BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21757_g2_i1 len=717 path=[4569:0-716]

Length=717
                                                                      Score     E

ref|XP_009622840.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       94.7    1e-20   
ref|XP_009793881.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       89.4    1e-18   
ref|XP_006355179.1|  PREDICTED: protein GLUTAMINE DUMPER 3-like       85.1    3e-17   
ref|XP_007032963.1|  Glutamine dumper 2, putative                     81.6    4e-16   
ref|XP_004233655.1|  PREDICTED: protein GLUTAMINE DUMPER 6            81.3    8e-16   
ref|XP_002530814.1|  conserved hypothetical protein                   65.1    3e-10   Ricinus communis
ref|XP_006373514.1|  hypothetical protein POPTR_0017s14420g           65.1    4e-10   
ref|XP_002539784.1|  conserved hypothetical protein                   64.7    5e-10   Ricinus communis
ref|XP_011032792.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       62.8    2e-09   
gb|KDO58877.1|  hypothetical protein CISIN_1g035876mg                 62.8    2e-09   
ref|XP_010261666.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       62.4    3e-09   
ref|XP_011021445.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       61.6    6e-09   
ref|XP_002530813.1|  conserved hypothetical protein                   61.2    1e-08   Ricinus communis
ref|XP_002305308.1|  hypothetical protein POPTR_0004s10810g           60.1    2e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007215171.1|  hypothetical protein PRUPE_ppa013605mg           60.1    2e-08   
ref|XP_006844172.1|  hypothetical protein AMTR_s00006p00263100        59.7    2e-08   
ref|XP_008230337.1|  PREDICTED: protein GLUTAMINE DUMPER 4-like       59.7    2e-08   
ref|XP_006373515.1|  hypothetical protein POPTR_0017s14430g           59.7    3e-08   
emb|CDP02369.1|  unnamed protein product                              59.3    4e-08   
ref|XP_006430883.1|  hypothetical protein CICLE_v10013138mg           57.8    1e-07   
ref|XP_011085667.1|  PREDICTED: protein GLUTAMINE DUMPER 5            57.4    2e-07   
ref|XP_010660536.1|  PREDICTED: protein GLUTAMINE DUMPER 4            57.4    2e-07   
ref|XP_002539968.1|  conserved hypothetical protein                   57.0    3e-07   Ricinus communis
ref|XP_011021142.1|  PREDICTED: protein GLUTAMINE DUMPER 3-like       56.2    6e-07   
ref|XP_010942293.1|  PREDICTED: protein GLUTAMINE DUMPER 1-like       57.8    7e-07   
ref|XP_002305310.2|  hypothetical protein POPTR_0004s10830g           55.5    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_009777637.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       55.5    1e-06   
ref|XP_008797611.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       55.1    1e-06   
gb|KHN14458.1|  hypothetical protein glysoja_029720                   54.3    3e-06   
ref|XP_006384232.1|  hypothetical protein POPTR_0004s10840g           53.9    4e-06   
ref|XP_009616053.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       55.1    4e-06   
gb|KDP20040.1|  hypothetical protein JCGZ_05809                       53.9    4e-06   
ref|XP_009603457.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       53.5    4e-06   
ref|XP_003551789.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       53.5    6e-06   
ref|XP_010032588.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       53.5    6e-06   
ref|XP_006845568.1|  hypothetical protein AMTR_s00019p00190490        53.9    6e-06   
ref|XP_002512022.1|  conserved hypothetical protein                   52.8    7e-06   Ricinus communis
ref|NP_001241098.1|  uncharacterized protein LOC100797343             53.1    8e-06   
ref|XP_004491972.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       53.1    9e-06   
gb|KHN13786.1|  hypothetical protein glysoja_016070                   53.1    1e-05   
ref|XP_010100897.1|  hypothetical protein L484_009667                 52.8    1e-05   
ref|XP_009596760.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       52.4    1e-05   
ref|XP_008797569.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       52.4    2e-05   
gb|KDP24335.1|  hypothetical protein JCGZ_25631                       52.0    2e-05   
ref|XP_007139366.1|  hypothetical protein PHAVU_008G023400g           52.0    3e-05   
gb|KCW51998.1|  hypothetical protein EUGRSUZ_J01437                   51.2    3e-05   
ref|XP_010034416.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       51.2    3e-05   
ref|XP_009407941.1|  PREDICTED: protein GLUTAMINE DUMPER 3-like       50.8    4e-05   
ref|XP_010660581.1|  PREDICTED: protein GLUTAMINE DUMPER 3-like       50.8    5e-05   
ref|XP_010528447.1|  PREDICTED: protein GLUTAMINE DUMPER 6            50.1    9e-05   
ref|XP_010929456.1|  PREDICTED: protein GLUTAMINE DUMPER 5-like       49.3    1e-04   
ref|XP_009621543.1|  PREDICTED: protein GLUTAMINE DUMPER 5-like       49.3    1e-04   
gb|EYU44262.1|  hypothetical protein MIMGU_mgv1a021848mg              48.9    2e-04   
ref|XP_009386998.1|  PREDICTED: protein GLUTAMINE DUMPER 4-like       48.9    2e-04   
gb|KDP24334.1|  hypothetical protein JCGZ_25630                       48.9    2e-04   
ref|XP_006373516.1|  hypothetical protein POPTR_0017s14440g           48.9    3e-04   
ref|XP_006373517.1|  hypothetical protein POPTR_0017s14450g           48.1    3e-04   
ref|XP_007037711.1|  Uncharacterized protein TCM_014438               47.8    5e-04   
ref|XP_008782086.1|  PREDICTED: protein GLUTAMINE DUMPER 2-like       48.9    5e-04   
ref|XP_006440842.1|  hypothetical protein CICLE_v10023021mg           47.8    5e-04   
ref|XP_010257852.1|  PREDICTED: protein GLUTAMINE DUMPER 6-like       47.8    7e-04   
ref|XP_004501399.1|  PREDICTED: protein GLUTAMINE DUMPER 5-like       48.1    7e-04   
ref|XP_009412243.1|  PREDICTED: protein GLUTAMINE DUMPER 5-like       47.4    7e-04   
emb|CBI16901.3|  unnamed protein product                              47.8    8e-04   



>ref|XP_009622840.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Nicotiana tomentosiformis]
Length=126

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 84/119 (71%), Gaps = 10/119 (8%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKK----------  194
            M+P  NTTSTA  +  HRWNSP+PYLFGGLA+M+GLIALAL+IL CS KK          
Sbjct  8    MKPLRNTTSTAGDSSFHRWNSPVPYLFGGLAVMMGLIALALLILACSYKKRSSSTEESSS  67

Query  195  SAGENQDDDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLDVV  371
            S+    D D  RQEKP++    V++PEMEPKFVVIMPGD+NPTCLAKP + +R   D V
Sbjct  68   SSNNVNDSDDGRQEKPSTKSVQVLRPEMEPKFVVIMPGDYNPTCLAKPAMPTRQGPDQV  126



