BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21749_g1_i5 len=1832 path=[6604:0-88 4366:89-319 @19495@!:320-1664
5953:1665-1831]

Length=1832
                                                                      Score     E

ref|XP_011097048.1|  PREDICTED: uncharacterized protein LOC105176065    528   4e-175   
ref|XP_010091282.1|  hypothetical protein L484_002910                   527   4e-175   
ref|XP_009591310.1|  PREDICTED: uncharacterized protein LOC104088352    516   2e-173   
emb|CBI21629.3|  unnamed protein product                                521   4e-173   
ref|XP_002273364.1|  PREDICTED: uncharacterized protein LOC100262883    522   5e-173   Vitis vinifera
emb|CDP11041.1|  unnamed protein product                                520   2e-172   
ref|XP_002307063.1|  hypothetical protein POPTR_0005s07170g             518   1e-171   Populus trichocarpa [western balsam poplar]
gb|KDP39744.1|  hypothetical protein JCGZ_02764                         518   1e-171   
ref|XP_009789145.1|  PREDICTED: uncharacterized protein LOC104236...    503   2e-171   
ref|XP_004238909.1|  PREDICTED: uncharacterized protein LOC101248774    516   2e-171   
ref|XP_006494507.1|  PREDICTED: uncharacterized protein LOC102609...    509   2e-170   
ref|XP_007213612.1|  hypothetical protein PRUPE_ppa002262mg             514   2e-170   
gb|KDO40638.1|  hypothetical protein CISIN_1g004764mg                   508   3e-170   
gb|EYU35717.1|  hypothetical protein MIMGU_mgv1a002542mg                511   7e-170   
gb|KDO40636.1|  hypothetical protein CISIN_1g004764mg                   509   4e-169   
ref|XP_008442210.1|  PREDICTED: uncharacterized protein LOC103486...    509   6e-168   
ref|XP_008442209.1|  PREDICTED: uncharacterized protein LOC103486...    509   6e-168   
ref|XP_008225871.1|  PREDICTED: uncharacterized protein LOC103325482    508   7e-168   
ref|XP_006344156.1|  PREDICTED: uncharacterized protein LOC102584245    507   8e-168   
gb|KCW54116.1|  hypothetical protein EUGRSUZ_I00094                     501   1e-167   
ref|XP_006494506.1|  PREDICTED: uncharacterized protein LOC102609...    508   1e-167   
gb|KDO40637.1|  hypothetical protein CISIN_1g004764mg                   508   1e-167   
ref|XP_011031087.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    506   4e-167   
ref|XP_004167205.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    506   4e-167   
gb|KGN54855.1|  hypothetical protein Csa_4G552160                       506   5e-167   
ref|XP_002522916.1|  conserved hypothetical protein                     506   6e-167   Ricinus communis
ref|XP_006431780.1|  hypothetical protein CICLE_v10000418mg             504   2e-166   
ref|XP_010030296.1|  PREDICTED: uncharacterized protein LOC104420091    499   3e-166   
ref|XP_009789144.1|  PREDICTED: uncharacterized protein LOC104236...    489   1e-165   
ref|XP_007048561.1|  Uncharacterized protein isoform 1                  499   4e-164   
ref|XP_010243863.1|  PREDICTED: uncharacterized protein LOC104587826    497   1e-163   
ref|XP_010027529.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    495   9e-163   
ref|XP_008371907.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    494   4e-162   
ref|XP_004295499.1|  PREDICTED: uncharacterized protein LOC101306028    493   5e-162   
ref|XP_007159891.1|  hypothetical protein PHAVU_002G276400g             485   2e-161   
gb|KHG05990.1|  RNA-directed RNA polymerase catalytic subunit           477   2e-161   
ref|XP_007137739.1|  hypothetical protein PHAVU_009G151900g             486   2e-159   
ref|XP_007159892.1|  hypothetical protein PHAVU_002G276400g             484   8e-159   
ref|XP_010674380.1|  PREDICTED: uncharacterized protein LOC104890548    484   2e-158   
ref|XP_003532367.1|  PREDICTED: uncharacterized protein LOC100785172    484   2e-158   
ref|XP_003525141.1|  PREDICTED: uncharacterized protein LOC100797103    483   5e-158   
ref|XP_008785881.1|  PREDICTED: uncharacterized protein LOC103704...    474   1e-156   
ref|XP_003528072.1|  PREDICTED: uncharacterized protein LOC100777483    479   2e-156   
ref|XP_004503887.1|  PREDICTED: uncharacterized protein LOC101501...    474   2e-156   
ref|XP_010547690.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    478   4e-156   
ref|XP_003630366.1|  cyclase/dehydrase family protein                   476   3e-155   
gb|AET04842.2|  polyketide cyclase/dehydrase and lipid transporter      474   2e-154   
ref|XP_004503886.1|  PREDICTED: uncharacterized protein LOC101501...    473   3e-154   
ref|XP_008785879.1|  PREDICTED: uncharacterized protein LOC103704...    473   4e-154   
ref|XP_010912051.1|  PREDICTED: uncharacterized protein LOC105038057    473   4e-154   
ref|NP_680157.1|  uncharacterized protein                               469   7e-153   Arabidopsis thaliana [mouse-ear cress]
gb|KFK25241.1|  hypothetical protein AALP_AA8G086200                    469   8e-153   
ref|XP_002873379.1|  hypothetical protein ARALYDRAFT_487714             467   5e-152   
emb|CDX69927.1|  BnaA10g22760D                                          467   6e-152   
emb|CDY21561.1|  BnaC09g47310D                                          466   1e-151   
ref|XP_009122491.1|  PREDICTED: uncharacterized protein LOC103847185    466   2e-151   
tpg|DAA52389.1|  TPA: hypothetical protein ZEAMMB73_348604              453   4e-151   
ref|XP_009404991.1|  PREDICTED: uncharacterized protein LOC103988...    461   5e-151   
ref|XP_006286366.1|  hypothetical protein CARUB_v10000329mg             464   7e-151   
ref|XP_009404990.1|  PREDICTED: uncharacterized protein LOC103988...    460   4e-149   
ref|XP_010491527.1|  PREDICTED: uncharacterized protein LOC104769093    459   8e-149   
ref|XP_010452890.1|  PREDICTED: uncharacterized protein LOC104734906    459   1e-148   
ref|XP_010423027.1|  PREDICTED: uncharacterized protein LOC104708207    454   5e-147   
ref|XP_002466133.1|  hypothetical protein SORBIDRAFT_01g001990          454   9e-147   Sorghum bicolor [broomcorn]
gb|KHN31201.1|  Trafficking protein particle complex subunit 2          457   2e-146   
ref|XP_004981125.1|  PREDICTED: uncharacterized protein LOC101782...    453   2e-146   
ref|XP_008666956.1|  PREDICTED: uncharacterized protein LOC103645724    453   2e-146   
ref|XP_004981126.1|  PREDICTED: uncharacterized protein LOC101782...    452   2e-146   
gb|EEE60262.1|  hypothetical protein OsJ_13288                          446   5e-144   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001051834.1|  Os03g0837900                                       446   8e-144   Oryza sativa Japonica Group [Japonica rice]
gb|EEC76487.1|  hypothetical protein OsI_14236                          446   1e-143   Oryza sativa Indica Group [Indian rice]
ref|XP_006651999.1|  PREDICTED: uncharacterized protein LOC102700516    441   2e-143   
gb|AAO41142.1|  unknown protein                                         446   4e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010237659.1|  PREDICTED: uncharacterized protein LOC100844...    444   4e-143   
ref|XP_010237590.1|  PREDICTED: uncharacterized protein LOC100844...    444   6e-143   
dbj|BAJ93672.1|  predicted protein                                      440   1e-141   
gb|EMT15446.1|  hypothetical protein F775_09633                         435   2e-141   
tpg|DAA52388.1|  TPA: hypothetical protein ZEAMMB73_348604              439   4e-141   
gb|EMS52767.1|  hypothetical protein TRIUR3_14190                       433   1e-140   
ref|XP_006399383.1|  hypothetical protein EUTSA_v10015845mg             412   1e-130   
ref|XP_008785880.1|  PREDICTED: uncharacterized protein LOC103704...    384   6e-121   
gb|KDP43698.1|  hypothetical protein JCGZ_25147                         348   2e-112   
ref|XP_007048564.1|  Uncharacterized protein isoform 4                  349   1e-107   
gb|KEH20935.1|  polyketide cyclase/dehydrase and lipid transporter      341   4e-104   
ref|XP_001783746.1|  predicted protein                                  331   2e-100   
ref|XP_006847046.1|  hypothetical protein AMTR_s00017p00186340          324   3e-99    
gb|KCW54072.1|  hypothetical protein EUGRSUZ_I00052                     317   3e-95    
ref|XP_002987615.1|  hypothetical protein SELMODRAFT_126454             300   9e-89    
ref|XP_002983334.1|  hypothetical protein SELMODRAFT_117904             300   1e-88    
gb|EPS57842.1|  hypothetical protein M569_16974                         262   9e-81    
gb|ABF99782.1|  Streptomyces cyclase/dehydrase family protein, ex...    181   4e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005645071.1|  hypothetical protein COCSUDRAFT_18573              168   2e-41    
ref|XP_009607357.1|  PREDICTED: uncharacterized protein At4g08330...    150   1e-38    
ref|XP_009607356.1|  PREDICTED: uncharacterized protein At4g08330...    149   3e-38    
ref|XP_010922547.1|  PREDICTED: uncharacterized protein At4g08330...    142   3e-36    
ref|XP_008805528.1|  PREDICTED: uncharacterized protein At4g08330...    140   2e-35    
ref|XP_004144699.1|  PREDICTED: uncharacterized protein LOC101212159    148   2e-35    
ref|XP_004240856.1|  PREDICTED: uncharacterized protein At4g08330...    140   4e-35    
ref|XP_011086373.1|  PREDICTED: uncharacterized protein At4g08330...    139   5e-35    
ref|XP_010242793.1|  PREDICTED: uncharacterized protein At4g08330...    139   6e-35    
gb|EPS70619.1|  hypothetical protein M569_04139                         143   3e-34    
ref|XP_002272466.1|  PREDICTED: uncharacterized protein At4g08330...    137   3e-34    Vitis vinifera
ref|XP_010920870.1|  PREDICTED: uncharacterized protein At4g08330...    136   4e-34    
ref|XP_011069531.1|  PREDICTED: uncharacterized protein At4g08330...    136   1e-33    
ref|XP_010692412.1|  PREDICTED: uncharacterized protein At4g08330...    135   1e-33    
ref|XP_002513762.1|  conserved hypothetical protein                     136   2e-33    Ricinus communis
ref|XP_011069530.1|  PREDICTED: uncharacterized protein At4g08330...    135   3e-33    
gb|KHG01816.1|  hypothetical protein F383_23265                         133   1e-32    
ref|XP_010243861.1|  PREDICTED: uncharacterized protein At4g08330...    133   2e-32    
ref|XP_007019072.1|  Uncharacterized protein TCM_035118                 132   4e-32    
ref|XP_004498340.1|  PREDICTED: uncharacterized protein At4g08330...    131   7e-32    
ref|XP_008793333.1|  PREDICTED: uncharacterized protein At4g08330...    130   7e-32    
ref|XP_002306286.1|  hypothetical protein POPTR_0005s07160g             131   8e-32    Populus trichocarpa [western balsam poplar]
gb|KHG21709.1|  hypothetical protein F383_26824                         130   1e-31    
ref|XP_008444153.1|  PREDICTED: uncharacterized protein At4g08330...    130   1e-31    
ref|XP_004161170.1|  PREDICTED: uncharacterized protein At4g08330...    130   1e-31    
gb|KDP32801.1|  hypothetical protein JCGZ_12093                         129   4e-31    
ref|XP_011027530.1|  PREDICTED: uncharacterized protein At4g08330...    129   5e-31    
ref|XP_006397309.1|  hypothetical protein EUTSA_v10029030mg             127   1e-30    
ref|XP_010530201.1|  PREDICTED: uncharacterized protein At4g08330...    127   2e-30    
gb|ACD56614.1|  predicted protein                                       129   2e-30    Gossypioides kirkii
ref|XP_010544791.1|  PREDICTED: uncharacterized protein At4g08330...    127   3e-30    
ref|XP_006434194.1|  hypothetical protein CICLE_v10002808mg             125   3e-30    
gb|KEH40531.1|  hypothetical protein MTR_1g030060                       125   4e-30    
ref|XP_006472780.1|  PREDICTED: uncharacterized protein At4g08330...    126   5e-30    
ref|XP_009410608.1|  PREDICTED: uncharacterized protein At4g08330...    125   5e-30    
ref|XP_010436454.1|  PREDICTED: uncharacterized protein At4g08330...    126   5e-30    
ref|XP_002874529.1|  hypothetical protein ARALYDRAFT_489746             125   7e-30    
ref|NP_192573.1|  uncharacterized protein                               125   7e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009765797.1|  PREDICTED: uncharacterized protein At4g08330...    125   1e-29    
ref|XP_009348666.1|  PREDICTED: uncharacterized protein At4g08330...    125   1e-29    
gb|EYU22971.1|  hypothetical protein MIMGU_mgv1a015375mg                124   2e-29    
gb|KFK32143.1|  hypothetical protein AALP_AA6G203800                    124   2e-29    
ref|XP_003542997.1|  PREDICTED: uncharacterized protein At4g08330...    124   3e-29    
ref|XP_009609607.1|  PREDICTED: uncharacterized protein At4g08330...    124   3e-29    
ref|XP_007141028.1|  hypothetical protein PHAVU_008G161200g             124   3e-29    
ref|XP_002300988.2|  hypothetical protein POPTR_0002s08420g             124   4e-29    Populus trichocarpa [western balsam poplar]
ref|XP_010999387.1|  PREDICTED: uncharacterized protein At4g08330...    124   4e-29    
gb|KHN25208.1|  Hypothetical protein glysoja_030455                     122   4e-29    
ref|XP_003544689.1|  PREDICTED: uncharacterized protein At4g08330...    123   5e-29    
ref|XP_006367804.1|  PREDICTED: uncharacterized protein At4g08330...    123   6e-29    
ref|XP_010421743.1|  PREDICTED: uncharacterized protein At4g08330...    123   6e-29    
ref|XP_002307435.2|  hypothetical protein POPTR_0005s20030g             123   6e-29    Populus trichocarpa [western balsam poplar]
ref|XP_009124771.1|  PREDICTED: uncharacterized protein At4g08330...    122   9e-29    
ref|XP_002285856.1|  PREDICTED: uncharacterized protein At4g08330...    122   9e-29    Vitis vinifera
ref|XP_006288812.1|  hypothetical protein CARUB_v10002147mg             122   1e-28    
ref|NP_001055787.1|  Os05g0466700                                       122   1e-28    Oryza sativa Japonica Group [Japonica rice]
gb|ACU20615.1|  unknown                                                 122   1e-28    Glycine max [soybeans]
ref|XP_003568271.1|  PREDICTED: uncharacterized protein At4g08330...    121   2e-28    
ref|XP_008219643.1|  PREDICTED: uncharacterized protein At4g08330...    122   2e-28    
ref|XP_007223618.1|  hypothetical protein PRUPE_ppa012569mg             122   2e-28    
ref|XP_008338775.1|  PREDICTED: uncharacterized protein At4g08330...    122   2e-28    
ref|XP_008378473.1|  PREDICTED: uncharacterized protein At4g08330...    122   2e-28    
ref|NP_001044712.1|  Os01g0833400                                       121   3e-28    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010455255.1|  PREDICTED: uncharacterized protein At4g08330...    121   3e-28    
gb|ACU24223.1|  unknown                                                 120   4e-28    Glycine max [soybeans]
ref|XP_010320097.1|  PREDICTED: uncharacterized protein At4g08330...    120   4e-28    
ref|XP_010674381.1|  PREDICTED: uncharacterized protein At4g08330...    120   5e-28    
ref|XP_010063967.1|  PREDICTED: uncharacterized protein At4g08330...    120   5e-28    
emb|CDP10909.1|  unnamed protein product                                120   6e-28    
ref|XP_006644960.1|  PREDICTED: uncharacterized protein At4g08330...    120   9e-28    
ref|XP_002441240.1|  hypothetical protein SORBIDRAFT_09g022930          119   1e-27    Sorghum bicolor [broomcorn]
emb|CDY53431.1|  BnaCnng25110D                                          119   1e-27    
ref|XP_005849540.1|  hypothetical protein CHLNCDRAFT_57236              128   1e-27    
ref|XP_010099760.1|  hypothetical protein L484_010946                   119   2e-27    
ref|XP_010106361.1|  hypothetical protein L484_004389                   118   3e-27    
ref|XP_004290870.1|  PREDICTED: uncharacterized protein At4g08330...    118   4e-27    
ref|XP_004970464.1|  PREDICTED: uncharacterized protein At4g08330...    117   7e-27    
gb|EMT12310.1|  hypothetical protein F775_14044                         116   2e-26    
ref|XP_006654525.1|  PREDICTED: uncharacterized protein At4g08330...    115   3e-26    
gb|AFW78310.1|  hypothetical protein ZEAMMB73_684979                    119   4e-26    
ref|XP_009402377.1|  PREDICTED: uncharacterized protein At4g08330...    115   8e-26    
gb|AFK48244.1|  unknown                                                 114   1e-25    
ref|NP_001144678.1|  uncharacterized protein LOC100277705               111   1e-24    Zea mays [maize]
ref|NP_001190689.1|  uncharacterized protein                            110   2e-24    
emb|CDP07990.1|  unnamed protein product                              93.2    2e-24    
ref|XP_004961796.1|  PREDICTED: uncharacterized protein At4g08330...    110   2e-24    
ref|XP_003602030.1|  hypothetical protein MTR_3g088030                  110   3e-24    
ref|NP_001145404.1|  uncharacterized protein LOC100278761               109   5e-24    Zea mays [maize]
ref|XP_008654761.1|  PREDICTED: uncharacterized protein LOC100278...    107   3e-23    
ref|XP_002456589.1|  hypothetical protein SORBIDRAFT_03g038930          106   8e-23    Sorghum bicolor [broomcorn]
ref|XP_008654762.1|  PREDICTED: uncharacterized protein LOC100278...    105   1e-22    
gb|AFW84678.1|  hypothetical protein ZEAMMB73_646060                    107   1e-22    
ref|XP_003564544.2|  PREDICTED: uncharacterized protein At4g08330...    106   4e-22    
ref|XP_004502467.1|  PREDICTED: uncharacterized protein At4g08330...    103   1e-21    
gb|KHN16927.1|  Hypothetical protein glysoja_003024                     102   2e-21    
ref|NP_001235338.1|  uncharacterized protein LOC100527641               101   3e-21    
ref|XP_007159890.1|  hypothetical protein PHAVU_002G276300g             101   3e-21    
ref|XP_006858776.1|  hypothetical protein AMTR_s00066p00155040        98.6    1e-20    
ref|XP_003074385.1|  unnamed protein product                            105   3e-20    
emb|CEF96689.1|  Streptomyces cyclase/dehydrase                         105   3e-20    
gb|EYU43129.1|  hypothetical protein MIMGU_mgv1a015366mg              98.2    5e-20    
ref|XP_003526632.1|  PREDICTED: uncharacterized protein At4g08330...  97.8    8e-20    
ref|XP_007137412.1|  hypothetical protein PHAVU_009G125000g           96.7    2e-19    
ref|XP_003524318.2|  PREDICTED: uncharacterized protein At4g08330...  95.5    2e-19    
ref|XP_006580352.1|  PREDICTED: uncharacterized protein At4g08330...  94.7    4e-19    
ref|XP_001415547.1|  predicted protein                                  100   1e-18    Ostreococcus lucimarinus CCE9901
ref|XP_002524580.1|  conserved hypothetical protein                   91.7    4e-18    Ricinus communis
ref|XP_006469372.1|  PREDICTED: uncharacterized protein At4g08330...  91.7    4e-18    
ref|XP_004978949.1|  PREDICTED: uncharacterized protein At4g08330...  89.0    3e-17    
ref|XP_008800694.1|  PREDICTED: uncharacterized protein At4g08330...  88.6    5e-17    
ref|NP_001144168.1|  uncharacterized protein LOC100277023             88.2    7e-17    Zea mays [maize]
gb|EEE51938.1|  hypothetical protein OsJ_33565                        88.2    7e-17    Oryza sativa Japonica Group [Japonica rice]
gb|EEC67970.1|  hypothetical protein OsI_35724                        88.2    8e-17    Oryza sativa Indica Group [Indian rice]
ref|XP_008235921.1|  PREDICTED: uncharacterized protein At4g08330...  87.8    9e-17    
ref|XP_002450522.1|  hypothetical protein SORBIDRAFT_05g006540        87.4    1e-16    Sorghum bicolor [broomcorn]
ref|XP_002970576.1|  hypothetical protein SELMODRAFT_441180           89.0    2e-16    
ref|XP_002968415.1|  hypothetical protein SELMODRAFT_409213           89.0    2e-16    
ref|XP_009358929.1|  PREDICTED: uncharacterized protein At4g08330...  85.9    5e-16    
gb|EMS47664.1|  hypothetical protein TRIUR3_22304                     90.1    7e-16    
ref|XP_008372679.1|  PREDICTED: uncharacterized protein At4g08330...  85.1    8e-16    
ref|XP_003630365.1|  hypothetical protein MTR_8g094790                85.5    1e-15    
ref|XP_004510741.1|  PREDICTED: uncharacterized protein At4g08330...  84.7    1e-15    
ref|XP_008382532.1|  PREDICTED: uncharacterized protein At4g08330...  84.7    1e-15    
gb|KFM27012.1|  hypothetical protein F751_1148                        90.1    2e-15    
ref|XP_002320553.2|  hypothetical protein POPTR_0014s17240g           87.4    2e-15    Populus trichocarpa [western balsam poplar]
ref|XP_006583257.1|  PREDICTED: uncharacterized protein At4g08330...  84.0    2e-15    
ref|XP_010090747.1|  hypothetical protein L484_013769                 89.0    3e-15    
ref|XP_010037071.1|  PREDICTED: uncharacterized protein At4g08330...  82.8    4e-15    
ref|XP_004960368.1|  PREDICTED: uncharacterized protein At4g08330...  81.6    2e-14    
ref|XP_010037070.1|  PREDICTED: uncharacterized protein At4g08330...  80.9    2e-14    
gb|EPS70954.1|  hypothetical protein M569_03805                       80.9    2e-14    
ref|XP_010037069.1|  PREDICTED: uncharacterized protein At4g08330...  80.9    3e-14    
dbj|BAJ97862.1|  predicted protein                                    81.3    4e-14    
gb|EMS47605.1|  hypothetical protein TRIUR3_05498                     81.3    4e-14    
ref|XP_010069558.1|  PREDICTED: uncharacterized protein At4g08330...  80.5    8e-14    
gb|EMT11708.1|  hypothetical protein F775_43284                       80.1    8e-14    
ref|XP_005538744.1|  hypothetical protein, conserved                  82.8    4e-13    
ref|XP_010547916.1|  PREDICTED: uncharacterized protein At4g08330...  75.5    3e-12    
ref|WP_015211581.1|  Putative ATPase subunit of terminase (gpP-like)  79.0    4e-12    
ref|XP_010037072.1|  PREDICTED: uncharacterized protein At4g08330...  72.8    7e-12    
ref|XP_002440515.1|  hypothetical protein SORBIDRAFT_09g002300        72.8    2e-11    Sorghum bicolor [broomcorn]
ref|XP_005538092.1|  hypothetical protein, conserved                  70.5    5e-10    
gb|KHN47024.1|  Hypothetical protein glysoja_018391                   68.2    6e-10    
ref|XP_010544805.1|  PREDICTED: uncharacterized protein At4g08330...  68.2    7e-10    
ref|XP_003566665.1|  PREDICTED: uncharacterized protein At4g08330...  65.1    1e-08    
ref|WP_036535875.1|  cyclase                                          63.9    4e-08    
ref|XP_008656527.1|  PREDICTED: uncharacterized protein At4g08330...  62.8    6e-08    
gb|ACG23989.1|  hypothetical protein                                  62.8    6e-08    Zea mays [maize]
emb|CDP11047.1|  unnamed protein product                              64.3    7e-08    
ref|XP_005705352.1|  hypothetical protein isoform 2                   65.9    7e-08    
ref|XP_005705353.1|  hypothetical protein isoform 1                   65.9    7e-08    
ref|WP_019492691.1|  hypothetical protein                             62.4    1e-07    
gb|AGT15916.1|  cyclase/dehydrase family protein                      63.2    1e-07    
gb|AFW82753.1|  hypothetical protein ZEAMMB73_019077                  62.0    1e-07    
ref|WP_015156436.1|  cyclase/dehydrase                                62.0    1e-07    
ref|WP_039714602.1|  cyclase                                          62.0    1e-07    
ref|NP_001142862.1|  uncharacterized protein LOC100275257             61.2    2e-07    Zea mays [maize]
ref|XP_007511700.1|  predicted protein                                64.3    2e-07    
ref|WP_015122294.1|  oligoketide cyclase/lipid transport protein      61.2    3e-07    
ref|XP_010557735.1|  PREDICTED: uncharacterized protein At4g08330...  60.1    3e-07    
ref|WP_015200696.1|  cyclase/dehydrase                                61.2    3e-07    
ref|XP_005705810.1|  hypothetical protein Gasu_32980                  63.5    3e-07    
ref|XP_002988783.1|  hypothetical protein SELMODRAFT_229401           60.1    3e-07    
ref|WP_015208354.1|  oligoketide cyclase/lipid transport protein      60.8    4e-07    
gb|EMT06933.1|  hypothetical protein F775_02631                       63.2    4e-07    
ref|WP_012161090.1|  cyclase                                          60.5    4e-07    
ref|WP_010473402.1|  cyclase                                          59.7    6e-07    
ref|XP_005711929.1|  unnamed protein product                          60.8    7e-07    
ref|XP_009397997.1|  PREDICTED: uncharacterized protein LOC103982723  58.9    8e-07    
ref|WP_026723014.1|  cyclase                                          59.7    9e-07    
ref|WP_015224862.1|  cyclase/dehydrase                                59.3    9e-07    
ref|WP_036264855.1|  cyclase                                          58.9    2e-06    
ref|WP_039724690.1|  hypothetical protein                             58.2    2e-06    
ref|XP_006387515.1|  hypothetical protein POPTR_0908s00200g           56.6    3e-06    
ref|WP_026072866.1|  cyclase                                          58.2    3e-06    
ref|WP_016861715.1|  cyclase                                          57.8    3e-06    
ref|XP_005707416.1|  cyclase/dehydrase                                58.9    3e-06    
ref|WP_026733466.1|  cyclase                                          57.8    4e-06    
ref|WP_020480010.1|  hypothetical protein                             57.4    4e-06    
ref|WP_009453715.1|  MULTISPECIES: cyclase                            57.0    5e-06    
ref|XP_006471195.1|  PREDICTED: uncharacterized protein LOC102626164  58.9    6e-06    
tpg|DAA43234.1|  TPA: hypothetical protein ZEAMMB73_494522            56.2    7e-06    
ref|WP_008233404.1|  cyclase/dehydrase-like protein                   56.6    9e-06    
ref|WP_016865378.1|  cyclase                                          55.8    1e-05    
ref|WP_017313316.1|  cyclase                                          55.8    1e-05    
ref|WP_015189755.1|  cyclase/dehydrase                                55.5    2e-05    
ref|WP_026087589.1|  cyclase                                          55.5    2e-05    
ref|XP_006828843.1|  hypothetical protein AMTR_s00001p00151920        54.7    2e-05    
ref|WP_012409309.1|  cyclase                                          55.5    2e-05    
ref|WP_027269087.1|  cyclase                                          55.1    2e-05    
ref|WP_011434033.1|  cyclase                                          55.1    2e-05    
ref|NP_001143478.1|  uncharacterized protein LOC100276150             54.3    3e-05    
ref|XP_004985794.1|  PREDICTED: uncharacterized protein LOC101760551  54.3    3e-05    
ref|WP_010995026.1|  cyclase                                          55.1    3e-05    
emb|CDY20809.1|  BnaC07g06580D                                        53.9    4e-05    
ref|WP_035154665.1|  cyclase                                          54.3    4e-05    
ref|WP_035996884.1|  cyclase                                          54.3    4e-05    
ref|WP_006195714.1|  cyclase                                          54.3    4e-05    
ref|WP_011321129.1|  cyclase                                          53.9    6e-05    
ref|WP_035985750.1|  cyclase                                          53.9    7e-05    
ref|XP_006649358.1|  PREDICTED: uncharacterized protein LOC102714711  52.8    9e-05    
ref|XP_001756113.1|  predicted protein                                54.7    9e-05    
ref|NP_001142833.1|  uncharacterized protein LOC100275223             52.8    1e-04    
ref|WP_017315079.1|  hypothetical protein                             53.1    1e-04    
ref|XP_003562125.1|  PREDICTED: uncharacterized protein At4g08330...  52.8    1e-04    
ref|WP_015230758.1|  oligoketide cyclase/lipid transport protein      52.8    1e-04    
ref|WP_015113798.1|  cyclase/dehydrase                                53.1    1e-04    
ref|XP_005645828.1|  hypothetical protein COCSUDRAFT_48336            55.5    1e-04    
ref|WP_015139137.1|  oligoketide cyclase/lipid transport protein      52.8    1e-04    
ref|XP_009400374.1|  PREDICTED: uncharacterized protein LOC103984578  52.0    2e-04    
ref|XP_010532934.1|  PREDICTED: uncharacterized protein At4g08330...  51.6    2e-04    
ref|XP_002278070.1|  PREDICTED: uncharacterized protein LOC100250649  51.6    2e-04    
ref|XP_010266905.1|  PREDICTED: uncharacterized protein LOC104604307  51.6    2e-04    
ref|WP_029638733.1|  cyclase [                                        52.4    2e-04    
ref|XP_009763038.1|  PREDICTED: uncharacterized protein LOC104215003  54.3    2e-04    
ref|XP_009344823.1|  PREDICTED: uncharacterized protein LOC103936697  51.6    2e-04    
ref|XP_008393727.1|  PREDICTED: uncharacterized protein At4g08330...  51.6    2e-04    
ref|WP_006517232.1|  oligoketide cyclase/lipid transport protein      52.0    2e-04    
emb|CBI24450.3|  unnamed protein product                              51.2    3e-04    
ref|XP_008344222.1|  PREDICTED: uncharacterized protein At4g08330...  51.2    3e-04    
ref|XP_002468554.1|  hypothetical protein SORBIDRAFT_01g047900        51.2    3e-04    
ref|XP_004512181.1|  PREDICTED: uncharacterized protein At4g08330...  50.8    3e-04    
ref|WP_010932224.1|  hypothetical protein                             52.8    4e-04    
ref|XP_009121092.1|  PREDICTED: uncharacterized protein LOC103845930  50.8    4e-04    
ref|XP_011022253.1|  PREDICTED: uncharacterized protein LOC105124083  50.8    4e-04    
emb|CDY24362.1|  BnaA07g02870D                                        50.8    4e-04    
ref|WP_036054482.1|  cyclase                                          51.2    4e-04    
gb|ESA33528.1|  cyclase dehydrase                                     51.2    4e-04    
ref|XP_002504864.1|  predicted protein                                53.5    5e-04    
ref|WP_011431546.1|  cyclase                                          51.2    5e-04    
gb|EAY88451.1|  hypothetical protein OsI_09916                        50.4    5e-04    
gb|ABF93857.1|  expressed protein                                     50.4    5e-04    
ref|XP_010239472.1|  PREDICTED: uncharacterized protein At4g08330...  50.4    5e-04    
ref|XP_001757989.1|  predicted protein                                51.6    6e-04    
ref|XP_002884077.1|  protein-methionine-s-oxide reductase             50.1    6e-04    
ref|WP_028082836.1|  cyclase                                          50.4    7e-04    
ref|WP_028090322.1|  cyclase                                          50.4    7e-04    
ref|WP_039747471.1|  cyclase                                          50.4    7e-04    
ref|XP_006383038.1|  hypothetical protein POPTR_0005s10950g           50.1    8e-04    
ref|NP_849966.2|  uncharacterized protein                             49.7    8e-04    
ref|XP_006467026.1|  PREDICTED: uncharacterized protein At4g08330...  49.7    8e-04    
ref|XP_004169176.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  49.7    8e-04    
gb|AIE85825.1|  hypothetical protein OP10G_2457                       52.8    8e-04    
ref|XP_008448515.1|  PREDICTED: uncharacterized protein At4g08330...  49.7    8e-04    
ref|XP_004146165.1|  PREDICTED: uncharacterized protein At4g08330...  49.7    9e-04    
gb|KDP23950.1|  hypothetical protein JCGZ_25338                       49.7    0.001    
ref|XP_001768742.1|  predicted protein                                50.1    0.001    



>ref|XP_011097048.1| PREDICTED: uncharacterized protein LOC105176065 [Sesamum indicum]
Length=743

 Score =   528 bits (1359),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 259/341 (76%), Positives = 289/341 (85%), Gaps = 12/341 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EI FEQVEGDFD+F+GKWILE+LGSHHTLL
Sbjct  408   VRILQEGCKGLLYMVLHARVVLDLCEHLEKEIRFEQVEGDFDAFRGKWILEKLGSHHTLL  467

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKMH+N FLSEAIMEEVIYEDLPSNLCAIRDY+E++E+E  + T    +Y +   
Sbjct  468   KYSVESKMHRNCFLSEAIMEEVIYEDLPSNLCAIRDYVEKIESEIHQDTHNNDSYAQT--  525

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                     S+ + S     SD ++S S RQRPKVPGLQRDIE+L++ELL FISEHGQEGF
Sbjct  526   --ASSSYGSSYNFSMEANDSDCISSSS-RQRPKVPGLQRDIEVLKSELLNFISEHGQEGF  582

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLRKHGRVDIEKAITRMGGFRRIA LMNLSLAYK+RKPKGYWDNLENLQ+EI+RF
Sbjct  583   MPMRKQLRKHGRVDIEKAITRMGGFRRIASLMNLSLAYKNRKPKGYWDNLENLQEEINRF  642

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QR+WGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ +  KEKK
Sbjct  643   QRNWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQAALAKEKK  702

Query  978   FD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
              D      VN +EKTP + YVSQD  KWL KLK+ DINWVE
Sbjct  703   VDYPISNNVNAQEKTPSKTYVSQDTQKWLMKLKDFDINWVE  743


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILE-QLGS  242
            +++ Q G +  LY  + ARV+LDL E    + + E+ F  V+GDF  F+GKW ++ + GS
Sbjct  160  IWLEQRGLQRALYWHIEARVVLDLQEFPNSENDRELHFSMVDGDFKKFEGKWTVQSRKGS  219

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
              T L Y V      N       +E +I  DLP NL A+
Sbjct  220  RTTSLGYEVNVIPRFN--FPAIFLERIIGSDLPVNLQAL  256



>ref|XP_010091282.1| hypothetical protein L484_002910 [Morus notabilis]
 gb|EXB44218.1| hypothetical protein L484_002910 [Morus notabilis]
Length=737

 Score =   527 bits (1358),  Expect = 4e-175, Method: Compositional matrix adjust.
 Identities = 261/343 (76%), Positives = 288/343 (84%), Gaps = 10/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE+ E+EISFEQVEGDFDSF+GKW+LEQLGSHHTLL
Sbjct  396   VRILQEGCKGLLYMVLHARVVLDLCERHEQEISFEQVEGDFDSFEGKWLLEQLGSHHTLL  455

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKMHK++FLSEAIMEEVIYEDLPSNLCAIRDY+E+ EA+++    +   Y E EI
Sbjct  456   KYTVESKMHKDTFLSEAIMEEVIYEDLPSNLCAIRDYVEKREADHSSVQCDQRIYMEGEI  515

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               + D D   D  +   E SDS    S RQRP+VPGLQRDIEIL++ELL FISEHGQEGF
Sbjct  516   -TSSDLDSDEDFDTAAYEISDSACQSSSRQRPRVPGLQRDIEILKSELLKFISEHGQEGF  574

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENLQ+EISRF
Sbjct  575   MPMRKQLRLHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDNLENLQEEISRF  634

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPS+MPSRK+FERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP+  +EKK
Sbjct  635   QRSWGMDPSFMPSRKTFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPNVAREKK  694

Query  978   FDV--------NGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
              D           E +TP   Y+SQD  KWL+KLK LD NWVE
Sbjct  695   ADNVSQTSVEDQNETETPSNPYISQDTQKWLSKLKHLDTNWVE  737



>ref|XP_009591310.1| PREDICTED: uncharacterized protein LOC104088352 [Nicotiana tomentosiformis]
Length=548

 Score =   516 bits (1330),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/340 (77%), Positives = 281/340 (83%), Gaps = 8/340 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E IE+EISFEQVEGDFDSFQGKWILEQLGSHHTLL
Sbjct  211   VRILQEGCKGLLYMVLHARVVLDLSEHIEQEISFEQVEGDFDSFQGKWILEQLGSHHTLL  270

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENA-EKTQEYVTYGEAE  434
             KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRD+IE+ E E   EK         + 
Sbjct  271   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDHIEKRETEKPLEKFNHDACREASV  330

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
                  D  +  D   P  + SDS +  S R+RPKVPGLQRDIE+L+AELL FISEHGQEG
Sbjct  331   SSSIKDSSVYYDR--PAAQNSDSCSLYSPRRRPKVPGLQRDIEVLKAELLAFISEHGQEG  388

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWD+LENLQ+EIS 
Sbjct  389   FMPMRKQLRNHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDSLENLQEEISC  448

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ +WGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ +  KE 
Sbjct  449   FQTNWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQANLAKET  508

Query  975   KF-----DVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             K      DVN E  + + +V+QDA KWL KLK+LDINWVE
Sbjct  509   KVEVLANDVNCETTSSKPFVAQDAQKWLMKLKDLDINWVE  548



>emb|CBI21629.3| unnamed protein product [Vitis vinifera]
Length=712

 Score =   521 bits (1343),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 256/343 (75%), Positives = 287/343 (84%), Gaps = 10/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDLCE++E+EISF QVEGDFDSFQGKWILEQLG+ HTLL
Sbjct  371   VRILQEGCKGLLYMVLHARAVLDLCEQLEQEISFVQVEGDFDSFQGKWILEQLGNQHTLL  430

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAE-  434
             KY+VESKMH++SFLSEAIMEEVIYEDLPSNLCAIRDYIE+ EA N+ +T +YV Y E + 
Sbjct  431   KYTVESKMHRDSFLSEAIMEEVIYEDLPSNLCAIRDYIEKREASNSLETSDYVRYSEEQF  490

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             I  +  +D+      P +E SD       RQRP+VPGLQR+IE+L+AELL FI EHGQEG
Sbjct  491   ISSSNGRDVDYHP-KPADEVSDVSGPNPLRQRPRVPGLQRNIEVLKAELLKFILEHGQEG  549

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLRKHGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENL++EI+R
Sbjct  550   FMPMRKQLRKHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDNLENLKEEITR  609

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQRSWGMDPSYMPSRK+FERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP+  K K
Sbjct  610   FQRSWGMDPSYMPSRKTFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPNLTKHK  669

Query  975   KFD--------VNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             + D        V+ +  T + YV QDA KWL  L+ LDINWVE
Sbjct  670   RSDFVASPDMVVDEDRTTSKPYVPQDAQKWLMSLQHLDINWVE  712


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 69/149 (46%), Gaps = 8/149 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E      + E+ F  V+GDF  F+GKW L + G  
Sbjct  146  IWLEQRGFQRALYWHIEARVVLDLQEVPNAANDRELRFSMVDGDFKKFEGKWSL-KYGKR  204

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             +    S E  +          +E +I  DLP NL A+    E+    N +      + G
Sbjct  205  SSTTSLSYEVNVIPRFNFPAIFLERIIRSDLPVNLQALACRSEKNFEGNQKIPFIESSLG  264

Query  426  EAEIKITPDKDLSADSISPYEETSDSVNS  512
             A I    DK  ++ S  P  ++S  ++S
Sbjct  265  TASIA---DKSHASSSFDPLFQSSSELSS  290



>ref|XP_002273364.1| PREDICTED: uncharacterized protein LOC100262883 [Vitis vinifera]
Length=735

 Score =   522 bits (1344),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 256/343 (75%), Positives = 287/343 (84%), Gaps = 10/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDLCE++E+EISF QVEGDFDSFQGKWILEQLG+ HTLL
Sbjct  394   VRILQEGCKGLLYMVLHARAVLDLCEQLEQEISFVQVEGDFDSFQGKWILEQLGNQHTLL  453

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAE-  434
             KY+VESKMH++SFLSEAIMEEVIYEDLPSNLCAIRDYIE+ EA N+ +T +YV Y E + 
Sbjct  454   KYTVESKMHRDSFLSEAIMEEVIYEDLPSNLCAIRDYIEKREASNSLETSDYVRYSEEQF  513

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             I  +  +D+      P +E SD       RQRP+VPGLQR+IE+L+AELL FI EHGQEG
Sbjct  514   ISSSNGRDVDYHP-KPADEVSDVSGPNPLRQRPRVPGLQRNIEVLKAELLKFILEHGQEG  572

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLRKHGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENL++EI+R
Sbjct  573   FMPMRKQLRKHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDNLENLKEEITR  632

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQRSWGMDPSYMPSRK+FERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP+  K K
Sbjct  633   FQRSWGMDPSYMPSRKTFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPNLTKHK  692

Query  975   KFD--------VNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             + D        V+ +  T + YV QDA KWL  L+ LDINWVE
Sbjct  693   RSDFVASPDMVVDEDRTTSKPYVPQDAQKWLMSLQHLDINWVE  735


 Score = 56.2 bits (134),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 71/167 (43%), Gaps = 5/167 (3%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E      + E+ F  V+GDF  F+GKW L + G  
Sbjct  146  IWLEQRGFQRALYWHIEARVVLDLQEVPNAANDRELRFSMVDGDFKKFEGKWSL-KYGKR  204

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             +    S E  +          +E +I  DLP NL A+    E+    N +      + G
Sbjct  205  SSTTSLSYEVNVIPRFNFPAIFLERIIRSDLPVNLQALACRSEKNFEGNQKIPFIESSLG  264

Query  426  EAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEI  566
             A I    +  +  D     E+ S  V  +SH      P  Q   E+
Sbjct  265  TASIADVANPGIDLDGALSVEKLSPGVFKKSHASSSFDPLFQSSSEL  311



>emb|CDP11041.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   520 bits (1340),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 252/337 (75%), Positives = 284/337 (84%), Gaps = 4/337 (1%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARVILDLCE +E+EISF+QVEGDFDSF+GKW LEQLG+HHTLL
Sbjct  392   VRILQEGCKGLLYMVLHARVILDLCEVLEQEISFKQVEGDFDSFRGKWSLEQLGNHHTLL  451

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM KNSFLSEAIMEEVIYEDLPSNLCAIRDYIE   AEN  K  +Y  Y   E+
Sbjct  452   KYTVESKMRKNSFLSEAIMEEVIYEDLPSNLCAIRDYIETKVAENTSKAFDYSAYTN-EL  510

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +   + +A +  P  +   S  S+S RQRPKVPGLQRDIE+L++EL  FI+EHGQEGF
Sbjct  511   FASSSNENAASNDEPANQNLSSTASDSSRQRPKVPGLQRDIEVLKSELFTFIAEHGQEGF  570

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR+HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENLQ+EIS F
Sbjct  571   MPMRKQLRRHGRVDIEKAITRMGGFRRIAALMNLSLAYKHRKPKGYWDNLENLQEEISWF  630

