   TDKPVIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMV  245

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  246   NVDLITLSYTFFEAKE  261



>ref|NP_001182369.1| COX11 homolog, cytochrome c oxidase assembly protein [Macaca 
mulatta]
 gb|EHH24821.1| hypothetical protein EGK_08546 [Macaca mulatta]
Length=276

 Score =   190 bits (483),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 122/196 (62%), Gaps = 24/196 (12%)
 Frame = +3

Query  681   KKSKKMLLYLTGLVFAMVGCSYAAVPLYRRFCQATGYGGTVQRKESVEEKIARHAIDGT-  857
             +++K  L Y+  +  AM+G SYAAVPLYR +CQ TG GG+          +A HA D   
Sbjct  90    RRNKTTLTYVAAVAVAMLGASYAAVPLYRLYCQTTGLGGSA---------VAGHASDQIE  140

Query  858   ----VSTREIVVQFNADVADGMPWKFIPTQREVPS*CSHHRPVRVKPGESALAFYTAENR  1025
                 V  R + + FNADV   + W F P Q E+           V PGE+ALAFY A+N 
Sbjct  141   NMVPVKDRILKISFNADVHASLQWNFRPQQTEI----------YVVPGETALAFYRAKNP  190

Query  1026  SSTPITGVSTYNVTPMKAAVYFNKIQCFCFEEQRLLPGEQIDMPVFFYIDPEFETDPKMD  1205
             +  PI G+STYNV P +A  YFNKIQCFCFEEQRL P E++DMPVFFYIDPEF  DP+M 
Sbjct  191   TDKPIIGISTYNVVPFEAGQYFNKIQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMI  250

Query  1206  GINNIILSYTFFKVSD  1253
              ++ I LSYTFF+  +
Sbjct  251   NVDLITLSYTFFEAKE  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5180161682960