>ref|XP_009793881.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Nicotiana sylvestris]
Length=127

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 83/120 (69%), Gaps = 11/120 (9%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            M+PSHNTTSTA  +  HRWNSP+PYLFGGLA+M+GLIALAL+IL CS KK +  + ++ +
Sbjct  8    MKPSHNTTSTAGDSSFHRWNSPVPYLFGGLAVMMGLIALALLILACSYKKRSSSSTEESS  67

Query  225  DR-----------QEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLDVV  371
                         QEK ++    V+ PEMEPKFVVIMPGD+NPT LAKPT+  R   D V
Sbjct  68   SSSNNVNDSDDGPQEKSSTKSVQVLSPEMEPKFVVIMPGDYNPTWLAKPTMPIRQGPDQV  127



>ref|XP_006355179.1| PREDICTED: protein GLUTAMINE DUMPER 3-like [Solanum tuberosum]
Length=121

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 82/110 (75%), Gaps = 11/110 (10%)
 Frame = +3

Query  48   RPSHNTTSTADP-TGLHRWNSPIPYlfgglalmlglialaliilVCSNKK------SAGE  206
            +PSHN TST    +G+ RWNSP+PYLFGG+A++LGLIALAL+++ CS KK      S+  
Sbjct  9    KPSHNATSTLLVDSGITRWNSPVPYLFGGIAIILGLIALALLVVTCSYKKPSTEESSSRS  68

Query  207  NQDDDADR-QEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSR  353
            N  +D+DR QEK      ++MKPEMEPKFVVIMPGD+NPT LAKPT+  R
Sbjct  69   NNVNDSDRGQEKKV---VELMKPEMEPKFVVIMPGDYNPTWLAKPTLPIR  115



>ref|XP_007032963.1| Glutamine dumper 2, putative [Theobroma cacao]
 gb|EOY03889.1| Glutamine dumper 2, putative [Theobroma cacao]
Length=104

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 74/108 (69%), Gaps = 4/108 (4%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+ N+T++A  TG   WNSP+PYLF GLALMLGLI+ AL+IL CS KKS   +  D+A
Sbjct  1    MRPASNSTASATGTGFGHWNSPVPYLFSGLALMLGLISFALVILACSYKKSPSNSAHDEA  60

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLDV  368
            +  EKPA   +  M+ EMEPK VVIM GD NPT LAKP   +R    V
Sbjct  61   E--EKPAKQVS--MQLEMEPKIVVIMAGDENPTYLAKPVSSTRLSEQV  104



>ref|XP_004233655.1| PREDICTED: protein GLUTAMINE DUMPER 6 [Solanum lycopersicum]
Length=121

 Score = 81.3 bits (199),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 80/110 (73%), Gaps = 9/110 (8%)
 Frame = +3

Query  45   MRPSHNTTSTADP-TGLHRWNSPIPYlfgglalmlglialaliilVCSNKK------SAG  203
            M+PSHN TST    +G+ +WNSP+PYLFGGLA++LGLIALAL+++ CS KK      S+ 
Sbjct  8    MKPSHNATSTLLVDSGITKWNSPVPYLFGGLAIILGLIALALLVVTCSYKKPSTEESSSR  67

Query  204  ENQDDDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSR  353
             N  +D D  +   +   ++MKPEMEPKFVVIMPGD+NPT LAKPT+  R
Sbjct  68   SNNVNDLDHGQDKKT--IELMKPEMEPKFVVIMPGDYNPTWLAKPTLPIR  115



>ref|XP_002530814.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31582.1| conserved hypothetical protein [Ricinus communis]
Length=115

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 73/114 (64%), Gaps = 4/114 (4%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP  N+T+TA   G   W+SP+PYLFGGLALMLG+IA+ALIIL CS +KS  +    D 
Sbjct  1    MRPVSNSTTTA---GFWHWSSPMPYLFGGLALMLGVIAVALIILACSYRKSLSDESRGDG  57

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLDVV*IECR  386
              +EKP +  A++     EPK VVIM GD NPT LAKP    R +  VV   C+
Sbjct  58   -HEEKPGAKQAELTVDSDEPKIVVIMAGDDNPTFLAKPKPKPRLEPAVVVCNCQ  110



>ref|XP_006373514.1| hypothetical protein POPTR_0017s14420g [Populus trichocarpa]
 gb|ERP51311.1| hypothetical protein POPTR_0017s14420g [Populus trichocarpa]
Length=133

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 52/101 (51%), Positives = 64/101 (63%), Gaps = 3/101 (3%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+ N+T+ A   G    NSPIPYLF  + LM GL+A+AL+IL CS +KS+  +  D  
Sbjct  1    MRPAFNSTAPAVHAGYQDRNSPIPYLFSSIGLMFGLVAVALMILACSYRKSSSTSATDP-  59

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTIC  347
            + QEK A+     MK EMEPK VVIM GD  PT LA P  C
Sbjct  60   EVQEKSANQVE--MKAEMEPKIVVIMAGDDRPTYLANPVSC  98



>ref|XP_002539784.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF22599.1| conserved hypothetical protein [Ricinus communis]
Length=125

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  45   MRPSHNTTST-ADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDD  221
            MRP+  + ST A   G   W+SPIPYLFGGLA+ML  + ++LIIL CS +KS   ++  D
Sbjct  2    MRPTATSNSTTAAAAGFWHWSSPIPYLFGGLAVMLAFVTVSLIILACSYRKSLFNHESRD  61

Query  222  ADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLA  332
             D ++K  +   +VM    EPK VVIM GD+NPT LA
Sbjct  62   DDHEDKTGAKKVEVMVDSDEPKIVVIMAGDNNPTFLA  98



>ref|XP_011032792.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Populus euphratica]
Length=106

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 65/101 (64%), Gaps = 3/101 (3%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+ N+T+ A   G    NSPIPYLF  LALML LIA++LIIL CS +KS+  +  D  
Sbjct  1    MRPASNSTAPAVHAGYQDGNSPIPYLFASLALMLALIAVSLIILACSYRKSSSSSSSDP-  59

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTIC  347
            + QEK  S     M+ EMEPK VVIM GD NPT LA P  C
Sbjct  60   EAQEK--SVKQVEMRAEMEPKIVVIMAGDDNPTYLADPVSC  98



>gb|KDO58877.1| hypothetical protein CISIN_1g035876mg [Citrus sinensis]
Length=117

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +3

Query  96   RWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMKPE  275
             WNSP+PYLFGGL LM+GLI +AL+IL CS +KS+  +  D AD  +         M+ E
Sbjct  23   HWNSPLPYLFGGLGLMMGLITVALMILACSYRKSSSNSATDHADEDKSAGHDKQVEMQTE  82

Query  276  MEPKFVVIMPGDHNPTCLAKPTICS  350
            MEPK VVIM GD NP+ LAKP  C+
Sbjct  83   MEPKIVVIMAGDDNPSYLAKPVSCT  107