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SW MDPS+MPSRK+FE+AGR+DIARALEKWGGLHEVSRLLSLKVRHPNRQ S  KE+K
Sbjct  631   QKSWRMDPSFMPSRKAFEQAGRFDIARALEKWGGLHEVSRLLSLKVRHPNRQASLAKERK  690

Query  978   FDV---NGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
              +V   N ++   + YVSQ+  KWLTK+KE DINWVE
Sbjct  691   MEVLAPNEDQAPSKPYVSQNTQKWLTKVKEFDINWVE  727



>ref|XP_002307063.1| hypothetical protein POPTR_0005s07170g [Populus trichocarpa]
 gb|EEE94059.1| hypothetical protein POPTR_0005s07170g [Populus trichocarpa]
Length=727

 Score =   518 bits (1335),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 255/340 (75%), Positives = 291/340 (86%), Gaps = 8/340 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSFQGKWILEQLGSHHTLL
Sbjct  390   VRILQEGCKGLLYMVLHARVVLDLCEHLEQEISFEQVEGDFDSFQGKWILEQLGSHHTLL  449

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESK H+++FLSEAIMEEVIYEDLPSNLCAIRDYIE+ E+ N+ +T+E+  Y + E+
Sbjct  450   KYNVESKTHRDTFLSEAIMEEVIYEDLPSNLCAIRDYIEKRESNNSSETEEHGQYSK-EL  508

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +        S++  ++ SD  N  S +QRP+VPGLQRDI++L++ELL FISEHGQEGF
Sbjct  509   DSSRGDSYHEHSMA-VQQVSDVSNPNSLKQRPRVPGLQRDIDVLKSELLKFISEHGQEGF  567

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENLQ+EISRF
Sbjct  568   MPMRKQLRLHGRVDIEKAITRMGGFRRIATLMNLSLAYKHRKPKGYWDNLENLQEEISRF  627

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMD S+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+LKVRHPNRQ +  K++K
Sbjct  628   QRSWGMDLSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALKVRHPNRQANSIKDRK  687

Query  978   F-----DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                   D  GE+K P +AYVSQD  KWL K K+LDINWV+
Sbjct  688   IDDVSTDAEGEDKIPTKAYVSQDTQKWLMKFKDLDINWVD  727


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            V++ Q G +  LY  + ARV+LDL E        E+ F  V+GDF  F+GKW L   G+ 
Sbjct  144  VWLEQRGLQRALYWHIEARVVLDLQEFPHSANNRELHFSMVDGDFKKFEGKWSLRS-GTR  202

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKT  404
            H     S E  +          +E +I  DLP NL A+    ER + E  +KT
Sbjct  203  HGTTTLSYEVNVMPRYNFPAIFLERIIGSDLPVNLRALACRAER-DFEGNQKT  254



>gb|KDP39744.1| hypothetical protein JCGZ_02764 [Jatropha curcas]
Length=723

 Score =   518 bits (1334),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 256/339 (76%), Positives = 285/339 (84%), Gaps = 11/339 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +++EISFEQVEGDFDSFQGKW+LEQLGSHHTLL
Sbjct  391   VRILQEGCKGLLYMVLHARVVLDLCEHLQQEISFEQVEGDFDSFQGKWLLEQLGSHHTLL  450

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKMHK+  LSEAIMEEVIYEDLPSNLCAIRDYIE+ EA N+ +  E   Y +   
Sbjct  451   KYSVESKMHKDLILSEAIMEEVIYEDLPSNLCAIRDYIEQQEAANSMEIHELKQYSQ---  507

Query  438   KITPDKDLSADSISPYEETSDSV----NSESHRQRPKVPGLQRDIEILRAELLGFISEHG  605
             KI   +    D  + Y   ++ V    N +S RQRP+VPGLQ+DIEIL++ELL FISEHG
Sbjct  508   KI---ESTHGDGDTKYRRATERVIVSNNPDSLRQRPRVPGLQKDIEILKSELLKFISEHG  564

Query  606   QEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDE  785
             QEGFMPMRKQLRKHGRVDIEKAITRMGGFR+IA LMNLSLAYK RKPKGYWDNLENLQ+E
Sbjct  565   QEGFMPMRKQLRKHGRVDIEKAITRMGGFRKIASLMNLSLAYKRRKPKGYWDNLENLQEE  624

Query  786   ISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFG  965
             ISRFQR+WGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLS+KVRHPNRQ +  
Sbjct  625   ISRFQRNWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSIKVRHPNRQANVT  684

Query  966   KEKKFDVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K+KK  V GEE +P +  V QD  KW+ KL +LDINWVE
Sbjct  685   KDKKLSVQGEETSPSKTSVPQDTQKWIEKLNDLDINWVE  723



>ref|XP_009789145.1| PREDICTED: uncharacterized protein LOC104236830 isoform X2 [Nicotiana 
sylvestris]
Length=325

 Score =   503 bits (1294),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 251/326 (77%), Positives = 273/326 (84%), Gaps = 6/326 (2%)
 Frame = +3

Query  117   MVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF  296
             MVLHARV+LDL E IE+EISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF
Sbjct  1     MVLHARVVLDLSEHIEQEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF  60

Query  297   LSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIKITPDKDLSADSI  476
             LSEAIMEEVIYEDLPSNLCAIRD+IE+ E E   +   +    EA +  +  KD      
Sbjct  61    LSEAIMEEVIYEDLPSNLCAIRDHIEKRETEKPLEKINHDACREASVS-SSIKDSYVYYD  119

Query  477   SPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRV  656
              P  + SDS +  S R+RPKVPGLQRDIE+L+AELL FISEHGQEGFMPMRKQLR HGRV
Sbjct  120   RPAAQNSDSCSLYSPRRRPKVPGLQRDIEVLKAELLDFISEHGQEGFMPMRKQLRNHGRV  179

Query  657   DIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPS  836
             DIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWD+LENLQ+EISRFQ +WGMDPSYMPS
Sbjct  180   DIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDSLENLQEEISRFQTNWGMDPSYMPS  239

Query  837   RKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKKF-----DVNGEEK  1001
             RKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ +  KE K      DVNGE  
Sbjct  240   RKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQANLAKETKVEVLANDVNGETM  299

Query  1002  TPRAYVSQDAHKWLTKLKELDINWVE  1079
             + + +V+QDA KWL KLK+LDINWVE
Sbjct  300   SSKPFVAQDAQKWLMKLKDLDINWVE  325



>ref|XP_004238909.1| PREDICTED: uncharacterized protein LOC101248774 [Solanum lycopersicum]
Length=700

 Score =   516 bits (1330),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 265/339 (78%), Positives = 287/339 (85%), Gaps = 6/339 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E IE+EISFEQVEGDFDSF+GKWILEQLGSHHTLL
Sbjct  363   VRILQEGCKGLLYMVLHARVVLDLSELIEQEISFEQVEGDFDSFEGKWILEQLGSHHTLL  422

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIE  E E   +   +  + EA +
Sbjct  423   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIEERETEKPLEKFNHDEFREASV  482

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +  KD S        + SDS +  S RQRPKVPGLQRDIE+L+AELL FISEHGQEGF
Sbjct  483   SSS-MKDSSVHYDRQAGQNSDSSSLHSPRQRPKVPGLQRDIEVLKAELLDFISEHGQEGF  541

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLRKHGRVDIEKAITRMGGFRRI+ LMNLSLAYKHRKPKGYWD+LENLQ+EISRF
Sbjct  542   MPMRKQLRKHGRVDIEKAITRMGGFRRISSLMNLSLAYKHRKPKGYWDSLENLQEEISRF  601

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMD SYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ SF KEKK
Sbjct  602   QKNWGMDLSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQASFAKEKK  661

Query  978   F-----DVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                   DVN E  + + +V+QDA KWL KLK+LDINWVE
Sbjct  662   VELLANDVNCETTSSKPFVAQDAKKWLMKLKDLDINWVE  700


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 10/118 (8%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E I+     E+ F  V+GDF  F+GKW + ++G+ 
Sbjct  126  IWLEQRGIQRSLYWHIEARVVLDLQEFIKSDNVRELHFSMVDGDFKKFEGKWSV-RVGTR  184

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVT  419
             +    S E  +          +E +I  DLP NL A+        AEN+ +  + VT
Sbjct  185  SSTAILSYEVSVIPRFNFPAIFLERIIRSDLPVNLQAL-----SCRAENSYQGYQNVT  237



>ref|XP_006494507.1| PREDICTED: uncharacterized protein LOC102609844 isoform X2 [Citrus 
sinensis]
Length=554

 Score =   509 bits (1310),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 285/344 (83%), Gaps = 10/344 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++D+CE+ E+EISFEQVEGDFDSFQGKW+ EQLGSHHTLL
Sbjct  211   VRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLL  270

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN--AEKTQEYVTYGEA  431
             KYSVESKM KNS LSEAIMEEVIYEDLPSNLCAIRDY+E+ E +N  A  + E   + ++
Sbjct  271   KYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREGDNSLANDSVETTNHTQS  330

Query  432   EIKITPDKD-LSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
                +T   D L A S S  E+  DS    S +QRP+VPGLQ +IE+L+AELL FIS+HGQ
Sbjct  331   SDDLTQSSDELGASSSSDNEDLVDSETPNSFKQRPRVPGLQTNIEVLKAELLEFISKHGQ  390

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             EGFMPMRKQLRKHGRVD+EKAITRMGGFRR+A LMNL+LAYKHRKPKGYWDNLENL++EI
Sbjct  391   EGFMPMRKQLRKHGRVDVEKAITRMGGFRRMASLMNLALAYKHRKPKGYWDNLENLEEEI  450

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
             SRFQRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR+    K
Sbjct  451   SRFQRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRRAHIIK  510

Query  969   EKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +KK D      +  E K P + YVSQD  KW  KLK+LDINWVE
Sbjct  511   DKKVDYVDPANLECEGKIPSKPYVSQDTQKWAMKLKDLDINWVE  554



>ref|XP_007213612.1| hypothetical protein PRUPE_ppa002262mg [Prunus persica]
 gb|EMJ14811.1| hypothetical protein PRUPE_ppa002262mg [Prunus persica]
Length=694

 Score =   514 bits (1323),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 251/341 (74%), Positives = 284/341 (83%), Gaps = 8/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDSF+GKW+ EQLGSHHTLL
Sbjct  355   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSFRGKWVFEQLGSHHTLL  414

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKM +++FLSEAIMEEVIYEDLPSNLC IRDY+E+ EA ++ K  +   Y E E 
Sbjct  415   KYSVESKMRRDTFLSEAIMEEVIYEDLPSNLCTIRDYVEKREAAHSMKACDESIYRE-EQ  473

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +   D   +S    +  SD+    S RQRP+VPGLQRDIE+L++ELL FISEHGQEGF
Sbjct  474   TASSSTDRDDESCITVDRLSDTNAQSSSRQRPRVPGLQRDIEVLKSELLKFISEHGQEGF  533

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT MGGFRRIA LMNLSLAYKHRKPKGYWDNL+NLQ+EI+RF
Sbjct  534   MPMRKQLRLHGRVDIEKAITHMGGFRRIATLMNLSLAYKHRKPKGYWDNLDNLQEEINRF  593

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP+  ++ K
Sbjct  594   QRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPNLARDVK  653

Query  978   F------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                    DV GE+  P   YVSQD  KW+++LK LDINWVE
Sbjct  654   LDYVVSTDVEGEKVAPSNPYVSQDTQKWISELKHLDINWVE  694



>gb|KDO40638.1| hypothetical protein CISIN_1g004764mg [Citrus sinensis]
Length=554

 Score =   508 bits (1309),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 285/344 (83%), Gaps = 10/344 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++D+CE+ E+EISFEQVEGDFDSFQGKW+ EQLGSHHTLL
Sbjct  211   VRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLL  270

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN--AEKTQEYVTYGEA  431
             KYSVESKM KNS LSEAIMEEVIYEDLPSNLCAIRDY+E+ E +N  A  + E   + ++
Sbjct  271   KYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREGDNSLANDSVETTNHTQS  330

Query  432   EIKITPDKD-LSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
                +T   D L A S S  E+  DS    S +QRP+VPGLQ +IE+L+AELL FIS+HGQ
Sbjct  331   SDDLTQSSDELGASSSSDNEDLVDSETPNSFKQRPRVPGLQTNIEVLKAELLEFISKHGQ  390

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             EGFMPMRKQLRKHGRVD+EKAITRMGGFRR+A LMNL+LAYKHRKPKGYWDNLENL++EI
Sbjct  391   EGFMPMRKQLRKHGRVDVEKAITRMGGFRRMASLMNLALAYKHRKPKGYWDNLENLEEEI  450

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
             SRFQRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR+    K
Sbjct  451   SRFQRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRRAHIIK  510

Query  969   EKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +KK D      +  E K P + YVSQD  KW  KLK+LDINWVE
Sbjct  511   DKKVDYVDPANLECEGKIPSKPYVSQDTQKWAMKLKDLDINWVE  554



>gb|EYU35717.1| hypothetical protein MIMGU_mgv1a002542mg [Erythranthe guttata]
Length=661

 Score =   511 bits (1316),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 257/345 (74%), Positives = 284/345 (82%), Gaps = 22/345 (6%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EI FEQVEGDFDSF+GKWILE+ GSHHTLL
Sbjct  328   VRILQEGCKGLLYMVLHARVVLDLCEDLEQEIRFEQVEGDFDSFRGKWILEKFGSHHTLL  387

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDY+E+ E EN +             
Sbjct  388   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYMEKREIENRQDND----------  437

Query  438   KITPDKDL----SADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHG  605
                 DKD     SA+S+S   + S  V+S S +QRPKVPGLQRDIEIL++EL+ FISEHG
Sbjct  438   SCAADKDTASSKSANSLSTEAKDSYCVSSSS-KQRPKVPGLQRDIEILKSELVNFISEHG  496

Query  606   QEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDE  785
             Q+GFMPMRKQLR+HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENL++E
Sbjct  497   QQGFMPMRKQLREHGRVDIEKAITRMGGFRRIALLMNLSLAYKHRKPKGYWDNLENLEEE  556

Query  786   ISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFG  965
             I+RFQR+WGMD S+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ    
Sbjct  557   INRFQRNWGMDSSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQGGLS  616

Query  966   KEKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             KEKK D      + G+E  P + YVSQD  KW  +LKE DINWVE
Sbjct  617   KEKKVDFVVSHSIIGQENIPSKTYVSQDTQKWQMQLKEFDINWVE  661



>gb|KDO40636.1| hypothetical protein CISIN_1g004764mg [Citrus sinensis]
Length=663

 Score =   509 bits (1311),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 285/344 (83%), Gaps = 10/344 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++D+CE+ E+EISFEQVEGDFDSFQGKW+ EQLGSHHTLL
Sbjct  320   VRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLL  379

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN--AEKTQEYVTYGEA  431
             KYSVESKM KNS LSEAIMEEVIYEDLPSNLCAIRDY+E+ E +N  A  + E   + ++
Sbjct  380   KYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREGDNSLANDSVETTNHTQS  439

Query  432   EIKITPDKD-LSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
                +T   D L A S S  E+  DS    S +QRP+VPGLQ +IE+L+AELL FIS+HGQ
Sbjct  440   SDDLTQSSDELGASSSSDNEDLVDSETPNSFKQRPRVPGLQTNIEVLKAELLEFISKHGQ  499

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             EGFMPMRKQLRKHGRVD+EKAITRMGGFRR+A LMNL+LAYKHRKPKGYWDNLENL++EI
Sbjct  500   EGFMPMRKQLRKHGRVDVEKAITRMGGFRRMASLMNLALAYKHRKPKGYWDNLENLEEEI  559

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
             SRFQRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR+    K
Sbjct  560   SRFQRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRRAHIIK  619

Query  969   EKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +KK D      +  E K P + YVSQD  KW  KLK+LDINWVE
Sbjct  620   DKKVDYVDPANLECEGKIPSKPYVSQDTQKWAMKLKDLDINWVE  663



>ref|XP_008442210.1| PREDICTED: uncharacterized protein LOC103486131 isoform X2 [Cucumis 
melo]
Length=730

 Score =   509 bits (1310),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 252/342 (74%), Positives = 283/342 (83%), Gaps = 11/342 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDS  GKW  EQLGSHHTLL
Sbjct  392   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSLSGKWHFEQLGSHHTLL  451

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVES+MHK++FLSEA+MEEV+YEDLPSNLCAIRD IE+   +N   + E +  G  E 
Sbjct  452   KYSVESRMHKDTFLSEALMEEVVYEDLPSNLCAIRDSIEKRGLKN---SFEVLYQGNLEE  508

Query  438   KITPDKDLSADSISPYEETSDSVNSE-SHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             K  P +   ++  +   E   ++N   S R RPKVPGLQRDIE+L+AE+L FISEHGQEG
Sbjct  509   KSVPRQCNQSNGYTTTAEGVSAINGRASFRPRPKVPGLQRDIEVLKAEVLKFISEHGQEG  568

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWD  +NLQ+EI+R
Sbjct  569   FMPMRKQLRMHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDKFDNLQEEINR  628

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ+SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF K++
Sbjct  629   FQKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFAKDR  688

Query  975   KF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K       DV+GE K P + Y+SQD  KWLT LK LDINWVE
Sbjct  689   KSDYVVANDVDGESKAPSKPYISQDTEKWLTGLKYLDINWVE  730


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 51/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E +      E+ F  V+GDF  F+GKW I     S
Sbjct  150  IWLEQRGLQRALYWHIEARVVLDLQEHLNSDGSRELLFSMVDGDFKKFEGKWSIKAGTRS  209

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
              T+L Y V      N      ++E +I  DLP NL A+
Sbjct  210  SPTMLSYEVNVIPRFN--FPAILLERIIRSDLPVNLRAL  246



>ref|XP_008442209.1| PREDICTED: uncharacterized protein LOC103486131 isoform X1 [Cucumis 
melo]
Length=731

 Score =   509 bits (1310),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 252/342 (74%), Positives = 283/342 (83%), Gaps = 11/342 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDS  GKW  EQLGSHHTLL
Sbjct  393   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSLSGKWHFEQLGSHHTLL  452

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVES+MHK++FLSEA+MEEV+YEDLPSNLCAIRD IE+   +N   + E +  G  E 
Sbjct  453   KYSVESRMHKDTFLSEALMEEVVYEDLPSNLCAIRDSIEKRGLKN---SFEVLYQGNLEE  509

Query  438   KITPDKDLSADSISPYEETSDSVNSE-SHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             K  P +   ++  +   E   ++N   S R RPKVPGLQRDIE+L+AE+L FISEHGQEG
Sbjct  510   KSVPRQCNQSNGYTTTAEGVSAINGRASFRPRPKVPGLQRDIEVLKAEVLKFISEHGQEG  569

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWD  +NLQ+EI+R
Sbjct  570   FMPMRKQLRMHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDKFDNLQEEINR  629

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ+SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF K++
Sbjct  630   FQKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFAKDR  689

Query  975   KF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K       DV+GE K P + Y+SQD  KWLT LK LDINWVE
Sbjct  690   KSDYVVANDVDGESKAPSKPYISQDTEKWLTGLKYLDINWVE  731


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 8/100 (8%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILE--QLG  239
            +++ Q G +  LY  + ARV+LDL E +      E+ F  V+GDF  F+GKW ++     
Sbjct  150  IWLEQRGLQRALYWHIEARVVLDLQEHLNSDGSRELLFSMVDGDFKKFEGKWSIKAGTRS  209

Query  240  SHHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
            S  T+L Y V      N      ++E +I  DLP NL A+
Sbjct  210  SSPTMLSYEVNVIPRFN--FPAILLERIIRSDLPVNLRAL  247



>ref|XP_008225871.1| PREDICTED: uncharacterized protein LOC103325482 [Prunus mume]
Length=735

 Score =   508 bits (1309),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 248/341 (73%), Positives = 283/341 (83%), Gaps = 8/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDSF+GKW+ EQLGSHHTLL
Sbjct  396   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSFRGKWVFEQLGSHHTLL  455

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKM K++FLSEAIMEEVIYEDLPSNLC IRDY+E+ EA ++ K  +   + E E 
Sbjct  456   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLCTIRDYVEKREAAHSMKACDESIFRE-EQ  514

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +   D   +S    +  S++    S RQRP+VPGLQRDIE+L++ELL FISEHGQEGF
Sbjct  515   TASSSTDRDDESCIAVDRLSETNAQSSSRQRPRVPGLQRDIEVLKSELLKFISEHGQEGF  574

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT MGGFRRIA LMNLSLAYKHRKPKGYWDNL+ LQ+EI+RF
Sbjct  575   MPMRKQLRLHGRVDIEKAITHMGGFRRIATLMNLSLAYKHRKPKGYWDNLDTLQEEINRF  634

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP+  ++  
Sbjct  635   QRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPNLARDVN  694

Query  978   F------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                    DV+GE+  P   YVSQD  KW+++LK LDINWVE
Sbjct  695   LDYVVSTDVDGEKVAPSNPYVSQDTQKWISELKHLDINWVE  735



>ref|XP_006344156.1| PREDICTED: uncharacterized protein LOC102584245 [Solanum tuberosum]
Length=706

 Score =   507 bits (1306),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 260/344 (76%), Positives = 283/344 (82%), Gaps = 16/344 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E I +EISFEQVEGDFDSF+GKWILEQLGSHHTLL
Sbjct  369   VRILQEGCKGLLYMVLHARVVLDLSELIVQEISFEQVEGDFDSFEGKWILEQLGSHHTLL  428

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIE  E E   +   +  + EA +
Sbjct  429   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIEERETEKPLEKFNHDEFREASV  488

Query  438   KITPDK-----DLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEH  602
               +        D  A       + SDS +  S RQRPKVPGLQRDIE+L+AELL FISEH
Sbjct  489   SSSMKDSSVYYDRQAG------QNSDSSSLHSPRQRPKVPGLQRDIEVLKAELLAFISEH  542

Query  603   GQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQD  782
             GQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRI+ LMNLSLAYKHRKPKGYWD+LENLQ+
Sbjct  543   GQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRISSLMNLSLAYKHRKPKGYWDSLENLQE  602

Query  783   EISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF  962
             EISRFQ++WGMD SYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ + 
Sbjct  603   EISRFQKNWGMDLSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQANL  662

Query  963   GKEKK-----FDVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
              KEKK      DV+ E    + +V+QDA KWL KLK+LDINWVE
Sbjct  663   AKEKKGELLANDVSCETTLSKPFVAQDAKKWLMKLKDLDINWVE  706


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 60/118 (51%), Gaps = 10/118 (8%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E I+     E+ F  V+GDF  F+GKW + ++G+ 
Sbjct  126  IWLEQRGIQRSLYWHIEARVVLDLQEFIKSNNVRELHFSMVDGDFKKFEGKWSV-RVGTR  184

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVT  419
             +    S E  +          +E +I  DLP NL A+        AEN+ +  + VT
Sbjct  185  SSTAILSYEVSVIPRFNFPAIFLERIIRSDLPVNLQAL-----SCRAENSYQGYQSVT  237



>gb|KCW54116.1| hypothetical protein EUGRSUZ_I00094 [Eucalyptus grandis]
Length=535

 Score =   501 bits (1290),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 248/341 (73%), Positives = 279/341 (82%), Gaps = 8/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E EI+F+QVEGDFDSFQGKWI EQLG+ HTLL
Sbjct  196   VRILQEGCKGLLYMVLHARVVLDLCEHLEREITFQQVEGDFDSFQGKWIFEQLGNQHTLL  255

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKMHK+SFLSEAIMEEVIYEDLPSNLCAIRDYIE  +A  A+      +   +E 
Sbjct  256   KYTVESKMHKDSFLSEAIMEEVIYEDLPSNLCAIRDYIENRDATAADSETISESGLSSEQ  315

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +P  D S   +S   E   + + +   QRP+VPGLQRDIE+L+AEL+ FISEHGQEGF
Sbjct  316   TASPSMDEST-CVSATTEDISNYDDDLSSQRPRVPGLQRDIEVLKAELVKFISEHGQEGF  374

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LM+LSLAYK RKPKGYWDNLENL++EI RF
Sbjct  375   MPMRKQLRLHGRVDIEKAITRMGGFRRIASLMDLSLAYKRRKPKGYWDNLENLEEEIRRF  434

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMD SYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP   K+K+
Sbjct  435   QRSWGMDLSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPGLAKDKR  494

Query  978   ------FDVNGEEK-TPRAYVSQDAHKWLTKLKELDINWVE  1079
                    DV  E++ T + Y+SQD  KWL++LK LDINWVE
Sbjct  495   ADPVAATDVEVEDRSTSKPYISQDTQKWLSQLKHLDINWVE  535



>ref|XP_006494506.1| PREDICTED: uncharacterized protein LOC102609844 isoform X1 [Citrus 
sinensis]
Length=735

 Score =   508 bits (1307),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 285/344 (83%), Gaps = 10/344 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++D+CE+ E+EISFEQVEGDFDSFQGKW+ EQLGSHHTLL
Sbjct  392   VRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLL  451

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN--AEKTQEYVTYGEA  431
             KYSVESKM KNS LSEAIMEEVIYEDLPSNLCAIRDY+E+ E +N  A  + E   + ++
Sbjct  452   KYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREGDNSLANDSVETTNHTQS  511

Query  432   EIKITPDKD-LSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
                +T   D L A S S  E+  DS    S +QRP+VPGLQ +IE+L+AELL FIS+HGQ
Sbjct  512   SDDLTQSSDELGASSSSDNEDLVDSETPNSFKQRPRVPGLQTNIEVLKAELLEFISKHGQ  571

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             EGFMPMRKQLRKHGRVD+EKAITRMGGFRR+A LMNL+LAYKHRKPKGYWDNLENL++EI
Sbjct  572   EGFMPMRKQLRKHGRVDVEKAITRMGGFRRMASLMNLALAYKHRKPKGYWDNLENLEEEI  631

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
             SRFQRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR+    K
Sbjct  632   SRFQRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRRAHIIK  691

Query  969   EKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +KK D      +  E K P + YVSQD  KW  KLK+LDINWVE
Sbjct  692   DKKVDYVDPANLECEGKIPSKPYVSQDTQKWAMKLKDLDINWVE  735


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 5/139 (4%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E I    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  143  IWLEQRGLQRALYWHIEARVVLDLQELIHSASDRELYFSMVDGDFKKFEGKWSIKS-GTR  201

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             +    S E  +          +E +I  DLP NL A+    ER    N +      ++G
Sbjct  202  SSTTTLSYEVNVIPRLNFPAIFLERIIRSDLPVNLQALACRAERSFGWNQKIPMIKNSFG  261

Query  426  EAEIKITPDKDLSADSISP  482
            E  + I     L  D   P
Sbjct  262  ELSLPILASPSLDFDGGLP  280



>gb|KDO40637.1| hypothetical protein CISIN_1g004764mg [Citrus sinensis]
Length=732

 Score =   508 bits (1307),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/344 (73%), Positives = 285/344 (83%), Gaps = 10/344 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++D+CE+ E+EISFEQVEGDFDSFQGKW+ EQLGSHHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN--AEKTQEYVTYGEA  431
             KYSVESKM KNS LSEAIMEEVIYEDLPSNLCAIRDY+E+ E +N  A  + E   + ++
Sbjct  449   KYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREGDNSLANDSVETTNHTQS  508

Query  432   EIKITPDKD-LSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
                +T   D L A S S  E+  DS    S +QRP+VPGLQ +IE+L+AELL FIS+HGQ
Sbjct  509   SDDLTQSSDELGASSSSDNEDLVDSETPNSFKQRPRVPGLQTNIEVLKAELLEFISKHGQ  568

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             EGFMPMRKQLRKHGRVD+EKAITRMGGFRR+A LMNL+LAYKHRKPKGYWDNLENL++EI
Sbjct  569   EGFMPMRKQLRKHGRVDVEKAITRMGGFRRMASLMNLALAYKHRKPKGYWDNLENLEEEI  628

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
             SRFQRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR+    K
Sbjct  629   SRFQRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRRAHIIK  688

Query  969   EKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +KK D      +  E K P + YVSQD  KW  KLK+LDINWVE
Sbjct  689   DKKVDYVDPANLECEGKIPSKPYVSQDTQKWAMKLKDLDINWVE  732


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 5/139 (4%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E I    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  140  IWLEQRGLQRALYWHIEARVVLDLQELIHSASDRELYFSMVDGDFKKFEGKWSIKS-GTR  198

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             +    S E  +          +E +I  DLP NL A+    ER    N +      ++G
Sbjct  199  SSTTTLSYEVNVIPRLNFPAIFLERIIRSDLPVNLQALACRAERSFGWNQKIPMIKNSFG  258

Query  426  EAEIKITPDKDLSADSISP  482
            E  + I     L  D   P
Sbjct  259  ELSLPILASPSLDFDGGLP  277



>ref|XP_011031087.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105130331 
[Populus euphratica]
Length=717

 Score =   506 bits (1303),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/334 (74%), Positives = 279/334 (84%), Gaps = 5/334 (1%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQV+GDFDSFQGKWILEQL SHHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARVVLDLCEHLEQEISFEQVQGDFDSFQGKWILEQLXSHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKMHK++FLSEAIMEEVIYEDLPSNLCAIRDYIE+ E+ N+ +T +Y      E+
Sbjct  449   KYNVESKMHKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEKRESNNSSETGQY----SKEL  504

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +        S++  ++ SD  N    +QRP+VPGLQRDI++L++ELL FISEHGQEGF
Sbjct  505   DSSRGDSYHEHSMA-VQQVSDVSNPNLLKQRPRVPGLQRDIDVLKSELLKFISEHGQEGF  563

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENLQ+EISRF
Sbjct  564   MPMRKQLRLHGRVDIEKAITRMGGFRRIATLMNLSLAYKHRKPKGYWDNLENLQEEISRF  623

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+LKVRHPNRQ +  K++K
Sbjct  624   QRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALKVRHPNRQANSIKDRK  683

Query  978   FDVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
              D            SQD  KWL K K+LDINWV+
Sbjct  684   IDNVASSTHAEGEDSQDTQKWLMKFKDLDINWVD  717


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/135 (31%), Positives = 62/135 (46%), Gaps = 8/135 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E        E+ F  V+GDF  F+GKW +   G+ 
Sbjct  143  IWLEQRGLQRALYWHIEARVVLDLQEFPHSANNRELHFSMVDGDFKKFEGKWSVRS-GTR  201

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
            H     S E  +          +E +I  DLP NL A+    ER + E  +KT   +T  
Sbjct  202  HGTTTLSYEVNVMPRYNFPAIFLERIIGSDLPVNLRALACRAER-DFEGNQKTG--ITES  258

Query  426  EAEIKITPDKDLSAD  470
            E  +  +    L  D
Sbjct  259  ETSMTASTSPGLVLD  273



>ref|XP_004167205.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101212159 
[Cucumis sativus]
Length=727

 Score =   506 bits (1304),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 250/342 (73%), Positives = 283/342 (83%), Gaps = 11/342 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDS  GKW  EQLGSHHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSLSGKWHFEQLGSHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVES+MHK++FLSEA+MEEV+YEDLPSNLCAIRD IE+   +N   + E +  G++E 
Sbjct  449   KYSVESRMHKDTFLSEALMEEVVYEDLPSNLCAIRDSIEKRVLKN---SFEALDQGDSEE  505

Query  438   KITPDKDLSADSISPYEETSDSVNSE-SHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             K    ++  ++  +   E    +N   S R RPKVPGLQRDIE+L+AE+L FISEHGQEG
Sbjct  506   KSVSRRNNQSNGYTTTAEGVSDINGRASFRPRPKVPGLQRDIEVLKAEVLKFISEHGQEG  565

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWD  +NLQ+EI+R
Sbjct  566   FMPMRKQLRMHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDKFDNLQEEINR  625

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ+SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF K++
Sbjct  626   FQKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFAKDR  685

Query  975   KF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K       D +GE K P + Y+SQD  KWLT LK LDINWVE
Sbjct  686   KSDYVVVNDFDGESKAPSKPYISQDTEKWLTGLKYLDINWVE  727


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 51/99 (52%), Gaps = 7/99 (7%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E +      E+ F  V+GDF  F+GKW I     S
Sbjct  147  IWLEQRGLQRALYWHIEARVVLDLQELLNSDGSRELLFSMVDGDFKKFEGKWSINAGTRS  206

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
              T+L Y V      N      ++E +I  DLP NL A+
Sbjct  207  SPTILSYEVNVIPRFN--FPAILLEXIIRSDLPVNLRAL  243



>gb|KGN54855.1| hypothetical protein Csa_4G552160 [Cucumis sativus]
Length=727

 Score =   506 bits (1303),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 250/342 (73%), Positives = 283/342 (83%), Gaps = 11/342 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDS  GKW  EQLGSHHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSLSGKWHFEQLGSHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVES+MHK++FLSEA+MEEV+YEDLPSNLCAIRD IE+   +N   + E +  G++E 
Sbjct  449   KYSVESRMHKDTFLSEALMEEVVYEDLPSNLCAIRDSIEKRVLKN---SFEALDQGDSEE  505

Query  438   KITPDKDLSADSISPYEETSDSVNSE-SHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             K    ++  ++  +   E    +N   S R RPKVPGLQRDIE+L+AE+L FISEHGQEG
Sbjct  506   KSVSRRNNQSNGYTTTAEGVSDINGRASFRPRPKVPGLQRDIEVLKAEVLKFISEHGQEG  565

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWD  +NLQ+EI+R
Sbjct  566   FMPMRKQLRMHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDKFDNLQEEINR  625

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ+SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF K++
Sbjct  626   FQKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFAKDR  685

Query  975   KF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K       D +GE K P + Y+SQD  KWLT LK LDINWVE
Sbjct  686   KSDYVVVNDFDGESKAPSKPYISQDTEKWLTGLKYLDINWVE  727


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 7/99 (7%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E +      E+ F  V+GDF  F+GKW I     S
Sbjct  147  IWLEQRGLQRALYWHIEARVVLDLQELLNSDGSRELLFSMVDGDFKKFEGKWSINAGTRS  206

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
              T+L Y V      N      ++E++I  DLP NL A+
Sbjct  207  SPTMLSYEVNVIPRFN--FPAILLEKIIRSDLPVNLRAL  243



>ref|XP_002522916.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39459.1| conserved hypothetical protein [Ricinus communis]
Length=722

 Score =   506 bits (1302),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 251/340 (74%), Positives = 282/340 (83%), Gaps = 8/340 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQ EGDFDSFQGKW+LEQLGSHHTLL
Sbjct  385   VRILQEGCKGLLYMVLHARVVLDLCEHLEQEISFEQAEGDFDSFQGKWLLEQLGSHHTLL  444

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+V SKMHK+SFLSEAIMEEVIYEDLPSN+CAIRDYIE+ E + + +      Y + E+
Sbjct  445   KYTVNSKMHKDSFLSEAIMEEVIYEDLPSNMCAIRDYIEKREDKISLEMHLLGQYSK-EL  503

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
             + + + D+     +   +  D  N  S RQRP+VPGLQRDIE+L++ELL FISEHGQEGF
Sbjct  504   E-SSNCDIDTKYGNATGDIVDLNNPNSVRQRPRVPGLQRDIEVLKSELLKFISEHGQEGF  562

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYK RKPKGYWDNLENLQ+EI RF
Sbjct  563   MPMRKQLRMHGRVDIEKAITRMGGFRRIASLMNLSLAYKRRKPKGYWDNLENLQEEIGRF  622

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+LKVRHPNRQ +  K+KK
Sbjct  623   QLSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALKVRHPNRQANVIKDKK  682

Query  978   FD------VNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
              D      V GE+   + YVSQD  KWLTKLK+LDINW E
Sbjct  683   IDYTTSTNVEGEDGISKTYVSQDTEKWLTKLKDLDINWGE  722



>ref|XP_006431780.1| hypothetical protein CICLE_v10000418mg [Citrus clementina]
 gb|ESR45020.1| hypothetical protein CICLE_v10000418mg [Citrus clementina]
Length=725

 Score =   504 bits (1299),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/341 (73%), Positives = 280/341 (82%), Gaps = 11/341 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++D+CE+ E+EISFEQVEGDFDSFQGKW+ EQLGSHHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARVVMDICEQHEQEISFEQVEGDFDSFQGKWLFEQLGSHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKM KNS LSEAIMEEVIYEDLPSNLCAIRDY+E+ E +N+       T    + 
Sbjct  449   KYSVESKMQKNSLLSEAIMEEVIYEDLPSNLCAIRDYVEKREGDNSLANDSVETTNHTQ-  507

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                   +L A S S  E+  DS    S +QRP+VPGLQ +IE+L+AELL FIS+HGQEGF
Sbjct  508   ---SSDELGASSSSDNEDLVDSETPNSFKQRPRVPGLQTNIEVLKAELLEFISKHGQEGF  564

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLRKHGRVDIEKAITRMGGFRR+A LMNL+LAYKHRKPKGYWDNLENL++EISRF
Sbjct  565   MPMRKQLRKHGRVDIEKAITRMGGFRRMASLMNLALAYKHRKPKGYWDNLENLEEEISRF  624

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR+    K+KK
Sbjct  625   QRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRRAHIIKDKK  684

Query  978   FD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
              D      +  E K P + YVSQD  KW  KLK+LDINWVE
Sbjct  685   VDYVNPANLECEGKIPSKPYVSQDTQKWAMKLKDLDINWVE  725


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 64/139 (46%), Gaps = 5/139 (4%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E I    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  140  IWLEQRGLQRALYWHIEARVVLDLQELIHSASDRELYFSMVDGDFKKFEGKWSIKS-GTR  198

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             +    S E  +          +E +I  DLP NL A+    ER    N +      ++G
Sbjct  199  SSTTNLSYEVNVIPRLNFPAIFLERIIRSDLPVNLQALACRAERSFGWNQKIPMIKNSFG  258

Query  426  EAEIKITPDKDLSADSISP  482
            E  + I     L  D   P
Sbjct  259  ELSLPILASPSLDFDGGLP  277



>ref|XP_010030296.1| PREDICTED: uncharacterized protein LOC104420091 [Eucalyptus grandis]
Length=594

 Score =   499 bits (1286),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 248/341 (73%), Positives = 279/341 (82%), Gaps = 8/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E EI+F+QVEGDFDSFQGKWI EQLG+ HTLL
Sbjct  255   VRILQEGCKGLLYMVLHARVVLDLCEHLEREITFQQVEGDFDSFQGKWIFEQLGNQHTLL  314

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKMHK+SFLSEAIMEEVIYEDLPSNLCAIRDYIE  +A  A+      +   +E 
Sbjct  315   KYTVESKMHKDSFLSEAIMEEVIYEDLPSNLCAIRDYIENRDATAADSETISESGLSSEQ  374

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +P  D S   +S   E   + + +   QRP+VPGLQRDIE+L+AEL+ FISEHGQEGF
Sbjct  375   TASPSMDEST-CVSATTEDISNYDDDLSSQRPRVPGLQRDIEVLKAELVKFISEHGQEGF  433

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LM+LSLAYK RKPKGYWDNLENL++EI RF
Sbjct  434   MPMRKQLRLHGRVDIEKAITRMGGFRRIASLMDLSLAYKRRKPKGYWDNLENLEEEIRRF  493

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMD SYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP   K+K+
Sbjct  494   QRSWGMDLSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPGLAKDKR  553

Query  978   ------FDVNGEEK-TPRAYVSQDAHKWLTKLKELDINWVE  1079
                    DV  E++ T + Y+SQD  KWL++LK LDINWVE
Sbjct  554   ADPVAATDVEVEDRSTSKPYISQDTQKWLSQLKHLDINWVE  594


 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 66/152 (43%), Gaps = 21/152 (14%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + A V+LDL E      E E+ F  V+GDF  F+GKW L+     
Sbjct  21   IWLEQRGLQRALYWHIEAHVVLDLQEFANSDNERELHFSMVDGDFKKFEGKWSLKSGPRS  80

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             T L Y V      N       +E +I  DLP NL A+    ER    N E  Q+  +  
Sbjct  81   STTLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLQALAFRAER----NFEGNQKLASTT  134

Query  426  E--------AEIKITPDKDLSADSISPYEETS  497
                     A   I PD D   D + P E TS
Sbjct  135  RFRDRAINGAVTSIGPDLD---DKVQPREITS  163



>ref|XP_009789144.1| PREDICTED: uncharacterized protein LOC104236830 isoform X1 [Nicotiana 
sylvestris]
Length=353

 Score =   489 bits (1258),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 251/354 (71%), Positives = 273/354 (77%), Gaps = 34/354 (10%)
 Frame = +3

Query  117   MVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF  296
             MVLHARV+LDL E IE+EISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF
Sbjct  1     MVLHARVVLDLSEHIEQEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF  60

Query  297   LSEAIMEE----------------------------VIYEDLPSNLCAIRDYIERLEAEN  392
             LSEAIMEE                            VIYEDLPSNLCAIRD+IE+ E E 
Sbjct  61    LSEAIMEEKMMRRLKSNRKKKTVDLQRKRKRIFMLAVIYEDLPSNLCAIRDHIEKRETEK  120

Query  393   AEKTQEYVTYGEAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILR  572
               +   +    EA +  +  KD       P  + SDS +  S R+RPKVPGLQRDIE+L+
Sbjct  121   PLEKINHDACREASVS-SSIKDSYVYYDRPAAQNSDSCSLYSPRRRPKVPGLQRDIEVLK  179

Query  573   AELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKG  752
             AELL FISEHGQEGFMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKG
Sbjct  180   AELLDFISEHGQEGFMPMRKQLRNHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKG  239

Query  753   YWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK  932
             YWD+LENLQ+EISRFQ +WGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK
Sbjct  240   YWDSLENLQEEISRFQTNWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLK  299

Query  933   VRHPNRQPSFGKEKKF-----DVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             VRHPNRQ +  KE K      DVNGE  + + +V+QDA KWL KLK+LDINWVE
Sbjct  300   VRHPNRQANLAKETKVEVLANDVNGETMSSKPFVAQDAQKWLMKLKDLDINWVE  353



>ref|XP_007048561.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007048562.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007048563.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92718.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92719.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX92720.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=726

 Score =   499 bits (1284),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 252/342 (74%), Positives = 284/342 (83%), Gaps = 13/342 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E++E+EISFEQVEGDFDSFQG+W+LEQLGSHHTLL
Sbjct  390   VRILQEGCKGLLYMVLHARVVLDLHEQLEQEISFEQVEGDFDSFQGRWLLEQLGSHHTLL  449

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKMH++S LSEAIMEEVIYEDLPSNLC+IRDY+E+ E E  E  Q     G+   
Sbjct  450   KYSVESKMHRDSLLSEAIMEEVIYEDLPSNLCSIRDYVEKREVETHESRQ---LSGKESS  506

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               + + +      +  E+  DS +  S  QRP+VPGLQRDIE+L+AELL FISEHGQEGF
Sbjct  507   SSSTNNETGYSDTA--EQVLDSTSPNSCGQRPRVPGLQRDIEVLKAELLKFISEHGQEGF  564

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYK RKPKGYWDNLENLQDEISRF
Sbjct  565   MPMRKQLRLHGRVDIEKAITRMGGFRRIASLMNLSLAYKQRKPKGYWDNLENLQDEISRF  624

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP-SFGKEK  974
             QRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP+RQP +  KEK
Sbjct  625   QRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPSRQPQTTPKEK  684

Query  975   KF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +       DV  E KTP  +YVSQ+  KWL +L++LDI+WV+
Sbjct  685   QIDNVASSDVESEGKTPSNSYVSQNPQKWLKRLQDLDIDWVD  726



>ref|XP_010243863.1| PREDICTED: uncharacterized protein LOC104587826 [Nelumbo nucifera]
Length=716