>ref|XP_010261666.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Nelumbo nucifera]
Length=105

 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 69/104 (66%), Gaps = 8/104 (8%)
 Frame = +3

Query  45   MRPSHNTTST--ADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDD  218
            MRP   TT       TG  RWNSP+PYLF G+A MLGLIALAL++LVC+++KS+  +   
Sbjct  1    MRPVSATTHAPATVATGFRRWNSPMPYLFAGIAAMLGLIALALLVLVCTHRKSSDNSSQQ  60

Query  219  DADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
              ++   P S+P     P+ EPK VV+MPG++ PT +AKP +CS
Sbjct  61   TEEKPANPISSP-----PDTEPKVVVVMPGEYKPTFIAKP-VCS  98



>ref|XP_011021445.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Populus euphratica]
Length=106

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 67/103 (65%), Gaps = 3/103 (3%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+ N+T+ A   G    NSPIPYLF G+ LM GL+A+AL+IL CS +KS+  +   D 
Sbjct  1    MRPAFNSTTPAVHAGYQDRNSPIPYLFSGIGLMFGLVAVALMILACSYRKSS-SSSTTDP  59

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSR  353
            + QEK A+     M  EMEPK VVIM GD +PT LA P  C+R
Sbjct  60   EVQEKSANQVE--MNAEMEPKIVVIMAGDDSPTYLANPVPCNR  100



>ref|XP_002530813.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31581.1| conserved hypothetical protein [Ricinus communis]
Length=124

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+ N+T+ A   G   W+SPIPYLFGGLAL+LG+IA+ALIIL CS +KS      +D 
Sbjct  1    MRPTSNSTTAAAAAGFWHWSSPIPYLFGGLALILGIIAVALIILACSYRKSLSNESTEDG  60

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLA  332
              +EKP +   ++M    EPK  VIM GD NPT LA
Sbjct  61   -HEEKPGARQVEIMVDSDEPKIAVIMAGDDNPTFLA  95



>ref|XP_002305308.1| hypothetical protein POPTR_0004s10810g [Populus trichocarpa]
 ref|XP_006388758.1| hypothetical protein POPTR_0105s00210g [Populus trichocarpa]
 gb|EEE85819.1| hypothetical protein POPTR_0004s10810g [Populus trichocarpa]
 gb|ERP47672.1| hypothetical protein POPTR_0105s00210g [Populus trichocarpa]
Length=106

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 66/102 (65%), Gaps = 3/102 (3%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+ N+T+ A   G    NSPIPYLF  LALML LIAL+LIIL CS +KS+  +  D  
Sbjct  1    MRPASNSTTPAVHAGYQDRNSPIPYLFASLALMLALIALSLIILACSYRKSSSNSSSDPE  60

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
             R++   S     M+ EMEPK VVIM GD NPT LA+P  C+
Sbjct  61   AREK---SGKQGEMRAEMEPKIVVIMAGDDNPTYLAEPVSCN  99



>ref|XP_007215171.1| hypothetical protein PRUPE_ppa013605mg [Prunus persica]
 gb|EMJ16370.1| hypothetical protein PRUPE_ppa013605mg [Prunus persica]
Length=113

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 10/110 (9%)
 Frame = +3

Query  45   MRPSHNTTSTADPTG----LHRWNSPIPYlfgglalmlglialaliilVCSNKKS--AGE  206
            MRPS N+TS A  TG    L  W SPIPYLFGGLALMLGL+A+AL+IL CS  K+  +  
Sbjct  1    MRPSANSTSAA--TGQDAVLRNWKSPIPYLFGGLALMLGLVAVALLILACSFHKTPSSNS  58

Query  207  NQDDDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRT  356
            +   DAD+ +KP + P D+   + EPK VVIM G+   T LAKP +CS T
Sbjct  59   STSSDADQDQKP-TRPVDIEAADSEPKIVVIMAGEKTATYLAKP-MCSNT  106



>ref|XP_006844172.1| hypothetical protein AMTR_s00006p00263100 [Amborella trichopoda]
 gb|ERN05847.1| hypothetical protein AMTR_s00006p00263100 [Amborella trichopoda]
Length=98

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 69/99 (70%), Gaps = 6/99 (6%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP +   S      L  W+SP+PYLFGGLA +LGLIA AL+IL+CS +K++GE+++  +
Sbjct  1    MRPINGNASAPK---LSLWHSPVPYLFGGLAFILGLIAFALLILLCSYRKNSGESEEQQS  57

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
               EKPA++   +   +MEPKFVVIM G+  PT LAKP+
Sbjct  58   ---EKPANSIETLSPLDMEPKFVVIMAGEQTPTFLAKPS  93



>ref|XP_008230337.1| PREDICTED: protein GLUTAMINE DUMPER 4-like [Prunus mume]
Length=113

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 6/108 (6%)
 Frame = +3

Query  45   MRPSHNTTS--TADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKS--AGENQ  212
            MRPS N+T+  T+    L  W SPIPYLFGGLALMLGL+A+AL+IL CS  K+  +  + 
Sbjct  1    MRPSANSTAAATSQDAALRNWKSPIPYLFGGLALMLGLVAVALLILACSFHKTPSSNSST  60

Query  213  DDDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRT  356
              DAD+ +KP + P D+   + EPK VVIM G+   T LAKP +CS T
Sbjct  61   SSDADQDQKP-TRPVDIEAADSEPKIVVIMAGEKTATYLAKP-MCSNT  106



>ref|XP_006373515.1| hypothetical protein POPTR_0017s14430g [Populus trichocarpa]
 gb|ERP51312.1| hypothetical protein POPTR_0017s14430g [Populus trichocarpa]
Length=109

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +3

Query  45   MRPSHN--TTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDD  218
            MRP+ N          G   WNSP+ Y+F GLALMLGLI +ALIIL CS +KS   +   
Sbjct  1    MRPATNPSVGGGGAHGGFWHWNSPVAYVFVGLALMLGLITVALIILACSYRKSLSNSSRR  60

Query  219  DADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTIC  347
            +A+  EKPA      ++ + EPK VVIM GD NPT LAKP  C
Sbjct  61   EAELDEKPAKQVE--IQVDFEPKVVVIMAGDENPTYLAKPVSC  101



>emb|CDP02369.1| unnamed protein product [Coffea canephora]
Length=113

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 15/116 (13%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGL-HRWNSPIPYlfgglalmlglialaliilVCSNK-------KSA  200
            M   +N+TS    +GL + WN+P+PYLF GLALMLGLIA +L+IL CS +       +S+
Sbjct  1    MTQENNSTSAHVNSGLFNHWNTPLPYLFTGLALMLGLIAFSLLILACSYRNPTTTTTQSS  60

Query  201  GENQDDDADRQEKPASTPADVMKP-EMEPKFVVIMPGDHNPTCLAKPTICSRTDLD  365
            G N DD    QEK  ST A V++P E EP+ VVIM GD NPT LAKPT  S +  D
Sbjct  61   GNNDDD----QEK--STRAAVLRPDEPEPRIVVIMAGDDNPTYLAKPTTQSTSHCD  110



>ref|XP_006430883.1| hypothetical protein CICLE_v10013138mg [Citrus clementina]
 gb|ESR44123.1| hypothetical protein CICLE_v10013138mg [Citrus clementina]
Length=117

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  102  NSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMKPEME  281
            NSP+PYLFGGL LM+GLI +AL+IL CS +KS+  +  D AD  +         M+ EME
Sbjct  25   NSPLPYLFGGLGLMMGLITIALMILACSYRKSSSNSATDHADEDKSAGHDKQVEMQTEME  84

Query  282  PKFVVIMPGDHNPTCLAKPTICS  350
            PK VVIM GD NP+ LAKP  C+
Sbjct  85   PKIVVIMAGDDNPSYLAKPVSCT  107



>ref|XP_011085667.1| PREDICTED: protein GLUTAMINE DUMPER 5 [Sesamum indicum]
Length=105

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 7/98 (7%)
 Frame = +3

Query  60   NTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEK  239
            N+T+ A   G  RWNSP+PYLFGGLAL+LG+IA+ALIILVCS +          ++  E+
Sbjct  10   NSTTAAAGGGFQRWNSPVPYLFGGLALVLGVIAMALIILVCSYR-------SPSSESSEE  62

Query  240  PASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSR  353
                    ++ EMEP+ VVIM G+ NPT LAKP   +R
Sbjct  63   KPEKSVHALRSEMEPRIVVIMAGETNPTHLAKPLGAAR  100



>ref|XP_010660536.1| PREDICTED: protein GLUTAMINE DUMPER 4 [Vitis vinifera]
Length=100

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 62/108 (57%), Gaps = 8/108 (7%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            M P++ TT  A   G H+WNSPIPYLF GL L LGLIALAL++L CS + S   +   + 
Sbjct  1    MMPTNTTTKAA---GFHQWNSPIPYLFCGLGLTLGLIALALVLLACSFRMSPSNSSTQEE  57

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLDV  368
            ++  K      D     MEP+FVV+MPGD  P  LAKP    R    V
Sbjct  58   EKPGKEVEKQTD-----MEPRFVVMMPGDDKPKFLAKPAASDRQSEQV  100



>ref|XP_002539968.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF22415.1| conserved hypothetical protein [Ricinus communis]
Length=118

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 65/107 (61%), Gaps = 7/107 (7%)
 Frame = +3

Query  45   MRPSHNTTSTADPT---GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQD  215
            M    N+ + + P+   G   WNSP+PYLFGGLALMLGLIA+AL+IL CS K S+  N  
Sbjct  1    MSHGSNSGTASAPSVNGGFQHWNSPVPYLFGGLALMLGLIAMALMILACSYKNSSPSNNS  60

Query  216  DDADRQEKPASTPAD----VMKPEMEPKFVVIMPGDHNPTCLAKPTI  344
               D Q     +  D     ++ EMEPK VVIM GDHNPT  AKP +
Sbjct  61   SPRDHQAAEEKSRHDHKRAELQMEMEPKIVVIMAGDHNPTYFAKPAV  107



>ref|XP_011021142.1| PREDICTED: protein GLUTAMINE DUMPER 3-like [Populus euphratica]
Length=109

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 62/103 (60%), Gaps = 4/103 (4%)
 Frame = +3

Query  45   MRPSHN--TTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDD  218
            MRP+ N          GL  WNSP+  +F GLALMLGLI +ALIIL CS +KS   +   
Sbjct  1    MRPAINPSAGGGGAHGGLWHWNSPVACVFVGLALMLGLITVALIILACSYRKSLSNSSRR  60

Query  219  DADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTIC  347
            +A+  EKPA      ++ + EPK VVIM GD NPT LAKP  C
Sbjct  61   EAELDEKPAKQVE--IQVDFEPKVVVIMAGDENPTYLAKPVSC  101



>ref|XP_010942293.1| PREDICTED: protein GLUTAMINE DUMPER 1-like [Elaeis guineensis]
Length=216

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 10/98 (10%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP     ST   TG   W+SPIPY+FGGLA M+GLIA+ALI+L C+ +KS  E+     
Sbjct  1    MRPG----STPRSTGFRLWSSPIPYIFGGLAAMMGLIAIALIVLACTRRKSPDEDSTLPC  56

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKP  338
               E+P   P D     MEPK VVIM GD+NPT LAKP
Sbjct  57   S-IERPGIIPLD-----MEPKIVVIMAGDYNPTFLAKP  88



>ref|XP_002305310.2| hypothetical protein POPTR_0004s10830g, partial [Populus trichocarpa]
 gb|EEE85821.2| hypothetical protein POPTR_0004s10830g, partial [Populus trichocarpa]
Length=126

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 51/122 (42%), Positives = 67/122 (55%), Gaps = 4/122 (3%)
 Frame = +3

Query  45   MRPSHNTTSTADP-TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDD  221
            MRPS N+T+      G   WNSP+ Y+F GLA MLGLI ++LIIL CS+ KS   +   +
Sbjct  1    MRPSTNSTAVGSAHGGFWHWNSPVAYVFVGLAFMLGLITVSLIILACSSGKSLSNSSTSE  60

Query  222  ADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLDVV*IECRMSCRR  401
            A+ ++        V   E EP  VVIM GD NPT LAKP  C+        + C ++ R 
Sbjct  61   AEDEKSAKQVEIQV---EFEPNIVVIMAGDDNPTYLAKPVSCNCPSEQFWLLFCFLNLRN  117

Query  402  SQ  407
             Q
Sbjct  118  MQ  119



>ref|XP_009777637.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Nicotiana sylvestris]
Length=114

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 60/107 (56%), Gaps = 10/107 (9%)
 Frame = +3

Query  54   SHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQ  233
            S +T  T   T L  W SP+PYLFG LAL L LIA+AL+ LVCS +K +     DD   +
Sbjct  13   SGSTMGTNGSTSLLHWKSPLPYLFGSLALTLTLIAVALLFLVCSYRKRSSSTATDD---E  69

Query  234  EKPA----STPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDL  362
            EK A     T A V   EM PK VVIM GD  PT LA P   S + L
Sbjct  70   EKSAYCDHKTSASV---EMTPKIVVIMAGDQKPTHLAIPLSSSSSQL  113



>ref|XP_008797611.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Phoenix dactylifera]
Length=102

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 10/98 (10%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP   T ST    G   W+SPI Y+FGGLA ++ +IA+ALI+L C+ +KS+ E+     
Sbjct  1    MRPGSTTRST----GYRLWSSPILYIFGGLAAIMVVIAIALIVLACTRRKSSDEDSTLPC  56

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKP  338
               ++P   P D     MEPK +VIM GD+ PT LAKP
Sbjct  57   S-IDRPVIIPLD-----MEPKILVIMAGDYKPTFLAKP  88