 Score =   497 bits (1279),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 255/341 (75%), Positives = 281/341 (82%), Gaps = 14/341 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYM LHARV+LDLCE +EEEISFEQVEGDFDSF+GKWILEQLG+HHTLL
Sbjct  383   VRILQEGCKGLLYMALHARVVLDLCEHLEEEISFEQVEGDFDSFRGKWILEQLGNHHTLL  442

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKMHK+SFLSEAIMEEVIYEDLPSNLCAIRD++E+  A N E+     T G+   
Sbjct  443   KYTVESKMHKDSFLSEAIMEEVIYEDLPSNLCAIRDFVEKQMAPNLEEEH---TEGQV--  497

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I    +   D     E+ S S +    RQRP+VPGLQRD+E+L+AELL FISEHGQEGF
Sbjct  498   -ILSGNNKDVDYGKKPEQVSFS-SQNPLRQRPRVPGLQRDVEVLKAELLTFISEHGQEGF  555

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFR+IA LMNLSLAYKHRKPKGYWDNLENLQ+EISRF
Sbjct  556   MPMRKQLRLHGRVDIEKAITRMGGFRKIASLMNLSLAYKHRKPKGYWDNLENLQEEISRF  615

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QR+WGMDP YMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP RQ    KEKK
Sbjct  616   QRNWGMDPCYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPTRQAKVEKEKK  675

Query  978   FD---VNG---EEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
              D   +N    E+K P +  VSQD  KWL+KLK LDINW+E
Sbjct  676   NDSIVLNDKEVEDKVPYKPCVSQDTQKWLSKLKYLDINWME  716


 Score = 62.4 bits (150),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 49/141 (35%), Positives = 74/141 (52%), Gaps = 17/141 (12%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLG-S  242
            +++ Q+G +  LY  + ARV+LDL E I      E+ F  V+GDF  F+GKW L+    S
Sbjct  135  IWLEQQGFQRALYWHIEARVVLDLQEVINSTNGRELHFSMVDGDFKKFEGKWSLKSGKRS  194

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V S + + +F +   +E +I  DLP NL A+   +ER    N+E  QE +  
Sbjct  195  STTILSYEV-SVIPRFNFPA-IFLERIIRSDLPVNLQALACRVER----NSEWNQEAMIM  248

Query  423  GEA------EIKITPDKDLSA  467
            G         +  +P  DLS+
Sbjct  249  GRTLNGTSKAVLPSPTMDLSS  269



>ref|XP_010027529.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104418018 
[Eucalyptus grandis]
Length=722

 Score =   495 bits (1274),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 247/341 (72%), Positives = 277/341 (81%), Gaps = 8/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E EISF+QVEGDFDSFQGKWI EQLG+ HTLL
Sbjct  383   VRILQEGCKGLLYMVLHARVVLDLCEHLEREISFQQVEGDFDSFQGKWIFEQLGNQHTLL  442

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKMHK+SFLSEAIMEEVIYEDLPSNLCAIRDYIE  +A  A+      +   +E 
Sbjct  443   KYTVESKMHKDSFLSEAIMEEVIYEDLPSNLCAIRDYIENRDATAADSETISESGLSSEQ  502

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +P  D S   +S   E   + + +   QRP+VPGLQRDIE+L+AEL+ FISEHGQEGF
Sbjct  503   TASPSMDEST-CVSATTEDISNYDDDLSSQRPRVPGLQRDIEVLKAELVKFISEHGQEGF  561

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT MGGFRRIA LM+LSLAYK R PKGYWDNLENL++EI RF
Sbjct  562   MPMRKQLRLHGRVDIEKAITGMGGFRRIASLMDLSLAYKRRXPKGYWDNLENLEEEIRRF  621

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMD SYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP   K+K+
Sbjct  622   QRSWGMDLSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPGLAKDKR  681

Query  978   F------DVNGEEK-TPRAYVSQDAHKWLTKLKELDINWVE  1079
                    DV  E++ T + Y+SQD  KWL++LK LDINWVE
Sbjct  682   VDPVAATDVEVEDRSTSKPYISQDTQKWLSQLKHLDINWVE  722


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 67/152 (44%), Gaps = 21/152 (14%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E      E E+ F  V+GDF  F+GKW L+     
Sbjct  149  IWLEQRGLQRALYWHIEARVVLDLQEFANSDNERELHFSMVDGDFKKFEGKWSLKSGPRS  208

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             T L Y V      N       +E +I  DLP NL A+    ER    N E  Q+  +  
Sbjct  209  STTLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLQALAFRAER----NFEGNQKLASTT  262

Query  426  E--------AEIKITPDKDLSADSISPYEETS  497
                     A   I PD D   D + P E TS
Sbjct  263  RFRDRAINGAVTSIGPDLD---DKVQPREITS  291



>ref|XP_008371907.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103435300 
[Malus domestica]
Length=746

 Score =   494 bits (1272),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 245/341 (72%), Positives = 278/341 (82%), Gaps = 7/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++EEEISFEQVEGDFDSF+GKW+LEQLGSHHTLL
Sbjct  406   VRILQEGCKGLLYMVLHARVVLDLCEQLEEEISFEQVEGDFDSFRGKWVLEQLGSHHTLL  465

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKM K++ LSEAIMEEVIYEDLPSNLC IR      EA ++ K  +   Y E E 
Sbjct  466   KYSVESKMRKDTLLSEAIMEEVIYEDLPSNLCTIRXLRREXEAAHSSKASDENIYTEEET  525

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                        S +  +  SD+    S R+RP+VPGLQRDIE+L++ELL FISEHGQEGF
Sbjct  526   ASCSSGHDDERSNTTVDRISDTDARSSSRKRPRVPGLQRDIEVLKSELLKFISEHGQEGF  585

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAI RMGGFRRIA LMNLSLAYK+RKPKGYWD+L+N+Q+EI+RF
Sbjct  586   MPMRKQLRVHGRVDIEKAIRRMGGFRRIASLMNLSLAYKNRKPKGYWDSLDNMQEEINRF  645

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP+ G++ K
Sbjct  646   QRSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPNLGRDVK  705

Query  978   FD----VNGEEKTPRA---YVSQDAHKWLTKLKELDINWVE  1079
              D     + EE+   A   YVSQD  KW+++LK LDINWVE
Sbjct  706   LDYVVSTDVEEEKVVASNPYVSQDTQKWISELKHLDINWVE  746



>ref|XP_004295499.1| PREDICTED: uncharacterized protein LOC101306028 [Fragaria vesca 
subsp. vesca]
Length=718

 Score =   493 bits (1269),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 242/341 (71%), Positives = 277/341 (81%), Gaps = 8/341 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EI+FEQVEGDFDSF+GKW+LEQLGSHHTLL
Sbjct  379   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEITFEQVEGDFDSFRGKWVLEQLGSHHTLL  438

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM K++FLSEAIMEEVIYEDLPSNLC IRDY+E+ E   + K  +   + E E 
Sbjct  439   KYTVESKMRKDTFLSEAIMEEVIYEDLPSNLCTIRDYMEKREEAKSLKECDETIHVE-EQ  497

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +   D + D     +  SD        QRP+VPGLQRDIE+L+AELL FI++HGQEGF
Sbjct  498   NASSSADHNDDGCKTVDHFSDPNAQSLSTQRPRVPGLQRDIEVLKAELLKFIADHGQEGF  557

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR  GRVDIEKAITRMGGFR+IA LMNLSLAYKHRKPKGYWDNL+NLQ+EISRF
Sbjct  558   MPMRKQLRLRGRVDIEKAITRMGGFRKIATLMNLSLAYKHRKPKGYWDNLDNLQEEISRF  617

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSL VRHPNR+ +  ++ K
Sbjct  618   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLNVRHPNRRLNLARDVK  677

Query  978   FD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
              D      + G +  P   YVSQD  KW+++LK LDINWVE
Sbjct  678   TDHAVSTNLKGAKDAPSNPYVSQDTQKWISELKHLDINWVE  718



>ref|XP_007159891.1| hypothetical protein PHAVU_002G276400g [Phaseolus vulgaris]
 gb|ESW31885.1| hypothetical protein PHAVU_002G276400g [Phaseolus vulgaris]
Length=539

 Score =   485 bits (1249),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/343 (71%), Positives = 279/343 (81%), Gaps = 12/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSFQGKW  EQLG+HHTLL
Sbjct  200   VRILQEGCKGLLYMVLHARVVLDLCEYLEQEISFEQVEGDFDSFQGKWTFEQLGNHHTLL  259

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE   A N  ++++     +   
Sbjct  260   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIENKTASNILESKQNTNSRQ---  316

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
             +  P      DS    EE SD  +    +QRP+VPGLQRDIE+L++E+L FI+EHGQEGF
Sbjct  317   QTAPSGFADDDSYCSVEELSDCNSQSLSQQRPRVPGLQRDIEVLKSEILKFIAEHGQEGF  376

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAI RMGGFR+IA +MNLSLAYKHRKPKGYWDNLENL DEI+RF
Sbjct  377   MPMRKQLRLHGRVDIEKAINRMGGFRKIAIIMNLSLAYKHRKPKGYWDNLENLHDEINRF  436

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQPSFGKEK  974
             QRSWGMDPS+MPSRKSFERAGR+DIARALEKWGGL++VSRLLSLKVR   ++Q +  K+K
Sbjct  437   QRSWGMDPSFMPSRKSFERAGRFDIARALEKWGGLNQVSRLLSLKVRRQRSKQGNLDKDK  496

Query  975   KF-------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K        +V+ + KTP R  VSQD  KWLT+LK+LDINWV+
Sbjct  497   KVEDDVASPEVDIQIKTPSRPTVSQDPQKWLTELKQLDINWVD  539



>gb|KHG05990.1| RNA-directed RNA polymerase catalytic subunit [Gossypium arboreum]
Length=331

 Score =   477 bits (1228),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/333 (73%), Positives = 275/333 (83%), Gaps = 14/333 (4%)
 Frame = +3

Query  117   MVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSVESKMHKNSF  296
             MVLHARV+LDL E++E+EI FEQVEGDFDSFQG+W+LEQLGSHHTLLKYSVESKMH++S 
Sbjct  1     MVLHARVVLDLHEQLEKEIMFEQVEGDFDSFQGRWLLEQLGSHHTLLKYSVESKMHRDSL  60

Query  297   LSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIKITPDKDLSADSI  476
             LSEA+MEEVIYEDLPSNLCAIRDY+E+ EA+ + +T+E       +   + D + +    
Sbjct  61    LSEALMEEVIYEDLPSNLCAIRDYVEKTEAKISLETRENRQLSGQQSSSSNDNETAYSDT  120

Query  477   SPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRV  656
                +E S+S NS   RQRP+VPGLQRDIE+L+ ELL FISEHGQEGFMPMRKQLR HGRV
Sbjct  121   GEEDEGSNSANS--LRQRPRVPGLQRDIEVLKTELLKFISEHGQEGFMPMRKQLRLHGRV  178

Query  657   DIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPS  836
             DIEKAITRMGGFRRIA LMNLSLAYK RKPKGYWDNLENLQ+EI+RFQRSWGMDPS+MPS
Sbjct  179   DIEKAITRMGGFRRIASLMNLSLAYKQRKPKGYWDNLENLQEEINRFQRSWGMDPSFMPS  238

Query  837   RKSFERAGRYDIARALEKWGGLHEVSRLLSLKVR--HPNRQP-SFGKEKKFD-------V  986
             RKSFERAGRYDIARALEKWGGLHEVSRLLSLKVR  HP+RQ  +  KEK+ D       +
Sbjct  239   RKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRQKHPSRQGLTSAKEKQVDNVAASRGI  298

Query  987   NGEEKTP--RAYVSQDAHKWLTKLKELDINWVE  1079
               EEKTP  + YVSQ+  KWLTKLK LDINWVE
Sbjct  299   ESEEKTPILKPYVSQNTQKWLTKLKGLDINWVE  331



>ref|XP_007137739.1| hypothetical protein PHAVU_009G151900g [Phaseolus vulgaris]
 gb|ESW09733.1| hypothetical protein PHAVU_009G151900g [Phaseolus vulgaris]
Length=722

 Score =   486 bits (1252),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/339 (71%), Positives = 278/339 (82%), Gaps = 13/339 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V +LQEGCKGLLYMVLHARV+L+LCE +E+EISFEQVEGDFDSF+GKWI EQLG+HHTLL
Sbjct  392   VRVLQEGCKGLLYMVLHARVVLELCEYLEQEISFEQVEGDFDSFRGKWIFEQLGNHHTLL  451

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYV----TYG  425
             KYSVESKM K++FLSEAIMEEVIYEDLPSNL AIRDYIE    +NA K+ E+       G
Sbjct  452   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLSAIRDYIEN---KNASKSSEFCEQNTNSG  508

Query  426   EAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHG  605
             +  +  +   D   D+    EE        S +QRPKVPGLQR+IE+L++ELL FI+EHG
Sbjct  509   QQIVSSSCQND---DNTGSVEEVPSCDARSSSQQRPKVPGLQRNIEVLKSELLQFIAEHG  565

Query  606   QEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDE  785
             QEGFMPMRKQLR HGRVDIEKAITRMGGFR+IA ++NLSLAYKHRKPKGYWDNLENLQ+E
Sbjct  566   QEGFMPMRKQLRLHGRVDIEKAITRMGGFRKIATVLNLSLAYKHRKPKGYWDNLENLQEE  625

Query  786   ISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFG  965
             ISRFQRSWG+DPS+MPSRKSFERAGRYDIARALEKWGGL EVSRLLSLKVR  +R  + G
Sbjct  626   ISRFQRSWGIDPSFMPSRKSFERAGRYDIARALEKWGGLQEVSRLLSLKVRQRSRHENIG  685

Query  966   KEKKFD-VNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             K+K+ D  + E KTP   +SQD  KWLTKLK++DINW E
Sbjct  686   KDKRSDHADSEMKTP--CISQDTQKWLTKLKQMDINWFE  722



>ref|XP_007159892.1| hypothetical protein PHAVU_002G276400g [Phaseolus vulgaris]
 gb|ESW31886.1| hypothetical protein PHAVU_002G276400g [Phaseolus vulgaris]
Length=704

 Score =   484 bits (1246),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 242/343 (71%), Positives = 279/343 (81%), Gaps = 12/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSFQGKW  EQLG+HHTLL
Sbjct  365   VRILQEGCKGLLYMVLHARVVLDLCEYLEQEISFEQVEGDFDSFQGKWTFEQLGNHHTLL  424

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSVESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE   A N  ++++     +   
Sbjct  425   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIENKTASNILESKQNTNSRQ---  481

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
             +  P      DS    EE SD  +    +QRP+VPGLQRDIE+L++E+L FI+EHGQEGF
Sbjct  482   QTAPSGFADDDSYCSVEELSDCNSQSLSQQRPRVPGLQRDIEVLKSEILKFIAEHGQEGF  541

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAI RMGGFR+IA +MNLSLAYKHRKPKGYWDNLENL DEI+RF
Sbjct  542   MPMRKQLRLHGRVDIEKAINRMGGFRKIAIIMNLSLAYKHRKPKGYWDNLENLHDEINRF  601

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQPSFGKEK  974
             QRSWGMDPS+MPSRKSFERAGR+DIARALEKWGGL++VSRLLSLKVR   ++Q +  K+K
Sbjct  602   QRSWGMDPSFMPSRKSFERAGRFDIARALEKWGGLNQVSRLLSLKVRRQRSKQGNLDKDK  661

Query  975   KF-------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             K        +V+ + KTP R  VSQD  KWLT+LK+LDINWV+
Sbjct  662   KVEDDVASPEVDIQIKTPSRPTVSQDPQKWLTELKQLDINWVD  704


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  +Y  + ARV+LDL E +    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  139  IWLEQRGFQRSMYWHIEARVVLDLQEFVNSAWDRELHFSMVDGDFKKFEGKWSVKS-GTR  197

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIER  377
             +    S E  +          +E +I  DLP NL A+   +ER
Sbjct  198  SSSTNVSYEVNVIPRFNFPAIFLERIIRSDLPVNLRALAYRVER  241



>ref|XP_010674380.1| PREDICTED: uncharacterized protein LOC104890548 [Beta vulgaris 
subsp. vulgaris]
Length=743

 Score =   484 bits (1247),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 240/349 (69%), Positives = 281/349 (81%), Gaps = 18/349 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR+++DLCE++E+EISFEQVEGDFDSFQG+W  EQLG+HHTLL
Sbjct  398   VRILQEGCKGLLYMVLHARIVMDLCEQLEQEISFEQVEGDFDSFQGRWQFEQLGNHHTLL  457

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEK-------TQEYV  416
             KYSVESKM +++FLSE+IMEEVIYEDLPSNLCAIRDYIE+    ++++        Q+  
Sbjct  458   KYSVESKMRRDTFLSESIMEEVIYEDLPSNLCAIRDYIEKRTGTHSDEYDEPHIELQKDE  517

Query  417   TYGEAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFIS  596
             TY E   K   + +++  S+   E  S    S   +QRP+VPGLQ+ IE+L++ELL F+S
Sbjct  518   TYQEQPTKSVNETNINQRSV---ENKSSGGGSSPIKQRPRVPGLQQSIEVLKSELLKFVS  574

Query  597   EHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENL  776
             EHGQEGFMPMRKQLR HGRVDIEKAI RMGGFRRIA LMNLSLAYKHRKPKGYWDNLENL
Sbjct  575   EHGQEGFMPMRKQLRSHGRVDIEKAINRMGGFRRIATLMNLSLAYKHRKPKGYWDNLENL  634

Query  777   QDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNR-Q  953
             QDEI+RFQ++WGMDPSYMPSRK+FERAGRYDIARALEKWGGLHEVSRLLSLK+RHPNR Q
Sbjct  635   QDEINRFQKNWGMDPSYMPSRKAFERAGRYDIARALEKWGGLHEVSRLLSLKLRHPNRQQ  694

Query  954   PSFGKEKKFD------VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
              +   EKK D      V  +EK P +   S +  KWLT+L +LDINWVE
Sbjct  695   ANISGEKKIDFASSDSVENKEKAPCKPTASVNTQKWLTELNDLDINWVE  743



>ref|XP_003532367.1| PREDICTED: uncharacterized protein LOC100785172 [Glycine max]
 gb|KHN16926.1| hypothetical protein glysoja_003023 [Glycine soja]
Length=721

 Score =   484 bits (1245),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 246/344 (72%), Positives = 276/344 (80%), Gaps = 13/344 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSFQGKW  EQLG+HHTLL
Sbjct  381   VRILQEGCKGLLYMVLHARVVLDLCEYLEQEISFEQVEGDFDSFQGKWTFEQLGNHHTLL  440

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENA-EKTQEYVTYGEAE  434
             KYS+ESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE   A N  E  ++    G+  
Sbjct  441   KYSLESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIENKTASNILEACKQNTNSGQQT  500

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             +    + D   DS    E+ SD     S +QRP+VPGLQRDIE+L++ELL FI+EHGQEG
Sbjct  501   VPSGFEDD---DSYCSAEDLSDCNAQSSSQQRPRVPGLQRDIEVLKSELLKFIAEHGQEG  557

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAI R GGFR+IA +MNLSLAYKHRKPKGYWDNLENL  EISR
Sbjct  558   FMPMRKQLRLHGRVDIEKAINRKGGFRKIATIMNLSLAYKHRKPKGYWDNLENLHYEISR  617

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQPSFGKE  971
             FQRSWGMDPS+MPSR+SFERAGR+DIARALEKWGGL +VSRLLSLKVR   +RQ    K+
Sbjct  618   FQRSWGMDPSFMPSRRSFERAGRFDIARALEKWGGLRQVSRLLSLKVRRQRSRQGKLAKD  677

Query  972   KKF-------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             KK        DV+ E KTP R  VSQD  KWLT+LK+LDINWVE
Sbjct  678   KKVDDDVASPDVDREIKTPSRPTVSQDPQKWLTELKQLDINWVE  721


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  +Y  + ARV+LDL E I    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  139  IWLEQRGFQRSMYWHIEARVVLDLQELINSAWDRELHFSMVDGDFKKFEGKWSVKS-GTR  197

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIER  377
             +    S E  +          +E +I  DLP NL A+   +ER
Sbjct  198  SSSTNLSYEVNVIPRFNFPAIFLERIIKSDLPVNLQALAYRVER  241



>ref|XP_003525141.1| PREDICTED: uncharacterized protein LOC100797103 [Glycine max]
 gb|KHN17412.1| hypothetical protein glysoja_026955 [Glycine soja]
Length=725

 Score =   483 bits (1243),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 245/344 (71%), Positives = 275/344 (80%), Gaps = 13/344 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSF GKW  EQLG+HHTLL
Sbjct  385   VRILQEGCKGLLYMVLHARVVLDLCEYLEQEISFEQVEGDFDSFHGKWTFEQLGNHHTLL  444

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENA-EKTQEYVTYGEAE  434
             KYSVESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE   A N  E  ++    G+  
Sbjct  445   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIENRTASNMFEACKQNTDLGQQT  504

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             +    + D   DS    E+  D     S +QRP+VPGLQRDIE+L++ELL FI+EHGQEG
Sbjct  505   VPSGFEDD---DSYCSAEDLFDCNAQSSSQQRPRVPGLQRDIEVLKSELLKFIAEHGQEG  561

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAI RMGGFR+IA +MNLSLAYKHRKPKGYWDNLENL  EISR
Sbjct  562   FMPMRKQLRLHGRVDIEKAINRMGGFRKIATIMNLSLAYKHRKPKGYWDNLENLHYEISR  621

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQPSFGKE  971
             FQRSWGMDPS+MPSR+SFERAGR+DIARALEKWGGL +VSRLLSLKVR   +RQ +  K+
Sbjct  622   FQRSWGMDPSFMPSRRSFERAGRFDIARALEKWGGLRQVSRLLSLKVRRQRSRQDNLAKD  681

Query  972   KKF-------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             KK        DV+ E KTP R  VSQD   WLT+LK+LDINWVE
Sbjct  682   KKVDDDVASPDVDSEIKTPSRPTVSQDPQNWLTELKQLDINWVE  725


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 73/164 (45%), Gaps = 22/164 (13%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  +Y  + ARV+LDL E I    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  143  IWLEQRGFQRSMYWHIEARVVLDLQEFINSAWDRELHFSMVDGDFKKFEGKWSVKS-GTR  201

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             +    S E  +          +E +I  DLP NL A+   +ER  + N + +       
Sbjct  202  SSSTNLSYEVNVIPRFNFPAIFLERIIRSDLPVNLRALAYRVERNISGNQKLS-------  254

Query  426  EAEIKITPDKDLSADSISPYEETSDSVNSESHRQR----PKVPG  545
                   P+  L   S   YE ++  +NS     R      +PG
Sbjct  255  ------LPENHLDKTSSDIYESSAQKINSALCENREYLVSSIPG  292



>ref|XP_008785881.1| PREDICTED: uncharacterized protein LOC103704391 isoform X3 [Phoenix 
dactylifera]
Length=566

 Score =   474 bits (1219),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/344 (70%), Positives = 272/344 (79%), Gaps = 17/344 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E++E EISFEQVEGDFDSFQGKWILEQLG  HTLL
Sbjct  230   VRILQEGCKGLLYMVLHARVVLDLHEELECEISFEQVEGDFDSFQGKWILEQLGDQHTLL  289

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQ---EYVTYGE  428
             KY VESKMHK++FLSEAI+EEVIYEDLPSNLCAIRD++E+ EA   E  +   + V    
Sbjct  290   KYIVESKMHKDTFLSEAILEEVIYEDLPSNLCAIRDFVEKREAAGNEPPKYPDKLVVPVS  349

Query  429   AEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
               + +   K     SI+        V++   RQRPKVPGLQRDIE+L+AEL+ FIS +GQ
Sbjct  350   NYVHVIESKPAEHVSIT-------DVSAIPLRQRPKVPGLQRDIEVLKAELMSFISRYGQ  402

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             +GFMPMRKQLR HGRVDIEKAITRMGGFR+IA LMNLSLAYKHRKP GYWDNLENLQ+EI
Sbjct  403   DGFMPMRKQLRMHGRVDIEKAITRMGGFRKIADLMNLSLAYKHRKPSGYWDNLENLQEEI  462

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
              RFQ+SWGMDP+YMPSRKSFERAGRYDIARALEKWGGL EV RLLSLK RHP R   F +
Sbjct  463   RRFQKSWGMDPAYMPSRKSFERAGRYDIARALEKWGGLQEVCRLLSLKPRHPRRHLDFDR  522

Query  969   EKKFDV------NGEEKT-PRAYVSQDAHKWLTKLKELDINWVE  1079
             E++ D       +GEEK   + Y+ QD  KWL KLK+LDINWVE
Sbjct  523   EEQHDFKARSEPDGEEKIQSKPYIPQDTEKWLRKLKDLDINWVE  566



>ref|XP_003528072.1| PREDICTED: uncharacterized protein LOC100777483 [Glycine max]
 gb|KHN09657.1| hypothetical protein glysoja_011931 [Glycine soja]
Length=724

 Score =   479 bits (1232),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/337 (72%), Positives = 275/337 (82%), Gaps = 8/337 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSF+GKWI EQLG+HHTLL
Sbjct  393   VRILQEGCKGLLYMVLHARVVLDLCEYLEQEISFEQVEGDFDSFRGKWIFEQLGNHHTLL  452

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN-AEKTQEYVTYGEAE  434
             KYSVESKM K++FLSEAIMEEVIYEDLPSNL AIRDYIE + A   +E  ++ +  G+  
Sbjct  453   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLSAIRDYIENMNASKYSEVCEQNMNSGQ--  510

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
              +I     L  D+    EE  +     S +QR KVPGLQR+I++L +ELL FI+EHGQEG
Sbjct  511   -QILSSGYLKDDNSGSAEEVPNCDVQCSSQQRSKVPGLQRNIKVLESELLKFIAEHGQEG  569

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFR+IA ++NLSLAYKHRKPKGYWDNLENLQ+EISR
Sbjct  570   FMPMRKQLRLHGRVDIEKAITRMGGFRKIATILNLSLAYKHRKPKGYWDNLENLQEEISR  629

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQR WG+DPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVR  +RQ +  K+K
Sbjct  630   FQRGWGIDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRQRSRQDNLAKDK  689

Query  975   KFD--VNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             +     + E KTP   +SQD  KWLTKLK LDINW E
Sbjct  690   RSGDHTDSEMKTP--CISQDTQKWLTKLKHLDINWFE  724



>ref|XP_004503887.1| PREDICTED: uncharacterized protein LOC101501397 isoform X2 [Cicer 
arietinum]
 ref|XP_004503888.1| PREDICTED: uncharacterized protein LOC101501397 isoform X3 [Cicer 
arietinum]
Length=578

 Score =   474 bits (1219),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/343 (70%), Positives = 280/343 (82%), Gaps = 12/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSFQGKW  EQLG+HHTLL
Sbjct  239   VRILQEGCKGLLYMVLHARVVLDLCECLEQEISFEQVEGDFDSFQGKWTFEQLGNHHTLL  298

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN-AEKTQEYVTYGEAE  434
             KYSV+SKM K++FLSEAIMEEVIYEDLPSNLCAIRDY+E  +A   +E  ++    G+  
Sbjct  299   KYSVDSKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYVENQKASQFSEVCEQNTNSGQIV  358

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             I      D S+ S   + + +  ++S     RP+VPGLQRDIE+L++ELL F++E+GQEG
Sbjct  359   ISSGSGDDNSSSSDDAFSDCNVQISSN---HRPRVPGLQRDIEVLKSELLKFVAEYGQEG  415

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFR+IA +MNLSLAYK+RKPKGYWDNLENLQDEISR
Sbjct  416   FMPMRKQLRLHGRVDIEKAITRMGGFRKIATIMNLSLAYKNRKPKGYWDNLENLQDEISR  475

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQPSFGKE  971
             FQRSWGMDPS+MPSRKSFERAGR+DIARALEKWGGLHEVSRLLSLK R   +RQ +  K+
Sbjct  476   FQRSWGMDPSFMPSRKSFERAGRFDIARALEKWGGLHEVSRLLSLKPRRKRSRQDNLAKD  535

Query  972   KKF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +K       DV+ E KT  R Y+SQD HKW  +LK+LDINWVE
Sbjct  536   RKNDEMELPDVDSEMKTASRPYISQDTHKWHKELKQLDINWVE  578



>ref|XP_010547690.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104819355 
[Tarenaya hassleriana]
Length=731

 Score =   478 bits (1230),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/338 (70%), Positives = 272/338 (80%), Gaps = 4/338 (1%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHAR +LDL E  E+EI F QVEGDFDS QGKW+LEQLGSHHTLL
Sbjct  394   VRIVQEGCKGLLYMVLHARAVLDLHEYREQEIRFVQVEGDFDSLQGKWLLEQLGSHHTLL  453

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESK+ K++ LSEAIMEEVIYEDLPSNLCAIRDYIE+ E E + +  +  T   +E 
Sbjct  454   KYTVESKIRKDTLLSEAIMEEVIYEDLPSNLCAIRDYIEKREGEKSLEACKLETRQVSEE  513

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +   D      +  E   +S      +QRP++PGLQRDI++L++ELL F+SEHGQEGF
Sbjct  514   TDSASSDTQTGCSAAEETVYESGGMNQTKQRPRIPGLQRDIKVLKSELLKFVSEHGQEGF  573

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYKHRKPKGYWDNLENLQDEI RF
Sbjct  574   MPMRKQLRLHGRVDIEKAITRMGGFRRIASLMNLSLAYKHRKPKGYWDNLENLQDEIGRF  633

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDPS+MPSRK+FERAGRYDIARALEKWGGLHEVSRLL+LKVRHPNRQ +   ++ 
Sbjct  634   QKNWGMDPSFMPSRKTFERAGRYDIARALEKWGGLHEVSRLLALKVRHPNRQTNATTKES  693

Query  978   FDVNGEEKT----PRAYVSQDAHKWLTKLKELDINWVE  1079
                +  + T     R YVSQD HKWL+KLK+LDINWV+
Sbjct  694   SKRSESDATFIANNRPYVSQDTHKWLSKLKDLDINWVQ  731


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 60/131 (46%), Gaps = 17/131 (13%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDL--CEKIE----EEISFEQVEGDFDSFQGKWILE-QL  236
            +++ Q G +  LY  + ARV+LDL  C  +      E+ F  V+GDF  F+GKW L    
Sbjct  152  IWLEQRGFQRALYWHIEARVVLDLQECXMLSGPNGRELHFSMVDGDFKKFEGKWSLNCGT  211

Query  237  GSHHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYV  416
             S  T+L Y V      N       +E +I  DLP NL A+        A  AE+  +  
Sbjct  212  RSEGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLQAL--------ACQAERNYKGY  261

Query  417  TYGEAEIKITP  449
             +G   +  TP
Sbjct  262  PWGRTSLPATP  272



>ref|XP_003630366.1| cyclase/dehydrase family protein [Medicago truncatula]
Length=742

 Score =   476 bits (1226),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/343 (70%), Positives = 275/343 (80%), Gaps = 11/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQ EGDFDSF GKW  EQLG+HHTLL
Sbjct  402   VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQAEGDFDSFHGKWTFEQLGNHHTLL  461

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSV+SKM +++FLSEAIMEEVIYEDLPSNLCAIRDY+E  +A    +  E  T    +I
Sbjct  462   KYSVDSKMRRDTFLSEAIMEEVIYEDLPSNLCAIRDYVENQKASQFLEVCEQNTNSGQQI  521

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              ++   D   ++ S  ++ SD     S  QR +VPGLQRDIE+L++ELL F++E+GQEGF
Sbjct  522   ILSGSGD--DNNSSSADDISDCNVQSSSNQRSRVPGLQRDIEVLKSELLKFVAEYGQEGF  579

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFR+IA +MNLSLAYK+RKPKGYWDNLENLQDEISRF
Sbjct  580   MPMRKQLRLHGRVDIEKAITRMGGFRKIATIMNLSLAYKYRKPKGYWDNLENLQDEISRF  639

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQP-SFGKE  971
             QR WGMDPS+MPSRKSFER GR+DIARALEKWGGLHEVSRLLSLK R    RQ  + GK+
Sbjct  640   QRCWGMDPSFMPSRKSFERVGRFDIARALEKWGGLHEVSRLLSLKARRKRTRQDNNLGKD  699

Query  972   KK------FDVNGE-EKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             KK       DV+ E     R Y+SQD HKW T+LKELDINWVE
Sbjct  700   KKNDHRESADVDSEINAASRPYISQDTHKWHTELKELDINWVE  742


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 54/104 (52%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  +Y  + ARV+LDL E +    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  153  IWLEQRGFQRAMYWHIEARVVLDLQELLNSEWDRELHFSMVDGDFKKFEGKWSVKS-GTR  211

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIER  377
             +    S E  +          +E ++  DLP NL A+   +ER
Sbjct  212  SSSTNLSYEVNVIPRFNFPAIFLERIVRSDLPVNLRALAYRVER  255



>gb|AET04842.2| polyketide cyclase/dehydrase and lipid transporter [Medicago 
truncatula]
Length=742

 Score =   474 bits (1220),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 238/343 (69%), Positives = 274/343 (80%), Gaps = 11/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHA V+LDLCE++E+EISFEQ EGDFDSF GKW  EQLG+HHTLL
Sbjct  402   VRILQEGCKGLLYMVLHAHVVLDLCEQLEQEISFEQAEGDFDSFHGKWTFEQLGNHHTLL  461

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KYSV+SKM +++FLSEAIMEEVIYEDLPSNLCAIRDY+E  +A    +  E  T    +I
Sbjct  462   KYSVDSKMRRDTFLSEAIMEEVIYEDLPSNLCAIRDYVENQKASQFLEVCEQNTNSGQQI  521

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              ++   D   ++ S  ++ SD     S  QR +VPGLQRDIE+L++ELL F++E+GQEGF
Sbjct  522   ILSGSGD--DNNSSSADDISDCNVQSSSNQRSRVPGLQRDIEVLKSELLKFVAEYGQEGF  579

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFR+IA +MNLSLAYK+RKPKGYWDNLENLQDEISRF
Sbjct  580   MPMRKQLRLHGRVDIEKAITRMGGFRKIATIMNLSLAYKYRKPKGYWDNLENLQDEISRF  639

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQP-SFGKE  971
             QR WGMDPS+MPSRKSFER GR+DIARALEKWGGLHEVSRLLSLK R    RQ  + GK+
Sbjct  640   QRCWGMDPSFMPSRKSFERVGRFDIARALEKWGGLHEVSRLLSLKARRKRTRQDNNLGKD  699

Query  972   KK------FDVNGE-EKTPRAYVSQDAHKWLTKLKELDINWVE  1079
             KK       DV+ E     R Y+SQD HKW T+LKELDINWVE
Sbjct  700   KKNDHRESADVDSEINAASRPYISQDTHKWHTELKELDINWVE  742


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 54/104 (52%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  +Y  + ARV+LDL E +    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  153  IWLEQRGFQRAMYWHIEARVVLDLQELLNSEWDRELHFSMVDGDFKKFEGKWSVKS-GTR  211

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIER  377
             +    S E  +          +E ++  DLP NL A+   +ER
Sbjct  212  SSSTNLSYEVNVIPRFNFPAIFLERIVRSDLPVNLRALAYRVER  255



>ref|XP_004503886.1| PREDICTED: uncharacterized protein LOC101501397 isoform X1 [Cicer 
arietinum]
Length=724

 Score =   473 bits (1217),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 241/343 (70%), Positives = 280/343 (82%), Gaps = 12/343 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSFQGKW  EQLG+HHTLL
Sbjct  385   VRILQEGCKGLLYMVLHARVVLDLCECLEQEISFEQVEGDFDSFQGKWTFEQLGNHHTLL  444

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN-AEKTQEYVTYGEAE  434
             KYSV+SKM K++FLSEAIMEEVIYEDLPSNLCAIRDY+E  +A   +E  ++    G+  
Sbjct  445   KYSVDSKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYVENQKASQFSEVCEQNTNSGQIV  504

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             I      D S+ S   + + +  ++S     RP+VPGLQRDIE+L++ELL F++E+GQEG
Sbjct  505   ISSGSGDDNSSSSDDAFSDCNVQISSN---HRPRVPGLQRDIEVLKSELLKFVAEYGQEG  561

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFR+IA +MNLSLAYK+RKPKGYWDNLENLQDEISR
Sbjct  562   FMPMRKQLRLHGRVDIEKAITRMGGFRKIATIMNLSLAYKNRKPKGYWDNLENLQDEISR  621

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHP-NRQPSFGKE  971
             FQRSWGMDPS+MPSRKSFERAGR+DIARALEKWGGLHEVSRLLSLK R   +RQ +  K+
Sbjct  622   FQRSWGMDPSFMPSRKSFERAGRFDIARALEKWGGLHEVSRLLSLKPRRKRSRQDNLAKD  681

Query  972   KKF------DVNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
             +K       DV+ E KT  R Y+SQD HKW  +LK+LDINWVE
Sbjct  682   RKNDEMELPDVDSEMKTASRPYISQDTHKWHKELKQLDINWVE  724


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 5/104 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  +Y  + ARV+LDL E +    + E+ F  V+GDF  F+GKW ++  G+ 
Sbjct  136  IWLEQRGFQRAMYWHIEARVVLDLQELLNSEWDRELHFSMVDGDFKKFEGKWSVKS-GTR  194

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIER  377
             +    S E  +          +E +I  DLP NL A+   +ER
Sbjct  195  SSSTNLSYEVNVIPRFNFPAIFLERIIRSDLPVNLRALAYRVER  238



>ref|XP_008785879.1| PREDICTED: uncharacterized protein LOC103704391 isoform X1 [Phoenix 
dactylifera]
Length=722

 Score =   473 bits (1217),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 240/344 (70%), Positives = 272/344 (79%), Gaps = 17/344 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E++E EISFEQVEGDFDSFQGKWILEQLG  HTLL
Sbjct  386   VRILQEGCKGLLYMVLHARVVLDLHEELECEISFEQVEGDFDSFQGKWILEQLGDQHTLL  445

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQ---EYVTYGE  428
             KY VESKMHK++FLSEAI+EEVIYEDLPSNLCAIRD++E+ EA   E  +   + V    
Sbjct  446   KYIVESKMHKDTFLSEAILEEVIYEDLPSNLCAIRDFVEKREAAGNEPPKYPDKLVVPVS  505

Query  429   AEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
               + +   K     SI+        V++   RQRPKVPGLQRDIE+L+AEL+ FIS +GQ
Sbjct  506   NYVHVIESKPAEHVSIT-------DVSAIPLRQRPKVPGLQRDIEVLKAELMSFISRYGQ  558

Query  609   EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
             +GFMPMRKQLR HGRVDIEKAITRMGGFR+IA LMNLSLAYKHRKP GYWDNLENLQ+EI
Sbjct  559   DGFMPMRKQLRMHGRVDIEKAITRMGGFRKIADLMNLSLAYKHRKPSGYWDNLENLQEEI  618

Query  789   SRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGK  968
              RFQ+SWGMDP+YMPSRKSFERAGRYDIARALEKWGGL EV RLLSLK RHP R   F +
Sbjct  619   RRFQKSWGMDPAYMPSRKSFERAGRYDIARALEKWGGLQEVCRLLSLKPRHPRRHLDFDR  678

Query  969   EKKFDV------NGEEKT-PRAYVSQDAHKWLTKLKELDINWVE  1079
             E++ D       +GEEK   + Y+ QD  KWL KLK+LDINWVE
Sbjct  679   EEQHDFKARSEPDGEEKIQSKPYIPQDTEKWLRKLKDLDINWVE  722


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 9/118 (8%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E  +     E+ +  V+GDF  F+GKW + + G  
Sbjct  137  IWLEQRGLQRALYWHIEARVVLDLQEIPDSANGRELHYSMVDGDFKKFEGKWSV-KAGPR  195

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVT  419
             +    S E  +          +E +I  DLP NL A+    ER    N+E+ Q+ +T
Sbjct  196  SSTAILSYEVNVIPRFNFPAIFLERIIRSDLPVNLRALACRAER----NSEENQKMLT  249



>ref|XP_010912051.1| PREDICTED: uncharacterized protein LOC105038057 [Elaeis guineensis]
Length=722

 Score =   473 bits (1216),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 241/349 (69%), Positives = 274/349 (79%), Gaps = 27/349 (8%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDL E++E EISFEQVEGDFDSFQGKW+LEQLG  HTLL
Sbjct  386   VRILQEGCKGLLYMVLHARVVLDLHEELEREISFEQVEGDFDSFQGKWLLEQLGDQHTLL  445

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VESKMHK++FLSEAI+EEVIYEDLPSNLCAIRD++E+ EA    K+ +Y        
Sbjct  446   KYIVESKMHKDTFLSEAILEEVIYEDLPSNLCAIRDFVEKREAA-GNKSPKY--------  496

Query  438   KITPDKDLSADS-------ISPYEETSDS-VNSESHRQRPKVPGLQRDIEILRAELLGFI  593
                PDK +   S         P E+ S S V++   RQRPKVPGLQRDIE+L+AEL+ FI
Sbjct  497   ---PDKLVVPVSNYVHVIESKPAEQVSTSDVSAAPLRQRPKVPGLQRDIEVLKAELMSFI  553

Query  594   SEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLEN  773
             S +GQ+GFMPMRKQLR HGRVDIEKAITRMGGFR+IA +MNLSLAYK RKP GYWDNLEN
Sbjct  554   SRYGQDGFMPMRKQLRMHGRVDIEKAITRMGGFRKIANMMNLSLAYKRRKPSGYWDNLEN  613

Query  774   LQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ  953
             LQ+EI RFQ++WGMDP+YMPSRKSFERAGRYDIARALEKWGGL EVSRLLSLK+RHP R 
Sbjct  614   LQEEIRRFQKNWGMDPAYMPSRKSFERAGRYDIARALEKWGGLQEVSRLLSLKLRHPRRH  673

Query  954   PSFGKEKKFDV------NGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                  E + D       +GEEK P + Y+ QD  KW  KLK+LDINWVE
Sbjct  674   LDLDSEGQHDFKAPSEPDGEEKIPSKPYIPQDTEKWFMKLKDLDINWVE  722


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (49%), Gaps = 5/109 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW + + G  
Sbjct  137  IWLEQRGLQRALYWHIEARVVLDLQELPDSANGRELHFSMVDGDFKKFEGKWSV-KAGPR  195

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN  392
             +    S E  +          +E +I  DLP NL A+    ER   EN
Sbjct  196  SSAAILSYEVNVIPTFNFPAIFLERIITSDLPVNLRALACRAERNSEEN  244



>ref|NP_680157.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAC35877.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42510.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64894.1| At5g08720 [Arabidopsis thaliana]
 gb|AED91341.1| uncharacterized protein AT5G08720 [Arabidopsis thaliana]
Length=719

 Score =   469 bits (1208),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 237/345 (69%), Positives = 274/345 (79%), Gaps = 17/345 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  380   VRILQEGCKGLLYMVLHARAVLDLHEIREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  439

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM K+SFLSEAIMEEVIYEDLPSNLCAIRDYIE+   E + ++ +  T   +E 
Sbjct  440   KYTVESKMRKDSFLSEAIMEEVIYEDLPSNLCAIRDYIEK-RGEKSSESCKLETCQVSEE  498

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +  +  S +++   ++ SD       +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  499   TCSSSRAKSVETVYNNDDGSDQT-----KQRRRIPGLQRDIEVLKSEILKFISEHGQEGF  553

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA +MNLSLAYKHRKPKGYWDNLENLQ+EI RF
Sbjct  554   MPMRKQLRLHGRVDIEKAITRMGGFRRIALMMNLSLAYKHRKPKGYWDNLENLQEEIGRF  613