>gb|KHN14458.1| hypothetical protein glysoja_029720 [Glycine soja]
Length=127

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 67/102 (66%), Gaps = 2/102 (2%)
 Frame = +3

Query  63   TTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKK--SAGENQDDDADRQE  236
            T+S    +G++ W SPIPYLFGGLA+ML +I++AL+ILVCS +K  S   +   + D++E
Sbjct  9    TSSPVSGSGINIWKSPIPYLFGGLAVMLAIISMALVILVCSYRKRDSQSSSSSSEVDQEE  68

Query  237  KPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDL  362
              +   +  ++   EP+ +VIM G+HNPT LAKP   S + +
Sbjct  69   IKSQAMSKNLETNSEPEVLVIMAGNHNPTYLAKPITSSSSSI  110



>ref|XP_006384232.1| hypothetical protein POPTR_0004s10840g, partial [Populus trichocarpa]
 gb|ERP62029.1| hypothetical protein POPTR_0004s10840g, partial [Populus trichocarpa]
Length=98

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 61/99 (62%), Gaps = 7/99 (7%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MR S++ TST     ++ W SPIPYLFG L ++L +I +ALI L CS  +    +++  +
Sbjct  1    MRASNDPTST-----INLWRSPIPYLFGSLGILLSIIVVALITLACSYYRK--HSRNSSS  53

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
            D QEKPA+ P  +   + EPK VVIM G++ P  LA P 
Sbjct  54   DEQEKPAAIPIRMPVLDAEPKIVVIMAGENKPAYLATPI  92



>ref|XP_009616053.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Nicotiana tomentosiformis]
Length=173

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 58/95 (61%), Gaps = 6/95 (6%)
 Frame = +3

Query  81   PTGLHR--WNSPIPYlfgglalmlglialaliilVCSNKKSAGENQ---DDDADRQEKPA  245
            P G  R  W+SP PYLF G+A MLGLIA AL+IL CS +K +G++Q   D +A   EK A
Sbjct  28   PAGFQRSPWHSPAPYLFAGVAAMLGLIAFALVILACSYRKRSGDDQSQSDIEAGAGEKSA  87

Query  246  STPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
                 VM P  E K VVIM GD NPT LA P   S
Sbjct  88   GDNLKVM-PVFEVKIVVIMAGDLNPTFLATPIYMS  121



>gb|KDP20040.1| hypothetical protein JCGZ_05809 [Jatropha curcas]
Length=106

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 70/103 (68%), Gaps = 10/103 (10%)
 Frame = +3

Query  45   MRPSH--NTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAG--ENQ  212
            MRP+   N+T ++  + L +W+SP+PY+F GL ++LGL+++AL+IL CSN KS+     Q
Sbjct  1    MRPTGRGNSTESSSSSILKQWSSPLPYVFVGLVIILGLMSIALVILACSNYKSSSLLSRQ  60

Query  213  DDDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
             ++ + +E  A+  A      MEPK VVIM GDH+PT +AKP+
Sbjct  61   KEEEEPKETTATVVA------MEPKIVVIMAGDHHPTYVAKPS  97



>ref|XP_009603457.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Nicotiana tomentosiformis]
Length=111

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 52/93 (56%), Gaps = 3/93 (3%)
 Frame = +3

Query  60   NTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEK  239
            +T S+   T L  W SP+PYLFG LAL L LIA+AL+ LVCS +K +     DD      
Sbjct  15   STMSSNGSTSLLHWRSPLPYLFGSLALTLTLIAVALLFLVCSYRKRSSSTATDDEKSAYS  74

Query  240  PASTPADVMKPEMEPKFVVIMPGDHNPTCLAKP  338
               T   V   EM PK VVIM GD  PT LA P
Sbjct  75   DHKTSGSV---EMTPKIVVIMAGDQKPTHLAVP  104



>ref|XP_003551789.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Glycine max]
Length=123

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +3

Query  45   MRPSHNTTSTADP---TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQD  215
            MRP  N+ S + P   +G++ W SPIPYLFGGLA+ML +I++AL+ILVCS +K   ++Q 
Sbjct  1    MRP-INSVSPSSPMRASGVNIWKSPIPYLFGGLAVMLAIISMALVILVCSYRKR--DSQS  57

Query  216  DDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
                 ++  +   A+ ++   EP+ +VIM GDHNPT LAKP   S
Sbjct  58   SSEVNEDVKSQAMANNLETNSEPEVLVIMAGDHNPTYLAKPITSS  102



>ref|XP_010032588.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Eucalyptus grandis]
 gb|KCW52000.1| hypothetical protein EUGRSUZ_J01439 [Eucalyptus grandis]
Length=111

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +3

Query  87   GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSA---GENQD-DDADRQEKPASTP  254
            G H+WN+PIPYLF GLALMLGLIA+AL++L CS++KS+   G ++D +D    +   + P
Sbjct  10   GFHKWNTPIPYLFAGLALMLGLIAVALVVLACSHRKSSASSGLSRDPEDQTGVDSDDNKP  69

Query  255  ADVMKPEMEPKFVVIMPGDHNPTCLAK  335
            + V + +  PK VVIMPG  NPT LAK
Sbjct  70   SKVEQEDNAPKIVVIMPGHENPTFLAK  96



>ref|XP_006845568.1| hypothetical protein AMTR_s00019p00190490 [Amborella trichopoda]
 gb|ERN07243.1| hypothetical protein AMTR_s00019p00190490 [Amborella trichopoda]
Length=141

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP  +  STA       W+SP+PYLFGGLA MLGLIA AL+IL CS  K +G  +  ++
Sbjct  1    MRPDSSFNSTASSAVHSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSGYFESGES  60

Query  225  DRQEKPASTPADVMK--PEMEPKFVVIMPGDHNPTCLAKPT  341
            D  E       + +K  P++E K VVIM GD  PT LAKP 
Sbjct  61   DLAENNGEKQGEPIKGLPDLEDKIVVIMAGDQKPTFLAKPI  101



>ref|XP_002512022.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50691.1| conserved hypothetical protein [Ricinus communis]
Length=88

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 60/91 (66%), Gaps = 9/91 (10%)
 Frame = +3

Query  90   LHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMK  269
            L +WN+P+PY+FGGL L++G +++ALIIL CS+ KS+GE       ++EK   T   V+ 
Sbjct  4    LAQWNTPLPYVFGGLVLIIGFMSVALIILACSHYKSSGE-------KEEKSRRTTDAVV-  55

Query  270  PEMEPKFVVIMPGDHNPTCLAKPTICSRTDL  362
              ME K  VIM GD +PT LAKP+  +R  L
Sbjct  56   -AMETKIAVIMAGDRHPTHLAKPSALTRNSL  85



>ref|NP_001241098.1| uncharacterized protein LOC100797343 [Glycine max]
 gb|ACU21265.1| unknown [Glycine max]
Length=126

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 66/100 (66%), Gaps = 2/100 (2%)
 Frame = +3

Query  63   TTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKK--SAGENQDDDADRQE  236
            T+S    +G++ W SPIPYLFGGLA+ML +I++AL+ILVCS +K  S   +   + D++E
Sbjct  9    TSSPVSGSGINIWKSPIPYLFGGLAVMLAIISMALVILVCSYRKRDSQSSSSSSEVDQEE  68

Query  237  KPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRT  356
              +   +  ++   EP+ +VIM G+HNPT LAKP   S +
Sbjct  69   IKSQAMSKNLETNSEPEVLVIMAGNHNPTYLAKPITSSSS  108



>ref|XP_004491972.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Cicer arietinum]
Length=123

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 6/103 (6%)
 Frame = +3

Query  45   MRPSHNTTSTADPTG-LHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDD  221
            MRP +N +++   T  +  W SPIPYLFG LALML LI+ AL+ILVCS KK     Q  +
Sbjct  1    MRPINNVSTSTTTTNEIKIWKSPIPYLFGSLALMLILISFALVILVCSYKKRGS--QSSN  58

Query  222  ADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
            +  + K  +   ++     EP+ +VIM GDHNPT +AKP I S
Sbjct  59   SSEEIKVINKNIEI---NSEPEILVIMAGDHNPTYIAKPIITS  98



>gb|KHN13786.1| hypothetical protein glysoja_016070 [Glycine soja]
Length=125

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 68/105 (65%), Gaps = 5/105 (5%)
 Frame = +3

Query  45   MRPSHNTTSTADP---TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQD  215
            MRP  N+ S + P   +G++ W SPIPYLFGGLA+ML +I++AL+ILVCS +K   ++  
Sbjct  1    MRP-INSVSPSSPMRASGVNIWKSPIPYLFGGLAVMLAIISMALVILVCSYRKRDSQSSS  59

Query  216  DDADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
             + +   K  +  A  ++   EP+ +VIM G+HNPT LAKP   S
Sbjct  60   SEVNEDVKSQAM-AKNLETNSEPEVLVIMAGNHNPTYLAKPITSS  103



>ref|XP_010100897.1| hypothetical protein L484_009667 [Morus notabilis]
 ref|XP_010113157.1| hypothetical protein L484_000167 [Morus notabilis]
 gb|EXB85821.1| hypothetical protein L484_009667 [Morus notabilis]
 gb|EXC68679.1| hypothetical protein L484_000167 [Morus notabilis]
Length=121

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 56/94 (60%), Gaps = 7/94 (7%)
 Frame = +3

Query  87   GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSA------GENQDDDADRQEKPAS  248
            G   WNSP+PYLFGGLALMLGLI +AL+IL CS +KS+             +   EKPA 
Sbjct  20   GFRHWNSPVPYLFGGLALMLGLITVALVILACSYRKSSPAPTPNSGRGTTSSGELEKPA-  78

Query  249  TPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
               DV     EPK VVIM GD  PT LAKP  CS
Sbjct  79   VQVDVNVGSDEPKIVVIMAGDDKPTYLAKPVACS  112



>ref|XP_009596760.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Nicotiana tomentosiformis]
Length=111

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 48/85 (56%), Gaps = 3/85 (4%)
 Frame = +3

Query  84   TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADV  263
            T L  W SP+PYLFG LAL L LIA+AL+ LVCS +K +     DD         T   V
Sbjct  23   TSLLHWRSPLPYLFGSLALTLTLIAVALLFLVCSYRKRSSSTATDDEKSAYSDHKTSGSV  82

Query  264  MKPEMEPKFVVIMPGDHNPTCLAKP  338
               EM PK VVIM GD  PT LA P
Sbjct  83   ---EMTPKIVVIMAGDQKPTHLAVP  104



>ref|XP_008797569.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Phoenix dactylifera]
Length=110

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 58/90 (64%), Gaps = 8/90 (9%)
 Frame = +3

Query  84   TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADV  263
            TG + W++PIPYLFGGL  M+ LIA+AL++LVCS++     + D D +  EKPA  P D 
Sbjct  10   TGSNLWHTPIPYLFGGLGAMMVLIAVALMVLVCSHRD---PSSDGDPESVEKPAIHPLD-  65

Query  264  MKPEMEPKFVVIMPGDHNPTCLAKPTICSR  353
                MEP+ +VIM GD  PT LAKP    R
Sbjct  66   ----MEPRILVIMAGDDEPTYLAKPISSIR  91



>gb|KDP24335.1| hypothetical protein JCGZ_25631 [Jatropha curcas]
Length=114

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = +3

Query  87   GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVM  266
            G   W+SP+PYLFGGLA MLG+IA+ALIIL CS +KS+  N  D    ++       +++
Sbjct  13   GFWHWSSPMPYLFGGLAFMLGIIAIALIILACSYRKSSLSNSSDRVGEEKSVKQVELEMV  72

Query  267  KPEMEPKFVVIMPGDHNPTCLAKP  338
              + EPK VVIM GDHNPT LA P
Sbjct  73   --DFEPKIVVIMAGDHNPTYLAMP  94



>ref|XP_007139366.1| hypothetical protein PHAVU_008G023400g [Phaseolus vulgaris]
 gb|ESW11360.1| hypothetical protein PHAVU_008G023400g [Phaseolus vulgaris]
Length=141

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 57/86 (66%), Gaps = 1/86 (1%)
 Frame = +3

Query  84   TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA-DRQEKPASTPAD  260
            TG+  W SPIPYLFGGLA+ML L+++AL+ILVCS +K    +    + + ++  +     
Sbjct  19   TGIKIWKSPIPYLFGGLAVMLALVSVALVILVCSYRKRDSSSDSSSSPEAEDMKSQAMTK  78

Query  261  VMKPEMEPKFVVIMPGDHNPTCLAKP  338
            ++    EP+ VVIM GDHNPT LAKP
Sbjct  79   ILHTNSEPEVVVIMAGDHNPTYLAKP  104



>gb|KCW51998.1| hypothetical protein EUGRSUZ_J01437 [Eucalyptus grandis]
Length=98

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 5/91 (5%)
 Frame = +3

Query  69   STADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPAS  248
            +T+  +  H W+SPIPYL+GGLALML LIA+ALIIL CS  K      +D  ++  KPA+
Sbjct  3    ATSSASNTHIWSSPIPYLYGGLALMLILIAVALIILACSYWKRPSNASNDADEKPVKPAT  62

Query  249  TPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
             P D     +EP+ VVIM GD  P  LAKP 
Sbjct  63   PPLD-----LEPRIVVIMAGDKKPKYLAKPV  88



>ref|XP_010034416.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Eucalyptus grandis]
 gb|KCW51999.1| hypothetical protein EUGRSUZ_J01438 [Eucalyptus grandis]
Length=98

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 59/92 (64%), Gaps = 7/92 (8%)
 Frame = +3