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK-  974
             Q+SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+L VRHPNRQ +  K+  
Sbjct  614   QQSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALNVRHPNRQLNSRKDNG  673

Query  975   ---------KFDVNGE-EKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                      + D+N    K  + YVSQD  KWL  LK+LDINWV+
Sbjct  674   NTILRTESTEADLNSTVNKNNKPYVSQDTEKWLYNLKDLDINWVQ  718


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 73/153 (48%), Gaps = 7/153 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E ++     E+ F  V+GDF  F+GKW ++  + S
Sbjct  143  IWLEQRGLQRALYWHIEARVVLDLHECLDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  202

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V      N       +E +I  DLP NL A+    E++  +  + +      
Sbjct  203  VGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEKIYKDCGKPSIIEDLL  260

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESH  521
            G    +  P   +  DS++     + SV S +H
Sbjct  261  GIISSQPAPSNGIEFDSLATERSVASSVGSLAH  293



>gb|KFK25241.1| hypothetical protein AALP_AA8G086200 [Arabis alpina]
Length=720

 Score =   469 bits (1208),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 234/346 (68%), Positives = 270/346 (78%), Gaps = 22/346 (6%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  384   VRILQEGCKGLLYMVLHARAVLDLHESREQEIRFEQVEGDFDSLKGKWIFEQLGSHHTLL  443

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE+     + +  +  T   +E 
Sbjct  444   KYTVESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK-----SSEPCKVETCHVSEE  498

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
               +  +  S +++   ++ +D       +QRP++P LQRDIE+L++E+L FISEHGQEGF
Sbjct  499   TCSSSRTTSVETVCNNDDGTDQT-----KQRPRIPNLQRDIEVLKSEILKFISEHGQEGF  553

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT+MGGFRRIA +MNLSLAYKHRKPKGYWDNLENLQDEI RF
Sbjct  554   MPMRKQLRLHGRVDIEKAITKMGGFRRIALMMNLSLAYKHRKPKGYWDNLENLQDEIGRF  613

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSL VRHPNRQ +  K+  
Sbjct  614   QQSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLNVRHPNRQQNSRKDNG  673

Query  978   FDVNGEE------------KTPRAYVSQDAHKWLTKLKELDINWVE  1079
               +   E            K  + YVSQD   WL KLK+LDINWV+
Sbjct  674   KTIQRTESIDTDSNSAIISKKNKPYVSQDTENWLYKLKDLDINWVQ  719



>ref|XP_002873379.1| hypothetical protein ARALYDRAFT_487714 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49638.1| hypothetical protein ARALYDRAFT_487714 [Arabidopsis lyrata subsp. 
lyrata]
Length=722

 Score =   467 bits (1202),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 237/345 (69%), Positives = 267/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  383   VRILQEGCKGLLYMVLHARAVLDLHEIREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  442

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM K+SFLSEAIMEEVIYEDLPSNLCAIRDYIE+      EK+ E       E+
Sbjct  443   KYTVESKMRKDSFLSEAIMEEVIYEDLPSNLCAIRDYIEK----RGEKSSESCKLETCEV  498

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                      A ++       D   S+  +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  499   SEETCSSSRATTVETVYNNDDG--SDRTKQRRRIPGLQRDIEVLKSEILKFISEHGQEGF  556

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA +MNLSLAYKHRKPKGYWDNLENLQ+EI RF
Sbjct  557   MPMRKQLRLHGRVDIEKAITRMGGFRRIALMMNLSLAYKHRKPKGYWDNLENLQEEIGRF  616

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK-  974
             Q+SWGMDPS+MPSRK+FERAGRYDIARALEKWGGLHEVSRLL+L VRHPNRQ +  K+  
Sbjct  617   QQSWGMDPSFMPSRKTFERAGRYDIARALEKWGGLHEVSRLLALNVRHPNRQVNSRKDNG  676

Query  975   ---------KFDVNGE-EKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                      + D+N    K    YVSQD  KWL  LK+LDINWV+
Sbjct  677   NTILRTESTEADLNSAVNKKNEPYVSQDTEKWLYNLKDLDINWVQ  721


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E ++     E+ F  V+GDF  F+GKW ++  + S
Sbjct  146  IWLEQRGLQRALYWHIEARVVLDLHECLDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  205

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V      N       +E +I  DLP NL A+    E++  +  + +      
Sbjct  206  IGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEKIYKDCGKPSIIEDLL  263

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESH  521
            G    +  P + +  +S++     + SV S +H
Sbjct  264  GRISSQPAPSRGVEFESLATERSVASSVGSLAH  296



>emb|CDX69927.1| BnaA10g22760D [Brassica napus]
Length=728

 Score =   467 bits (1202),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 234/346 (68%), Positives = 276/346 (80%), Gaps = 18/346 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLG+HHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARAVLDLHETREQEIRFEQVEGDFDSLEGKWIFEQLGNHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE+   E + +T +  T   +E 
Sbjct  449   KYTVESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK-RGEKSSETCKVETCHVSEE  507

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                  +D S +++   + ++D V+    +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  508   SCYSSRDTSTETV---KNSNDCVDQT--KQRARIPGLQRDIEVLKSEILKFISEHGQEGF  562

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA +MNLSLAYK+RKPKGYWDNLENLQ+EI +F
Sbjct  563   MPMRKQLRSHGRVDIEKAITRMGGFRRIAVMMNLSLAYKYRKPKGYWDNLENLQEEIGKF  622

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK-  974
             Q+SWGMDPS+MPSRK+FERAGRYDIARALEKWGGLHEVSRLL+L VRHP+RQ +  K+  
Sbjct  623   QQSWGMDPSFMPSRKTFERAGRYDIARALEKWGGLHEVSRLLALNVRHPSRQLNSRKDNG  682

Query  975   ---------KFDVNG--EEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                        D+N     K  + YVSQD  KWL KLK+LDINWV+
Sbjct  683   GTMQRSESIDTDLNSTLSSKKNKPYVSQDTEKWLYKLKDLDINWVQ  728


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW ++  + S
Sbjct  151  IWLEQRGFQRALYWHIEARVVLDLHECPDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  210

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
               +L Y V      N       +E +I  DLP NL A+    E       + +      
Sbjct  211  VGAVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEINYRAREKPSIIDALL  268

Query  423  GEAEIKITPDKDLSADS-ISPYEETSDSVNSESH  521
            G A +  TP   + ++S ++     + SV S SH
Sbjct  269  GRASVPSTPSHGVESESPVTERSAATSSVGSLSH  302



>emb|CDY21561.1| BnaC09g47310D [Brassica napus]
Length=721

 Score =   466 bits (1200),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 231/344 (67%), Positives = 271/344 (79%), Gaps = 18/344 (5%)
 Frame = +3

Query  84    ILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKY  263
             ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLG+HHTLLKY
Sbjct  384   ILQEGCKGLLYMVLHARAVLDLHETREQEIRFEQVEGDFDSLEGKWIFEQLGNHHTLLKY  443

Query  264   SVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIKI  443
             +VESKM +++FLSEAIMEEVIYEDLPSNLCAIRDYIE+   E + +T +  T   +E   
Sbjct  444   TVESKMRRDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK-RGEKSSETCKVETCHVSEETC  502

Query  444   TPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMP  623
                +D S +++    + +D       +QR ++PGLQRDIE+L++E+L FISEHGQEGFMP
Sbjct  503   YSSRDTSTETVKDSNDCADQT-----KQRARIPGLQRDIEVLKSEILKFISEHGQEGFMP  557

Query  624   MRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQR  803
             MRKQLR HGRVDIEKAITRMGGFRRIA +MNLSLAYK+RKPKGYWDNLENLQ+EI +FQ+
Sbjct  558   MRKQLRSHGRVDIEKAITRMGGFRRIAVMMNLSLAYKYRKPKGYWDNLENLQEEIGKFQQ  617

Query  804   SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ----------  953
             SWGMDPS+MPSRK+FERAGRYDIARALEKWGGLHEVSRLL+L VRHP+RQ          
Sbjct  618   SWGMDPSFMPSRKTFERAGRYDIARALEKWGGLHEVSRLLALNVRHPSRQLNSRKDNGGT  677

Query  954   PSFGKEKKFDVNG--EEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                G+    D+N     K  + YVSQD  KWL KLK+LDINWV+
Sbjct  678   TQRGESIDGDLNSTLSSKKNKPYVSQDTEKWLYKLKDLDINWVQ  721


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 71/154 (46%), Gaps = 8/154 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW ++  + S
Sbjct  144  IWLEQRGLQRALYWHIEARVVLDLHECPDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  203

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
               +L Y V      N       +E +I  DLP NL A+    E       + +      
Sbjct  204  VGAVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEINYKAREKPSIIDALL  261

Query  423  GEAEIKITPDKDLSADS-ISPYEETSDSVNSESH  521
            G A +  TP   + ++S ++     + SV S SH
Sbjct  262  GRASVPSTPSHGVESESPVTERYAATSSVGSLSH  295



>ref|XP_009122491.1| PREDICTED: uncharacterized protein LOC103847185 [Brassica rapa]
Length=724

 Score =   466 bits (1199),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 231/346 (67%), Positives = 273/346 (79%), Gaps = 18/346 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHA+ +LDL E  E+EI FEQVEGDFDS +GKWI EQLG+HHTLL
Sbjct  385   VRILQEGCKGLLYMVLHAKAVLDLHETREQEIRFEQVEGDFDSLEGKWIFEQLGNHHTLL  444

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESKM K++FLSEAIMEEVIYEDLPSNLCAIRDYIE+   + + +T +  T   +E 
Sbjct  445   KYTVESKMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK-RGDKSSETCKVETCHVSEE  503

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                  +D S +++    + +D       +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  504   TCYSSRDTSTETVKNSNDCADQT-----KQRARIPGLQRDIEVLKSEILKFISEHGQEGF  558

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA +MNLSLAYK+RKPKGYWDNLENLQ+EI +F
Sbjct  559   MPMRKQLRSHGRVDIEKAITRMGGFRRIAVMMNLSLAYKYRKPKGYWDNLENLQEEIGKF  618

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK-  974
             Q+SWGMDPS+MPSRK+FERAGRYDIARALEKWGGLHEVSRLL+L VRHP+RQ +  K+  
Sbjct  619   QQSWGMDPSFMPSRKTFERAGRYDIARALEKWGGLHEVSRLLALNVRHPSRQLNSRKDNG  678

Query  975   ---------KFDVNG--EEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                        D+N     K  + YVSQD  KWL KLK+LDINWV+
Sbjct  679   GTMQRSESIDTDLNSTLSSKKNKPYVSQDTEKWLYKLKDLDINWVQ  724


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 69/150 (46%), Gaps = 9/150 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW ++  + S
Sbjct  147  IWLEQRGLQRALYWHIEARVVLDLHECPDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  206

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
               +L Y V      N       +E +I  DLP NL A+    E       + +      
Sbjct  207  VGAVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEINYRAREKPSIIDALL  264

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNS  512
            G A +  TP    S +S SP  E S + +S
Sbjct  265  GRASVPSTPSH--SVESESPVTERSAATSS  292



>tpg|DAA52389.1| TPA: hypothetical protein ZEAMMB73_348604 [Zea mays]
Length=388

 Score =   453 bits (1166),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 272/345 (79%), Gaps = 22/345 (6%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHARV++DL EK E+EISFEQVEGDF +F+GKW LEQLG  HTLL
Sbjct  54    VRIMQEGCKGLLYMVLHARVVMDLREKHEQEISFEQVEGDFYTFKGKWRLEQLGDQHTLL  113

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMH+++FLSE+I+EEVIYEDLPSNLCAIRDYIE+  A+++  T      G + +
Sbjct  114   KYMVETKMHRDTFLSESILEEVIYEDLPSNLCAIRDYIEKAGAKSSNST------GHSNV  167

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                PD D+  D     E+T  S +S + +QRPKVPGLQ+DIE+L++EL  FI+E+GQ GF
Sbjct  168   PTDPDPDVDHDESRQSEQTCVSCSSSTMKQRPKVPGLQKDIEVLKSELDNFIAEYGQYGF  227

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EISRF
Sbjct  228   MPKRKHLRSHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEISRF  287

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ--------  953
             Q+ WG+DPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL++R+P RQ        
Sbjct  288   QKIWGLDPSYMPSRKSFERAGRYDIARALEKWGGVQEVSRLLSLELRYPRRQADPDDERQ  347

Query  954   ---PSFGKEKKFDVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                PS G  KK  V  +E      VS +A KWL KLK+LD+NWVE
Sbjct  348   SESPS-GMMKKHGVKPDE----GNVSPNAQKWLLKLKDLDVNWVE  387



>ref|XP_009404991.1| PREDICTED: uncharacterized protein LOC103988171 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=609

 Score =   461 bits (1186),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 274/342 (80%), Gaps = 14/342 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V +LQEGCKGLLYMVLHARV+LDLCE  E EI FEQVEGDFDSF+GKW+LEQLG+ HTLL
Sbjct  274   VRVLQEGCKGLLYMVLHARVVLDLCEDFEHEIKFEQVEGDFDSFKGKWLLEQLGNQHTLL  333

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIE-RLEAENAEKTQEYVTYGEAE  434
             KY VES+MH ++FLSEAI+EEVIYEDLPSNLC+IRD +E R+  +N ++      Y +  
Sbjct  334   KYVVESRMHMDTFLSEAILEEVIYEDLPSNLCSIRDAVEDRVGIKNDQRD-----YSDEH  388

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             I    D  L  D     E + +     + RQRPKVPGLQRD+E+L++EL  FIS++GQ+G
Sbjct  389   IGSNSDP-LHDDKSGQNEPSPNGNAVCTIRQRPKVPGLQRDVEVLKSELAAFISKYGQDG  447

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYK RKPKGYWDNLENLQ+EISR
Sbjct  448   FMPMRKQLRLHGRVDIEKAITRMGGFRRIADLMNLSLAYKQRKPKGYWDNLENLQEEISR  507

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ++WGMDP+YMP+RKSFERAGRYDIARALEKWGGL EVSRLLSL++R+P R+    +E 
Sbjct  508   FQKNWGMDPAYMPTRKSFERAGRYDIARALEKWGGLQEVSRLLSLELRYPRRRSDAEQEG  567

Query  975   KFDV------NGEEK-TPRAYVSQDAHKWLTKLKELDINWVE  1079
             + D+      NG+EK + +  ++QD HKWL KLK+LDINWVE
Sbjct  568   QNDLKASNEPNGQEKMSNKPLIAQDTHKWLMKLKDLDINWVE  609



>ref|XP_006286366.1| hypothetical protein CARUB_v10000329mg [Capsella rubella]
 gb|EOA19264.1| hypothetical protein CARUB_v10000329mg [Capsella rubella]
Length=717

 Score =   464 bits (1194),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 232/345 (67%), Positives = 267/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  379   VRILQEGCKGLLYMVLHARAVLDLHEIREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  438

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESK+ K++FLSEAIMEEVIYEDLPSNLCAIRDYIE+      +KT E       ++
Sbjct  439   KYTVESKVRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK----RGDKTSESCKLETCQV  494

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                      A S+     + D   ++  +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  495   SEETCSSSRATSVETVYNSDDG--TDQTKQRRRIPGLQRDIEVLKSEILKFISEHGQEGF  552

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT+MGGFRR+A +MNLSLAYKHRKPKGYWDNLENLQ+EI RF
Sbjct  553   MPMRKQLRLHGRVDIEKAITKMGGFRRVALMMNLSLAYKHRKPKGYWDNLENLQEEIGRF  612

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+L VRHPNRQ +  K+  
Sbjct  613   QQSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALNVRHPNRQLNSRKDNG  672

Query  978   FDVNGEE-----------KTPRAYVSQDAHKWLTKLKELDINWVE  1079
               +   E           K  + YVSQD  KWL  LK+LDINWV+
Sbjct  673   NTIQKTESVDTDSNSTVSKKHKPYVSQDTEKWLYNLKDLDINWVQ  717


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 73/153 (48%), Gaps = 7/153 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E ++     E+ F  V+GDF  F+GKW ++  + S
Sbjct  142  IWLEQRGLQRALYWHIEARVVLDLHESLDSPNGRELHFSMVDGDFKKFEGKWCVKSGIRS  201

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V      N       +E +I  DLP NL A+    E+      + +      
Sbjct  202  IGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEKFYKGCRKPSIIEDLL  259

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESH  521
            G    ++ P  D+  +S++     + SV S SH
Sbjct  260  GRTFSQLAPSHDIEFESLATERSIASSVGSLSH  292



>ref|XP_009404990.1| PREDICTED: uncharacterized protein LOC103988171 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=721

 Score =   460 bits (1183),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 230/342 (67%), Positives = 274/342 (80%), Gaps = 14/342 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V +LQEGCKGLLYMVLHARV+LDLCE  E EI FEQVEGDFDSF+GKW+LEQLG+ HTLL
Sbjct  386   VRVLQEGCKGLLYMVLHARVVLDLCEDFEHEIKFEQVEGDFDSFKGKWLLEQLGNQHTLL  445

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIE-RLEAENAEKTQEYVTYGEAE  434
             KY VES+MH ++FLSEAI+EEVIYEDLPSNLC+IRD +E R+  +N ++      Y +  
Sbjct  446   KYVVESRMHMDTFLSEAILEEVIYEDLPSNLCSIRDAVEDRVGIKNDQRD-----YSDEH  500

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             I    D  L  D     E + +     + RQRPKVPGLQRD+E+L++EL  FIS++GQ+G
Sbjct  501   IGSNSDP-LHDDKSGQNEPSPNGNAVCTIRQRPKVPGLQRDVEVLKSELAAFISKYGQDG  559

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYK RKPKGYWDNLENLQ+EISR
Sbjct  560   FMPMRKQLRLHGRVDIEKAITRMGGFRRIADLMNLSLAYKQRKPKGYWDNLENLQEEISR  619

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ++WGMDP+YMP+RKSFERAGRYDIARALEKWGGL EVSRLLSL++R+P R+    +E 
Sbjct  620   FQKNWGMDPAYMPTRKSFERAGRYDIARALEKWGGLQEVSRLLSLELRYPRRRSDAEQEG  679

Query  975   KFDV------NGEEK-TPRAYVSQDAHKWLTKLKELDINWVE  1079
             + D+      NG+EK + +  ++QD HKWL KLK+LDINWVE
Sbjct  680   QNDLKASNEPNGQEKMSNKPLIAQDTHKWLMKLKDLDINWVE  721


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 53/109 (49%), Gaps = 5/109 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E        E+ F  V+GDF  F+GKW + + G  
Sbjct  139  IWLEQRGLQRALYWHIEARVVLDLQEFPNSANGSELHFSMVDGDFSKFEGKWTV-KAGPR  197

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN  392
             ++   S E  +          +E +I  DLP NL A+    ER   EN
Sbjct  198  SSMATLSYEVTVVPRFNFPAIFLERIIGSDLPVNLRAVACRAERNFEEN  246



>ref|XP_010491527.1| PREDICTED: uncharacterized protein LOC104769093 [Camelina sativa]
Length=726

 Score =   459 bits (1181),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 230/345 (67%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  388   VRIVQEGCKGLLYMVLHARAVLDLHEIREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  447

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESK+ K++FLSEAIMEEVIYEDLPSNLCAIRDYIE+      EK  E       ++
Sbjct  448   KYTVESKVRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK----RGEKYSESCKLETCQV  503

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                      A S+       D   ++  +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  504   SEETCSSSGATSVETIYNNDDG--TDQTKQRRRIPGLQRDIEVLKSEILKFISEHGQEGF  561

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT+MGGFRR+A +MNL+LAYKHRKPKGYWDNLENLQ+EI RF
Sbjct  562   MPMRKQLRLHGRVDIEKAITKMGGFRRVALMMNLALAYKHRKPKGYWDNLENLQEEIGRF  621

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ--------  953
             Q+SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+L VRHPNRQ        
Sbjct  622   QQSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALNVRHPNRQLNSRKDNG  681

Query  954   PSFGKEKKFDVNGEEKTP---RAYVSQDAHKWLTKLKELDINWVE  1079
              +  K +    N + K       YVSQD  KWL  LK+LDINWV+
Sbjct  682   NTIQKTESIHTNLDSKVNEKHNPYVSQDTEKWLYNLKDLDINWVQ  726


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 73/153 (48%), Gaps = 7/153 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E ++     E+ F  V+GDF  F+GKW ++  + S
Sbjct  151  IWLEQRGLQRALYWHIEARVVLDLHECLDSPNGRELHFSMVDGDFKKFEGKWSVKSGVRS  210

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V      N       +E +I  DLP NL A+    E++  +  + +      
Sbjct  211  IGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEKIYKDCGKPSIIEDLL  268

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESH  521
            G    ++ P   +  + ++     + SV S SH
Sbjct  269  GRTFSQLAPSHGIEFEGLATERSVASSVGSLSH  301



>ref|XP_010452890.1| PREDICTED: uncharacterized protein LOC104734906 [Camelina sativa]
Length=726

 Score =   459 bits (1180),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 231/348 (66%), Positives = 266/348 (76%), Gaps = 23/348 (7%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  388   VRILQEGCKGLLYMVLHARAVLDLHEIREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  447

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESK+ K++FLSEAIMEEVIYEDLPSNLCAIRDYIE+      EK  E       ++
Sbjct  448   KYTVESKVRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIEK----RGEKYSESCKLETCQV  503

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                      A S+       D   ++  +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  504   SEETCSSSGATSVETIYNNDDG--TDQTKQRRRIPGLQRDIEVLKSEILKFISEHGQEGF  561

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEK+IT+MGGFRR+A +MNL+LAYKHRKPKGYWDNLENLQ+EI RF
Sbjct  562   MPMRKQLRLHGRVDIEKSITKMGGFRRVALIMNLALAYKHRKPKGYWDNLENLQEEIGRF  621

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+L VRHPNRQ +    +K
Sbjct  622   QQSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALNVRHPNRQLN---SRK  678

Query  978   FDVNGEEKTP--------------RAYVSQDAHKWLTKLKELDINWVE  1079
              + N  +KT                 YVSQD  KWL  LK+LDINWV+
Sbjct  679   DNGNTTQKTESIHTNLDSKVNEKHNPYVSQDTEKWLYNLKDLDINWVQ  726


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E ++     E+ F  V+GDF  F+GKW ++  + S
Sbjct  151  IWLEQRGLQRALYWHIEARVVLDLHECLDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  210

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V      N       +E +I  DLP NL A+    E++  +  + +      
Sbjct  211  IGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEKIYKDCGKPSIIEDLL  268

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESH  521
            G    ++ P   +  DS++     + S+ S SH
Sbjct  269  GRTFSQLAPSHGIEFDSLATERSVASSIGSLSH  301



>ref|XP_010423027.1| PREDICTED: uncharacterized protein LOC104708207 [Camelina sativa]
Length=725

 Score =   454 bits (1169),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 264/345 (77%), Gaps = 17/345 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  387   VRIVQEGCKGLLYMVLHARAVLDLHEIREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  446

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VESK+ K++FLSEAI+EEVIYEDLPSNLCAIRDYIE+      EK  E       ++
Sbjct  447   KYTVESKVRKDTFLSEAIIEEVIYEDLPSNLCAIRDYIEK----RGEKYSESCKLETCQV  502

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                      A S+       D   ++  +QR ++PGLQRDIE+L++E++ FISEHGQEGF
Sbjct  503   SEETCYSSGATSVETVYNNDDG--TDQTKQRRRIPGLQRDIEVLKSEIIKFISEHGQEGF  560

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAIT+MGGFRR+A +MNL+LAYKHRKPKGYWDNLENLQ+EI RF
Sbjct  561   MPMRKQLRLHGRVDIEKAITKMGGFRRVALIMNLALAYKHRKPKGYWDNLENLQEEIGRF  620

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPS------  959
             Q+SWGMDPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLL+L VRHPNRQ +      
Sbjct  621   QQSWGMDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLALNVRHPNRQLNSRKDNG  680

Query  960   --FGKEKKFDVNGEEKTP---RAYVSQDAHKWLTKLKELDINWVE  1079
                 K +    N + K       YVSQD  KWL  LK+LDINWV+
Sbjct  681   NIIQKTESIHTNLDSKVNEKHNPYVSQDTEKWLYNLKDLDINWVQ  725


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 74/153 (48%), Gaps = 7/153 (5%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQ-LGS  242
            +++ Q G +  LY  + ARV+LDL E ++     E+ F  V+GDF  F+GKW ++  + S
Sbjct  150  IWLEQRGLQRALYWHIEARVVLDLHECLDSPNGRELHFSMVDGDFKKFEGKWSVKSGIRS  209

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
              T+L Y V      N       +E +I  DLP NL A+    E++  +  + +      
Sbjct  210  IGTVLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLRAVARQAEKIYKDCGKPSIIEDLL  267

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESH  521
            G    ++ P   +  +S++     + SV S SH
Sbjct  268  GRTFSQLAPSHGIEFESLATERSVASSVGSLSH  300



>ref|XP_002466133.1| hypothetical protein SORBIDRAFT_01g001990 [Sorghum bicolor]
 gb|EER93131.1| hypothetical protein SORBIDRAFT_01g001990 [Sorghum bicolor]
Length=717

 Score =   454 bits (1167),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 226/340 (66%), Positives = 268/340 (79%), Gaps = 14/340 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHARV++DL EK E+EI FEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  385   VRIMQEGCKGLLYMVLHARVVMDLREKFEQEIRFEQVEGDFYSFKGKWRLEQLGDQHTLL  444

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMH+++FLSE+I+EEVIYEDLPSNLCAIRDYIE+  A+ +  T        +++
Sbjct  445   KYMVETKMHRDTFLSESILEEVIYEDLPSNLCAIRDYIEKAGAKGSNST------AHSDV  498

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I PD   +    S  E+ S S +S + +QRPKVPGLQ+DIE+L++EL  FI+E+GQ GF
Sbjct  499   SIDPDAYHAESRQS--EQASVSCSSSTMKQRPKVPGLQKDIEVLKSELENFIAEYGQYGF  556

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EISRF
Sbjct  557   MPKRKHLRSHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEISRF  616

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SWGMDPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSLK+R P RQ     E +
Sbjct  617   QKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGVQEVSRLLSLKLRRPRRQGDLDDESR  676

Query  978   FDVNGEE------KTPRAYVSQDAHKWLTKLKELDINWVE  1079
              +   E       K  +  VS DA KWL KLK+LD+NWVE
Sbjct  677   SESPSEMTKKHGVKPDKGNVSPDAQKWLLKLKDLDVNWVE  716


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 55/110 (50%), Gaps = 7/110 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW I     S
Sbjct  138  IWLEQRGLQQALYWHIEARVVLDLQEIHDSINGRELHFSMVDGDFKKFEGKWSIRSGPRS  197

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN  392
               +L Y V      N       +E++I  DLP NL A+    E++  EN
Sbjct  198  SSAVLLYEVNVIPRFN--FPAIFLEKIIRSDLPVNLGALACRAEKIYLEN  245



>gb|KHN31201.1| Trafficking protein particle complex subunit 2 [Glycine soja]
Length=870

 Score =   457 bits (1177),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 227/312 (73%), Positives = 260/312 (83%), Gaps = 5/312 (2%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV+LDLCE +E+EISFEQVEGDFDSF+GKWI EQLG+HHTLL
Sbjct  395   VRILQEGCKGLLYMVLHARVVLDLCEYLEQEISFEQVEGDFDSFRGKWIFEQLGNHHTLL  454

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEA-ENAEKTQEYVTYGEAE  434
             KYSVESKM K++FLSEAIMEEVIYEDLPSNL AIRDYIE + A +++E  ++    G+  
Sbjct  455   KYSVESKMRKDTFLSEAIMEEVIYEDLPSNLSAIRDYIENMNASKSSEVCEQNTNSGQQI  514

Query  435   IKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
             +     KD   D+    EE        S +QR KVPGLQR+I++L +ELL FI+EHGQEG
Sbjct  515   VSSGSQKD---DNSGSTEEVPHCDVRCSSQQRSKVPGLQRNIKVLESELLKFIAEHGQEG  571

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMPMRKQLR HGRVDIEKAITRMGGFR+IA ++NLSLAYKHRKPKGYWDNLENLQ+EISR
Sbjct  572   FMPMRKQLRLHGRVDIEKAITRMGGFRKIATILNLSLAYKHRKPKGYWDNLENLQEEISR  631

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQRSWG+DPS+MPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVR  +RQ +  K+K
Sbjct  632   FQRSWGIDPSFMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRQRSRQDNLAKDK  691

Query  975   KFD-VNGEEKTP  1007
             + D  + E KTP
Sbjct  692   RSDHTDSEMKTP  703



>ref|XP_004981125.1| PREDICTED: uncharacterized protein LOC101782261 isoform X1 [Setaria 
italica]
Length=718

 Score =   453 bits (1165),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/342 (67%), Positives = 270/342 (79%), Gaps = 16/342 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHARV++DL EK+EEEISFEQVEGDF SF+GKW  EQLG  HTLL
Sbjct  384   VRIMQEGCKGLLYMVLHARVVMDLREKLEEEISFEQVEGDFYSFKGKWRFEQLGDQHTLL  443

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EE+IYEDLPSNLCAIRDYIE+  AE +  T    T+  A  
Sbjct  444   KYMVETKMHKDTFLSESILEEIIYEDLPSNLCAIRDYIEKAGAEGSNST----THSAAPT  499

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                PD D + D  S  E+ S S +  S +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  500   H--PDIDHAEDRQS--EKESASCSFSSMKQRPKVPGLQKDIEVLKSELENFIAKYGQDGF  555

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA  MNLSL+YK+RKP+GYWDNLENLQ+EISRF
Sbjct  556   MPKRKHLRSHGRVDIEKAITRMGGFRKIASTMNLSLSYKNRKPRGYWDNLENLQEEISRF  615

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SWGMDPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL++R P RQ     E++
Sbjct  616   QKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGVQEVSRLLSLELRRPRRQADSDDERQ  675

Query  978   FDVNGEE--------KTPRAYVSQDAHKWLTKLKELDINWVE  1079
              +             K  +A  S DAHKWL KLK+LD+NWVE
Sbjct  676   SESPAGSGITKQHGMKPDKANTSLDAHKWLLKLKDLDVNWVE  717


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 47/176 (27%), Positives = 76/176 (43%), Gaps = 18/176 (10%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW +    S 
Sbjct  140  IWLEQRGLQQALYWHIEARVVLDLQEVPDSINGRELHFSMVDGDFKKFEGKWSIRSGPSR  199

Query  246  HT--LLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVT  419
             +  +L Y V      N       +E +I  DLP NL A+    E++  EN         
Sbjct  200  SSSAILLYEVNVIPRFN--FPAIFLERIIRSDLPVNLRALACRAEKIYLENQR-------  250

Query  420  YGEAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLG  587
             G + +   P    S  S   +  ++    S   ++ P   G+   +    +EL+G
Sbjct  251  CGFSAVDSKPS---STSSQLKFHSSTIDTTSSKFKEAPPTSGVGSVLPSPSSELIG  303



>ref|XP_008666956.1| PREDICTED: uncharacterized protein LOC103645724 [Zea mays]
Length=728

 Score =   453 bits (1165),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 272/345 (79%), Gaps = 22/345 (6%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHARV++DL EK E+EISFEQVEGDF +F+GKW LEQLG  HTLL
Sbjct  394   VRIMQEGCKGLLYMVLHARVVMDLREKHEQEISFEQVEGDFYTFKGKWRLEQLGDQHTLL  453

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMH+++FLSE+I+EEVIYEDLPSNLCAIRDYIE+  A+++  T      G + +
Sbjct  454   KYMVETKMHRDTFLSESILEEVIYEDLPSNLCAIRDYIEKAGAKSSNST------GHSNV  507

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                PD D+  D     E+T  S +S + +QRPKVPGLQ+DIE+L++EL  FI+E+GQ GF
Sbjct  508   PTDPDPDVDHDESRQSEQTCVSCSSSTMKQRPKVPGLQKDIEVLKSELDNFIAEYGQYGF  567

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EISRF
Sbjct  568   MPKRKHLRSHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEISRF  627

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ--------  953
             Q+ WG+DPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL++R+P RQ        
Sbjct  628   QKIWGLDPSYMPSRKSFERAGRYDIARALEKWGGVQEVSRLLSLELRYPRRQADPDDERQ  687

Query  954   ---PSFGKEKKFDVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                PS G  KK  V  +E      VS +A KWL KLK+LD+NWVE
Sbjct  688   SESPS-GMMKKHGVKPDEGN----VSPNAQKWLLKLKDLDVNWVE  727



>ref|XP_004981126.1| PREDICTED: uncharacterized protein LOC101782261 isoform X2 [Setaria 
italica]
Length=717

 Score =   452 bits (1164),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 229/342 (67%), Positives = 270/342 (79%), Gaps = 16/342 (5%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHARV++DL EK+EEEISFEQVEGDF SF+GKW  EQLG  HTLL
Sbjct  383   VRIMQEGCKGLLYMVLHARVVMDLREKLEEEISFEQVEGDFYSFKGKWRFEQLGDQHTLL  442

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EE+IYEDLPSNLCAIRDYIE+  AE +  T    T+  A  
Sbjct  443   KYMVETKMHKDTFLSESILEEIIYEDLPSNLCAIRDYIEKAGAEGSNST----THSAAPT  498

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                PD D + D  S  E+ S S +  S +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  499   H--PDIDHAEDRQS--EKESASCSFSSMKQRPKVPGLQKDIEVLKSELENFIAKYGQDGF  554

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA  MNLSL+YK+RKP+GYWDNLENLQ+EISRF
Sbjct  555   MPKRKHLRSHGRVDIEKAITRMGGFRKIASTMNLSLSYKNRKPRGYWDNLENLQEEISRF  614

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q+SWGMDPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL++R P RQ     E++
Sbjct  615   QKSWGMDPSYMPSRKSFERAGRYDIARALEKWGGVQEVSRLLSLELRRPRRQADSDDERQ  674

Query  978   FDVNGEE--------KTPRAYVSQDAHKWLTKLKELDINWVE  1079
              +             K  +A  S DAHKWL KLK+LD+NWVE
Sbjct  675   SESPAGSGITKQHGMKPDKANTSLDAHKWLLKLKDLDVNWVE  716


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 48/175 (27%), Positives = 75/175 (43%), Gaps = 17/175 (10%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW I     S
Sbjct  140  IWLEQRGLQQALYWHIEARVVLDLQEVPDSINGRELHFSMVDGDFKKFEGKWSIRSGPRS  199

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTY  422
               +L Y V      N       +E +I  DLP NL A+    E++  EN          
Sbjct  200  SSAILLYEVNVIPRFN--FPAIFLERIIRSDLPVNLRALACRAEKIYLENQR-------C  250

Query  423  GEAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLG  587
            G + +   P    S  S   +  ++    S   ++ P   G+   +    +EL+G
Sbjct  251  GFSAVDSKPS---STSSQLKFHSSTIDTTSSKFKEAPPTSGVGSVLPSPSSELIG  302



>gb|EEE60262.1| hypothetical protein OsJ_13288 [Oryza sativa Japonica Group]
Length=703

 Score =   446 bits (1147),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  368   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  427

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDYIE+ EAE+   T   +    A+ 
Sbjct  428   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYIEKAEAESGNSTSSSIVASNADT  487

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I  D      S    E+ S S +S   +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  488   -IAIDYAEGRQS----EQASTSCSSSPVKQRPKVPGLQKDIEVLKSELEKFIAKYGQDGF  542

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EI RF
Sbjct  543   MPKRKHLRLHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEIRRF  602

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDP+YMPSRKSFERAGRYDIARALEKWGG+HEVSRLLSL++R P R+ +   E K
Sbjct  603   QKNWGMDPAYMPSRKSFERAGRYDIARALEKWGGVHEVSRLLSLELRRPRRRANSDDESK  662

Query  978   FD-----VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                     N     P +  VS D  KWL KLK+LD NW+E
Sbjct  663   AGSSYAITNKHASKPNKPSVSPDKQKWLLKLKDLDANWIE  702



>ref|NP_001051834.1| Os03g0837900 [Oryza sativa Japonica Group]
 gb|ABF99781.1| Streptomyces cyclase/dehydrase family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13748.1| Os03g0837900 [Oryza sativa Japonica Group]
Length=722

 Score =   446 bits (1147),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  387   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  446

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDYIE+ EAE+   T   +    A+ 
Sbjct  447   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYIEKAEAESGNSTSSSIVASNADT  506

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I  D      S    E+ S S +S   +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  507   -IAIDYAEGRQS----EQASTSCSSSPVKQRPKVPGLQKDIEVLKSELEKFIAKYGQDGF  561

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EI RF
Sbjct  562   MPKRKHLRLHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEIRRF  621

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDP+YMPSRKSFERAGRYDIARALEKWGG+HEVSRLLSL++R P R+ +   E K
Sbjct  622   QKNWGMDPAYMPSRKSFERAGRYDIARALEKWGGVHEVSRLLSLELRRPRRRANSDDESK  681

Query  978   FD-----VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                     N     P +  VS D  KWL KLK+LD NW+E
Sbjct  682   AGSSYAITNKHASKPNKPSVSPDKQKWLLKLKDLDANWIE  721



>gb|EEC76487.1| hypothetical protein OsI_14236 [Oryza sativa Indica Group]
Length=750

 Score =   446 bits (1148),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  415   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  474

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDYIE+ EAE+   T   +    A+ 
Sbjct  475   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYIEKAEAESGNSTSSSIVASNADT  534

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I  D      S    E+ S S +S   +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  535   -IAIDYAEGRQS----EQASTSCSSSPVKQRPKVPGLQKDIEVLKSELEKFIAKYGQDGF  589

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EI RF
Sbjct  590   MPKRKHLRLHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEIRRF  649

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDP+YMPSRKSFERAGRYDIARALEKWGG+HEVSRLLSL++R P R+ +   E K
Sbjct  650   QKNWGMDPAYMPSRKSFERAGRYDIARALEKWGGVHEVSRLLSLELRRPRRRANSDDESK  709

Query  978   FD-----VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                     N     P +  VS D  KWL KLK+LD NW+E
Sbjct  710   AGSSYAITNKHASKPNKPSVSPDKQKWLLKLKDLDANWIE  749



>ref|XP_006651999.1| PREDICTED: uncharacterized protein LOC102700516 [Oryza brachyantha]
Length=576

 Score =   441 bits (1133),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/340 (66%), Positives = 264/340 (78%), Gaps = 11/340 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  241   VRILQEGCKGLLYMVLHARVVMDLHEKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  300

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDYIE+ EAE+   T        ++ 
Sbjct  301   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYIEKAEAESGNSTTSSCVATNSDT  360

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I+ D      S    E+ S S +S   +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  361   -ISVDYAEGRQS----EQASSSCSSSPAKQRPKVPGLQKDIEVLKSELERFIAKYGQDGF  415

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EI RF
Sbjct  416   MPKRKHLRLHGRVDIEKAITRMGGFRKIAGIMNLSLSYKNRKPRGYWDNLENLQEEIRRF  475

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL++R P RQ +   E K
Sbjct  476   QKNWGMDPSYMPSRKSFERAGRYDIARALEKWGGVQEVSRLLSLELRRPRRQANSADESK  535

Query  978   ------FDVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
                          K  +  VS D  KWL KLK+LD NW+E
Sbjct  536   AGSSCAMTNKNASKPEKPSVSPDKQKWLLKLKDLDANWIE  575



>gb|AAO41142.1| unknown protein [Oryza sativa Japonica Group]
Length=782

 Score =   446 bits (1148),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 225/340 (66%), Positives = 266/340 (78%), Gaps = 11/340 (3%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  447   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  506

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDYIE+ EAE+   T   +    A+ 
Sbjct  507   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYIEKAEAESGNSTSSSIVASNADT  566

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              I  D      S    E+ S S +S   +QRPKVPGLQ+DIE+L++EL  FI+++GQ+GF
Sbjct  567   -IAIDYAEGRQS----EQASTSCSSSPVKQRPKVPGLQKDIEVLKSELEKFIAKYGQDGF  621

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENLQ+EI RF
Sbjct  622   MPKRKHLRLHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENLQEEIRRF  681

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDP+YMPSRKSFERAGRYDIARALEKWGG+HEVSRLLSL++R P R+ +   E K
Sbjct  682   QKNWGMDPAYMPSRKSFERAGRYDIARALEKWGGVHEVSRLLSLELRRPRRRANSDDESK  741

Query  978   FD-----VNGEEKTP-RAYVSQDAHKWLTKLKELDINWVE  1079
                     N     P +  VS D  KWL KLK+LD NW+E
Sbjct  742   AGSSYAITNKHASKPNKPSVSPDKQKWLLKLKDLDANWIE  781



>ref|XP_010237659.1| PREDICTED: uncharacterized protein LOC100844212 isoform X2 [Brachypodium 
distachyon]
Length=713

 Score =   444 bits (1142),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 265/347 (76%), Gaps = 25/347 (7%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  378   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFFSFKGKWRLEQLGDQHTLL  437

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDY+E+ EAE    T           
Sbjct  438   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYVEKAEAERGNST-----------  486

Query  438   KITPDKDLSADSIS-PYEE------TSDSVNSESHRQRPKVPGLQRDIEILRAELLGFIS  596
              +  D   + D+++  Y E      TS   +S S +QRPKVPGLQ+DIE+L++EL  FIS
Sbjct  487   -VHSDAPTNPDTVAIDYAEERRSVQTSVHCSSSSTKQRPKVPGLQKDIEVLKSELGSFIS  545

Query  597   EHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENL  776
             ++GQ GFMP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENL
Sbjct  546   KYGQNGFMPKRKHLRTHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENL  605

Query  777   QDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP  956
             Q+EI RFQ++WG+DPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL+ R P RQ 
Sbjct  606   QEEIRRFQKNWGIDPSYMPSRKSFERAGRYDIARALEKWGGIQEVSRLLSLEPRRPRRQA  665

Query  957   SFGKEKKFDVNGEEKTPR------AYVSQDAHKWLTKLKELDINWVE  1079
                 EK+ +   E  T          V  DA KWL KLK+LD+NWVE
Sbjct  666   DSDSEKQPESPREATTKHPSKPDEPSVPPDAQKWLLKLKDLDVNWVE  712


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIE----EEISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW +     S
Sbjct  135  IWLEQRGLQQALYWHIEARVVLDLREVPDAVNGRELHFSMVDGDFKKFEGKWSVRSGPRS  194

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEK  401
               +L Y V      N       +E +I  DLP NL A+    E+L  EN ++
Sbjct  195  ASAILLYEVNVIPRFN--FPSIFLERIIRSDLPVNLRALAFRSEKLYLENLKR  245



>ref|XP_010237590.1| PREDICTED: uncharacterized protein LOC100844212 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010237622.1| PREDICTED: uncharacterized protein LOC100844212 isoform X1 [Brachypodium 
distachyon]
Length=717

 Score =   444 bits (1141),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 226/347 (65%), Positives = 265/347 (76%), Gaps = 25/347 (7%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  382   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFFSFKGKWRLEQLGDQHTLL  441

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDY+E+ EAE    T           
Sbjct  442   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYVEKAEAERGNST-----------  490

Query  438   KITPDKDLSADSIS-PYEE------TSDSVNSESHRQRPKVPGLQRDIEILRAELLGFIS  596
              +  D   + D+++  Y E      TS   +S S +QRPKVPGLQ+DIE+L++EL  FIS
Sbjct  491   -VHSDAPTNPDTVAIDYAEERRSVQTSVHCSSSSTKQRPKVPGLQKDIEVLKSELGSFIS  549

Query  597   EHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENL  776
             ++GQ GFMP RK LR HGRVDIEKAITRMGGFR+IA +MNLSL+YK+RKP+GYWDNLENL
Sbjct  550   KYGQNGFMPKRKHLRTHGRVDIEKAITRMGGFRKIASIMNLSLSYKNRKPRGYWDNLENL  609