Query  69   STADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKK-SAGENQDDDADRQEKPA  245
            +T+  +  H W+SPIPYLFGGLAL L LI  ALIILVCS +K ++GE ++ D ++  K  
Sbjct  3    ATSSMSSTHIWSSPIPYLFGGLALTLILIFTALIILVCSYQKHTSGELREAD-EKLPKAV  61

Query  246  STPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
              P D      EPK VVIM GD  PT +AKP 
Sbjct  62   IIPLDA-----EPKIVVIMAGDDMPTYIAKPV  88



>ref|XP_009407941.1| PREDICTED: protein GLUTAMINE DUMPER 3-like [Musa acuminata subsp. 
malaccensis]
Length=97

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 56/85 (66%), Gaps = 7/85 (8%)
 Frame = +3

Query  99   WNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQ-EKPASTPADVMKPE  275
            W +P+PYLFGGL  M+ LIA+AL++L CS++KSAG+     A    EK    P D     
Sbjct  15   WRTPLPYLFGGLGAMMILIAVALVVLACSHRKSAGDRDSAAASSLPEKVLVAPLD-----  69

Query  276  MEPKFVVIMPGDHNPTCLAKP-TIC  347
            MEP+FVVIM G+  P+ +AKP ++C
Sbjct  70   MEPRFVVIMAGESTPSFIAKPNSLC  94



>ref|XP_010660581.1| PREDICTED: protein GLUTAMINE DUMPER 3-like [Vitis vinifera]
Length=101

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 69/107 (64%), Gaps = 9/107 (8%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+++++S+ +   + RWNSP PYLFGGLAL+LGLI +ALIIL CS+KK    + D D 
Sbjct  1    MRPANSSSSSNE---IWRWNSPFPYLFGGLALILGLIGVALIILSCSHKKRT-PSPDHDK  56

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDLD  365
            D+  K   T     +P+  P+ VVIM GD NPT LA P   S T  D
Sbjct  57   DKPPKTICT-----EPDTVPRVVVIMAGDENPTYLATPVPTSTTASD  98



>ref|XP_010528447.1| PREDICTED: protein GLUTAMINE DUMPER 6 [Tarenaya hassleriana]
Length=115

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 69/114 (61%), Gaps = 12/114 (11%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGE------  206
            MRP+ N T+      ++ WNSP+PYLFGGL+++L LIAL+L +LVCS++ S+        
Sbjct  1    MRPTPNQTAPR----INIWNSPVPYLFGGLSVVLLLIALSLFLLVCSHRISSSSVDNGNT  56

Query  207  NQDDDA-DRQEKPA-STPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTDL  362
            NQ++D  D QE+ A S   D       PK VVI+ GD  P+CLA P +   + +
Sbjct  57   NQNNDGEDVQEREAKSGGGDGFLTAEVPKIVVILAGDAKPSCLAYPVMADSSSI  110



>ref|XP_010929456.1| PREDICTED: protein GLUTAMINE DUMPER 5-like [Elaeis guineensis]
Length=99

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 49/83 (59%), Gaps = 5/83 (6%)
 Frame = +3

Query  90   LHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMK  269
               W+SPIPY+FGGLA M+ LIA+AL  L C  ++S  E+       +  P  TP D   
Sbjct  12   FQLWSSPIPYIFGGLAAMMVLIAVALTALACMRRRSTDEDSTLPCSMEMMPVITPTDT--  69

Query  270  PEMEPKFVVIMPGDHNPTCLAKP  338
               EPK +VIM G++ PT LAKP
Sbjct  70   ---EPKILVIMAGEYKPTFLAKP  89



>ref|XP_009621543.1| PREDICTED: protein GLUTAMINE DUMPER 5-like [Nicotiana tomentosiformis]
Length=102

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 55/96 (57%), Gaps = 3/96 (3%)
 Frame = +3

Query  72   TADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPAST  251
            T   T   +W SP+PYLFGGLAL L LI +AL++L CS  K    +   D   +EK A  
Sbjct  6    TNSTTSFWQWKSPLPYLFGGLALTLALIVVALVLLACSFHKRRLSSAVSD---EEKSAPR  62

Query  252  PADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRTD  359
            P ++   +M P+ +VIM GD  PT +  P I S +D
Sbjct  63   PVNITIEDMSPRIIVIMAGDQKPTHIGVPAISSSSD  98



>gb|EYU44262.1| hypothetical protein MIMGU_mgv1a021848mg, partial [Erythranthe 
guttata]
Length=90

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 52/81 (64%), Gaps = 3/81 (4%)
 Frame = +3

Query  99   WNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMKPEM  278
            WNSP+PYLF GL LML LIA ALIILVCS +K     ++D   +  +P+++ A     + 
Sbjct  6    WNSPLPYLFAGLGLMLLLIATALIILVCSYRKRPSSQEEDGGVKAAQPSASAA---VADN  62

Query  279  EPKFVVIMPGDHNPTCLAKPT  341
             PK VVIM GD NPT LA P 
Sbjct  63   TPKIVVIMAGDDNPTQLAIPI  83



>ref|XP_009386998.1| PREDICTED: protein GLUTAMINE DUMPER 4-like [Musa acuminata subsp. 
malaccensis]
Length=89

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 5/80 (6%)
 Frame = +3

Query  99   WNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMKPEM  278
            W +PIPYLFGGL  M  LIA+AL+IL+CS  KS+     + +   EK  + P+D     M
Sbjct  7    WRTPIPYLFGGLGAMGILIAIALVILLCSTSKSSSGENSELSTLHEKAMAVPSD-----M  61

Query  279  EPKFVVIMPGDHNPTCLAKP  338
            EP+ +V+M GD  PT +A+P
Sbjct  62   EPRILVVMAGDDMPTFVARP  81



>gb|KDP24334.1| hypothetical protein JCGZ_25630 [Jatropha curcas]
Length=103

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = +3

Query  93   HRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVMKP  272
            H W+SP+P+LFGGLA+++ LI+  ++IL CS K S+     +D  +QE PA+     M  
Sbjct  11   HFWHSPMPFLFGGLAIIIALISAVIVILACSRKNSSLNLSSED--QQENPAARLELDMAV  68

Query  273  EMEPKFVVIMPGDHNPTCLAKPTICSRT  356
              EPK VVIM GD+ PT +A P I   T
Sbjct  69   LDEPKIVVIMAGDNLPTYIAMPEITFST  96



>ref|XP_006373516.1| hypothetical protein POPTR_0017s14440g [Populus trichocarpa]
 gb|ERP51313.1| hypothetical protein POPTR_0017s14440g [Populus trichocarpa]
Length=106

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 64/104 (62%), Gaps = 6/104 (6%)
 Frame = +3

Query  45   MRPSHNTTSTADPT--GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDD  218
            MR + N+T+  D T  G   WNSP+ Y F GLA MLGLI +ALIIL CS +KS   +   
Sbjct  1    MRSATNSTAV-DGTHGGFWHWNSPVVYFFVGLAFMLGLITVALIILACSYRKSLSSSSRS  59

Query  219  DADRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICS  350
            DA   EKPA    + ++ ++EPK  VIM GD NPT L KP  C+
Sbjct  60   DAG-DEKPAKH--EEIQVDLEPKIAVIMAGDENPTYLLKPVSCN  100



>ref|XP_006373517.1| hypothetical protein POPTR_0017s14450g [Populus trichocarpa]
 gb|ERP51314.1| hypothetical protein POPTR_0017s14450g [Populus trichocarpa]
Length=88

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 57/98 (58%), Gaps = 11/98 (11%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRPS ++TST     ++ W SP PYLFG L L+L +IA+AL  L CS  +      +   
Sbjct  1    MRPSSDSTST-----INVWRSPTPYLFGSLGLLLAIIAVALTSLACSYYR------NSSG  49

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKP  338
            D++EKPA+    +     EP+ VV+M G+  PT LA P
Sbjct  50   DQEEKPAAMLTSMPVLHAEPEIVVVMAGEDKPTYLAAP  87



>ref|XP_007037711.1| Uncharacterized protein TCM_014438 [Theobroma cacao]
 gb|EOY22212.1| Uncharacterized protein TCM_014438 [Theobroma cacao]
Length=97

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 62/100 (62%), Gaps = 8/100 (8%)
 Frame = +3

Query  60   NTTSTADP-TGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQE  236
            +T+ ++ P  GL  WNSPIPY+FGGL ++ G+IA+AL++L CS ++ + E      D+ +
Sbjct  2    STSGSSTPGRGLLPWNSPIPYVFGGLFIIFGIIAVALLVLACSPQRPSPEFPSGKEDKYK  61

Query  237  KPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPTICSRT  356
            +     A      ++PK VVIM GDH PT +AKP  C R 
Sbjct  62   ERIQASAT-----LQPKIVVIMAGDHLPTYIAKP--CPRI  94



>ref|XP_008782086.1| PREDICTED: protein GLUTAMINE DUMPER 2-like [Phoenix dactylifera]
Length=167

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 58/94 (62%), Gaps = 6/94 (6%)
 Frame = +3

Query  99   WNSPIPYlfgglalmlglialaliilVCSNKKSAG--ENQDDDADRQEKPASTPAD-VMK  269
            W+SP+PYLFGGLA MLGLIA AL+IL CS  K +G  E+ D D + +     T AD   K
Sbjct  26   WHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSGYLESGDGDVENRGGDGKTSADPAAK  85

Query  270  PE--MEPKFVVIMPGDHNPTCLAKPTICSRTDLD  365
            P    EP+ VVIM GD  PT LA P I SR   D
Sbjct  86   PRESFEPRIVVIMAGDEEPTFLATP-ISSRAAAD  118



>ref|XP_006440842.1| hypothetical protein CICLE_v10023021mg [Citrus clementina]
 ref|XP_006485728.1| PREDICTED: protein GLUTAMINE DUMPER 4-like [Citrus sinensis]
 gb|ESR54082.1| hypothetical protein CICLE_v10023021mg [Citrus clementina]
 gb|KDO65618.1| hypothetical protein CISIN_1g034219mg [Citrus sinensis]
Length=101

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 60/99 (61%), Gaps = 8/99 (8%)
 Frame = +3

Query  57   HNTTSTADPTG--LHRWNSPIPYlfgglalmlglialaliilVCSNKKSA--GENQDDDA  224
            H  T    P+G  L +WNSP+PY+FGGL L+ G+IA+AL+ L C + KS+  G +  D  
Sbjct  3    HVATDLTAPSGAGLVQWNSPLPYMFGGLLLVFGVIAVALMFLACCHDKSSITGPSSGDQK  62

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
            D +   A  P       +EPK VVIM GD +PT +A+P+
Sbjct  63   DEKSAEAIDP----PAALEPKIVVIMAGDDHPTRIARPS  97



>ref|XP_010257852.1| PREDICTED: protein GLUTAMINE DUMPER 6-like [Nelumbo nucifera]
Length=108

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 57/85 (67%), Gaps = 5/85 (6%)
 Frame = +3

Query  87   GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVM  266
            G   WNSP+PYLFGG+A  LGLIALAL+IL C+++K +  +  +  ++  KP S P    
Sbjct  17   GFGGWNSPLPYLFGGIAATLGLIALALLILTCTHRKPSTYSSHETEEKTTKPTSPP----  72

Query  267  KPEMEPKFVVIMPGDHNPTCLAKPT  341
             P+ E + VV+MPGD+ PT +AKP 
Sbjct  73   -PDTEYRVVVLMPGDNEPTFIAKPV  96



>ref|XP_004501399.1| PREDICTED: protein GLUTAMINE DUMPER 5-like [Cicer arietinum]
Length=143

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 6/87 (7%)
 Frame = +3

Query  99   WNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDD-----ADRQEKPASTPADV  263
            W+SPIPYLFGGLA MLGLIA AL+IL CS  + +G+ QD++      D Q++  ST  + 
Sbjct  25   WHSPIPYLFGGLAAMLGLIAFALLILACSYWRLSGQLQDEENGNSNMDNQKEGDSTKKES  84

Query  264  MKPEMEPKFVVIMPGDHNPTCLAKPTI  344
            +K   E K +VIM GD NPT LA P  
Sbjct  85   LKV-YEEKILVIMAGDENPTFLATPVF  110



>ref|XP_009412243.1| PREDICTED: protein GLUTAMINE DUMPER 5-like [Musa acuminata subsp. 
malaccensis]
Length=101

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 53/84 (63%), Gaps = 6/84 (7%)
 Frame = +3

Query  87   GLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDADRQEKPASTPADVM  266
            GL  W SP+PYLFGG+A M+ LIA+AL++L C+  KS+ E+        EKP   P    
Sbjct  13   GLQPWRSPLPYLFGGVAAMMCLIAVALLVLACTRHKSSEEDSTPPCT-AEKPVVVPL---  68

Query  267  KPEMEPKFVVIMPGDHNPTCLAKP  338
              EMEP+ VV+M GD  PT +AKP
Sbjct  69   --EMEPRVVVVMAGDDVPTFIAKP  90



>emb|CBI16901.3| unnamed protein product [Vitis vinifera]
Length=119

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 65/99 (66%), Gaps = 10/99 (10%)
 Frame = +3

Query  45   MRPSHNTTSTADPTGLHRWNSPIPYlfgglalmlglialaliilVCSNKKSAGENQDDDA  224
            MRP+++++S+     + RWNS +PYLFGGLAL++GLI +ALIIL CS+KK    + D D 
Sbjct  1    MRPANSSSSSE----IWRWNSLLPYLFGGLALIIGLIVVALIILSCSHKKRT-PSPDHDK  55

Query  225  DRQEKPASTPADVMKPEMEPKFVVIMPGDHNPTCLAKPT  341
            D+  K   T     +P+  P+ VVIM GD NPT LA P 
Sbjct  56   DKPAKTICT-----EPDTLPRVVVIMAGDENPTYLATPV  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1178898346980