Query  777   QDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP  956
             Q+EI RFQ++WG+DPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL+ R P RQ 
Sbjct  610   QEEIRRFQKNWGIDPSYMPSRKSFERAGRYDIARALEKWGGIQEVSRLLSLEPRRPRRQA  669

Query  957   SFGKEKKFDVNGEEKTPR------AYVSQDAHKWLTKLKELDINWVE  1079
                 EK+ +   E  T          V  DA KWL KLK+LD+NWVE
Sbjct  670   DSDSEKQPESPREATTKHPSKPDEPSVPPDAQKWLLKLKDLDVNWVE  716


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 56/113 (50%), Gaps = 7/113 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIE----EEISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW +     S
Sbjct  135  IWLEQRGLQQALYWHIEARVVLDLREVPDAVNGRELHFSMVDGDFKKFEGKWSVRSGPRS  194

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEK  401
               +L Y V      N       +E +I  DLP NL A+    E+L  EN ++
Sbjct  195  ASAILLYEVNVIPRFN--FPSIFLERIIRSDLPVNLRALAFRSEKLYLENLKR  245



>dbj|BAJ93672.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=710

 Score =   440 bits (1132),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 224/341 (66%), Positives = 260/341 (76%), Gaps = 13/341 (4%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQV GDF SF+GKW LEQLG  HTLL
Sbjct  375   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVGGDFYSFKGKWRLEQLGDQHTLL  434

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDY+E+ EAE +  T        ++ 
Sbjct  435   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYVEKAEAERSNSTVH------SDA  488

Query  438   KITPDK-DLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEG  614
                PD   L        E+ S   +S S RQRPKVPGLQ+DIE+L++EL  FI +HGQ G
Sbjct  489   PTIPDTVPLCYTQGRQSEQASVQCSSSSTRQRPKVPGLQKDIEVLKSELGSFIEKHGQNG  548

Query  615   FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
             FMP RK LR HGRVDIEKAITRMGGFR+IA LMNLSL+YK+RKP+GYWDNLENLQ+EI R
Sbjct  549   FMPKRKHLRTHGRVDIEKAITRMGGFRKIATLMNLSLSYKNRKPRGYWDNLENLQEEIRR  608

Query  795   FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEK  974
             FQ++WGMDPSYMPSRK+FERAGRYDIARALEKWGG+ EVSRLLSL+ R P +Q     E 
Sbjct  609   FQKNWGMDPSYMPSRKAFERAGRYDIARALEKWGGIQEVSRLLSLEPRRPRKQVDPDDES  668

Query  975   KFDVNGEEKTP------RAYVSQDAHKWLTKLKELDINWVE  1079
             + +              +A V  DA KWL KLK+LDINWVE
Sbjct  669   QPESPSAAAAAGSSKADKASVPLDAQKWLLKLKDLDINWVE  709


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIE----EEISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW +     S
Sbjct  132  IWLEQRGLQQALYWHIEARVVLDLREVPDAVDGRELHFSMVDGDFKKFEGKWSVRAGPRS  191

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN  392
               +L Y V      N       +E +I  DLP NL A+    E++  EN
Sbjct  192  ASAILLYEVNVIPRFN--FPAIFLERIIRSDLPVNLTALAFRSEKMYLEN  239



>gb|EMT15446.1| hypothetical protein F775_09633 [Aegilops tauschii]
Length=585

 Score =   435 bits (1119),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 223/343 (65%), Positives = 255/343 (74%), Gaps = 37/343 (11%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK E EISFEQVEGDF SF+GKW L QLG  HTLL
Sbjct  270   VRILQEGCKGLLYMVLHARVVMDLREKHEREISFEQVEGDFYSFKGKWRLGQLGDQHTLL  329

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDY+E+ EAE   +  E         
Sbjct  330   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYVEKAEAEREGRQSE---------  380

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                              + S   +S S RQRPKVPGLQ+DIE+L++EL  FI++HGQ GF
Sbjct  381   -----------------QASVHCSSSSTRQRPKVPGLQKDIEVLKSELGSFIAKHGQNGF  423

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA LMNLSL+YK+RKP+GYWDNLENL++EI RF
Sbjct  424   MPKRKHLRTHGRVDIEKAITRMGGFRKIATLMNLSLSYKNRKPRGYWDNLENLEEEIRRF  483

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQ--------  953
             Q++WGMDPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL+ R P +Q        
Sbjct  484   QKNWGMDPSYMPSRKSFERAGRYDIARALEKWGGIQEVSRLLSLEPRRPRKQTDPDGEQT  543

Query  954   -PSFGKEKKFDVNGEEKTPRAYVSQDAHKWLTKLKELDINWVE  1079
              PS     K       K  +A V  DA KWL KLK+LDINWVE
Sbjct  544   DPSAADATKHP--SSSKADKASVPLDAQKWLLKLKDLDINWVE  584


 Score = 52.8 bits (125),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIE----EEISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW +     S
Sbjct  27   IWLEQRGLQQALYWHIEARVVLDLREVPDAVDGRELHFSMVDGDFKKFEGKWSVRAGPRS  86

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN  392
               +L Y V      N       +E +I  DLP NL A+    E++  EN
Sbjct  87   ASAILLYEVNVIPRFN--FPAIFLERIIRSDLPVNLTALAFRSEKMYLEN  134



>tpg|DAA52388.1| TPA: hypothetical protein ZEAMMB73_348604 [Zea mays]
Length=718

 Score =   439 bits (1129),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 272/370 (74%), Gaps = 47/370 (13%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V I+QEGCKGLLYMVLHARV++DL EK E+EISFEQVEGDF +F+GKW LEQLG  HTLL
Sbjct  359   VRIMQEGCKGLLYMVLHARVVMDLREKHEQEISFEQVEGDFYTFKGKWRLEQLGDQHTLL  418

Query  258   KYSVESKMHKNSFLSEAIMEE-------------------------VIYEDLPSNLCAIR  362
             KY VE+KMH+++FLSE+I+EE                         VIYEDLPSNLCAIR
Sbjct  419   KYMVETKMHRDTFLSESILEELNALIKFNVFRDSKADCSFFMNLLQVIYEDLPSNLCAIR  478

Query  363   DYIERLEAENAEKTQEYVTYGEAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVP  542
             DYIE+  A+++  T      G + +   PD D+  D     E+T  S +S + +QRPKVP
Sbjct  479   DYIEKAGAKSSNST------GHSNVPTDPDPDVDHDESRQSEQTCVSCSSSTMKQRPKVP  532

Query  543   GLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLS  722
             GLQ+DIE+L++EL  FI+E+GQ GFMP RK LR HGRVDIEKAITRMGGFR+IA +MNLS
Sbjct  533   GLQKDIEVLKSELDNFIAEYGQYGFMPKRKHLRSHGRVDIEKAITRMGGFRKIASIMNLS  592

Query  723   LAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGL  902
             L+YK+RKP+GYWDNLENLQ+EISRFQ+ WG+DPSYMPSRKSFERAGRYDIARALEKWGG+
Sbjct  593   LSYKNRKPRGYWDNLENLQEEISRFQKIWGLDPSYMPSRKSFERAGRYDIARALEKWGGV  652

Query  903   HEVSRLLSLKVRHPNRQ-----------PSFGKEKKFDVNGEEKTPRAYVSQDAHKWLTK  1049
              EVSRLLSL++R+P RQ           PS G  KK  V  +E      VS +A KWL K
Sbjct  653   QEVSRLLSLELRYPRRQADPDDERQSESPS-GMMKKHGVKPDEGN----VSPNAQKWLLK  707

Query  1050  LKELDINWVE  1079
             LK+LD+NWVE
Sbjct  708   LKDLDVNWVE  717



>gb|EMS52767.1| hypothetical protein TRIUR3_14190 [Triticum urartu]
Length=587

 Score =   433 bits (1114),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 222/343 (65%), Positives = 256/343 (75%), Gaps = 35/343 (10%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  270   VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  329

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDY+E+ EAE   +  E         
Sbjct  330   KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYVEKAEAEREGRQPE---------  380

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                              +     +S S RQR KVPGLQ+DIE+L++EL  FI++HGQ GF
Sbjct  381   -----------------QAPVHCSSTSTRQRSKVPGLQKDIEVLKSELGSFIAKHGQNGF  423

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP RK LR HGRVDIEKAITRMGGFR+IA LMNLSL+YK+RKP+GYWDNLENLQ+EI RF
Sbjct  424   MPKRKHLRTHGRVDIEKAITRMGGFRKIATLMNLSLSYKNRKPRGYWDNLENLQEEIGRF  483

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
             Q++WGMDPSYMPSRKSFERAGRYDIARALEKWGG+ EVSRLLSL+ R P +Q     E +
Sbjct  484   QKNWGMDPSYMPSRKSFERAGRYDIARALEKWGGIQEVSRLLSLEPRRPRKQADPDGESQ  543

Query  978   FD---VNGEEKTP------RAYVSQDAHKWLTKLKELDINWVE  1079
              +       E  P      +A V  DA KWL KLK+LDINWVE
Sbjct  544   PESPSAAAAEHHPSSSNADKASVPLDAQKWLLKLKDLDINWVE  586


 Score = 52.8 bits (125),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIE----EEISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E  +     E+ F  V+GDF  F+GKW +     S
Sbjct  27   IWLEQRGLQQALYWHIEARVVLDLREVPDAVDGRELHFSMVDGDFKKFEGKWSVRAGPRS  86

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAEN  392
               +L Y V      N       +E +I  DLP NL A+    E++  EN
Sbjct  87   ASAILLYEVNVIPRFN--FPAIFLERIITSDLPVNLTALAFRSEKMYLEN  134



>ref|XP_006399383.1| hypothetical protein EUTSA_v10015845mg, partial [Eutrema salsugineum]
 gb|ESQ40836.1| hypothetical protein EUTSA_v10015845mg, partial [Eutrema salsugineum]
Length=748

 Score =   412 bits (1060),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 220/362 (61%), Positives = 250/362 (69%), Gaps = 39/362 (11%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V ILQEGCKGLLYMVLHAR +LDL E  E+EI FEQVEGDFDS +GKWI EQLGSHHTLL
Sbjct  389   VRILQEGCKGLLYMVLHARAVLDLHESREQEIRFEQVEGDFDSLEGKWIFEQLGSHHTLL  448

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY+VES+M K++FLSEAIMEEVIYEDLPSNLCAIRDYIE       EK+ E       ++
Sbjct  449   KYTVESRMRKDTFLSEAIMEEVIYEDLPSNLCAIRDYIE----NGGEKSSESCKVETCQV  504

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
                      A S+       D   ++  +QR ++PGLQRDIE+L++E+L FISEHGQEGF
Sbjct  505   SEETCPSSRATSVEKVYNNDDC--TDQTKQRARIPGLQRDIEVLKSEILKFISEHGQEGF  562

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MPMRKQLR HGRVDIEKAITRMGGFRRIA +MNLSLAYKHRKPKGYWDNLENLQ+E    
Sbjct  563   MPMRKQLRSHGRVDIEKAITRMGGFRRIALMMNLSLAYKHRKPKGYWDNLENLQEENG--  620

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKEKK  977
                        P   S   +GRYDIARALEKWGGLHEVSRLL+L VRHPNRQ +  K+  
Sbjct  621   -----------PRNISSAASGRYDIARALEKWGGLHEVSRLLALNVRHPNRQQNSRKDNG  669

Query  978   FDVNGEE-------------KTPRAYVSQDAHKWLTKLKELDINWV-------E*HIYKV  1097
               +   E             K  + YVSQD  KWL  LK+LDINWV       E HI  V
Sbjct  670   NKIQRTESIDTDHLNSTLISKKNQPYVSQDTEKWLYNLKDLDINWVHLVITRKEKHIVFV  729

Query  1098  HY  1103
             +Y
Sbjct  730   NY  731



>ref|XP_008785880.1| PREDICTED: uncharacterized protein LOC103704391 isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   384 bits (987),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 191/264 (72%), Positives = 216/264 (82%), Gaps = 10/264 (4%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHARV+LDL E++E EISFEQVEGDFDSFQGKWILEQLG  HTLL
Sbjct  386  VRILQEGCKGLLYMVLHARVVLDLHEELECEISFEQVEGDFDSFQGKWILEQLGDQHTLL  445

Query  258  KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQ---EYVTYGE  428
            KY VESKMHK++FLSEAI+EEVIYEDLPSNLCAIRD++E+ EA   E  +   + V    
Sbjct  446  KYIVESKMHKDTFLSEAILEEVIYEDLPSNLCAIRDFVEKREAAGNEPPKYPDKLVVPVS  505

Query  429  AEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQ  608
              + +   K     SI+        V++   RQRPKVPGLQRDIE+L+AEL+ FIS +GQ
Sbjct  506  NYVHVIESKPAEHVSIT-------DVSAIPLRQRPKVPGLQRDIEVLKAELMSFISRYGQ  558

Query  609  EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
            +GFMPMRKQLR HGRVDIEKAITRMGGFR+IA LMNLSLAYKHRKP GYWDNLENLQ+EI
Sbjct  559  DGFMPMRKQLRMHGRVDIEKAITRMGGFRKIADLMNLSLAYKHRKPSGYWDNLENLQEEI  618

Query  789  SRFQRSWGMDPSYMPSRKSFERAG  860
             RFQ+SWGMDP+YMPSRKSFERAG
Sbjct  619  RRFQKSWGMDPAYMPSRKSFERAG  642


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 9/118 (8%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E  +     E+ +  V+GDF  F+GKW + + G  
Sbjct  137  IWLEQRGLQRALYWHIEARVVLDLQEIPDSANGRELHYSMVDGDFKKFEGKWSV-KAGPR  195

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVT  419
             +    S E  +          +E +I  DLP NL A+    ER    N+E+ Q+ +T
Sbjct  196  SSTAILSYEVNVIPRFNFPAIFLERIIRSDLPVNLRALACRAER----NSEENQKMLT  249



>gb|KDP43698.1| hypothetical protein JCGZ_25147 [Jatropha curcas]
Length=242

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/230 (76%), Positives = 195/230 (85%), Gaps = 2/230 (1%)
 Frame = +3

Query  84   ILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKY  263
            +LQEGCKGLLYMVLHA V+LDL E ++EEISFEQV+GDFDSFQGKW+ E+LGSHHTLLKY
Sbjct  11   LLQEGCKGLLYMVLHAHVVLDLREHLQEEISFEQVKGDFDSFQGKWLPEELGSHHTLLKY  70

Query  264  SVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIKI  443
            SVESKMHK+S LSEAIMEEVIYEDLPSNLCAIRDYIE+ EA N+ +  E + Y + +I+ 
Sbjct  71   SVESKMHKDSILSEAIMEEVIYEDLPSNLCAIRDYIEQREAANSMEIHELIQYSQ-KIES  129

Query  444  TPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMP  623
            T D D         E+  DS N +SHRQRP+VPGLQRDIEIL++ELL FISEHGQEGFMP
Sbjct  130  THD-DGDTKYRRATEKVIDSNNPDSHRQRPRVPGLQRDIEILKSELLKFISEHGQEGFMP  188

Query  624  MRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLEN  773
            MRKQLRKHGRVDIEKAIT M GFR+IA LMNLSLAYK RKPKGYWDNLEN
Sbjct  189  MRKQLRKHGRVDIEKAITHMVGFRKIASLMNLSLAYKRRKPKGYWDNLEN  238



>ref|XP_007048564.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOX92721.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=625

 Score =   349 bits (896),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 196/237 (83%), Gaps = 5/237 (2%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHARV+LDL E++E+EISFEQVEGDFDSFQG+W+LEQLGSHHTLL
Sbjct  390  VRILQEGCKGLLYMVLHARVVLDLHEQLEQEISFEQVEGDFDSFQGRWLLEQLGSHHTLL  449

Query  258  KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
            KYSVESKMH++S LSEAIMEEVIYEDLPSNLC+IRDY+E+ E E  E  Q     G+   
Sbjct  450  KYSVESKMHRDSLLSEAIMEEVIYEDLPSNLCSIRDYVEKREVETHESRQ---LSGKESS  506

Query  438  KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              + + +      +  E+  DS +  S  QRP+VPGLQRDIE+L+AELL FISEHGQEGF
Sbjct  507  SSSTNNETGYSDTA--EQVLDSTSPNSCGQRPRVPGLQRDIEVLKAELLKFISEHGQEGF  564

Query  618  MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
            MPMRKQLR HGRVDIEKAITRMGGFRRIA LMNLSLAYK RKPKGYWDNLENLQDE 
Sbjct  565  MPMRKQLRLHGRVDIEKAITRMGGFRRIASLMNLSLAYKQRKPKGYWDNLENLQDEC  621



>gb|KEH20935.1| polyketide cyclase/dehydrase and lipid transporter [Medicago 
truncatula]
Length=650

 Score =   341 bits (874),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/252 (67%), Positives = 201/252 (80%), Gaps = 4/252 (2%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHA V+LDLCE++E+EISFEQ EGDFDSF GKW  EQLG+HHTLL
Sbjct  402  VRILQEGCKGLLYMVLHAHVVLDLCEQLEQEISFEQAEGDFDSFHGKWTFEQLGNHHTLL  461

Query  258  KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
            KYSV+SKM +++FLSEAIMEEVIYEDLPSNLCAIRDY+E  +A    +  E  T    +I
Sbjct  462  KYSVDSKMRRDTFLSEAIMEEVIYEDLPSNLCAIRDYVENQKASQFLEVCEQNTNSGQQI  521

Query  438  KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
             ++   D   ++ S  ++ SD     S  QR +VPGLQRDIE+L++ELL F++E+GQEGF
Sbjct  522  ILSGSGD--DNNSSSADDISDCNVQSSSNQRSRVPGLQRDIEVLKSELLKFVAEYGQEGF  579

Query  618  MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
            MPMRKQLR HGRVDIEKAITRMGGFR+IA +MNLSLAYK+RKPKGYWDNLENLQDE+  F
Sbjct  580  MPMRKQLRLHGRVDIEKAITRMGGFRKIATIMNLSLAYKYRKPKGYWDNLENLQDEVD-F  638

Query  798  QRSWGMDPSYMP  833
             RS  +   Y+P
Sbjct  639  CRS-SIFSCYLP  649



>ref|XP_001783746.1| predicted protein [Physcomitrella patens]
 gb|EDQ51460.1| predicted protein [Physcomitrella patens]
Length=634

 Score =   331 bits (848),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 177/335 (53%), Positives = 223/335 (67%), Gaps = 24/335 (7%)
 Frame = +3

Query  78    VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
             V +LQEGCK LLYMVLHARVILDL E+ + EI F+QVEGDFDSFQGKW LE LG+ HTLL
Sbjct  302   VRLLQEGCKCLLYMVLHARVILDLWERPQYEILFQQVEGDFDSFQGKWTLEPLGAQHTLL  361

Query  258   KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
             KY V++KMHK+S L+EA++EEVIYEDLP+NLCAIRD +E L + +   ++  V      I
Sbjct  362   KYLVDTKMHKDSLLAEALVEEVIYEDLPANLCAIRDRVELLGSNSLLDSRNEVVEKLENI  421

Query  438   KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
             K      +    + P         S   RQRP V GLQRD  IL+ ELL FI+E G +G 
Sbjct  422   KKQEFLHVVKSDLKP---------SPRIRQRPLVAGLQRDFNILQQELLKFIAEKGTKGV  472

Query  618   MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
             MP+R +LR+ GRVD+EKAITR GGF  +A  +NLSLAYK RKP+GYWDNL+N+  EI  F
Sbjct  473   MPLRCELREAGRVDLEKAITRNGGFGPVASKLNLSLAYKERKPRGYWDNLQNVHKEILLF  532

Query  798   QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRH------------  941
             Q+  G D + MP+R+S ERAGRYD+AR+LEKWGGL EV+R+L L+V+             
Sbjct  533   QKEHGNDRTTMPTRQSLERAGRYDLARSLEKWGGLREVARVLGLQVKKRQKSRTAKTDVV  592

Query  942   PNRQPSFGKEKKFDVNGEEKTPRAYVSQDAHKWLT  1046
             P   P    E + D+    KT    +   + KW+T
Sbjct  593   PALAPKDSDESETDIKVPLKT---MLPLKSRKWVT  624


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 74/159 (47%), Gaps = 28/159 (18%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIE----EEISFEQVEGDFDSFQGKWILEQLGSH  245
             ++LQEG +  +Y  + ARV+LDL E ++     E+ F  V+GDF  + G+W L      
Sbjct  70   TWLLQEGKQSAMYWQIEARVVLDLEEFLDAKDGRELRFSMVDGDFKRYVGRWYLRPDVRP  129

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIR------DYIERLEA-------  386
             T++ +  E  +        A +E++I  DLP+NL AI         + R+ A       
Sbjct  130  GTIILH-YEVNVTPRLLFPAAFVEKIIKSDLPTNLRAIAARAEDCSNVSRVAAVQTKDVV  188

Query  387  ---------ENAEKTQEYVTYGEAEIKITPDKDLSADSI  476
                      ++ KT+EY T G A  ++   KD S  +I
Sbjct  189  SPRLFQKIERSSTKTREYSTAGSARSRLI-SKDSSWGAI  226



>ref|XP_006847046.1| hypothetical protein AMTR_s00017p00186340 [Amborella trichopoda]
 gb|ERN08627.1| hypothetical protein AMTR_s00017p00186340 [Amborella trichopoda]
Length=533

 Score =   324 bits (831),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 165/244 (68%), Positives = 196/244 (80%), Gaps = 9/244 (4%)
 Frame = +3

Query  75   LVFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTL  254
            +V ILQEGCKGLLYMVLHARV+LDLCE+ E EI+FEQVEGDFDSF+GKW+LE+LG+ HTL
Sbjct  287  VVRILQEGCKGLLYMVLHARVVLDLCEQHEHEITFEQVEGDFDSFKGKWLLEKLGNQHTL  346

Query  255  LKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAE  434
            LKY VESKMHKNSFLSEAI+EEVIYEDLPSNLCAIRD   R+E E   K+    +  E +
Sbjct  347  LKYIVESKMHKNSFLSEAIVEEVIYEDLPSNLCAIRD---RVEVEEMAKSMRLESVVE-Q  402

Query  435  IKITPDKDLSADSISPYEETSDSVNSESHRQ-----RPKVPGLQRDIEILRAELLGFISE  599
            +K+      S+  +   E   +   S    Q     RPKVPGLQRDIEIL++ELL FISE
Sbjct  403  LKVGSSPTPSSSPLLVKESRGEGKASSRDAQTRSTPRPKVPGLQRDIEILKSELLKFISE  462

Query  600  HGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQ  779
            +GQ+G+MPMRKQLR HGRVD+EKA+TRMGGFR+IA LMNLSLAYKHRKPKGYWDNL+NL+
Sbjct  463  YGQDGYMPMRKQLRLHGRVDLEKAVTRMGGFRKIASLMNLSLAYKHRKPKGYWDNLDNLK  522

Query  780  DEIS  791
            +E++
Sbjct  523  EEVN  526



>gb|KCW54072.1| hypothetical protein EUGRSUZ_I00052 [Eucalyptus grandis]
Length=649

 Score =   317 bits (813),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 160/232 (69%), Positives = 182/232 (78%), Gaps = 1/232 (0%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHARV+LDLCE +E EISF+QVEGDFDSFQGKWI EQLG+ HTLL
Sbjct  383  VRILQEGCKGLLYMVLHARVVLDLCEHLEREISFQQVEGDFDSFQGKWIFEQLGNQHTLL  442

Query  258  KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEI  437
            KY+VESKMHK+SFLSEAIMEEVIYEDLPSNLCAIRDYIE  +A  A+      +   +E 
Sbjct  443  KYTVESKMHKDSFLSEAIMEEVIYEDLPSNLCAIRDYIENRDATAADSETISESGLSSEQ  502

Query  438  KITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGF  617
              +P  D S   +S   E   + + +   QRP+VPGLQRDIE+L+AEL+ FISEHGQEGF
Sbjct  503  TASPSMDEST-CVSATTEDISNYDDDLSSQRPRVPGLQRDIEVLKAELVKFISEHGQEGF  561

Query  618  MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLEN  773
            MPMRKQLR HGRVDIEKAIT MGGFRRIA LM+LSLAYK R  +G    L+ 
Sbjct  562  MPMRKQLRLHGRVDIEKAITGMGGFRRIASLMDLSLAYKRRNRRGTGTTLKT  613


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 67/152 (44%), Gaps = 21/152 (14%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCE----KIEEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E      E E+ F  V+GDF  F+GKW L+     
Sbjct  149  IWLEQRGLQRALYWHIEARVVLDLQEFANSDNERELHFSMVDGDFKKFEGKWSLKSGPRS  208

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYG  425
             T L Y V      N       +E +I  DLP NL A+    ER    N E  Q+  +  
Sbjct  209  STTLSYEVNVIPRFN--FPAIFLERIIRSDLPVNLQALAFRAER----NFEGNQKLASTT  262

Query  426  E--------AEIKITPDKDLSADSISPYEETS  497
                     A   I PD D   D + P E TS
Sbjct  263  RFRDRAINGAVTSIGPDLD---DKVQPREITS  291



>ref|XP_002987615.1| hypothetical protein SELMODRAFT_126454 [Selaginella moellendorffii]
 gb|EFJ11190.1| hypothetical protein SELMODRAFT_126454 [Selaginella moellendorffii]
Length=649

 Score =   300 bits (768),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 196/285 (69%), Gaps = 18/285 (6%)
 Frame = +3

Query  84   ILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKY  263
            +LQEGCK LLYMVLHARV+L+L E    EI+F+QVEGDFD F GKW LE LG+ HTLL+Y
Sbjct  349  VLQEGCKCLLYMVLHARVVLELQELPPNEITFQQVEGDFDVFSGKWTLESLGAEHTLLRY  408

Query  264  SVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIKI  443
            SV+ KMH +  L   I+EE++YEDLP NLCAIR  +E    +     +E V+      ++
Sbjct  409  SVDMKMHNDFLLPREIIEEIVYEDLPENLCAIRARVEL--GDGCYIAKENVSPPPPPPQV  466

Query  444  TPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMP  623
                D                 S  + +R  VPGLQ DI++L  EL GF+++ G+E  MP
Sbjct  467  REPAD----------------ESFKNPKRKPVPGLQTDIKVLERELEGFVAKAGKERVMP  510

Query  624  MRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQR  803
            +R +LRK+GRVD+EKAI R GGFR IA  +N+SLAYK RKP+G+W N ENL+ EI  FQ+
Sbjct  511  VRAELRKNGRVDLEKAIRRFGGFRSIAERLNMSLAYKRRKPRGFWQNSENLKREIQLFQK  570

Query  804  SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVR  938
                DPS MPSR++ ERAGRYDIARALEKWGGLHEV+++L+L+ +
Sbjct  571  KLRSDPSRMPSRRTLERAGRYDIARALEKWGGLHEVAKVLNLQTK  615



>ref|XP_002983334.1| hypothetical protein SELMODRAFT_117904 [Selaginella moellendorffii]
 gb|EFJ15676.1| hypothetical protein SELMODRAFT_117904 [Selaginella moellendorffii]
Length=649

 Score =   300 bits (768),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 153/285 (54%), Positives = 198/285 (69%), Gaps = 18/285 (6%)
 Frame = +3

Query  84   ILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKY  263
            +LQEGCK LLYMVLHARV+L+L E    EI+F+QVEGDFD F GKW LE LG+ HTLL+Y
Sbjct  349  VLQEGCKCLLYMVLHARVVLELQELPPNEITFQQVEGDFDVFSGKWTLESLGAEHTLLRY  408

Query  264  SVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIKI  443
            SV+ KMH +  L   I+EE++YEDLP NLCAIR  +E    +     +E V+      ++
Sbjct  409  SVDMKMHNDFLLPREIIEEIVYEDLPENLCAIRARVEL--GDGCYIAKENVSPPPPPPQV  466

Query  444  TPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMP  623
                D S   ++P              +R  VPGLQ DI++L  EL GF+++ G+E  MP
Sbjct  467  REPADESF--MNP--------------KRKPVPGLQTDIKVLERELEGFVAKAGKERVMP  510

Query  624  MRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQR  803
            +R +LRK+GRVD+EKAI R GGFR IA  +N+SLAYK RKP+G+W N ENL+ EI  FQ+
Sbjct  511  VRAELRKNGRVDLEKAIRRFGGFRSIAERLNMSLAYKRRKPRGFWQNSENLKREIQLFQK  570

Query  804  SWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVR  938
                DPS MPSR++ ERAGRYDIARALEKWGGLHEV+++L+L+ +
Sbjct  571  KLRSDPSRMPSRRTLERAGRYDIARALEKWGGLHEVAKVLNLQTK  615



>gb|EPS57842.1| hypothetical protein M569_16974, partial [Genlisea aurea]
Length=141

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +3

Query  516  SHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFR  695
            S RQRPKVPGLQR +E+L++ELL FISEHGQEGFMPMRKQLRKHGRVDIEKAIT MGGFR
Sbjct  1    SSRQRPKVPGLQRSVEVLKSELLNFISEHGQEGFMPMRKQLRKHGRVDIEKAITSMGGFR  60

Query  696  RIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIA  875
            +IA LMNLSLAYK RKPKGYWD+LENLQ+EISRFQR+WGMD S MPSRKSFERAGRYDIA
Sbjct  61   KIASLMNLSLAYKQRKPKGYWDDLENLQEEISRFQRNWGMDLSLMPSRKSFERAGRYDIA  120

Query  876  RALEKWGGLHEVSRLLSLKVR  938
            RALEKWGGLHEVSRLLSLKVR
Sbjct  121  RALEKWGGLHEVSRLLSLKVR  141



>gb|ABF99782.1| Streptomyces cyclase/dehydrase family protein, expressed [Oryza 
sativa Japonica Group]
Length=518

 Score =   181 bits (458),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 100/119 (84%), Gaps = 0/119 (0%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHARV++DL EK+E EISFEQVEGDF SF+GKW LEQLG  HTLL
Sbjct  387  VRILQEGCKGLLYMVLHARVVMDLREKLEREISFEQVEGDFYSFKGKWRLEQLGDQHTLL  446

Query  258  KYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAE  434
            KY VE+KMHK++FLSE+I+EEVIYEDLPSNLCAIRDYIE+ EAE+   T   +    A+
Sbjct  447  KYMVETKMHKDTFLSESILEEVIYEDLPSNLCAIRDYIEKAEAESGNSTSSSIVASNAD  505



>ref|XP_005645071.1| hypothetical protein COCSUDRAFT_18573, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20527.1| hypothetical protein COCSUDRAFT_18573, partial [Coccomyxa subellipsoidea 
C-169]
Length=572

 Score =   168 bits (425),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 151/281 (54%), Gaps = 15/281 (5%)
 Frame = +3

Query  90   QEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSV  269
            Q G K +++M LHA  +LDL E+   EI F  V GDF   QGK++L +     T LKY+V
Sbjct  277  QVGFKDMVFMQLHAEAVLDLHERPHREIQFRAVAGDFGVLQGKFMLSEPERKETHLKYAV  336

Query  270  ESKMHKNS---FLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAEIK  440
            E K+ +++    L E I+E ++YED+P NL A++  +E L      K Q  +   EA+  
Sbjct  337  EVKIPRSTPMMGLLEPILERMVYEDIPFNLAALKQRVEDL------KLQRRIAELEAQ--  388

Query  441  ITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFM  620
                  +   +     E + +       +RP++  +  D  +L AEL       G  G M
Sbjct  389  -GTSWAIPMLNFFFAGEGNRAAYLRRRTERPRLSEMAEDFGLLAAELERCF---GGTGTM  444

Query  621  PMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQ  800
            P R QLR   R D+EKA+   GG   +A  M   LAYK + P+GYWD L+N++ EI+ F 
Sbjct  445  PTRAQLRAITRTDLEKAMVAHGGPAAVAKRMGWKLAYKAKAPRGYWDKLKNVEREIAEFC  504

Query  801  RSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLL  923
               G+ P  MP +  F RA RYD+A  +E+WGGL E++ LL
Sbjct  505  EQEGLPPRIMPLKMDFVRANRYDLAHVVERWGGLSELAELL  545



>ref|XP_009607357.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=169

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 94/132 (71%), Gaps = 17/132 (13%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNL+SCNRNT+VIGS+Y K M+RGV+SF CIDE+RFT I+K RC+PYFRS
Sbjct  34    TYSCGSCGYELNLNSCNRNTTVIGSKYGKTMRRGVLSFLCIDESRFTQISKVRCIPYFRS  93

Query  1496  KHSWGLFRRHTKLLCRECGNYIG--------TLPSSL--------NPQSQQWDGLSACRS  1365
             K+SWG F++HTKLLCR C +YIG        T  +SL        +  +  WDGLSAC++
Sbjct  94    KNSWGFFKQHTKLLCRNCSSYIGIAHIENNNTSAASLARKNINVKSDATPNWDGLSACKT  153

Query  1364  -YDINISSLTPS  1332
              YDI I +L PS
Sbjct  154   NYDIKICALRPS  165



>ref|XP_009607356.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=174

 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 93/129 (72%), Gaps = 17/129 (13%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+SCNRNT+VIGS+Y K M+RGV+SF CIDE+RFT I+K RC+PYFRSK+S
Sbjct  42    CGSCGYELNLNSCNRNTTVIGSKYGKTMRRGVLSFLCIDESRFTQISKVRCIPYFRSKNS  101

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSL--------NPQSQQWDGLSACRS-YD  1359
             WG F++HTKLLCR C +YIG        T  +SL        +  +  WDGLSAC++ YD
Sbjct  102   WGFFKQHTKLLCRNCSSYIGIAHIENNNTSAASLARKNINVKSDATPNWDGLSACKTNYD  161

Query  1358  INISSLTPS  1332
             I I +L PS
Sbjct  162   IKICALRPS  170



>ref|XP_010922547.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Elaeis guineensis]
Length=157

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS NRNT+ IG +Y KA+K+GV+SFF IDE+RF+   + RCLPYF S
Sbjct  26    TYGCGHCGYALNLSSSNRNTTNIGLKYGKAIKKGVVSFFSIDESRFSQTDELRCLPYFNS  85

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTL-------PSSLNPQSQQWDGLSACRSYDINISSLT  1338
             K+SWGLFRR T+LLCR+CG+YIG+          S N  S   +G SAC+ Y+I IS+L 
Sbjct  86    KNSWGLFRRKTRLLCRKCGSYIGSAYDENSPPIGSENSDSSSGNGASACKKYNIKISALQ  145

Query  1337  PSSQD  1323
             P S D
Sbjct  146   PWSDD  150



>ref|XP_008805528.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Phoenix dactylifera]
Length=157

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 87/125 (70%), Gaps = 7/125 (6%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS NRNT+ IG +Y KA+K+GV+SFF IDE+RF+   + RCLPYF S
Sbjct  26    TYSCGHCGYALNLSSSNRNTTNIGLKYGKAIKKGVVSFFSIDESRFSQTDELRCLPYFNS  85

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTL-------PSSLNPQSQQWDGLSACRSYDINISSLT  1338
             K+SWGLFR  T+LLCR+CG+YIG+          S N  S   +G SAC+ Y I IS+L 
Sbjct  86    KNSWGLFRHRTRLLCRKCGSYIGSAYEENSPPIGSENSDSSSANGASACKKYSIKISALQ  145

Query  1337  PSSQD  1323
             P S D
Sbjct  146   PWSDD  150



>ref|XP_004144699.1| PREDICTED: uncharacterized protein LOC101212159, partial [Cucumis 
sativus]
Length=471

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHARV+LDLCE++E+EISFEQVEGDFDS  GKW  EQLGSHHTLL
Sbjct  389  VRILQEGCKGLLYMVLHARVVLDLCEQLEQEISFEQVEGDFDSLSGKWHFEQLGSHHTLL  448

Query  258  KYSVESKMHKNSFLSEAIMEEV  323
            KYSVES+MHK++FLSEA+MEEV
Sbjct  449  KYSVESRMHKDTFLSEALMEEV  470


 Score = 52.4 bits (124),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 52/99 (53%), Gaps = 7/99 (7%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEE----EISFEQVEGDFDSFQGKW-ILEQLGS  242
            +++ Q G +  LY  + ARV+LDL E +      E+ F  V+GDF  F+GKW I     S
Sbjct  147  IWLEQRGLQRALYWHIEARVVLDLQELLNSDGSRELLFSMVDGDFKKFEGKWSINAGTRS  206

Query  243  HHTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
              T+L Y V      N      ++E++I  DLP NL A+
Sbjct  207  SPTMLSYEVNVIPRFN--FPAILLEKIIRSDLPVNLRAL  243



>ref|XP_004240856.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Solanum lycopersicum]
Length=175

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 90/138 (65%), Gaps = 20/138 (14%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNL+S NRNT+VIGS+Y K M+RGV+SF CIDE+RFT I+K RC PYFRS
Sbjct  33    TYSCGSCGYELNLNSGNRNTTVIGSKYGKTMRRGVLSFLCIDESRFTQISKLRCSPYFRS  92

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQ-------------------WDGLSA  1374
             K+SWG F+R TKLLCR+C NYIG   ++ N                        WDGLSA
Sbjct  93    KNSWGFFQRRTKLLCRKCTNYIGISYTTSNNNGTSGAALHIDVTSDAALATPNCWDGLSA  152

Query  1373  CRS-YDINISSLTPSSQD  1323
             C + Y+I I +L PS ++
Sbjct  153   CTTNYEIKICALRPSVKE  170



>ref|XP_011086373.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Sesamum indicum]
Length=160

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 86/123 (70%), Gaps = 10/123 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG C Y LNL+SCNRN SVI + Y+K+MKRGVISFF IDE+RFT I+K R LPY  SK+S
Sbjct  30    CGSCSYELNLNSCNRNISVIDANYEKSMKRGVISFFSIDESRFTQISKVRWLPYLASKNS  89

Query  1487  WGLFRRHTKLLCRECGNYIGTLPS----------SLNPQSQQWDGLSACRSYDINISSLT  1338
             W LF+R TKLLCR CGN+IGT  +           +  +S  WDG+SA R+Y++ I SL 
Sbjct  90    WRLFQRRTKLLCRNCGNHIGTARNVDDTCSSPFQVVKQRSVTWDGISARRTYEMRIRSLR  149

Query  1337  PSS  1329
             P S
Sbjct  150   PLS  152



>ref|XP_010242793.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Nelumbo nucifera]
Length=158

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY+LNLSS NRNTS IGS+Y K++KRG+ISFF IDE+RFT + + RC+PY+ SKHS
Sbjct  27    CGSCGYSLNLSSSNRNTSKIGSKYGKSIKRGIISFFSIDESRFTQVDELRCMPYYISKHS  86

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSLN-PQSQQWDGLSACRSYDINISSLTP  1335
             WG  RR TKLLCR+CG+ +G        + PS  +   S    G+S CR YD+ I SL P
Sbjct  87    WGFLRRRTKLLCRKCGSLVGHAYEDNAFSYPSVPDGSDSSSGYGMSFCRKYDVKIRSLQP  146

Query  1334  SSQD  1323
             SS +
Sbjct  147   SSSE  150



>gb|EPS70619.1| hypothetical protein M569_04139, partial [Genlisea aurea]
Length=365

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/82 (84%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLL  257
            V ILQEGCKGLLYMVLHARV+LDL E +E+EI FEQ+EGDFDSF+GKWILE+LGSHHTLL
Sbjct  284  VRILQEGCKGLLYMVLHARVVLDLLEHLEQEIKFEQIEGDFDSFRGKWILEKLGSHHTLL  343

Query  258  KYSVESKMHKNSFLSEAIMEEV  323
            KYSVESKM K+S LSEAIMEEV
Sbjct  344  KYSVESKMRKDSLLSEAIMEEV  365


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 51/98 (52%), Gaps = 6/98 (6%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKI----EEEISFEQVEGDFDSFQGKWILEQLGSH  245
            +++ Q G +  LY  + ARV+LDL E +    + E+ F  V+GDF+ FQGKW ++     
Sbjct  60   IWLEQRGLQTALYWHIEARVVLDLKEHLISEGDRELHFSMVDGDFNKFQGKWSVKSTTQI  119

Query  246  HTLLKYSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAI  359
             T L Y V      N       +E +I  DLP NL AI
Sbjct  120  TTTLAYEVNVIPRFN--FPAIFLERIITSDLPVNLQAI  155



>ref|XP_002272466.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Vitis 
vinifera]
 emb|CBI21628.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   137 bits (345),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 6/118 (5%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+SCNR TSV+GS+Y+K++K+G+ISFF IDETRFT   + RCLPYF S+ S
Sbjct  30    CGSCGYQLNLNSCNR-TSVLGSKYEKSIKKGIISFFSIDETRFTQTNELRCLPYFNSRCS  88

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP----QSQQWDGLS-ACRSYDINISSLTPSS  1329
             WGLFRR +KLLC++CGN+IG    + N      S  WDG+S + R YDI I +L PSS
Sbjct  89    WGLFRRRSKLLCKKCGNHIGNAYKTNNRSGKLDSSAWDGISDSSRIYDIKICALQPSS  146



>ref|XP_010920870.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Elaeis guineensis]
Length=142

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 86/118 (73%), Gaps = 9/118 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CG+ALNLSS NRNTS IGS+Y KA+K+GV+SFF IDE+RF+   +  CLP F S
Sbjct  25    TYSCGSCGFALNLSSSNRNTSNIGSKYPKAIKKGVVSFFSIDESRFSQADELLCLPCFSS  84

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTPSSQD  1323
             KH WGLF R T+LLCRECGN+IG++ S++ P S        CR Y+I IS+L PSS +
Sbjct  85    KHWWGLFGRKTRLLCRECGNFIGSV-SAIGPDS--------CRKYNIKISALQPSSAE  133



>ref|XP_011069531.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform 
X2 [Sesamum indicum]
Length=159

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 84/126 (67%), Gaps = 10/126 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNLSS +RNTS IGS+Y K++K+G+ISFF IDE+RF  + +F+C+PYF S
Sbjct  25    TYSCGSCGYDLNLSSSSRNTSTIGSKYGKSIKKGIISFFSIDESRFNQVEEFKCVPYFIS  84

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQW----------DGLSACRSYDINIS  1347
             KHSWGLFRR TKLLCR+CGN++G      +  S               +S  R YDI I 
Sbjct  85    KHSWGLFRRRTKLLCRKCGNHVGIAYDDNSASSYHLITNGTGSPSGSEISNKRKYDIRIR  144

Query  1346  SLTPSS  1329
             SL PSS
Sbjct  145   SLQPSS  150



>ref|XP_010692412.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=156

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 6/121 (5%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNT+ IGS+Y K++KRG+ISFF IDE+RF  +   RC+PYF SK+S
Sbjct  28    CGACGYELNLSSSNRNTATIGSKYGKSIKRGIISFFQIDESRFMKVDDVRCIPYFISKNS  87

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLN------PQSQQWDGLSACRSYDINISSLTPSSQ  1326
             WGLFRR TKLLCR+CGN++G   +  N      P           R +DI I +L PSS 
Sbjct  88    WGLFRRRTKLLCRKCGNHVGEAYNDKNCSYPLVPDDTNSSEAVTHRKFDIRIRALQPSSA  147

Query  1325  D  1323
             D
Sbjct  148   D  148



>ref|XP_002513762.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48345.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 85/130 (65%), Gaps = 10/130 (8%)
 Frame = -1

Query  1688  ILVPTEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLP  1509
             +LVP   CG CGY LNLSS NRNTS IGS+Y K++KRG+ISFF IDE+RFT   +F+C+P
Sbjct  56    LLVPV-FCGTCGYELNLSSSNRNTSTIGSKYGKSIKRGIISFFDIDESRFTQAEEFQCIP  114

Query  1508  YFRSKHSWGLFRRHTKLLCRECGNYIG--------TLPSSLNPQSQQWDGLSACRSYDIN  1353
             YF SK SWG FRR TKLLCR+CGNYIG          P   +         S  R YDI 
Sbjct  115   YF-SKSSWGFFRRRTKLLCRKCGNYIGIAYEDETSAYPLVSDGSDSSSVNESKRRKYDIK  173

Query  1352  ISSLTPSSQD  1323
             I +L PSS D
Sbjct  174   IRALQPSSVD  183



>ref|XP_011069530.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform 
X1 [Sesamum indicum]
Length=164

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 83/123 (67%), Gaps = 10/123 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS +RNTS IGS+Y K++K+G+ISFF IDE+RF  + +F+C+PYF SKHS
Sbjct  33    CGSCGYDLNLSSSSRNTSTIGSKYGKSIKKGIISFFSIDESRFNQVEEFKCVPYFISKHS  92

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQW----------DGLSACRSYDINISSLT  1338
             WGLFRR TKLLCR+CGN++G      +  S               +S  R YDI I SL 
Sbjct  93    WGLFRRRTKLLCRKCGNHVGIAYDDNSASSYHLITNGTGSPSGSEISNKRKYDIRIRSLQ  152

Query  1337  PSS  1329
             PSS
Sbjct  153   PSS  155



>gb|KHG01816.1| hypothetical protein F383_23265 [Gossypium arboreum]
Length=163

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 88/125 (70%), Gaps = 10/125 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNLSS +RNT+ IGS+Y K++KRG+ISFF IDE+RFT + +F+C+PYF S
Sbjct  30    TYSCGSCGYELNLSSSSRNTATIGSKYGKSIKRGIISFFSIDESRFTQVDEFQCVPYF-S  88

Query  1496  KHSWGLFRRHTKLLCRECGNYIGT--------LPSSLNP-QSQQWDGLSACRSYDINISS  1344
             +HSWGLFR  TKLLCR+CGN+IG          P  L+   S   + +S+ R YD+ I +
Sbjct  89    RHSWGLFRHRTKLLCRKCGNHIGNAYDEKTSGYPLVLDKSNSSPSNEVSSHRKYDVRIRA  148

Query  1343  LTPSS  1329
             L PSS
Sbjct  149   LQPSS  153



>ref|XP_010243861.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Nelumbo 
nucifera]
Length=177

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS NRNTS IGS+Y K++KRG+ISF  IDE+RFT + + +C+PY+ SKHS
Sbjct  46    CGSCGYALNLSSSNRNTSKIGSKYGKSIKRGIISFLSIDESRFTQVDELQCMPYYISKHS  105

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPS-SLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGL RR TKLLCR+CGN +G        + PS      S    G+S CR YD+ I SL P
Sbjct  106   WGLLRRRTKLLCRKCGNLVGHAYEDNTFSYPSVPDGSDSSSGSGVSFCRKYDVKIRSLQP  165

Query  1334  SSQD  1323
             SS +
Sbjct  166   SSSE  169



>ref|XP_007019072.1| Uncharacterized protein TCM_035118 [Theobroma cacao]
 gb|EOY16297.1| Uncharacterized protein TCM_035118 [Theobroma cacao]
Length=163

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 88/127 (69%), Gaps = 10/127 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNLSS +RNT+ IGS+Y K++KRG+ISFF IDE+RFT + +F+C+PYF  
Sbjct  30    TYSCGSCGYELNLSSSSRNTATIGSKYGKSIKRGIISFFTIDESRFTQVDEFQCIPYFL-  88

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTL--------PSSLN-PQSQQWDGLSACRSYDINISS  1344
             K+SWGLFR+ TKLLCR+CGN+IG          P  L+   S   + +S  R YD+ I +
Sbjct  89    KNSWGLFRQRTKLLCRKCGNHIGNAYDDKTSGYPVVLDGSDSSSGNEVSGRRKYDVRIRA  148

Query  1343  LTPSSQD  1323
             L PSS +
Sbjct  149   LQPSSAE  155



>ref|XP_004498340.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Cicer arietinum]
Length=162

 Score =   131 bits (329),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 86/124 (69%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNT+ IGS+Y K++KRGVISFF ID++RFT + + +C+P+F  KHS
Sbjct  32    CGACGYELNLSSSNRNTTSIGSKYGKSIKRGVISFFNIDDSRFTQVDEIQCVPHFH-KHS  90

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLP-SSLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+CGN+IG        +LP  S   +S     +S    YDI + SL P
Sbjct  91    WGLFRRTTKLLCRKCGNHIGNAYNGFTSSLPLVSDGAESSPGSKVSGSVKYDIRLRSLQP  150

Query  1334  SSQD  1323
             SS +
Sbjct  151   SSSE  154



>ref|XP_008793333.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Phoenix dactylifera]
Length=143

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 83/119 (70%), Gaps = 10/119 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLP-YFR  1500
             T  CG CG+ALNLSS NRNT+ IGS+Y KA+K+GV+SFF IDE+RF+   +  CLP  F 
Sbjct  25    TYSCGSCGFALNLSSSNRNTTSIGSKYGKAIKKGVVSFFSIDESRFSQADELLCLPCSFN  84

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTPSSQD  1323
             SKHSWGLF R T+LLCR+CG +IG+  S + P S        CR Y I IS+L PSS D
Sbjct  85    SKHSWGLFGRRTRLLCRKCGTFIGSA-SPIGPNS--------CRKYSIKISALQPSSAD  134



>ref|XP_002306286.1| hypothetical protein POPTR_0005s07160g [Populus trichocarpa]
 gb|ABK94489.1| unknown [Populus trichocarpa]
 gb|EEE93282.1| hypothetical protein POPTR_0005s07160g [Populus trichocarpa]
Length=162

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 67/127 (53%), Positives = 79/127 (62%), Gaps = 12/127 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+SCNRNT  IG  Y K++K+G ISFF IDETRFT I + RC PYF S  S
Sbjct  31    CGSCGYQLNLNSCNRNTPDIGVNYKKSIKKGSISFFSIDETRFTQIEELRCTPYFNSMRS  90

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQ------------QWDGLSACRSYDINISS  1344
             WGLF+R TKLLC +CGN++G      N  S              WDG+S  R Y I I S
Sbjct  91    WGLFQRRTKLLCYKCGNHLGIAYKENNTSSSPLRLGKCRSDLISWDGISDARIYVIKIRS  150

Query  1343  LTPSSQD  1323
             L P+S +
Sbjct  151   LQPASTE  157



>gb|KHG21709.1| hypothetical protein F383_26824 [Gossypium arboreum]
Length=163

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 85/127 (67%), Gaps = 10/127 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNLSS +RNT+ IGS+Y K++KRG+ISFF IDETRFT + +F+C PYF S
Sbjct  30    TYSCGSCGYELNLSSSSRNTATIGSKYGKSIKRGMISFFNIDETRFTQVDEFQCRPYF-S  88

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTL--------PSSLN-PQSQQWDGLSACRSYDINISS  1344
             KHSWGLFR  TKLLCR+CGN+IG          P  L+   S      S  R YD+ I +
Sbjct  89    KHSWGLFRHRTKLLCRKCGNHIGNAYDDKSTGYPRVLDGSDSSSGTEPSNHRKYDVRIRA  148

Query  1343  LTPSSQD  1323
             L PS+ +
Sbjct  149   LQPSTAE  155



>ref|XP_008444153.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Cucumis 
melo]
Length=168

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 11/132 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG+ISF  IDE+RFT + + +C+P+F SK+S
Sbjct  38    CGACGYELNLSSINRNTSTIGSKYGKSIKRGIISFLNIDESRFTQVDELQCVPHF-SKNS  96

Query  1487  WGLFRRHTKLLCRECGNYIGT----------LPSSLNPQSQQWDGLSACRSYDINISSLT  1338
             WGLFRR  KLLCR+CGNYIG           L S  +  S   + +S C  Y++ I +L 
Sbjct  97    WGLFRRRIKLLCRKCGNYIGNAHSNHTASSPLVSDGSDSSSLPNEVSRCMKYEVKIRALQ  156

Query  1337  PSSQD*FPRFIL  1302
             PSS + F   I+
Sbjct  157   PSSSNEFEPSII  168



>ref|XP_004161170.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54566.1| hypothetical protein Csa_4G363480 [Cucumis sativus]
Length=168

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/132 (52%), Positives = 88/132 (67%), Gaps = 11/132 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG+ISF  IDE+RFT + + +C+P+F SK+S
Sbjct  38    CGACGYELNLSSINRNTSTIGSKYGKSIKRGIISFLNIDESRFTQVDELQCVPHF-SKNS  96

Query  1487  WGLFRRHTKLLCRECGNYIGT----------LPSSLNPQSQQWDGLSACRSYDINISSLT  1338
             WGLFRR  KLLCR+CGNYIG           L S  +  S   + +S C  Y++ I +L 
Sbjct  97    WGLFRRRIKLLCRKCGNYIGNAHSNHTASSPLVSDGSDSSSLPNEVSRCMKYEVKIRALQ  156

Query  1337  PSSQD*FPRFIL  1302
             PSS + F   I+
Sbjct  157   PSSSNEFEPSII  168



>gb|KDP32801.1| hypothetical protein JCGZ_12093 [Jatropha curcas]
Length=163

 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 9/121 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG+ISFF IDE+RFT   + +C+PYF SK+S
Sbjct  34    CGTCGYELNLSSSNRNTSTIGSKYGKSIKRGIISFFNIDESRFTQTEEVQCIPYF-SKNS  92

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             WGLFRR TKLLCR+CGN IG          P   +         S  R YD+ I +L PS
Sbjct  93    WGLFRRRTKLLCRKCGNQIGIAYDDETLAYPIVSDGSDSSSVNESKRRKYDVKIRALQPS  152

Query  1331  S  1329
             S
Sbjct  153   S  153



>ref|XP_011027530.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Populus euphratica]
Length=164

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 87/126 (69%), Gaps = 10/126 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++K+G+ISFF IDE+RFT + +F+C+P+F S++S
Sbjct  34    CGICGYELNLSSSNRNTSSIGSKYGKSIKKGIISFFFIDESRFTQVDEFQCIPFF-SRNS  92

Query  1487  WGLFRRHTKLLCRECGNYIG----TLPSSLNPQSQQWDGLSAC-----RSYDINISSLTP  1335
             WGLF R T LLCR+CGN+IG       S+    +   D  SAC     R YD+ I +L P
Sbjct  93    WGLFHRRTALLCRKCGNHIGFAYDDKASAYPLVADGSDSSSACEVSKHRKYDVKIRALQP  152

Query  1334  SSQD*F  1317
             SS D F
Sbjct  153   SSVDQF  158



>ref|XP_006397309.1| hypothetical protein EUTSA_v10029030mg [Eutrema salsugineum]
 gb|ESQ38762.1| hypothetical protein EUTSA_v10029030mg [Eutrema salsugineum]
Length=161

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 80/121 (66%), Gaps = 9/121 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSSIGSKYGKSMKGGIISFFNIDEARFSQVDQFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQS----QQWDGLS----ACRSYDINISSLTPS  1332
             WGLFRR TKLLCR+C NYIG       P      Q  D  S      + YDI I SL PS
Sbjct  96    WGLFRRRTKLLCRKCNNYIGNASEEKTPAYAVVIQNSDSTSPKNGTVKKYDIRIRSLQPS  155

Query  1331  S  1329
             S
Sbjct  156   S  156



>ref|XP_010530201.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Tarenaya hassleriana]
Length=180

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 82/123 (67%), Gaps = 11/123 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K++K+GVISFF IDE+R T + +F+C+P+F S++S
Sbjct  40    CGACGYELNLSSSNRVTSTIGSKYGKSIKKGVISFFNIDESRLTQVDEFQCMPHF-SRNS  98

Query  1487  WGLFRRHTKLLCRECGNYIGTLPS----------SLNPQSQQWDGLSACRSYDINISSLT  1338
             WGLFR  TKLLCR C N+IGT  +          + +  S   D  S  + YDI I +L 
Sbjct  99    WGLFRHRTKLLCRRCNNHIGTATAQDKASAYSRVAESSGSSPMDAASGVKKYDIKIRALQ  158

Query  1337  PSS  1329
             PSS
Sbjct  159   PSS  161



>gb|ACD56614.1| predicted protein [Gossypioides kirkii]
Length=218

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS +RNT+ IGS+Y K++KRG+ISFF IDE+RFT + +F+C+PYF S+HS
Sbjct  10    CGSCGYELNLSSSSRNTATIGSKYGKSIKRGIISFFSIDESRFTQVDEFQCVPYF-SRHS  68

Query  1487  WGLFRRHTKLLCRECGNYIGTL--------PSSLNP-QSQQWDGLSACRSYDINISSLTP  1335
             WGLFR  TKLLCR+CGN+IG          P  L+   S   + +S+ R Y++ I +L P
Sbjct  69    WGLFRHRTKLLCRKCGNHIGNAYDEKTSGYPLVLDKSNSSPSNEVSSHRKYNVRIRALQP  128

Query  1334  SS  1329
             SS
Sbjct  129   SS  130



>ref|XP_010544791.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010544798.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=169

 Score =   127 bits (318),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 82/122 (67%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K++K G+ISFF IDE+RFT + +FRC+P+F SK+S
Sbjct  38    CGSCGYELNLSSSNRITSTIGSKYGKSIKSGIISFFNIDESRFTQVEEFRCIPHF-SKNS  96

Query  1487  WGLFRRHTKLLCRECGNYIGTLPS---------SLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFR  TKLLCR+C N+IGT            + +  S   D  S  + YDI I +L P
Sbjct  97    WGLFRHRTKLLCRKCNNHIGTASQDKASAHTVVAESSDSSPSDVGSGIKKYDIRIRALQP  156

Query  1334  SS  1329
             SS
Sbjct  157   SS  158



>ref|XP_006434194.1| hypothetical protein CICLE_v10002808mg [Citrus clementina]
 gb|ESR47434.1| hypothetical protein CICLE_v10002808mg [Citrus clementina]
Length=139

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSSCNRN S IG +Y K+MKRG+ISF  IDE+RFT + + +C+P+F SK+S
Sbjct  9     CGSCGYELNLSSCNRNISSIGLKYGKSMKRGIISFVDIDESRFTQVDELQCIPHF-SKNS  67

Query  1487  WGLFRRHTKLLCRECGNYIGTL----PSSLNPQSQQWD-----GLSACRSYDINISSLTP  1335
             WG+ R  TKLLCR+CGN IG       S+ +P+S   D     G S  R YD+ I +L P
Sbjct  68    WGILRHRTKLLCRKCGNPIGIAYTDKTSAYSPKSNGSDSPSVPGASGRRKYDVRIRALQP  127

Query  1334  SSQD  1323
             SS +
Sbjct  128   SSSE  131



>gb|KEH40531.1| hypothetical protein MTR_1g030060 [Medicago truncatula]
Length=138

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 84/129 (65%), Gaps = 10/129 (8%)
 Frame = -1

Query  1682  VPTEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYF  1503
              P   CG CGY LNLSS NRNT+ IGS+Y K++KRG+ISFF ID++RFT + + +C P+F
Sbjct  3     TPRISCGACGYELNLSSSNRNTTSIGSKYGKSIKRGIISFFNIDDSRFTQVDEIQCAPHF  62

Query  1502  RSKHSWGLFRRHTKLLCRECGNYIGTLPSSL---------NPQSQQWDGLSACRSYDINI  1350
               KHSWGLFRR TKLLCR+CGN+IG   +             +S     +S+   YDI I
Sbjct  63    H-KHSWGLFRRRTKLLCRKCGNHIGNAYNGFTSSFPLVTDGEESSPSSKVSSGVKYDIRI  121

Query  1349  SSLTPSSQD  1323
              SL PSS D
Sbjct  122   RSLQPSSSD  130



>ref|XP_006472780.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Citrus sinensis]
 gb|KDO80649.1| hypothetical protein CISIN_1g031507mg [Citrus sinensis]
Length=158

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSSCNRN S IG +Y K+MKRG+I+F  IDE+RFT + + +C+P+F SK+S
Sbjct  28    CGSCGYELNLSSCNRNISSIGLKYGKSMKRGIIAFVDIDESRFTQVDELQCIPHF-SKNS  86

Query  1487  WGLFRRHTKLLCRECGNYIGTL----PSSLNPQSQQWD-----GLSACRSYDINISSLTP  1335
             WG+ R  TKLLCR+CGN IG       S+ +P+S   D     G S  R YD+ I +L P
Sbjct  87    WGILRHRTKLLCRKCGNPIGIAYTDKTSAYSPKSNGSDSPSVPGASGRRKYDVRIRALQP  146

Query  1334  SSQD  1323
             SS +
Sbjct  147   SSSE  150



>ref|XP_009410608.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=152

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 76/124 (61%), Gaps = 9/124 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS +RNT+ IG EY KA+K+GV+SF  IDE+RFT   + RCLPYFRS+ S
Sbjct  22    CGHCGYALNLSSSDRNTAKIGVEYGKAIKKGVVSFVAIDESRFTQADELRCLPYFRSRRS  81

Query  1487  WGLFRRHTKLLCRECGNYIGTLP---------SSLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFR  T+LLCR CG+ IG             S       +   S  R Y I I +L P
Sbjct  82    WGLFRHQTRLLCRGCGSLIGVATYDGTSSPSSPSEGSSESNYPASSGSRKYKIRIGALQP  141

Query  1334  SSQD  1323
             S  D
Sbjct  142   SDDD  145



>ref|XP_010436454.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Camelina 
sativa]
 ref|XP_010436470.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Camelina 
sativa]
Length=162

 Score =   126 bits (316),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 81/122 (66%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSTIGSKYGKSMKSGIISFFNIDEGRFSQVDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ-----SQQWDGLS----ACRSYDINISSLTP  1335
             WGLFRR TKLLCR+C NYIG       P      +Q  D  S    +   YDI I SL P
Sbjct  96    WGLFRRRTKLLCRKCNNYIGNASQEKAPPEYALVTQNSDPTSPRTGSVTKYDIRIRSLQP  155

Query  1334  SS  1329
             SS
Sbjct  156   SS  157



>ref|XP_002874529.1| hypothetical protein ARALYDRAFT_489746 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50788.1| hypothetical protein ARALYDRAFT_489746 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 9/121 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSTIGSKYGKSMKSGIISFFNIDEGRFSQVDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ----SQQWDGLS----ACRSYDINISSLTPS  1332
             WGLFR  TKLLCR+C NYIG       P+    +Q  D  S    +   YDI I SL PS
Sbjct  96    WGLFRHRTKLLCRKCNNYIGNASQEKAPEYALVTQNSDPTSPRIGSVTKYDIRIRSLQPS  155

Query  1331  S  1329
             S
Sbjct  156   S  156



>ref|NP_192573.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9STN5.1|Y4833_ARATH RecName: Full=Uncharacterized protein At4g08330, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB52555.1| putative protein [Arabidopsis thaliana]
 emb|CAB77958.1| putative protein [Arabidopsis thaliana]
 dbj|BAC42303.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50525.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82627.1| uncharacterized protein AT4G08330 [Arabidopsis thaliana]
Length=164

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 81/121 (67%), Gaps = 9/121 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  40    CGSCGYELNLSSTNRITSTIGSKYGKSMKSGIISFFNIDEGRFSQVDEFQCMPHF-SRYS  98

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ----SQQWDGLS----ACRSYDINISSLTPS  1332
             WGLFR  TKLLCR+C NYIG       P+    +Q  D  S    +   YDI I SL PS
Sbjct  99    WGLFRHRTKLLCRKCNNYIGNASQEKAPEYALVTQNSDPTSPRIGSVTKYDIRIRSLQPS  158

Query  1331  S  1329
             S
Sbjct  159   S  159



>ref|XP_009765797.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Nicotiana 
sylvestris]
Length=157

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 82/122 (67%), Gaps = 9/122 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S +RNT+ IGS+Y K++K+G+ISF  IDE+RFT + +F+C+P+F SK S
Sbjct  27    CGSCGYELNLNSSSRNTASIGSKYGKSIKKGMISFLSIDESRFTQVEEFKCVPFFFSKRS  86

Query  1487  WGLFRRHTKLLCRECGNYIGTL----PSSLNPQSQQWDGLSAC-----RSYDINISSLTP  1335
             WGLF+R TKLLCR+CGN IG       SS    +   D  S       R YDI I SL P
Sbjct  87    WGLFQRRTKLLCRKCGNDIGIAYDDSASSYPLVADASDTASGSETSTHRKYDIKIRSLQP  146

Query  1334  SS  1329
             SS
Sbjct  147   SS  148



>ref|XP_009348666.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Pyrus x bretschneideri]
Length=165

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 89/136 (65%), Gaps = 12/136 (9%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFR  1500
             T  CG CGY LNLSS NRNTS IGS +Y K++KRG+ISFF IDE+RFT + + +C P+F 
Sbjct  30    TYSCGSCGYELNLSSSNRNTSTIGSNKYGKSIKRGIISFFNIDESRFTQVDELKCKPHF-  88

Query  1499  SKHSWGLFRRHTKLLCRECGNYIG---------TLPSSLNP-QSQQWDGLSACRSYDINI  1350
             SK SWGLF R TKLLCR+CGN+IG         + P  L+   S     ++ CR +D+ I
Sbjct  89    SKRSWGLFSRRTKLLCRKCGNHIGNAYDEYTSSSYPLVLDESDSSAGQEVTKCRKFDVRI  148

Query  1349  SSLTPSSQD*FPRFIL  1302
              +L PS+ + F   IL
Sbjct  149   RALQPSNSEEFGPSIL  164



>gb|EYU22971.1| hypothetical protein MIMGU_mgv1a015375mg [Erythranthe guttata]
Length=159

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 80/125 (64%), Gaps = 10/125 (8%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNL+S +RN S+IGS+Y K++K+GVISFF IDE+RF  + +  CLPYF +
Sbjct  25    TYSCGSCGYDLNLNSSSRNMSIIGSKYGKSVKKGVISFFSIDESRFNQVEESTCLPYFIT  84

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNP----------QSQQWDGLSACRSYDINIS  1347
             K SWG  +R TKLLCR CGN+IG+   + N            S    G+S  R YDI I 
Sbjct  85    KLSWGFLQRKTKLLCRNCGNHIGSARDNDNASSYPLMTDARSSPSRSGISNKRKYDIMIR  144

Query  1346  SLTPS  1332
             SL PS
Sbjct  145   SLQPS  149



>gb|KFK32143.1| hypothetical protein AALP_AA6G203800 [Arabis alpina]
Length=155

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 82/121 (68%), Gaps = 9/121 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS Y K++K G+I+FF IDE RF+ + +F+C+P+F S++S
Sbjct  34    CGSCGYELNLSSTNRITSSIGSNYGKSIKSGIIAFFNIDEGRFSQVDEFQCMPHF-SRYS  92

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP------QSQQWDGLSA--CRSYDINISSLTPS  1332
             WGLFRR TK+LCR+C NYIG       P      Q+   +G+++     YDI I SL PS
Sbjct  93    WGLFRRRTKILCRKCNNYIGNASQEKTPEYALVTQNSTKNGVTSNTVNKYDIRIRSLQPS  152

Query  1331  S  1329
             S
Sbjct  153   S  153



>ref|XP_003542997.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Glycine max]
 gb|KHN33850.1| Hypothetical protein glysoja_021731 [Glycine soja]
Length=158

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNT+ IGS+Y K++KRG+ISFF ID +RFT + + +C+P+F  KHS
Sbjct  28    CGTCGYELNLSSSNRNTASIGSKYGKSIKRGIISFFSIDLSRFTQVDEIQCVPHF-DKHS  86

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSLN-PQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+CGN+IG        + P   +  +S     + +   YDI I +L P
Sbjct  87    WGLFRRRTKLLCRKCGNHIGNAYNGYTSSFPLVTDGAESSPSSKVVSHTKYDIRIRALQP  146

Query  1334  SSQD  1323
             SS +
Sbjct  147   SSSE  150



>ref|XP_009609607.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Nicotiana tomentosiformis]
Length=157

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 82/122 (67%), Gaps = 9/122 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S +RNT+ IGS+Y K++K+G+ISF  IDE+RFT + +F+C+P+F SK S
Sbjct  27    CGSCGYELNLNSSSRNTASIGSKYGKSIKKGMISFLSIDESRFTQVEEFKCVPFFFSKRS  86

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSLNPQ-SQQWDGLSACRSYDINISSLTP  1335
             WGLF+R TKLLCR+CGN IG        + P   +   +      S  R YDI I SL P
Sbjct  87    WGLFQRRTKLLCRKCGNDIGIAYDDSASSYPLVADASVTASGSETSTHRKYDIKIRSLQP  146

Query  1334  SS  1329
             SS
Sbjct  147   SS  148



>ref|XP_007141028.1| hypothetical protein PHAVU_008G161200g [Phaseolus vulgaris]
 gb|ESW13022.1| hypothetical protein PHAVU_008G161200g [Phaseolus vulgaris]
Length=161

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 83/124 (67%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG+ISFF ID +RFT + + +C+P+F  KHS
Sbjct  31    CGTCGYELNLSSSNRNTSSIGSKYGKSIKRGIISFFNIDLSRFTQVDEIQCVPHF-DKHS  89

Query  1487  WGLFRRHTKLLCRECGNYIGTLPS---------SLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+C N+IG   +         S   +S     +++   YDI I +L P
Sbjct  90    WGLFRRRTKLLCRKCSNHIGNAHNGYTTSFPLVSDGAESSPSSKVASHTKYDIRIRTLQP  149

Query  1334  SSQD  1323
             SS +
Sbjct  150   SSSE  153



>ref|XP_002300988.2| hypothetical protein POPTR_0002s08420g [Populus trichocarpa]
 gb|EEE80261.2| hypothetical protein POPTR_0002s08420g [Populus trichocarpa]
Length=164

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG+ISFF IDE+RFT + +F+C+P+F S++S
Sbjct  34    CGICGYELNLSSSNRNTSSIGSKYGKSIKRGIISFFFIDESRFTQVDEFQCIPFF-SRNS  92

Query  1487  WGLFRRHTKLLCRECGNYIG-TLPSSLNPQSQQWDGLSAC--------RSYDINISSLTP  1335
             WGLF R T LLCR+CGN IG       +      DG  +         R YD+ I +L P
Sbjct  93    WGLFHRRTALLCRKCGNNIGIAYDDKASAYPLVADGSDSSSVSEVSKHRKYDVKIRALQP  152

Query  1334  SSQD*F  1317
             SS D F
Sbjct  153   SSVDQF  158



>ref|XP_010999387.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Populus 
euphratica]
Length=164

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG ISFF IDE+RFT + +F+C P+F SK+S
Sbjct  34    CGICGYELNLSSSNRNTSTIGSKYGKSIKRGKISFFLIDESRFTQVDEFQCFPFF-SKNS  92

Query  1487  WGLFRRHTKLLCRECGNYIGTL---PSSLNPQSQQWDGLSAC------RSYDINISSLTP  1335
              GLFR+ T LLCR+CGN+IG      +S  P        S+       R YD+ I +L P
Sbjct  93    LGLFRQRTALLCRKCGNHIGIAYADEASAYPLVADGSDSSSVSEVFKRRKYDVKIRALQP  152

Query  1334  SSQD*F  1317
             SS + F
Sbjct  153   SSAEQF  158



>gb|KHN25208.1| Hypothetical protein glysoja_030455, partial [Glycine soja]
Length=132

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 83/124 (67%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNT+ IGS+Y K++KRG+ISFF ID +RFT + + +C+P+F  KHS
Sbjct  2     CGTCGYELNLSSSNRNTASIGSKYGKSIKRGIISFFSIDLSRFTQVDEIQCVPHF-DKHS  60

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLP-SSLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+CGN+IG        + P  S   +S     +     YDI I +L P
Sbjct  61    WGLFRRRTKLLCRKCGNHIGNAYNGYTSSFPLVSDGAESSPSSKVVNHTKYDIRICALQP  120

Query  1334  SSQD  1323
             SS +
Sbjct  121   SSSE  124



>ref|XP_003544689.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Glycine max]
Length=158

 Score =   123 bits (308),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNT+ IGS+Y K++KRG+ISFF ID +RFT + + +C+P+F  KHS
Sbjct  28    CGTCGYELNLSSSNRNTASIGSKYGKSIKRGIISFFSIDLSRFTQVDEIQCVPHF-DKHS  86

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLP-SSLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+CGN+IG        + P  S   +S     + +   YDI I +L P
Sbjct  87    WGLFRRRTKLLCRKCGNHIGNAYNGYTSSFPLVSDGAESSPSSKVVSHTKYDIRICALQP  146

Query  1334  SSQD  1323
             SS +
Sbjct  147   SSSE  150



>ref|XP_006367804.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Solanum tuberosum]
Length=157

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 81/122 (66%), Gaps = 9/122 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S +RNT+ IGS+Y K++K+G+ISF  IDE+RFT + +F+C+P+F SK S
Sbjct  27    CGSCGYELNLNSSSRNTASIGSKYGKSIKKGMISFLSIDESRFTQVDEFKCVPFFFSKRS  86

Query  1487  WGLFRRHTKLLCRECGNYIGTL----PSSLNPQSQQWDGLSAC-----RSYDINISSLTP  1335
             WGLF+R TKL CR+CGN IG       SS    +   D  S       R YDI I SL P
Sbjct  87    WGLFQRRTKLQCRKCGNNIGIAYDNSASSYPLVADASDTASGSEITTHRKYDIKIRSLQP  146

Query  1334  SS  1329
             SS
Sbjct  147   SS  148



>ref|XP_010421743.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Camelina sativa]
Length=163

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 80/123 (65%), Gaps = 11/123 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSTIGSKYGKSMKSGIISFFNIDEGRFSEVDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ-----SQQWDGL-----SACRSYDINISSLT  1338
             WGLFRR TKLLCR+C NYIG       P      +   D       S+   YDI I SL 
Sbjct  96    WGLFRRRTKLLCRKCNNYIGNASQEKAPPEYALVTHNSDPTSPRTGSSITKYDIRIRSLQ  155

Query  1337  PSS  1329
             PSS
Sbjct  156   PSS  158



>ref|XP_002307435.2| hypothetical protein POPTR_0005s20030g [Populus trichocarpa]
 gb|ABK94339.1| unknown [Populus trichocarpa]
 gb|EEE94431.2| hypothetical protein POPTR_0005s20030g [Populus trichocarpa]
Length=164

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS IGS+Y K++KRG ISFF IDE+RFT + +F+C P+F SK+S
Sbjct  34    CGICGYELNLSSSNRNTSTIGSKYGKSIKRGKISFFFIDESRFTQVDEFQCFPFF-SKNS  92

Query  1487  WGLFRRHTKLLCRECGNYIGTL---PSSLNPQSQQWDGLSAC------RSYDINISSLTP  1335
              GLFR+ T LLCR+CGN+IG      +S  P        S+       R YD+ I +L P
Sbjct  93    LGLFRQRTALLCRKCGNHIGIAYADEASAYPLVADGSDSSSVSEVFKRRKYDVKIRALQP  152

Query  1334  SSQD*F  1317
             SS + F
Sbjct  153   SSAEQF  158



>ref|XP_009124771.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Brassica 
rapa]
 emb|CDY69123.1| BnaA02g36660D [Brassica napus]
Length=162

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 80/122 (66%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSSIGSKYGKSMKTGIISFFNIDEGRFSQVDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP--------QSQQWDGLS-ACRSYDINISSLTP  1335
             WGLFRR TKLLCR+C NYIG       P         S    G++     YDI I +L P
Sbjct  96    WGLFRRKTKLLCRQCNNYIGNASYDKAPPEYALVTQNSSPRKGVTDTVTKYDIRIRALQP  155

Query  1334  SS  1329
             SS
Sbjct  156   SS  157



>ref|XP_002285856.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Vitis 
vinifera]
 emb|CBI19018.3| unnamed protein product [Vitis vinifera]
Length=164

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 79/128 (62%), Gaps = 13/128 (10%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY L L S NRNT  IGS+Y K +KRGVISF  +DE+RFT + +F+C+PYF S+HS
Sbjct  29    CGSCGYELKLCSSNRNTKNIGSKYGKNIKRGVISFLQVDESRFTLVDEFKCIPYFISRHS  88

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWD-------------GLSACRSYDINIS  1347
             WGLF   TKLLCR+C N++G      +P     D              +S CR YDI + 
Sbjct  89    WGLFCHRTKLLCRKCSNHVGNAYVRKSPYPLVLDESDSAPAPATATTDISTCRKYDIRLR  148

Query  1346  SLTPSSQD  1323
             +L PSS +
Sbjct  149   ALQPSSSE  156



>ref|XP_006288812.1| hypothetical protein CARUB_v10002147mg [Capsella rubella]
 gb|EOA21710.1| hypothetical protein CARUB_v10002147mg [Capsella rubella]
Length=162

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 80/122 (66%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISF  IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSTIGSKYGKSMKSGIISFVNIDEGRFSQVDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ-----SQQWDGLS----ACRSYDINISSLTP  1335
             WGLF+R TKLLCR+C NYIG       P      +Q  D  S    +   YDI I SL P
Sbjct  96    WGLFKRRTKLLCRKCNNYIGNASQEKAPPEYALVTQNSDPTSPRTRSVTKYDIRIRSLQP  155

Query  1334  SS  1329
             SS
Sbjct  156   SS  157



>ref|NP_001055787.1| Os05g0466700 [Oryza sativa Japonica Group]
 gb|AAT58764.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT58786.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17701.1| Os05g0466700 [Oryza sativa Japonica Group]
 gb|EAY98359.1| hypothetical protein OsI_20270 [Oryza sativa Indica Group]
 gb|EEE64020.1| hypothetical protein OsJ_18849 [Oryza sativa Japonica Group]
Length=152

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 83/127 (65%), Gaps = 14/127 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS  RNT+ IGS+Y K +++GVISFF IDE+RFT   +  C+PYF S+ S
Sbjct  21    CGYCGYALNLSSSTRNTANIGSKYGKQIRKGVISFFAIDESRFTQTDEVSCMPYFHSRRS  80

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDG------------LSACRSYDINISS  1344
             WGLFR+ T+L+CR+CG  IG   +  +  S  +DG            +S+ + Y I I++
Sbjct  81    WGLFRKRTRLICRKCGGRIGN--AYEDEDSTLYDGSDDLHMSSEGYSMSSGKKYVIKINA  138

Query  1343  LTPSSQD  1323
             L PS+ D
Sbjct  139   LQPSTDD  145



>gb|ACU20615.1| unknown [Glycine max]
Length=158

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 84/124 (68%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNT+ IGS+Y K++KRG+ISFF ID +RFT + + +C+P+F  KHS
Sbjct  28    CGTCGYELNLSSSNRNTASIGSKYGKSIKRGIISFFSIDLSRFTQVDEIQCVPHF-DKHS  86

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSLN-PQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+CG++IG        + P   +  +S     + +   YDI I +L P
Sbjct  87    WGLFRRRTKLLCRKCGSHIGNAYNGYTSSFPLVTDGAESSPSSKVVSHTKYDIRIRALQP  146

Query  1334  SSQD  1323
             SS +
Sbjct  147   SSSE  150



>ref|XP_003568271.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Brachypodium distachyon]
Length=147

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 81/123 (66%), Gaps = 10/123 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS  RNT+ IGS+Y K +++GV+SFF IDE+RFT   +  C+PYFRS+ S
Sbjct  20    CGYCGYALNLSSSTRNTANIGSKYGKQIRKGVVSFFAIDESRFTQTDEVSCMPYFRSRCS  79

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSAC--------RSYDINISSLTPS  1332
             WG FR+ T+LLCR+CG +IG   S  +  S  +D L           + Y I I++L PS
Sbjct  80    WGFFRKRTRLLCRKCGGHIG--DSYEDKDSPLYDSLDDTHLSSAGSRKKYVIKINALQPS  137

Query  1331  SQD  1323
             S D
Sbjct  138   SDD  140



>ref|XP_008219643.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic [Prunus 
mume]
Length=164

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY LNLSS NRNTS IGS +Y K++KRG+ISFF ID++RFT + + +C P+F SK 
Sbjct  32    CGSCGYELNLSSNNRNTSTIGSNKYGKSIKRGIISFFHIDDSRFTQVDELQCKPHF-SKR  90

Query  1490  SWGLFRRHTKLLCRECGNYIG---------TLPSSLN-PQSQQWDGLSACRSYDINISSL  1341
             SWGLF R TKLLCR+CG +IG         + P  L+   S     LS CR YD+ I SL
Sbjct  91    SWGLFSRRTKLLCRKCGKHIGNAYDDYTSSSFPLVLDGSDSSSGRELSKCRKYDVRIRSL  150

Query  1340  TPSSQD  1323
              PS+ +
Sbjct  151   QPSNSE  156



>ref|XP_007223618.1| hypothetical protein PRUPE_ppa012569mg [Prunus persica]
 gb|EMJ24817.1| hypothetical protein PRUPE_ppa012569mg [Prunus persica]
Length=164

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 12/126 (10%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY LNLSS NRNTS IGS +Y K++KRG+ISFF ID++RFT + + +C P+F SK 
Sbjct  32    CGSCGYELNLSSNNRNTSTIGSNKYGKSIKRGIISFFHIDDSRFTQVDELQCKPHF-SKR  90

Query  1490  SWGLFRRHTKLLCRECGNYIG---------TLPSSLN-PQSQQWDGLSACRSYDINISSL  1341
             SWGLF R TKLLCR+CG +IG         + P  L+   S     LS CR YD+ I SL
Sbjct  91    SWGLFSRRTKLLCRKCGKHIGNAYDDYTSSSFPLVLDGSDSSSGRELSKCRKYDVRIRSL  150

Query  1340  TPSSQD  1323
              PS+ +
Sbjct  151   QPSNSE  156



>ref|XP_008338775.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Malus domestica]
Length=164

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 85/126 (67%), Gaps = 12/126 (10%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY LNLSS NRNTS IGS +Y K++KRG+ISFF IDE+RFT + + +C P+F SK 
Sbjct  32    CGSCGYELNLSSNNRNTSTIGSNKYGKSIKRGIISFFNIDESRFTQVDELKCKPHF-SKR  90

Query  1490  SWGLFRRHTKLLCRECGNYIG---------TLPSSLN-PQSQQWDGLSACRSYDINISSL  1341
             SWGLF R TKLLCR+CGN+IG         + P  L+   S     ++ CR +D+ I +L
Sbjct  91    SWGLFSRRTKLLCRKCGNHIGNAYDEYTSSSYPLVLDGSDSSSGHEVTKCRKFDVRIRAL  150

Query  1340  TPSSQD  1323
              PS+ +
Sbjct  151   QPSNSE  156



>ref|XP_008378473.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Malus domestica]
Length=164

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 87/133 (65%), Gaps = 12/133 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY LNL S NRNT+ IGS +Y K++KRG+ISFF IDE+RFT + +F+C P+F SK 
Sbjct  32    CGSCGYELNLCSSNRNTTTIGSNKYGKSIKRGIISFFNIDESRFTQVDEFKCKPHF-SKR  90

Query  1490  SWGLFRRHTKLLCRECGNYIGTL---------PSSLNP-QSQQWDGLSACRSYDINISSL  1341
             SWGLF R TKLLCR+CGN+IG           P  L+   S     ++ CR +D+ I +L
Sbjct  91    SWGLFSRRTKLLCRKCGNHIGNAYDEYTSSSCPLVLDESDSSAGHEVTKCRKFDVRICAL  150

Query  1340  TPSSQD*FPRFIL  1302
              PS+ + F   IL
Sbjct  151   QPSNSEEFGTSIL  163



>ref|NP_001044712.1| Os01g0833400 [Oryza sativa Japonica Group]
 dbj|BAD73777.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF06626.1| Os01g0833400 [Oryza sativa Japonica Group]
 gb|EAY76387.1| hypothetical protein OsI_04318 [Oryza sativa Indica Group]
 gb|EAZ14048.1| hypothetical protein OsJ_03973 [Oryza sativa Japonica Group]
 dbj|BAG93154.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97532.1| unnamed protein product [Oryza sativa Japonica Group]
Length=157

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 81/135 (60%), Gaps = 17/135 (13%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  RNT+ IGS+Y K +K+GV+SFF +DE+RFT   +  C+PYF S
Sbjct  15    TYSCGYCGYALNLSSSTRNTANIGSKYGKQIKKGVVSFFAVDESRFTQADEVTCVPYFHS  74

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQW---DGLSACRS-------------  1365
             + SWGLFRR ++LLCR+CG  IG+      P +      DG    R+             
Sbjct  75    RRSWGLFRRRSRLLCRKCGGRIGSAYEEDEPAAAALPACDGPDDLRTTSSGSSGSASSQK  134

Query  1364  -YDINISSLTPSSQD  1323
              Y I I++L PSS D
Sbjct  135   NYVIKINALQPSSDD  149



>ref|XP_010455255.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Camelina sativa]
Length=162

 Score =   121 bits (303),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 79/122 (65%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSTIGSKYGKSMKSGIISFFNIDEGRFSEVDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ-----SQQWDGLS----ACRSYDINISSLTP  1335
             WGLFRR TKLLC +C NYIG       P      +   D  S    +   YDI I SL P
Sbjct  96    WGLFRRRTKLLCGKCNNYIGNASQEKAPHEYALVTHNSDPASPRTGSITKYDIRIRSLQP  155

Query  1334  SS  1329
             SS
Sbjct  156   SS  157



>gb|ACU24223.1| unknown [Glycine max]
Length=158

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 83/124 (67%), Gaps = 10/124 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL S NRNT+ IGS+Y K++KRG+ISFF ID +RFT + + +C+P+F  KHS
Sbjct  28    CGTCGYELNLFSSNRNTASIGSKYGKSIKRGIISFFSIDLSRFTQVDEIQCVPHF-DKHS  86

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLP-SSLNPQSQQWDGLSACRSYDINISSLTP  1335
             WGLFRR TKLLCR+CGN+IG        + P  S   +S     + +   YDI I +L P
Sbjct  87    WGLFRRRTKLLCRKCGNHIGNAYNGYTSSFPLVSDGAESSPSSKVVSHTKYDIRICALQP  146

Query  1334  SSQD  1323
             SS +
Sbjct  147   SSSE  150



>ref|XP_010320097.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Solanum lycopersicum]
Length=157

 Score =   120 bits (302),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 81/122 (66%), Gaps = 9/122 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S +RNT+ IGS+Y K++K+G+ISF  IDE+RFT + +F+C+P+F SK S
Sbjct  27    CGSCGYELNLNSSSRNTASIGSKYGKSIKKGMISFLSIDESRFTQVDEFKCVPFFFSKRS  86

Query  1487  WGLFRRHTKLLCRECGNYIGTL----PSSLNPQSQQWDGLSAC-----RSYDINISSLTP  1335
             WGLF+R TKL CR+CGN IG       SS    +   D  S       R Y+I I SL P
Sbjct  87    WGLFQRRTKLQCRKCGNDIGIAYDDSASSYPLVADASDTASGSEITTHRKYNIKIRSLQP  146

Query  1334  SS  1329
             SS
Sbjct  147   SS  148



>ref|XP_010674381.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=164

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 62/128 (48%), Positives = 80/128 (63%), Gaps = 14/128 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+SCNRNTS    +Y +++K+G+ISFF IDETRF+   + RC P+F S  S
Sbjct  29    CGSCGYKLNLNSCNRNTSG-SKDYGRSIKKGIISFFSIDETRFSRTEQLRCKPFFDSARS  87

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQ-------------WDGLSACRSYDINIS  1347
             WGLF+R T+L CR+CG Y+G        QS +             WDG+S   +YDI I 
Sbjct  88    WGLFQRRTRLYCRKCGKYVGNAHKFTTYQSLKHKDTSPDSTTSWGWDGISDAITYDIRIR  147

Query  1346  SLTPSSQD  1323
             +L PSS D
Sbjct  148   ALQPSSCD  155



>ref|XP_010063967.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW71261.1| hypothetical protein EUGRSUZ_F04352 [Eucalyptus grandis]
Length=162

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 79/120 (66%), Gaps = 10/120 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRN S IGS+Y K++K+G+ISF  +DE+RFT + +  C+PYF SK S
Sbjct  32    CGSCGYELNLSSLNRNMSTIGSKYSKSIKKGIISFRNVDESRFTLVDELHCIPYF-SKRS  90

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSL-NPQSQQWDGLSAC--------RSYDINISSLTP  1335
             WGLFRR TKLLCR+CGN IG     + +  S   DGL +         R YD+ I +L P
Sbjct  91    WGLFRRRTKLLCRKCGNRIGIAYDPITSSDSLVSDGLESFSSSEVPSQRKYDVRIRALQP  150



>emb|CDP10909.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 77/122 (63%), Gaps = 6/122 (5%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY LNLSS +RNTS IGS+YDK++K+G+ISFF IDE+RFT +   +C+P F  
Sbjct  24    TYSCGSCGYELNLSSSSRNTSKIGSKYDKSIKKGIISFFYIDESRFTQVEVLKCVPNFIF  83

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPS------SLNPQSQQWDGLSACRSYDINISSLTP  1335
             KHSWGL  R TKLLCR CGN+IG          +           S+ R YDI I  L P
Sbjct  84    KHSWGLLHRKTKLLCRNCGNHIGDAYEDNAALVTNESDFSSNSESSSQRKYDIRIRCLQP  143

Query  1334  SS  1329
             SS
Sbjct  144   SS  145



>ref|XP_006644960.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Oryza brachyantha]
Length=165

 Score =   120 bits (300),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 84/148 (57%), Gaps = 35/148 (24%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  RNT+ IGS+Y K +K+GV+SFF +DE+RFT   +  C+PYF S
Sbjct  15    TYSCGYCGYALNLSSSTRNTANIGSKYGKQIKKGVVSFFAVDESRFTQADEVTCVPYFHS  74

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSAC------------------  1371
             + SWGLFRR ++LLCR+CG  IG+     +P +     LSAC                  
Sbjct  75    RRSWGLFRRRSRLLCRKCGGRIGSAYEEDDPAA-----LSACDADGGPDDLRTTSSGSSG  129

Query  1370  ------------RSYDINISSLTPSSQD  1323
                         R+Y I I++L PSS D
Sbjct  130   GGSTISSSASSRRNYVIKINALQPSSDD  157



>ref|XP_002441240.1| hypothetical protein SORBIDRAFT_09g022930 [Sorghum bicolor]
 gb|EES19670.1| hypothetical protein SORBIDRAFT_09g022930 [Sorghum bicolor]
Length=149

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 76/125 (61%), Gaps = 10/125 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS  RNT+ IGS+Y K +++GV+SFF IDE+RFT   +  C PYF S HS
Sbjct  18    CGYCGYALNLSSSARNTANIGSKYGKHIRKGVVSFFAIDESRFTQTDEVSCTPYFHSSHS  77

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP----------QSQQWDGLSACRSYDINISSLT  1338
             WG FR  T+LLCR+C  +IG      +P           S +    S  + Y I I++L 
Sbjct  78    WGFFRNRTRLLCRKCSGHIGNAYEDEDPTLCDGSDDLDMSSKGSSTSPRKKYVIKINALQ  137

Query  1337  PSSQD  1323
             PSS D
Sbjct  138   PSSDD  142



>emb|CDY53431.1| BnaCnng25110D [Brassica napus]
Length=162

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 79/122 (65%), Gaps = 10/122 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS IGS+Y K+MK G+ISFF IDE RF+ I +F+C+P+F S++S
Sbjct  37    CGSCGYELNLSSTNRITSSIGSKYGKSMKTGIISFFNIDEGRFSQIDEFQCMPHF-SRYS  95

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP--------QSQQWDGLS-ACRSYDINISSLTP  1335
              GLFRR TKLLCR+C NYIG       P         S    G++     YDI I +L P
Sbjct  96    LGLFRRKTKLLCRQCNNYIGNASYDKAPPEYALVTQNSSPRKGVTDTVTKYDIRIRALQP  155

Query  1334  SS  1329
             SS
Sbjct  156   SS  157



>ref|XP_005849540.1| hypothetical protein CHLNCDRAFT_57236 [Chlorella variabilis]
 gb|EFN57438.1| hypothetical protein CHLNCDRAFT_57236 [Chlorella variabilis]
Length=924

 Score =   128 bits (322),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 104/353 (29%), Positives = 151/353 (43%), Gaps = 122/353 (35%)
 Frame = +3

Query  75   LVFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQL------  236
            ++ I Q G K +LYM LHA  +LDL EK + EI F QV GDF+ FQGKW+L+ L      
Sbjct  521  IIRIRQVGYKRMLYMCLHAESVLDLIEKPQGEIQFRQVAGDFERFQGKWMLQGLPLSGNS  580

Query  237  ---------GSHHTLLKYSVESKMHKNSFL---SEAIMEEVIYEDLPSNLCAIRDYIERL  380
                      +  T LKY+VE  + +++ +    E ++E  ++ED+PSNL AI+  +E L
Sbjct  581  SSTTSDAEPSASQTQLKYAVEIVIPRSTRMLGVLEPLLERTVFEDVPSNLAAIKQRVESL  640

Query  381  EAENAEKTQEYVTYGEAEIKITPDKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDI  560
            +AE                            I   EE  +S  + + R       +  D 
Sbjct  641  QAER--------------------------DIRRLEEAGESAAATALRH------MVDDF  668

Query  561  EILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHR  740
             +L AEL       G  G +P R +LR+                      MN       R
Sbjct  669  AVLVAELERCF---GTNGVLPTRSELRE----------------------MN-------R  696

Query  741  KPKGYWDNLENLQDEISRFQRSWGMDP------SYM------------------------  830
            +PKGYWD+ EN++ E+  F    G+ P      S+M                        
Sbjct  697  RPKGYWDSPENVRAELDEFIEEQGLPPGGCSSKSFMQSALHGNRYAMRLVGRKCRLPYLA  756

Query  831  ---------PSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF  962
                     P + +   AGRYDIARA+E+WGGL+E++  L   V   +R+P F
Sbjct  757  FSPVLEALCPQKMTLYGAGRYDIARAVERWGGLYELAGELGYAVTG-SRKPGF  808



>ref|XP_010099760.1| hypothetical protein L484_010946 [Morus notabilis]
 gb|EXB80378.1| hypothetical protein L484_010946 [Morus notabilis]
Length=166

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 82/128 (64%), Gaps = 16/128 (13%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFR-CLPYFRSKH  1491
             CG CGY LNL+S NRNTS + S Y K +KRG+ISFFC+DE+RF  + K +  +P+F SK 
Sbjct  29    CGSCGYQLNLNSDNRNTSAVSSNYGKLIKRGIISFFCVDESRFVQVEKLQLIIPFFTSKS  88

Query  1490  ---SWGLFRRHTKLLCRECGNYIGT-----------LPSSLNPQSQQWDGLSACRS-YDI  1356
                SWGLF+R TKLLCR+CGN+IG              +S    S  WDG+S CR  YDI
Sbjct  89    SSCSWGLFQRRTKLLCRKCGNHIGNAYKEEISTSSSSGNSNTSYSISWDGISDCRKIYDI  148

Query  1355  NISSLTPS  1332
              I +L PS
Sbjct  149   KIRALQPS  156



>ref|XP_010106361.1| hypothetical protein L484_004389 [Morus notabilis]
 gb|EXC10211.1| hypothetical protein L484_004389 [Morus notabilis]
Length=141

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 11/120 (9%)
 Frame = -1

Query  1652  YALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHSWGLFR  1473
             YALNLSS NRN S IGS+Y K++KRG+ISFF +D++RFT + + +C+P+F SKHSW LFR
Sbjct  20    YALNLSSSNRNISTIGSKYGKSIKRGIISFFYVDDSRFTQVDEIQCIPHF-SKHSWSLFR  78

Query  1472  RHTKLLCRECGNYIGTL---PSSLNP----QSQQWDGLSAC--RSYDINISSLTP-SSQD  1323
             R TKLLCR+C N+IGT     +S +P    +S    G  A   R YDI I +L P SSQ+
Sbjct  79    RQTKLLCRKCNNHIGTTYDEYTSSHPIGLEESDSSSGHEASKRRKYDIKIRALQPLSSQE  138



>ref|XP_004290870.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=166

 Score =   118 bits (296),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 88/136 (65%), Gaps = 16/136 (12%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY LNLSS NRNTS+IGS +Y K++KRG+ISFF IDE+RF+ + + +C P+F S+ 
Sbjct  31    CGACGYELNLSSNNRNTSLIGSNKYGKSIKRGIISFFYIDESRFSQVDELQCKPHF-SRR  89

Query  1490  SWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQ-------------QWDGLSACRSYDINI  1350
             SWGLF R TKLLCR+CGN+IG   +  +  +                  ++ CR YD+ I
Sbjct  90    SWGLFSRRTKLLCRKCGNHIGNAYNDYSSSASYPLVSDGSSDCSSSGRQITICRKYDVRI  149

Query  1349  SSLTPS-SQD*FPRFI  1305
              SL PS S++  P F+
Sbjct  150   RSLQPSNSEERGPSFL  165



>ref|XP_004970464.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Setaria italica]
Length=172

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 81/135 (60%), Gaps = 17/135 (13%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  R+T+ IGS+Y K +K+GV++F  +DE RFT   +  C+PYFRS
Sbjct  30    TYSCGYCGYALNLSSSARDTAGIGSKYRKQIKKGVVAFVAVDEGRFTLADEVACMPYFRS  89

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDG-----------------LSACR  1368
               +WGLFRR ++LLCR+CG  IG      +  S   DG                  S+ R
Sbjct  90    SRAWGLFRRRSRLLCRKCGGRIGDAYEDEDRDSGLSDGDAFSDDLRASSGSGGSSASSQR  149

Query  1367  SYDINISSLTPSSQD  1323
             +Y I IS+L PSS+D
Sbjct  150   NYVIKISALQPSSED  164



>gb|EMT12310.1| hypothetical protein F775_14044 [Aegilops tauschii]
Length=162

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/127 (47%), Positives = 77/127 (61%), Gaps = 14/127 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS  RNT+ IGS+Y K +++GV+SFF IDE+RFT   +  C PYFRS  S
Sbjct  31    CGYCGYALNLSSSTRNTANIGSKYGKLIRKGVVSFFAIDESRFTQTDEVSCTPYFRSSRS  90

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSAC------------RSYDINISS  1344
             WG FR+ T+LLCR+C  +IG      +  S  +D L               + Y I I++
Sbjct  91    WGFFRKRTRLLCRKCSGHIGNAYD--DKDSALYDTLDDTLASSEVSSMSSRKKYVIKINA  148

Query  1343  LTPSSQD  1323
             L PSS D
Sbjct  149   LQPSSDD  155



>ref|XP_006654525.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Oryza brachyantha]
Length=150

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 79/126 (63%), Gaps = 11/126 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS  RNT+ IGS+Y K +++GVISFF +DE+RFT   +  C PYF S+ S
Sbjct  18    CGYCGYALNLSSSTRNTANIGSKYGKQIRKGVISFFSVDESRFTQTDEVSCTPYFHSRRS  77

Query  1487  WGLFRRHTKLLCRECGNYIGTL-----PSSLNPQSQ------QWDGLSACRSYDINISSL  1341
             WG FR+ T+L CR+CG  IG+       S+L   S       +   +S  + Y I I++L
Sbjct  78    WGFFRKRTRLFCRKCGGRIGSAYEDEGSSTLYGGSDDLHMASEGSSISIGKKYVIRINAL  137

Query  1340  TPSSQD  1323
              PS+ D
Sbjct  138   RPSTDD  143



>gb|AFW78310.1| hypothetical protein ZEAMMB73_684979 [Zea mays]
Length=308

 Score =   119 bits (298),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 75/120 (63%), Gaps = 5/120 (4%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CG+ALNLSS  RNT+ IGS+Y K +++GV+SFF IDE+RFT   +  C PYFRS  S
Sbjct  182   CGYCGFALNLSSSTRNTANIGSKYGKHIRKGVVSFFAIDESRFTQADEVSCTPYFRSSRS  241

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP-----QSQQWDGLSACRSYDINISSLTPSSQD  1323
             WG FR  T+LLCR+CG + G       P      S +    S  + Y I IS+L PSS D
Sbjct  242   WGFFRNRTRLLCRKCGGHTGHAYEDEGPADDLDMSSRGSSTSPRKKYVIKISALRPSSDD  301



>ref|XP_009402377.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=212

 Score =   115 bits (289),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 77/127 (61%), Gaps = 25/127 (20%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS +R+T+ IGS+Y K+ K+G++SF  +DE+RF+ + + RC PYF S+HS
Sbjct  90    CGSCGYALNLSSSDRDTANIGSKYRKSAKKGIVSFVAVDESRFSQVEELRCWPYFESRHS  149

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLS----------------ACRSYDI  1356
             WGL RR TKL CR+C N++G            +DG S                A + Y I
Sbjct  150   WGLLRRKTKLSCRKCKNFVGV---------GHYDGASTQAGSDSSVSGSGNGEAPKKYFI  200

Query  1355  NISSLTP  1335
              IS+L P
Sbjct  201   KISALQP  207



>gb|AFK48244.1| unknown [Lotus japonicus]
Length=165

 Score =   114 bits (285),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY LNLSS NRNTS IGS +Y K++KRG+I FF ID++RFT + +  C P+F SKH
Sbjct  30    CGTCGYELNLSSSNRNTSSIGSTKYGKSIKRGIIPFFNIDDSRFTQVDEIECAPHF-SKH  88

Query  1490  SWGLFRRHTKLLCRECGNYIG  1428
             SWGLFRR TKLLCR+C NYIG
Sbjct  89    SWGLFRRKTKLLCRKCCNYIG  109



>ref|NP_001144678.1| uncharacterized protein LOC100277705 [Zea mays]
 gb|ACG42267.1| hypothetical protein [Zea mays]
Length=153

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 74/129 (57%), Gaps = 14/129 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CG+ALNLSS  RNT+ IGS+Y K +++GV+SFF IDE+RFT   +  C PYFRS  S
Sbjct  18    CGYCGFALNLSSSTRNTANIGSKYGKHIRKGVVSFFAIDESRFTQADEVSCTPYFRSSRS  77

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQ---WDGLSAC-----------RSYDINI  1350
             WG FR  T+LLCR+CG + G       P  +     D L              + Y I I
Sbjct  78    WGFFRNRTRLLCRKCGGHTGYAYEDEGPALRDEGPADDLDMSSSSRGSSTSPRKKYVIKI  137

Query  1349  SSLTPSSQD  1323
             S+L P S D
Sbjct  138   SALRPLSDD  146



>ref|NP_001190689.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE82628.1| uncharacterized protein AT4G08330 [Arabidopsis thaliana]
Length=153

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 75/114 (66%), Gaps = 9/114 (8%)
 Frame = -1

Query  1646  LNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHSWGLFRRH  1467
             +N SS NR TS IGS+Y K+MK G+ISFF IDE RF+ + +F+C+P+F S++SWGLFR  
Sbjct  36    VNYSSTNRITSTIGSKYGKSMKSGIISFFNIDEGRFSQVDEFQCMPHF-SRYSWGLFRHR  94

Query  1466  TKLLCRECGNYIGTLPSSLNPQ----SQQWDGLS----ACRSYDINISSLTPSS  1329
             TKLLCR+C NYIG       P+    +Q  D  S    +   YDI I SL PSS
Sbjct  95    TKLLCRKCNNYIGNASQEKAPEYALVTQNSDPTSPRIGSVTKYDIRIRSLQPSS  148



>emb|CDP07990.1| unnamed protein product [Coffea canephora]
Length=439

 Score = 93.2 bits (230),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 43/45 (96%), Gaps = 0/45 (0%)
 Frame = +3

Query  708  LMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRK  842
            LMNLSLAYKHRKPKGYWDNLENLQ+EIS FQ+SWGMDP +MPSRK
Sbjct  356  LMNLSLAYKHRKPKGYWDNLENLQEEISWFQKSWGMDPLFMPSRK  400


 Score = 49.3 bits (116),  Expect(2) = 2e-24, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  823  LICPAENLLNEQVDTILLVHWKNGVGFMKSHVFCHSR*GIPTDNQ  957
            L  P+  LL++QV  IL +HW++G  FMK HVF H R GI TD +
Sbjct  394  LFMPSRKLLSKQVAMILRMHWRSGEVFMKFHVFFHLRYGILTDKK  438


 Score = 59.3 bits (142),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  87   LQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSF  209
            LQ    GLLY+VL  RV+L LCE +E+E SF+QVEGDFDSF
Sbjct  292  LQVQTAGLLYVVLQVRVVLYLCEALEQESSFQQVEGDFDSF  332



>ref|XP_004961796.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Setaria italica]
Length=167

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 75/125 (60%), Gaps = 10/125 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS  RNT+ IGS+Y K +++GV+SFF IDE RFT   +  C+PYF S  S
Sbjct  18    CGYCGYALNLSSSTRNTANIGSKYGKQIRKGVVSFFAIDENRFTQTDEVSCMPYFHSSRS  77

Query  1487  WGLFRRHTKLLCRECGNYIGTLPS----SLNPQSQQWD------GLSACRSYDINISSLT  1338
             WG FR  T+LLCR+C  +IG        +L   S   D        S  + Y I I++L 
Sbjct  78    WGFFRNRTRLLCRKCSGHIGNAYEDEDFTLCEASDDLDMSSKSSSTSTRKKYVIKINALQ  137

Query  1337  PSSQD  1323
             PSS D
Sbjct  138   PSSDD  142



>ref|XP_003602030.1| hypothetical protein MTR_3g088030 [Medicago truncatula]
 gb|AES72281.1| hypothetical protein MTR_3g088030 [Medicago truncatula]
Length=176

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 80/126 (63%), Gaps = 14/126 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRNTS I S+Y K++KRG+ISFF ID++RFT + +  C P+F SK+ 
Sbjct  40    CGSCGYDLNLSSSNRNTSSIDSKYGKSIKRGIISFFNIDDSRFTQVDEIECAPHF-SKNL  98

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQW-----DGLSACRS--------YDINIS  1347
             WGLFRR TKLLCR+C N+IG   +  N  S  +     +G     S        Y+I I 
Sbjct  99    WGLFRRKTKLLCRKCCNHIGYAYNGNNSSSPSFILVSSNGAEPSPSTEAPTHVKYNIRIR  158

Query  1346  SLTPSS  1329
             +L PSS
Sbjct  159   ALQPSS  164



>ref|NP_001145404.1| uncharacterized protein LOC100278761 [Zea mays]
 gb|ACG47304.1| hypothetical protein [Zea mays]
Length=167

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 78/144 (54%), Gaps = 26/144 (18%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  R+T  IG +Y K +++GV++F  +DE+RFT   +  C PYFRS
Sbjct  15    TYSCGYCGYALNLSSSARDTEGIGPKYRKQIRKGVVAFVAVDESRFTLAHELTCTPYFRS  74

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSAC------------------  1371
               SWGLFRR ++LLCR+CG +IG+       +    D  S+                   
Sbjct  75    ARSWGLFRRRSRLLCRKCGGHIGSAYGYGEEEEDARDSSSSSLFGGDGSSDDTRPSSGSG  134

Query  1370  --------RSYDINISSLTPSSQD  1323
                     +SY + IS+L PSS D
Sbjct  135   RSSVASSQKSYVVRISALQPSSDD  158



>ref|XP_008654761.1| PREDICTED: uncharacterized protein LOC100278761 isoform X1 [Zea 
mays]
 gb|AFW84677.1| hypothetical protein ZEAMMB73_646060 [Zea mays]
Length=163

 Score =   107 bits (267),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  R+T  IG +Y K +++GV++F  +DE+RFT   +  C PYFRS
Sbjct  15    TYSCGYCGYALNLSSSARDTEGIGPKYRKQIRKGVVAFVAVDESRFTLAHELTCTPYFRS  74

Query  1496  KHSWGLFRRHTKLLCRECGNYIGT  1425
               SWGLFRR ++LLCR+CG +IG+
Sbjct  75    ARSWGLFRRRSRLLCRKCGGHIGS  98



>ref|XP_002456589.1| hypothetical protein SORBIDRAFT_03g038930 [Sorghum bicolor]
 gb|EES01709.1| hypothetical protein SORBIDRAFT_03g038930 [Sorghum bicolor]
Length=184

 Score =   106 bits (265),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIG-SEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFR  1500
             T  CG CGYALNLSS  R+T  IG S+Y K +K+GV++F  +DETRFT   +  C+PYFR
Sbjct  28    TYSCGYCGYALNLSSSARDTEGIGCSKYRKQIKKGVVAFVAVDETRFTLADEVTCMPYFR  87

Query  1499  SKHSWGLFRRHTKLLCRECGNYIG  1428
             S  SWGLFRR  +LLCR+CG  IG
Sbjct  88    SARSWGLFRRRARLLCRKCGGRIG  111



>ref|XP_008654762.1| PREDICTED: uncharacterized protein LOC100278761 isoform X2 [Zea 
mays]
Length=155

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  R+T  IG +Y K +++GV++F  +DE+RFT   +  C PYFRS
Sbjct  15    TYSCGYCGYALNLSSSARDTEGIGPKYRKQIRKGVVAFVAVDESRFTLAHELTCTPYFRS  74

Query  1496  KHSWGLFRRHTKLLCRECGNYIGT  1425
               SWGLFRR ++LLCR+CG +IG+
Sbjct  75    ARSWGLFRRRSRLLCRKCGGHIGS  98



>gb|AFW84678.1| hypothetical protein ZEAMMB73_646060 [Zea mays]
Length=228

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGYALNLSS  R+T  IG +Y K +++GV++F  +DE+RFT   +  C PYFRS
Sbjct  80    TGSCGYCGYALNLSSSARDTEGIGPKYRKQIRKGVVAFVAVDESRFTLAHELTCTPYFRS  139

Query  1496  KHSWGLFRRHTKLLCRECGNYIGT  1425
               SWGLFRR ++LLCR+CG +IG+
Sbjct  140   ARSWGLFRRRSRLLCRKCGGHIGS  163



>ref|XP_003564544.2| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Brachypodium distachyon]
Length=247

 Score =   106 bits (264),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 1/86 (1%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGS-EYDKAMKRGVISFFCIDETRFTHITKFRCLPYFR  1500
             T  CG CGYALNL S  RNT+ IGS +Y K +K+GV++F  +DETRFT   +  C P+FR
Sbjct  101   TYSCGYCGYALNLCSSARNTAGIGSTKYGKQIKKGVVAFLAVDETRFTRADEVTCAPHFR  160

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTL  1422
             S  SWGLFRR ++LLCR+CG  IG +
Sbjct  161   SARSWGLFRRRSRLLCRKCGGRIGAV  186



>ref|XP_004502467.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Cicer arietinum]
Length=171

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 72/116 (62%), Gaps = 6/116 (5%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRN SVI S+Y K++KRG+ISF  ID+TRFT   +  C P+F SK S
Sbjct  43    CGSCGYDLNLSSSNRNISVIDSKYKKSIKRGIISFSNIDDTRFTQADEIHCAPHF-SKKS  101

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNP-----QSQQWDGLSACRSYDINISSLTP  1335
             W LFR  +KLLCR+C N+IG   +  N       +      S  + Y I IS+L P
Sbjct  102   WSLFRPKSKLLCRKCCNHIGYSYNGYNSSFILVSNGAEPSPSTEKQYSIRISALQP  157



>gb|KHN16927.1| Hypothetical protein glysoja_003024 [Glycine soja]
Length=161

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 21/120 (18%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNT-SVIGSEYDKAMKRGVISFFCIDETRFTHITKFR---CLPYFR  1500
             CG CGY LNL+S NRNT S+I S   K++KRG+ISFF +DE+RFT I +      +P+F 
Sbjct  30    CGSCGYELNLNSSNRNTCSLIDS---KSIKRGIISFFSVDESRFTQIQQLHWPSWMPFFN  86

Query  1499  SKHSWGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLS-ACRSYDINISSLTPS  1332
             SK      R+ TKL CR CGN++G   TLPS    QSQ WDG+S   R YDI +++L PS
Sbjct  87    SK------RQRTKLFCRSCGNHLGYAYTLPS----QSQSWDGISDDSRIYDIKLTALLPS  136



>ref|NP_001235338.1| uncharacterized protein LOC100527641 [Glycine max]
 gb|ACU16772.1| unknown [Glycine max]
Length=161

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 79/120 (66%), Gaps = 21/120 (18%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNT-SVIGSEYDKAMKRGVISFFCIDETRFTHITKFR---CLPYFR  1500
             CG CGY LNL+S NRNT S+I S   K++KRG+ISFF +DE+RFT I +      +P+F 
Sbjct  30    CGSCGYELNLNSSNRNTCSLIDS---KSIKRGIISFFSMDESRFTQIQQLHWPSWMPFFN  86

Query  1499  SKHSWGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLS-ACRSYDINISSLTPS  1332
             SK      R+ TKL CR CGN++G   TLPS    QSQ WDG+S   R YDI +++L PS
Sbjct  87    SK------RQRTKLFCRSCGNHLGYAYTLPS----QSQSWDGISDDSRIYDIKLTALLPS  136



>ref|XP_007159890.1| hypothetical protein PHAVU_002G276300g [Phaseolus vulgaris]
 gb|ESW31884.1| hypothetical protein PHAVU_002G276300g [Phaseolus vulgaris]
Length=160

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 19/119 (16%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFR---CLPYFRS  1497
             CG CGY LNL+S NRNT +I S   K++KRG+ISFF +DE+RFT I +      +P+F S
Sbjct  30    CGSCGYELNLNSSNRNTGLIDS---KSIKRGIISFFSVDESRFTQIQQLPWSFWIPFFNS  86

Query  1496  KHSWGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLS-ACRSYDINISSLTPS  1332
             K      ++ TKLLCR C +++G   TLPS    QSQ WDG+S   R YDI +++L PS
Sbjct  87    KR-----QQRTKLLCRNCASHLGYAYTLPS----QSQSWDGISDDSRIYDIKLTALLPS  136



>ref|XP_006858776.1| hypothetical protein AMTR_s00066p00155040 [Amborella trichopoda]
 gb|ERN20243.1| hypothetical protein AMTR_s00066p00155040 [Amborella trichopoda]
Length=120

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRS  1497
             T  CG CGY+LNL S NR TS IGS Y K++K+GVISF  +D +RFT I + +CLPY   
Sbjct  7     TYSCGSCGYSLNLKSSNRITSRIGSGYQKSIKKGVISFLSVDPSRFTQIDEVKCLPY---  63

Query  1496  KHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
               SWG F   TKLLCR CG +IG                S+ R Y I I ++ P
Sbjct  64    --SWGPFGMKTKLLCRNCGTHIGYGYGDSASNCSDSATHSSHRKYTIKIRAVQP  115



>ref|XP_003074385.1| unnamed protein product [Ostreococcus tauri]
Length=612

 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 157/307 (51%), Gaps = 48/307 (16%)
 Frame = +3

Query  126  HARVILDLCEKIEEEISFEQVEGD--------------FDSFQGKW-ILEQLGSHHTLLK  260
            H  V  +L   +EE +  + V+ D              F + QGKW ++    S  ++LK
Sbjct  318  HVFVKCELFHAVEEAVGMDVVQKDDRTELQFRILQNPKFGALQGKWLVVPTEDSKASVLK  377

Query  261  YSVESKMHKNSFLSEAIM----EEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGE  428
            +++E  + + + +   ++    E +++E++ + L   RD++E +         E  ++G 
Sbjct  378  FAIEGVVRRENDMGAKVLDPLNERIVFEEISTMLKQARDFMENI------ANMEVESFGS  431

Query  429  AEIKITPDKDLSADSISPYEE------TSDSVNSESHRQRPKVPGLQRDIEILRAELLGF  590
              IKI  D  L  + +S  EE      TS +++S   ++R +    +  +  LR EL+G 
Sbjct  432  VNIKIA-DLVLKGEGMSVDEEDIVEEQTSGTLSSSVVKRRSE--DSEEMLRALREELIGL  488

Query  591  ISEHGQEGFMPMRKQLRKHGR--VDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDN  764
                G++G MP R+QLR  GR  V IEK I  +GGF R+A  M+ + A    +P+GYW +
Sbjct  489  --GFGEDGLMPTREQLRA-GRHWVAIEK-IESLGGFVRVAQKMDWTGA--KTRPRGYW-S  541

Query  765  LENLQDEISRFQRSWGM-----DPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSL  929
            L  L+ EI+ F  +  +     +P  MPS+K F  AGR DI  AL+++GG  +V+  ++L
Sbjct  542  LNTLELEINEFIANSDVPSVRENPGVMPSQKVFREAGRADIVNALKRFGGAGKVATRMNL  601

Query  930  KVRHPNR  950
            + +  ++
Sbjct  602  EFKRASK  608



>emb|CEF96689.1| Streptomyces cyclase/dehydrase [Ostreococcus tauri]
Length=620

 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 89/307 (29%), Positives = 157/307 (51%), Gaps = 48/307 (16%)
 Frame = +3

Query  126  HARVILDLCEKIEEEISFEQVEGD--------------FDSFQGKW-ILEQLGSHHTLLK  260
            H  V  +L   +EE +  + V+ D              F + QGKW ++    S  ++LK
Sbjct  326  HVFVKCELFHAVEEAVGMDVVQKDDRTELQFRILQNPKFGALQGKWLVVPTEDSKASVLK  385

Query  261  YSVESKMHKNSFLSEAIM----EEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGE  428
            +++E  + + + +   ++    E +++E++ + L   RD++E +         E  ++G 
Sbjct  386  FAIEGVVRRENDMGAKVLDPLNERIVFEEISTMLKQARDFMENI------ANMEVESFGS  439

Query  429  AEIKITPDKDLSADSISPYEE------TSDSVNSESHRQRPKVPGLQRDIEILRAELLGF  590
              IKI  D  L  + +S  EE      TS +++S   ++R +    +  +  LR EL+G 
Sbjct  440  VNIKIA-DLVLKGEGMSVDEEDIVEEQTSGTLSSSVVKRRSE--DSEEMLRALREELIGL  496

Query  591  ISEHGQEGFMPMRKQLRKHGR--VDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDN  764
                G++G MP R+QLR  GR  V IEK I  +GGF R+A  M+ + A    +P+GYW +
Sbjct  497  --GFGEDGLMPTREQLRA-GRHWVAIEK-IESLGGFVRVAQKMDWTGA--KTRPRGYW-S  549

Query  765  LENLQDEISRFQRSWGM-----DPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSL  929
            L  L+ EI+ F  +  +     +P  MPS+K F  AGR DI  AL+++GG  +V+  ++L
Sbjct  550  LNTLELEINEFIANSDVPSVRENPGVMPSQKVFREAGRADIVNALKRFGGAGKVATRMNL  609

Query  930  KVRHPNR  950
            + +  ++
Sbjct  610  EFKRASK  616



>gb|EYU43129.1| hypothetical protein MIMGU_mgv1a015366mg [Erythranthe guttata]
Length=160

 Score = 98.2 bits (243),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 76/126 (60%), Gaps = 23/126 (18%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+SCNR+   I  +Y+K++KRGVISF+ IDE+RFT +         R +  
Sbjct  38    CGSCGYELNLNSCNRD---ISEQYEKSIKRGVISFYSIDESRFTEMNN----KMMRWRL-  89

Query  1487  WGLF--RRHTKLLCRECGNYIGTL-------------PSSLNPQSQQWDGLSACRSYDIN  1353
             W LF  R  TKLLCR CG+YIGT+              +  N  +  WDG+SA R+Y+I 
Sbjct  90    WFLFQGRSRTKLLCRNCGSYIGTVCNINNNNNSSSFSSAIKNTSAVTWDGISARRTYEIK  149

Query  1352  ISSLTP  1335
             I SL+P
Sbjct  150   IRSLSP  155



>ref|XP_003526632.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Glycine max]
 gb|KHN09206.1| Hypothetical protein glysoja_025667 [Glycine soja]
Length=168

 Score = 97.8 bits (242),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 75/125 (60%), Gaps = 13/125 (10%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NRN S IGS+Y K++KRG+ISF  +D++RFT   +    PYF SKH 
Sbjct  35    CGTCGYELNLSSSNRNISSIGSKYGKSIKRGIISFLNVDDSRFTRADEIEFAPYF-SKHK  93

Query  1487  WGLFRRHTKLLCRECGNYIGT------------LPSSLNPQSQQWDGLSACRSYDINISS  1344
             WGLFRR TKLLCR+C N+IG             + +   P        S+   YDI I +
Sbjct  94    WGLFRRKTKLLCRKCCNHIGYAYNDRTSSFFPFVSNRTEPSPPTEASNSSPMKYDIRIRA  153

Query  1343  LTPSS  1329
             L PSS
Sbjct  154   LQPSS  158



>ref|XP_007137412.1| hypothetical protein PHAVU_009G125000g [Phaseolus vulgaris]
 ref|XP_007137413.1| hypothetical protein PHAVU_009G125000g [Phaseolus vulgaris]
 gb|ESW09406.1| hypothetical protein PHAVU_009G125000g [Phaseolus vulgaris]
 gb|ESW09407.1| hypothetical protein PHAVU_009G125000g [Phaseolus vulgaris]
Length=165

 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 80/125 (64%), Gaps = 11/125 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR+ S IGS+Y K++KRG+ISF  +D++RFT   +  C P+F SKHS
Sbjct  35    CGTCGYDLNLSSSNRSISSIGSKYGKSIKRGIISFLNVDDSRFTRAEEIECAPFF-SKHS  93

Query  1487  WGLFRRHTKLLCRECGNYIG-------TLPSSLNPQSQQWDGLSACRS---YDINISSLT  1338
             WGLFR  TKLLCR+C N++G       +L S L     +    +   S   YDI I +L 
Sbjct  94    WGLFRPKTKLLCRKCCNHVGYSYNHHTSLSSPLVSNGTKPSPATQASSPIKYDIRIRALQ  153

Query  1337  PSSQD  1323
             PSSQ+
Sbjct  154   PSSQE  158



>ref|XP_003524318.2| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X1 [Glycine max]
Length=134

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 17/117 (15%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNT-SVIGSEYDKAMKRGVISFFCIDETRFTHITKFR---CLPYFR  1500
             C  CGY LNL+S NRNT S+I S   K++KRG+ISFF +DE+RFT I +      +P+F 
Sbjct  12    CSSCGYELNLNSSNRNTCSLIDS---KSIKRGIISFFSVDESRFTQIQQLHWPSWIPFFN  68

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLS-ACRSYDINISSLTPS  1332
             SK      R+ TKLLCR CGN++G   +S    SQ WDG+S   R YDI ++SL PS
Sbjct  69    SK------RQRTKLLCRSCGNHLGYAYTS---PSQSWDGISDDSRIYDIKLTSLLPS  116



>ref|XP_006580352.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X2 [Glycine max]
Length=128

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 17/117 (15%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNT-SVIGSEYDKAMKRGVISFFCIDETRFTHITKFR---CLPYFR  1500
             C  CGY LNL+S NRNT S+I S   K++KRG+ISFF +DE+RFT I +      +P+F 
Sbjct  16    CSSCGYELNLNSSNRNTCSLIDS---KSIKRGIISFFSVDESRFTQIQQLHWPSWIPFFN  72

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLS-ACRSYDINISSLTPS  1332
             SK      R+ TKLLCR CGN++G   +S    SQ WDG+S   R YDI ++SL PS
Sbjct  73    SK------RQRTKLLCRSCGNHLGYAYTS---PSQSWDGISDDSRIYDIKLTSLLPS  120



>ref|XP_001415547.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO93839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=688

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 91/312 (29%), Positives = 148/312 (47%), Gaps = 61/312 (20%)
 Frame = +3

Query  135  VILDLCEKIEEEISFEQVEGD--------------FDSFQGKW-ILEQLGSHHTLLKYSV  269
            V  DL   IEE  + + V+ D              F + QGKW ++    S  T+LK+++
Sbjct  392  VKCDLFHAIEESTALDVVQKDDRTELQFRVLQNPKFGALQGKWLVVPTEDSAATVLKFAI  451

Query  270  ESKMHKNSFLSEA-----IMEEVIYEDLPSNLCAIRDYIERLEAENAEKTQEYVTYGEAE  434
            E  +        A     + E +++E++ + L   RD++E +       ++E  +YG   
Sbjct  452  EGVVSNAGIDGTAKKVDPLNERIVFEEISTMLKQARDFMEGI------ASKEVQSYGNVN  505

Query  435  IKITPDKDLSADSISPYEETS------DSVNSESHRQRPKVPGLQRDIEILRAEL--LGF  590
            IK+  D  L    +S  EE +       ++NSE+   +      ++ I+ L+ EL  LGF
Sbjct  506  IKVA-DLVLKGAGMSVDEEDAVDEQIVGALNSEATENQ------EKQIQALKRELITLGF  558

Query  591  ISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLE  770
                G+   MP R+QLR     D  + I  +GGF ++A L++ S A    +P+GYW  L 
Sbjct  559  ----GENKCMPTREQLRGGRHWDAIQQIESLGGFVKVAQLLDWSGA--KTRPRGYW-TLR  611

Query  771  NLQDEISRF---------QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLL  923
             L+ EI  F         QR    +P  MPS+KS   AGR DI  AL+++GG  +V+  +
Sbjct  612  TLELEIKDFIANTEDPNVQR----NPRRMPSQKSLRDAGRADIVNALKRFGGAEKVAASM  667

Query  924  SLKVRHPNRQPS  959
             L+    N++ S
Sbjct  668  GLEFGSGNKRSS  679



>ref|XP_002524580.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37788.1| conserved hypothetical protein [Ricinus communis]
Length=122

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 70/121 (58%), Gaps = 16/121 (13%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR TS I SEY K++K+G ISF  +D +RFT + +  C+P +     
Sbjct  10    CGSCGYPLNLSSSNRITSSIDSEYRKSIKKGYISFLSVDLSRFTQVDEVNCIPLY-----  64

Query  1487  WGLFRRHTKLLCRECGNYIG-------TLPSSLNPQSQQWDGLSACRSYDINISSLTPSS  1329
             WG +R  TKLLCR+CG +IG        L    +P S      SA + + I I +L PS 
Sbjct  65    WGRYRSKTKLLCRKCGVHIGYGYGDSPALCGFDSPSSSN----SAYKKFTIKIRALQPSE  120

Query  1328  Q  1326
             +
Sbjct  121   E  121



>ref|XP_006469372.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Citrus sinensis]
Length=125

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 69/115 (60%), Gaps = 8/115 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS IGSEY K++K+G ISF  ID +RFT + +  C P      +
Sbjct  10    CGSCGYPLNLTSSNRITSGIGSEYQKSIKKGFISFLSIDLSRFTQVDEVNCFPV-----A  64

Query  1487  WGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             WG +R  TKLLCR+CG +IG      S+L          SA + ++I + +L PS
Sbjct  65    WGRYRSKTKLLCRKCGVHIGYGYGCSSALCGFDSPNATSSAYKKFNIKLRALQPS  119



>ref|XP_004978949.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Setaria italica]
Length=124

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 69/118 (58%), Gaps = 13/118 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR+TS +GS Y K++K+G+ISF  +D +RFT + +  C P      +
Sbjct  10    CGSCGYPLNLSSSNRSTSEVGSSYKKSLKKGLISFVSVDLSRFTQVDEISCFPI-----T  64

Query  1487  WGLFRRHTKLLCRECGNYIG------TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             W  +R  TKLLCR+CG  IG      T+  S +P S      S  + Y I I +L PS
Sbjct  65    WRAYRPKTKLLCRKCGASIGYGYGEPTVLCSFDPASSSS--SSTSQKYLIKIQALQPS  120



>ref|XP_008800694.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Phoenix dactylifera]
Length=120

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/116 (44%), Positives = 68/116 (59%), Gaps = 8/116 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS IGS+Y K++K+GVISF  +D +RFT + +  C P      +
Sbjct  10    CGSCGYPLNLTSSNRITSGIGSDYQKSIKKGVISFISVDLSRFTQVDEINCFPI-----N  64

Query  1487  WGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLSACRSYDINISSLTPSS  1329
              G +R  TKLLCR+CG  IG      + L          S+C+ Y I I +L PS+
Sbjct  65    LGRYRPKTKLLCRKCGALIGYGYGESAVLCGFDSVGSSSSSCQKYSIKIRALQPSA  120



>ref|NP_001144168.1| uncharacterized protein LOC100277023 [Zea mays]
 gb|ACG38417.1| hypothetical protein [Zea mays]
Length=124

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 5/80 (6%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR+TS +GS Y K++K+G+ISF  +D +RFT + K  C P      +
Sbjct  10    CGFCGYPLNLSSSNRSTSEVGSSYKKSLKKGLISFISVDLSRFTQVDKVSCFPL-----T  64

Query  1487  WGLFRRHTKLLCRECGNYIG  1428
             W  +R  TKLLCR+CG  IG
Sbjct  65    WRSYRPKTKLLCRKCGASIG  84



>gb|EEE51938.1| hypothetical protein OsJ_33565 [Oryza sativa Japonica Group]
Length=123

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 8/115 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR+TS +GS Y K++K+G+ISF  +D +RFT + +  C P      +
Sbjct  10    CGSCGYPLNLSSSNRSTSDVGSSYQKSVKKGLISFITVDLSRFTQVDEISCFPL-----T  64

Query  1487  WGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             W  +R  TKLLCR+CG  IG     P+ L          S  + Y I I +L PS
Sbjct  65    WRSYRPKTKLLCRKCGASIGYGYGEPAVLCSFDPASSSSSTSQKYLIKIQALQPS  119



>gb|EEC67970.1| hypothetical protein OsI_35724 [Oryza sativa Indica Group]
Length=123

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 50/115 (43%), Positives = 66/115 (57%), Gaps = 8/115 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR+TS +GS Y K++K+G+ISF  +D +RFT + +  C P      +
Sbjct  10    CGSCGYPLNLSSSNRSTSGVGSSYQKSVKKGLISFITVDLSRFTQVDEISCFPL-----T  64

Query  1487  WGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             W  +R  TKLLCR+CG  IG     P+ L          S  + Y I I +L PS
Sbjct  65    WRSYRPKTKLLCRKCGASIGYGYGEPAVLCSFDPASSSSSTSQKYLIKIQALQPS  119



>ref|XP_008235921.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Prunus mume]
Length=124

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 69/123 (56%), Gaps = 18/123 (15%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSV--IGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSK  1494
             CG C Y LNLSS NR TS   IGSEY K++K+G ISF  +D +RFT + +  C P     
Sbjct  10    CGSCAYPLNLSSLNRLTSGSGIGSEYQKSVKKGFISFLTVDLSRFTQVDEVNCFPV----  65

Query  1493  HSWGLFRRHTKLLCRECGNYIG-------TLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
              SWG +R  TKLLCR+CG +IG        L    +P S      SA R + + I +L P
Sbjct  66    -SWGRYRSKTKLLCRKCGVHIGYGYGDSSVLCGFDSPNSST----SAYRKFTVKIRALQP  120

Query  1334  SSQ  1326
             S +
Sbjct  121   SEE  123



>ref|XP_002450522.1| hypothetical protein SORBIDRAFT_05g006540 [Sorghum bicolor]
 gb|EES09510.1| hypothetical protein SORBIDRAFT_05g006540 [Sorghum bicolor]
Length=124

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 5/80 (6%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNLSS NR+TS +GS Y K++K+G+ISF  +D +RFT + +  C P      +
Sbjct  10    CGSCGYPLNLSSSNRSTSEVGSSYKKSLKKGLISFISVDLSRFTQVDEVSCFPL-----A  64

Query  1487  WGLFRRHTKLLCRECGNYIG  1428
             W  +R  TKLLCR+CG  IG
Sbjct  65    WRSYRPKTKLLCRKCGASIG  84



>ref|XP_002970576.1| hypothetical protein SELMODRAFT_441180 [Selaginella moellendorffii]
 gb|EFJ28706.1| hypothetical protein SELMODRAFT_441180 [Selaginella moellendorffii]
Length=195

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 8/120 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG C + LNLSS +R  + IG  Y K  ++G++ F  IDE+RF  + + +C PYF S   
Sbjct  16    CGRCAFKLNLSSSDRLITSIGPRYSKTSRKGILYFLSIDESRFRMLDEVKCGPYFESPGK  75

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYD------INISSLTPSSQ  1326
             WG+ R  T+LLCR+CG  IG L S ++  S     L   RS D      I I +L P  +
Sbjct  76    WGIQRMQTRLLCRQCGATIGHLESGIS--SSVIGCLDVDRSTDDGKRFCIKIRALQPEQE  133



>ref|XP_002968415.1| hypothetical protein SELMODRAFT_409213 [Selaginella moellendorffii]
 gb|EFJ30669.1| hypothetical protein SELMODRAFT_409213 [Selaginella moellendorffii]
Length=195

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 66/120 (55%), Gaps = 8/120 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG C + LNLSS +R  + IG  Y K  ++G++ F  IDE+RF  + + +C PYF S   
Sbjct  16    CGRCAFKLNLSSSDRLITSIGPRYSKTSRKGILYFLSIDESRFRMLDEVKCGPYFESPGK  75

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYD------INISSLTPSSQ  1326
             WG+ R  T+LLCR+CG  IG L S ++  S     L   RS D      I I +L P  +
Sbjct  76    WGIQRMQTRLLCRQCGATIGHLESGIS--SSVIGCLDVDRSTDDGKRFCIKIRALQPEQE  133



>ref|XP_009358929.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Pyrus x bretschneideri]
Length=125

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 11/120 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSV--IGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSK  1494
             CG C Y LNLSS NR TS   IGS Y K++K+G ISF  +D +RFT + +  C P     
Sbjct  10    CGSCAYPLNLSSANRLTSESGIGSNYQKSIKKGFISFLTVDLSRFTQVDEVNCFPV----  65

Query  1493  HSWGLFRRHTKLLCRECGNYI--GTLPSSL--NPQSQQWDGLSACRSYDINISSLTPSSQ  1326
              SWG +R  TKLLCR+CG +I  G   SS+     S      S+CR ++I I +L PS +
Sbjct  66    -SWGRYRSKTKLLCRKCGVHIGYGYGESSVLCGFDSPNSSSTSSCRKFNIKIRALQPSEE  124



>gb|EMS47664.1| hypothetical protein TRIUR3_22304 [Triticum urartu]
Length=409

 Score = 90.1 bits (222),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 4/80 (5%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGYALNLSS NR+TS +GS Y K++K+G+ISF  ID +RFT + +  C P+     +
Sbjct  10    CGSCGYALNLSSSNRSTSDVGSSYQKSLKKGLISFTSIDLSRFTQVDEISCFPFL----T  65

Query  1487  WGLFRRHTKLLCRECGNYIG  1428
             W  +R  TKLLCR+CG+ IG
Sbjct  66    WRSYRPKTKLLCRKCGSSIG  85



>ref|XP_008372679.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Malus domestica]
 ref|XP_008356284.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Malus domestica]
Length=125

 Score = 85.1 bits (209),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 70/120 (58%), Gaps = 11/120 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSV--IGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSK  1494
             CG C Y LNLSS NR TS   IGS Y K++K+G ISF  +D +RFT + +  C P     
Sbjct  10    CGSCAYPLNLSSSNRLTSESGIGSNYQKSIKKGFISFLTVDLSRFTQVDEVNCFPV----  65

Query  1493  HSWGLFRRHTKLLCRECGNYI--GTLPSSL--NPQSQQWDGLSACRSYDINISSLTPSSQ  1326
              SWG +R  TKLLCR+CG +I  G   SS+     S      S+CR ++I I +L PS +
Sbjct  66    -SWGRYRSKTKLLCRKCGVHIGYGYGESSVLCGFDSPNSSSTSSCRKFNIKIRALQPSEE  124



>ref|XP_003630365.1| hypothetical protein MTR_8g094790 [Medicago truncatula]
 gb|AET04841.1| hypothetical protein MTR_8g094790 [Medicago truncatula]
Length=150

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 76/123 (62%), Gaps = 12/123 (10%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNT--SVIGSEYDKAMK---RGVISFFCIDETRFTHITKFRCLPYF  1503
             CG CGY LNL+S NRNT  S+  S Y K++K   R +ISFF +DETRFT I +F     F
Sbjct  30    CGSCGYELNLNSSNRNTTLSLTDSNYGKSIKKRKRCLISFFSVDETRFTQIQQFSF--SF  87

Query  1502  RSKHSWGLFRRHT--KLLCRECGNYIG---TLPSSLNPQSQQWDGLSACRSYDINISSLT  1338
               + S+  F+R T  KLLCR C N++G   T PS  +  S  WDG+S  R + I ++++ 
Sbjct  88    SWRISFFNFQRTTTTKLLCRNCRNHLGYARTFPSQSHSHSHSWDGISDSRIFYIKLNAIQ  147

Query  1337  PSS  1329
             PSS
Sbjct  148   PSS  150



>ref|XP_004510741.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Cicer arietinum]
Length=130

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 68/121 (56%), Gaps = 15/121 (12%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS I SEY K++K+G ISF  +D +RFT + K  C P      S
Sbjct  18    CGSCGYPLNLTSSNRITSNIASEYKKSVKKGSISFSSVDLSRFTQVDKINCFPV-----S  72

Query  1487  WGLFRRHTKLLCRECGNYIGTLPSSLNPQ------SQQWDGLSACRSYDINISSLTPSSQ  1326
             W L    TKLLCR+CG +IG      +P       S   D L   R + I I SL PSS+
Sbjct  73    W-LNPSKTKLLCRKCGVHIGYGYGRESPALCGCEPSISSDTL---RKFSIKIRSLQPSSE  128

Query  1325  D  1323
             +
Sbjct  129   E  129



>ref|XP_008382532.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Malus domestica]
Length=125

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 71/120 (59%), Gaps = 11/120 (9%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNT--SVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSK  1494
             CG CGY LNLSS NR T  S IGS Y K++K+G+ISF  +D +RFT + +  C P     
Sbjct  10    CGSCGYPLNLSSSNRLTAESGIGSNYRKSIKKGLISFLTVDLSRFTQVDEVNCFPV----  65

Query  1493  HSWGLFRRHTKLLCRECGNYI--GTLPSSL--NPQSQQWDGLSACRSYDINISSLTPSSQ  1326
              SWG +R  TKLLCR+CG +I  G   SS+     S      S+ R ++I I +L PS Q
Sbjct  66    -SWGRYRSKTKLLCRKCGVHIGYGYGDSSVLCGFDSPNSSSTSSYRKFNIKIRALQPSEQ  124



>gb|KFM27012.1| hypothetical protein F751_1148 [Auxenochlorella protothecoides]
Length=573

 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +3

Query  594  SEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLEN  773
            + +G+   +P R  LR  GR  +EKAI++ GG   +   +  + A + RKP+GYW NLEN
Sbjct  405  AAYGKHRMIPPRDVLRADGRSHLEKAISQHGGMAVVLARLGWAAAKRARKPRGYWSNLEN  464

Query  774  LQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLL  923
            ++ EI  F     +    MP + +F R GR+DIARA+E+ GGLH ++  L
Sbjct  465  VRAEIRAFIIEHHLPEGIMPHKTTFVRCGRHDIARAVERLGGLHHLTTAL  514


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 112/234 (48%), Gaps = 35/234 (15%)
 Frame = +3

Query  114  YMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWIL-----EQLGSHHTLLKYSVESK  278
            Y+ L A+ ++++ EK + EI F QVEGD D F+GKW++     E+ G     + Y+ E K
Sbjct  304  YLSLQAQAVMEVLEKEQREIQFRQVEGDLDFFRGKWMVEDDVEEETGVPVCKVTYAAEGK  363

Query  279  MHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERLEAENAEKT----QEYVTYGEAEIKIT  446
            +  ++ +++ +  E + E +        D++    AE  E++     E V     + ++ 
Sbjct  364  LQHSAAVTQVL--EPLLEKV--------DWLAWWGAEKLEESFRRLAEEVEAAYGKHRMI  413

Query  447  PDKD-LSADSISPYEETSDS----------VNSESHRQRPKVPGLQRDIEILRAELLGFI  593
            P +D L AD  S  E+              +   + ++  K  G   ++E +RAE+  FI
Sbjct  414  PPRDVLRADGRSHLEKAISQHGGMAVVLARLGWAAAKRARKPRGYWSNLENVRAEIRAFI  473

Query  594  SEHG-QEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKG  752
             EH   EG MP +    + GR DI +A+ R+GG       +  +L Y + +P G
Sbjct  474  IEHHLPEGIMPHKTTFVRCGRHDIARAVERLGGLHH----LTTALGYSNPRPAG  523



>ref|XP_002320553.2| hypothetical protein POPTR_0014s17240g [Populus trichocarpa]
 gb|EEE98868.2| hypothetical protein POPTR_0014s17240g [Populus trichocarpa]
Length=295

 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/121 (42%), Positives = 69/121 (57%), Gaps = 16/121 (13%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS IGS Y K++K+G ISF  +D +RFT + +  CLP      S
Sbjct  10    CGSCGYPLNLTSSNRITSNIGSGYQKSIKKGYISFLSVDLSRFTQVDEVNCLPV-----S  64

Query  1487  WGLFRRHTKLLCRECGNYIG-------TLPSSLNPQSQQWDGLSACRSYDINISSLTPSS  1329
             WG +   +KLLCR+CG ++G        L    +P S      SA + + I I +L PS 
Sbjct  65    WGRYHSKSKLLCRKCGVHVGYGYGDSPALCGFDSPNSSS----SAYKKFTIKIRALQPSE  120

Query  1328  Q  1326
             +
Sbjct  121   E  121



>ref|XP_006583257.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Glycine max]
Length=122

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 19/123 (15%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS I SEY K++K+G +SF  +D +RFT I +  C P      S
Sbjct  10    CGSCGYPLNLTSSNRITSNIASEYQKSVKKGSLSFASVDLSRFTQIEEINCFPV-----S  64

Query  1487  WGLFRRHTKLLCRECGNYIG--------TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             W   R  TKLLCR+CG +IG         L    +P S      ++ R + I I SL PS
Sbjct  65    W-FNRSKTKLLCRKCGVHIGYGYGGESHVLCGFESPTSS-----TSQRKFTIKIRSLQPS  118

Query  1331  SQD  1323
             S++
Sbjct  119   SEE  121



>ref|XP_010090747.1| hypothetical protein L484_013769 [Morus notabilis]
 gb|EXB40466.1| hypothetical protein L484_013769 [Morus notabilis]
Length=493

 Score = 89.0 bits (219),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 69/118 (58%), Gaps = 10/118 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS I SEY K++K+G+ISF  +D +RFT + +  C P      S
Sbjct  10    CGSCGYPLNLTSSNRITSGIDSEYRKSIKKGLISFISVDLSRFTQVDEVNCFPL-----S  64

Query  1487  WGLFRRHTKLLCRECGNYI----GTLPSSLNPQSQQWDGLSACRSYDINISSLTPSSQ  1326
             WG +R  TKLLCR+CG +I    G  P+     S    G+   + + + I +L PS +
Sbjct  65    WGRYRLKTKLLCRKCGVHIGYGYGDSPALCGFDSANSSGVGY-KKFTVKIRALQPSEE  121



>ref|XP_010037071.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X3 [Eucalyptus grandis]
 gb|KCW48697.1| hypothetical protein EUGRSUZ_K02349 [Eucalyptus grandis]
Length=105

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 53/82 (65%), Gaps = 5/82 (6%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S N+ T+ +GSEYDK +K+G  +F  ID +RFT + +  C P +     
Sbjct  10    CGSCGYPLNLASSNQITAGVGSEYDKDLKKGFGTFLTIDLSRFTQVDEVTCFPVY-----  64

Query  1487  WGLFRRHTKLLCRECGNYIGTL  1422
             WG     TKLLCR+CG +IG L
Sbjct  65    WGRNHSKTKLLCRKCGAHIGQL  86



>ref|XP_004960368.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Setaria italica]
Length=147

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 63/112 (56%), Gaps = 12/112 (11%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTS-VIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGY L L S +RNT+ ++G  Y +A +RGV+ F  ID+ RF H  +FRC+   R++ 
Sbjct  26    CGACGYDLRLRSSDRNTAGIVGGGYGRAARRGVVPFDAIDDARFGHADEFRCVD-VRARR  84

Query  1490  SWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
                LF R T+LLCR+CG       +SL        G +    YDI I +L P
Sbjct  85    ---LFVRRTRLLCRKCG-------ASLGFAYDDRAGDARSPRYDIKIRALQP  126



>ref|XP_010037070.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
Length=120

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 5/80 (6%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S N+ T+ +GSEYDK +K+G  +F  ID +RFT + +  C P +     
Sbjct  10    CGSCGYPLNLASSNQITAGVGSEYDKDLKKGFGTFLTIDLSRFTQVDEVTCFPVY-----  64

Query  1487  WGLFRRHTKLLCRECGNYIG  1428
             WG     TKLLCR+CG +IG
Sbjct  65    WGRNHSKTKLLCRKCGAHIG  84



>gb|EPS70954.1| hypothetical protein M569_03805, partial [Genlisea aurea]
Length=113

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 62/115 (54%), Gaps = 8/115 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG C Y LNLSS NR TS I S+Y +++ +G  SF  ID +RFT + K  C+P      S
Sbjct  2     CGSCRYPLNLSSSNRVTSTIDSKYRRSISKGYFSFRSIDPSRFTQVDKLNCIPI-----S  56

Query  1487  WGLFRRHTKLLCRECGNYIG---TLPSSLNPQSQQWDGLSACRSYDINISSLTPS  1332
             WG++   TKLLCR CG  IG   +    L    Q     S+ +   + I +L PS
Sbjct  57    WGVYSPKTKLLCRNCGVLIGYGYSQRPMLCGMDQTNASASSYKKIKVKIKALNPS  111



>ref|XP_010037069.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
Length=122

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 52/80 (65%), Gaps = 5/80 (6%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S N+ T+ +GSEYDK +K+G  +F  ID +RFT + +  C P +     
Sbjct  10    CGSCGYPLNLASSNQITAGVGSEYDKDLKKGFGTFLTIDLSRFTQVDEVTCFPVY-----  64

Query  1487  WGLFRRHTKLLCRECGNYIG  1428
             WG     TKLLCR+CG +IG
Sbjct  65    WGRNHSKTKLLCRKCGAHIG  84



>dbj|BAJ97862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=165

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 77/139 (55%), Gaps = 22/139 (16%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAM-KRGVISFFCIDETRFTHITKFRCLPYFR  1500
             T  CG CGYALNLSS  RNT+ IGS+Y K + K+GV++F  +DETRFT   +  C P  R
Sbjct  18    TYSCGYCGYALNLSSAARNTAGIGSKYGKQIRKKGVVAFVAVDETRFTQADEVTCAPRLR  77

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTL---------PSSL---------NPQSQQWDGLSA  1374
                +W LFRR ++LLC +CG  IG           P+ L         +P++   DG  A
Sbjct  78    -PWTWRLFRRRSRLLCGKCGGRIGAAYEVDEDEEDPAGLSACAGSDDDDPRTSPGDGGGA  136

Query  1373  C--RSYDINISSLTPSSQD  1323
                RSY I I +L P + D
Sbjct  137   TRRRSYLIRIGALQPCTDD  155



>gb|EMS47605.1| hypothetical protein TRIUR3_05498 [Triticum urartu]
Length=166

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 78/145 (54%), Gaps = 26/145 (18%)
 Frame = -1

Query  1676  TEMCGCCGYALNLSSCNRNTSVIGSEYDKAM-KRGVISFFCIDETRFTHITKFRCLPYFR  1500
             T  CG CGYALNLSS  RNT+ IGS+Y K + K+G+++F  +DETRFT   +  C P  R
Sbjct  18    TYSCGYCGYALNLSSAARNTANIGSKYGKQIRKKGIVAFVAVDETRFTQADEVTCAPRLR  77

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSAC-----------------  1371
                +W LFRR ++LLC +CG  IG     ++ + +   GLSAC                 
Sbjct  78    -PWTWRLFRRRSRLLCGKCGGRIGAA-YEVDEEDEDPAGLSACGGSDDDDDDLRTSPGDD  135

Query  1370  ------RSYDINISSLTPSSQD*FP  1314
                   R+Y I I +L PS+ D  P
Sbjct  136   VGASRRRNYLIRIGALQPSTDDPPP  160



>ref|XP_010069558.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Eucalyptus grandis]
Length=164

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 66/118 (56%), Gaps = 10/118 (8%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S NR TS IGS+Y K++K+G ISF  +D +RFT + +  C P      +
Sbjct  52    CGSCGYPLNLTSSNRITSGIGSKYRKSIKKGSISFLSVDLSRFTQVDQVNCFPV-----A  106

Query  1487  WGLFRRHTKLLCRECGNYI----GTLPSSLNPQSQQWDGLSACRSYDINISSLTPSSQ  1326
             W      TKLLCR+CG +I    G  P+     S      S+ + + +NI +L PS  
Sbjct  107   WVRRGLKTKLLCRKCGAHIGYGYGDSPALCGFDSPNLS-TSSYKKFTVNIRALQPSED  163



>gb|EMT11708.1| hypothetical protein F775_43284 [Aegilops tauschii]
Length=151

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 69/116 (59%), Gaps = 4/116 (3%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAM-KRGVISFFCIDETRFTHITKFRCLPYFRSKH  1491
             CG CGYALNLSS  RNT+ IGS+Y K + K+GV++F  +DETRFT   +  C P  R   
Sbjct  4     CGYCGYALNLSSAARNTAGIGSKYGKNIRKKGVVAFVAVDETRFTQADEVTCAPRLR-PW  62

Query  1490  SWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTPSSQD  1323
             +W LFRR ++LLC +CG  +G   +  + +     GLSAC   D +   L  S  D
Sbjct  63    TWRLFRRRSRLLCGKCGGRLGAAHAGGDDEDPA--GLSACAGSDDDGDDLRTSPGD  116



>ref|XP_005538744.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM82708.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=908

 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/173 (34%), Positives = 84/173 (49%), Gaps = 11/173 (6%)
 Frame = +3

Query  528   RPKVPGLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAF  707
             RP+  G   D E LR EL  F+ E+G  G MP  +QLR + R D+  AI R GG   +A 
Sbjct  462   RPR--GYWSDFENLRTELQAFVQENGYPGIMPRLEQLRMYNREDLINAIHRHGGAANVAR  519

Query  708   LMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALE  887
              ++L   Y    PK +W   ENL   +  F          MP+++    AGR D+A  + 
Sbjct  520   RLHL-FWYG---PKTFWRKFENLGQRLRAFLHKSRFSHDKMPTQQELISAGRVDVAYGVH  575

Query  888   KWGGLHEVSRLLSLKVRHPNRQPSFGKEKKFDVNGEEKTPRAYVSQDAH-KWL  1043
               GG++EV+R L L+V  P R P +      D+   E    A+V+   H  W+
Sbjct  576   LHGGVYEVARRLRLQVLDPPRAPFYWN----DIQNVETELIAFVNSAVHAAWI  624


 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 60/122 (49%), Gaps = 2/122 (2%)
 Frame = +3

Query  567  LRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSL-AYKHRK  743
            L  EL   +  +     MP RK+L    R D+  AI + GGF  +A  + LS  A  H +
Sbjct  403  LENELRALLQANNMGWRMPNRKELEALDRHDLIYAIRKFGGFLTVATKLGLSRDALTHTR  462

Query  744  PKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLL  923
            P+GYW + ENL+ E+  F +  G  P  MP  +      R D+  A+ + GG   V+R L
Sbjct  463  PRGYWSDFENLRTELQAFVQENGY-PGIMPRLEQLRMYNREDLINAIHRHGGAANVARRL  521

Query  924  SL  929
             L
Sbjct  522  HL  523


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 48/91 (53%), Gaps = 6/91 (7%)
 Frame = +3

Query  531  PKVPGLQRDIEILRAELLGFISE--HG---QEGFMPMRKQLRKHGRVDIEKAITRMGGFR  695
            P+ P    DI+ +  EL+ F++   H    Q G MP    + + GR D+  AI R GG+ 
Sbjct  595  PRAPFYWNDIQNVETELIAFVNSAVHAAWIQNGVMPTSMTIVRSGRRDLAAAIRRHGGWD  654

Query  696  RIAFLMNLSLAYKHRKPKGYWDNLENLQDEI  788
              A  +NL  A   R PKGYW+ L N++ E+
Sbjct  655  AFARRLNLRPAAPKR-PKGYWNTLRNVEAEL  684


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = +3

Query  552  RDIEILRAELLGFISE-HGQEGFMPMRKQLRKHGRVDIEKAITRM-GGFRRIAFLMNLSL  725
            RD + L AELL    +  G++   P ++ L + GR D++ AI R  GG+ R+A  +    
Sbjct  327  RDRDALVAELLRLFPDLMGKQKRFPRQQDLVRLGRYDLDWAIHRWHGGYTRLAAELGYLR  386

Query  726  AYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLH  905
            +    KP+ +W +  NL++E+    ++  M    MP+RK  E   R+D+  A+ K+GG  
Sbjct  387  SRLPCKPRNFWSDERNLENELRALLQANNMG-WRMPNRKELEALDRHDLIYAIRKFGGFL  445

Query  906  EVSRLLSL  929
             V+  L L
Sbjct  446  TVATKLGL  453


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 61/120 (51%), Gaps = 7/120 (6%)
 Frame = +3

Query  618  MPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRF  797
            MP +++L   GRVD+   +   GG   +A  + L +    R P  YW++++N++ E+  F
Sbjct  556  MPTQQELISAGRVDVAYGVHLHGGVYEVARRLRLQVLDPPRAPF-YWNDIQNVETELIAF  614

Query  798  QRS-----WGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQPSF  962
              S     W +    MP+  +  R+GR D+A A+ + GG    +R L+L+   P R   +
Sbjct  615  VNSAVHAAW-IQNGVMPTSMTIVRSGRRDLAAAIRRHGGWDAFARRLNLRPAAPKRPKGY  673



>ref|XP_010547916.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Tarenaya hassleriana]
Length=152

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 71/129 (55%), Gaps = 22/129 (17%)
 Frame = -1

Query  1685  LVPTEMCGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPY  1506
             +V T  CG CGY LNL+S NRNT++IGS+Y K MK+G++SF+ IDETRFT + + R    
Sbjct  26    IVVTYSCGSCGYQLNLNSDNRNTTMIGSKYGKWMKKGIMSFWSIDETRFTRVEERRFFRR  85

Query  1505  FRSKHSWGLFRRHTKLLCRECGNYIGTL-PSSLNPQSQQWDG---------LSACRSYDI  1356
             +            TKLLC +C N+IG    ++ N +  Q            L   + Y+I
Sbjct  86    Y------------TKLLCGKCENHIGIAQKTTKNSRRIQLRKSYTFPANGILEGNKVYEI  133

Query  1355  NISSLTPSS  1329
              I +L P S
Sbjct  134   KIRALQPCS  142



>ref|WP_015211581.1| Putative ATPase subunit of terminase (gpP-like) [Microcoleus 
sp. PCC 7113]
 ref|YP_007151034.1| Putative ATPase subunit of terminase (gpP-like) [Microcoleus 
sp. PCC 7113]
 gb|AFZ22266.1| Putative ATPase subunit of terminase (gpP-like) [Microcoleus 
sp. PCC 7113]
Length=498

 Score = 79.0 bits (193),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 88/170 (52%), Gaps = 8/170 (5%)
 Frame = +3

Query  450  DKDLSADSISPYEETSDSVNSESHRQRPKVPGLQRDIEILRAELLGFISEHGQEGFMPMR  629
            +K+L    +     T       S +++P   G   D E L++++L   ++ GQ G MP  
Sbjct  267  EKELPQVCVGTQLSTLGEAACLSSQRKPA--GYWTDFERLKSDILTLNAQLGQIGVMPKA  324

Query  630  KQLRKHGRVDIEKAITRM-GGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRS  806
             QLR+ GR D+  AI++  GG+R +A    L L Y  ++  GYW +  N++ E+  F   
Sbjct  325  AQLRQLGRYDLAMAISKYHGGYRSVA--SRLGLTYTGQR-FGYWHDFANVEGELKAFIEQ  381

Query  807  WGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP  956
             G  P  MPSR+  E+AG   +A A+   GG+  V+R L  K+ +  R+P
Sbjct  382  QG-TPGVMPSRQQLEQAGEKPLAAAIGLHGGVLAVARRLGFKLPY-GRKP  429


 Score = 73.2 bits (178),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 65/136 (48%), Gaps = 4/136 (3%)
 Frame = +3

Query  543  GLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLS  722
            G   D   +  EL  FI + G  G MP R+QL + G   +  AI   GG   +A  +   
Sbjct  363  GYWHDFANVEGELKAFIEQQGTPGVMPSRQQLEQAGEKPLAAAIGLHGGVLAVARRLGFK  422

Query  723  LAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGL  902
            L Y  RKP+GYW N +NL+ E+       G  P  MP+R+   +  R ++  A+   GG 
Sbjct  423  LPY-GRKPRGYWKNPDNLKSELVAVAVQLG-TPGVMPTREQLVQIQRAELISAIATNGGW  480

Query  903  HEVSRLLSLKVRHPNR  950
              V+R   L   +PN+
Sbjct  481  PSVARRFGLA--NPNK  494



>ref|XP_010037072.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
isoform X4 [Eucalyptus grandis]
Length=90

 Score = 72.8 bits (177),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 46/73 (63%), Gaps = 5/73 (7%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTHITKFRCLPYFRSKHS  1488
             CG CGY LNL+S N+ T+ +GSEYDK +K+G  +F  ID +RFT + +  C P +     
Sbjct  10    CGSCGYPLNLASSNQITAGVGSEYDKDLKKGFGTFLTIDLSRFTQVDEVTCFPVY-----  64

Query  1487  WGLFRRHTKLLCR  1449
             WG     TKLLCR
Sbjct  65    WGRNHSKTKLLCR  77



>ref|XP_002440515.1| hypothetical protein SORBIDRAFT_09g002300 [Sorghum bicolor]
 gb|EES18945.1| hypothetical protein SORBIDRAFT_09g002300 [Sorghum bicolor]
Length=149

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 65/117 (56%), Gaps = 15/117 (13%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTS-VIGSEYDKAMKRG-VISFFCIDETRFTHITKFRCLPYFRSK  1494
             CG CGY L L S +RNT+ ++G     A +RG V++F  ID+ RF H  +FRC+   R++
Sbjct  33    CGACGYDLRLRSSDRNTAGIVGG---AARRRGLVVAFDAIDDARFGHADEFRCVD-LRAR  88

Query  1493  HSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTPSSQD  1323
                 LF R T+LLCR+CG  +G          +  DG    R YDI I +L P + D
Sbjct  89    R---LFVRRTRLLCRKCGAGLG-----FGYDDRGQDGGRPPR-YDIKIRALQPLADD  136



>ref|XP_005538092.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM82056.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=281

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 70/141 (50%), Gaps = 12/141 (9%)
 Frame = +3

Query  552  RDIEILRAELLGFISEHGQ-EGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLA  728
            +D + L  EL  FI+EH + +  MP   QL  H R D+ +AI + GGF ++A  + L   
Sbjct  139  KDFDNLAKELQSFIAEHLEAKDTMPTAGQLAAHHRSDLIRAIRKHGGFPKVAEQLGLK--  196

Query  729  YKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHE  908
              HR+P GYW++      E+  F  +  + P   P+ ++ +R G   +A A+ + GG   
Sbjct  197  -AHRRPNGYWNDKRRTLVELKTFIAAHRLPPDRAPTYRTMKRFGASTLAAAVGRLGGTAH  255

Query  909  VSRLLSLKV--------RHPN  947
             SRLL  K          HPN
Sbjct  256  FSRLLRRKTPMALPAKESHPN  276



>gb|KHN47024.1| Hypothetical protein glysoja_018391 [Glycine soja]
Length=117

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -1

Query  1589  AMKRGVISFFCIDETRFTHITKFRCLPYFRSKHSWGLFRRHTKLLCRECGNYIGTLPSSL  1410
             ++KRG+ISF  +D++RFT + +    PYF SK+SWG FRR TKLLCR+C N+I    S  
Sbjct  42    SLKRGIISFLNVDDSRFTRVDEIEFAPYF-SKYSWGFFRRKTKLLCRKCCNHIALHHSFP  100

Query  1409  NPQSQQ  1392
             + Q++Q
Sbjct  101   SYQTEQ  106



>ref|XP_010544805.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=131

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRGVISFFCIDETRFTH  1533
             CG CGY LNLSS NR TS IGS+Y K++K G+ISFF IDE+RFT 
Sbjct  38    CGSCGYELNLSSSNRITSTIGSKYGKSIKSGIISFFNIDESRFTQ  82



>ref|XP_003566665.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Brachypodium distachyon]
Length=142

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 65/135 (48%), Gaps = 32/135 (24%)
 Frame = -1

Query  1688  ILVPTEM-------CGCCGYALNLSSCNRNTSVIGSEYDKAMKRG---VISFFCIDETRF  1539
             +L+P  +       CG CGY L LSS  R  +      D  + RG    ++F  ID+ RF
Sbjct  12    VLLPRSLSAAVTYCCGACGYDLKLSSNAREYTA-----DGIVGRGRAATVAFGAIDDDRF  66

Query  1538  THITKFRCLPYFRSKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACR---  1368
              H+ +FRCL       +  LF R T+LLCR+CG ++G            +D  +A R   
Sbjct  67    GHLDEFRCL----DVRARRLFARRTRLLCRKCGAHLGF----------GYDDTAAARRPP  112

Query  1367  SYDINISSLTPSSQD  1323
              Y I I +L P+S D
Sbjct  113   RYLIKIRALHPASSD  127



>ref|WP_036535875.1| cyclase [Neosynechococcus sphagnicola]
 gb|KGF71737.1| cyclase [Neosynechococcus sphagnicola sy1]
Length=202

 Score = 63.9 bits (154),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 52/97 (54%), Gaps = 0/97 (0%)
 Frame = +3

Query  90   QEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSV  269
            Q G + LL +   ARV+LD+ E+  ++ISF+ VEGDF +F G W L  L S   +   + 
Sbjct  101  QVGTQRLLRLNFSARVVLDIEEQFLQQISFQMVEGDFKAFSGCWQLATLQSDQPMTGLNY  160

Query  270  ESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERL  380
               +     +  A++E  I  DLP NL A+   +E L
Sbjct  161  TVTILPKRTMPVALIERRIRRDLPLNLLAVLQRVETL  197



>ref|XP_008656527.1| PREDICTED: uncharacterized protein At4g08330, chloroplastic-like 
[Zea mays]
Length=154

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 59/115 (51%), Gaps = 14/115 (12%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRG----VISFFCIDETRFTHITKFRCLPYFR  1500
             CG CGY L L S +RNT+ I      A  R     V++F  ID+ RF H  +FRC+   R
Sbjct  29    CGACGYDLRLRSSDRNTAGIVGAGGAAYGRAARRGVVAFDAIDDARFGHADEFRCVD-LR  87

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
             ++    LF R T+LLCR+CG  +G          +  DG    R YDI I +L P
Sbjct  88    ARR---LFVRRTRLLCRKCGAGLG-----FGYDDRGQDGARPPR-YDIKIRALQP  133



>gb|ACG23989.1| hypothetical protein [Zea mays]
Length=155

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 59/115 (51%), Gaps = 14/115 (12%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRG----VISFFCIDETRFTHITKFRCLPYFR  1500
             CG CGY L L S +RNT+ I      A  R     V++F  ID+ RF H  +FRC+   R
Sbjct  29    CGACGYDLRLRSSDRNTAGIVGAGGAAYGRAARRGVVAFDAIDDARFGHADEFRCVD-LR  87

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
             ++    LF R T+LLCR+CG  +G          +  DG    R YDI I +L P
Sbjct  88    ARR---LFVRRTRLLCRKCGAGLG-----FGYDDRGQDGARPPR-YDIKIRALQP  133



>emb|CDP11047.1| unnamed protein product [Coffea canephora]
Length=294

 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +3

Query  87   LQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWIL  227
            LQ    GLLYMVLHARV+L  CE +E++ SF+QVEGDFDSF+GK+ L
Sbjct  234  LQVKTSGLLYMVLHARVVLYSCEVLEQDSSFDQVEGDFDSFRGKYNL  280



>ref|XP_005705352.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
 gb|EME28832.1| hypothetical protein isoform 2 [Galdieria sulphuraria]
Length=754

 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = +3

Query  534  KVPGLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLM  713
            K  G   D  ILRAE+  F+  +G  G MP+  +LR+H R D+  AI   GGF  +A  +
Sbjct  378  KAKGYWNDFAILRAEISVFLRRYGTPGVMPLGHELRRHQRRDLCYAIQLHGGFSVVAGKL  437

Query  714  NLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKW  893
            +L+       P  +W N  NL+  +      WG     MP+       GR D+A  +   
Sbjct  438  HLNWI----GPISFWRNWSNLRKRLYADMEKWGYH--RMPTLNDLVIRGRVDLAFGIRLH  491

Query  894  GGLHEVSRLLSLKVRHPNR  950
             G   V++   L+   P+R
Sbjct  492  HGFPAVAKAFGLEWTIPSR  510


 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 6/114 (5%)
 Frame = +3

Query  615  FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
            +MP   QL K  R+D+ KAI + GGF  +A  +   +  K RK   YW N++NL++E+ +
Sbjct  181  YMPTYHQLLKARRLDLAKAIHKYGGFPAVAEKLG-RIPNKRRK---YWHNMDNLRNELLQ  236

Query  795  FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP  956
            F +  G++   +P+        R+D+  A+   GGL+EVSR   + +    RQP
Sbjct  237  FMQQNGLEQ--LPTMTLLSTCKRWDLMGAIRLHGGLYEVSRKTQIPLSKSTRQP  288


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 70/147 (48%), Gaps = 23/147 (16%)
 Frame = +3

Query  555  DIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYK  734
            +++ LR ELL F+ ++G E  +P    L    R D+  AI   GG   ++    + L+  
Sbjct  226  NMDNLRNELLQFMQQNGLEQ-LPTMTLLSTCKRWDLMGAIRLHGGLYEVSRKTQIPLSKS  284

Query  735  HRKPKGYWDNLENLQDEISRF----------------QRSWGMDPSY------MPSRKSF  848
             R+P+GYW N+ENL++E++ F                   W +  SY      +P+  + 
Sbjct  285  TRQPRGYWSNIENLKEELTAFISFQDHSMNNIPYSSRYLVWMIRDSYSSICVIVPTLSNL  344

Query  849  ERAGRYDIARALEKWGGLHEVSRLLSL  929
            +R  R D+  A+ K GG+  V+  L +
Sbjct  345  KRNQRQDLVEAIRKHGGVQTVAAKLYM  371


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 32/186 (17%)
 Frame = +3

Query  543   GLQRDIEILRAELLGFISEH-GQEGF---------MPMRKQLRKHGRVDIEKAIT-RMGG  689
             G  +D   +R E++ ++ +  G  G          MP   +LRK GR  +  AI+   GG
Sbjct  85    GYWKDYSSVRKEIIQYVEQRDGVSGLDENSIALHRMPSANELRKSGRYALALAISSHHGG  144

Query  690   FRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYD  869
             F  +A  + L     +    GYWD+ E++  EI+ ++        YMP+     +A R D
Sbjct  145   FHAVAREIGLQ---PNHHSSGYWDHFEHVAKEIAEWR------TLYMPTYHQLLKARRLD  195

Query  870   IARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKE---------KKFDVNGEEKTPRAYVS  1022
             +A+A+ K+GG   V+  L    R PN++  +            +    NG E+ P   + 
Sbjct  196   LAKAIHKYGGFPAVAEKLG---RIPNKRRKYWHNMDNLRNELLQFMQQNGLEQLPTMTLL  252

Query  1023  QDAHKW  1040
                 +W
Sbjct  253   STCKRW  258


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 74/163 (45%), Gaps = 28/163 (17%)
 Frame = +3

Query  510  SESHRQRPKVPGLQRDIEILRAELLGFIS--EHGQEGF---------------------M  620
            S+S RQ P+  G   +IE L+ EL  FIS  +H                          +
Sbjct  282  SKSTRQ-PR--GYWSNIENLKEELTAFISFQDHSMNNIPYSSRYLVWMIRDSYSSICVIV  338

Query  621  PMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQ  800
            P    L+++ R D+ +AI + GG + +A  + + L    RK KGYW++   L+ EIS F 
Sbjct  339  PTLSNLKRNQRQDLVEAIRKHGGVQTVAAKLYM-LRQSKRKAKGYWNDFAILRAEISVFL  397

Query  801  RSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSL  929
            R +G  P  MP      R  R D+  A++  GG   V+  L L
Sbjct  398  RRYG-TPGVMPLGHELRRHQRRDLCYAIQLHGGFSVVAGKLHL  439



>ref|XP_005705353.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
 gb|EME28833.1| hypothetical protein isoform 1 [Galdieria sulphuraria]
Length=736

 Score = 65.9 bits (159),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 43/139 (31%), Positives = 64/139 (46%), Gaps = 6/139 (4%)
 Frame = +3

Query  534  KVPGLQRDIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLM  713
            K  G   D  ILRAE+  F+  +G  G MP+  +LR+H R D+  AI   GGF  +A  +
Sbjct  360  KAKGYWNDFAILRAEISVFLRRYGTPGVMPLGHELRRHQRRDLCYAIQLHGGFSVVAGKL  419

Query  714  NLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIARALEKW  893
            +L+       P  +W N  NL+  +      WG     MP+       GR D+A  +   
Sbjct  420  HLNWI----GPISFWRNWSNLRKRLYADMEKWGYH--RMPTLNDLVIRGRVDLAFGIRLH  473

Query  894  GGLHEVSRLLSLKVRHPNR  950
             G   V++   L+   P+R
Sbjct  474  HGFPAVAKAFGLEWTIPSR  492


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = +3

Query  555  DIEILRAELLGFISEHGQEGFMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYK  734
            +++ LR ELL F+ ++G E  +P    L    R D+  AI   GG   ++    + L+  
Sbjct  226  NMDNLRNELLQFMQQNGLEQ-LPTMTLLSTCKRWDLMGAIRLHGGLYEVSRKTQIPLSKS  284

Query  735  HRKPKGYWDNLENLQDEISRF----QRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGL  902
             R+P+GYW N+ENL++E++ F      S    P  +P+  + +R  R D+  A+ K GG+
Sbjct  285  TRQPRGYWSNIENLKEELTAFISFQDHSMNNIPYSIPTLSNLKRNQRQDLVEAIRKHGGV  344

Query  903  HEVSRLLSL  929
              V+  L +
Sbjct  345  QTVAAKLYM  353


 Score = 62.8 bits (151),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 63/114 (55%), Gaps = 6/114 (5%)
 Frame = +3

Query  615  FMPMRKQLRKHGRVDIEKAITRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISR  794
            +MP   QL K  R+D+ KAI + GGF  +A  +   +  K RK   YW N++NL++E+ +
Sbjct  181  YMPTYHQLLKARRLDLAKAIHKYGGFPAVAEKLG-RIPNKRRK---YWHNMDNLRNELLQ  236

Query  795  FQRSWGMDPSYMPSRKSFERAGRYDIARALEKWGGLHEVSRLLSLKVRHPNRQP  956
            F +  G++   +P+        R+D+  A+   GGL+EVSR   + +    RQP
Sbjct  237  FMQQNGLEQ--LPTMTLLSTCKRWDLMGAIRLHGGLYEVSRKTQIPLSKSTRQP  288


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 74/145 (51%), Gaps = 10/145 (7%)
 Frame = +3

Query  510  SESHRQRPKVPGLQRDIEILRAELLGFIS--EHGQEGF---MPMRKQLRKHGRVDIEKAI  674
            S+S RQ P+  G   +IE L+ EL  FIS  +H        +P    L+++ R D+ +AI
Sbjct  282  SKSTRQ-PR--GYWSNIENLKEELTAFISFQDHSMNNIPYSIPTLSNLKRNQRQDLVEAI  338

Query  675  TRMGGFRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFER  854
             + GG + +A  + + L    RK KGYW++   L+ EIS F R +G  P  MP      R
Sbjct  339  RKHGGVQTVAAKLYM-LRQSKRKAKGYWNDFAILRAEISVFLRRYG-TPGVMPLGHELRR  396

Query  855  AGRYDIARALEKWGGLHEVSRLLSL  929
              R D+  A++  GG   V+  L L
Sbjct  397  HQRRDLCYAIQLHGGFSVVAGKLHL  421


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 81/186 (44%), Gaps = 32/186 (17%)
 Frame = +3

Query  543   GLQRDIEILRAELLGFISEH-GQEGF---------MPMRKQLRKHGRVDIEKAIT-RMGG  689
             G  +D   +R E++ ++ +  G  G          MP   +LRK GR  +  AI+   GG
Sbjct  85    GYWKDYSSVRKEIIQYVEQRDGVSGLDENSIALHRMPSANELRKSGRYALALAISSHHGG  144

Query  690   FRRIAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYD  869
             F  +A  + L     +    GYWD+ E++  EI+ ++        YMP+     +A R D
Sbjct  145   FHAVAREIGLQ---PNHHSSGYWDHFEHVAKEIAEWR------TLYMPTYHQLLKARRLD  195

Query  870   IARALEKWGGLHEVSRLLSLKVRHPNRQPSFGKE---------KKFDVNGEEKTPRAYVS  1022
             +A+A+ K+GG   V+  L    R PN++  +            +    NG E+ P   + 
Sbjct  196   LAKAIHKYGGFPAVAEKLG---RIPNKRRKYWHNMDNLRNELLQFMQQNGLEQLPTMTLL  252

Query  1023  QDAHKW  1040
                 +W
Sbjct  253   STCKRW  258



>ref|WP_019492691.1| hypothetical protein [Calothrix sp. PCC 7103]
Length=197

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = +3

Query  90   QEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGSHHTLLKYSV  269
            Q G + LL +  +ARV+LDL E   +EISF+ VEGDF  + G W+L+   +  +      
Sbjct  101  QIGRERLLKLNFNARVVLDLFESFPKEISFQMVEGDFKEYSGSWLLQPCDNDQSTTNLCY  160

Query  270  ESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIE  374
               +H    +  +++E+ + + L  NL AI+ Y+E
Sbjct  161  TLTVHPKRLMPVSLIEQRLGKGLRVNLHAIKKYVE  195



>gb|AGT15916.1| cyclase/dehydrase family protein [Saccharum hybrid cultivar R570]
Length=267

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 5/55 (9%)
 Frame = +3

Query  78   VFILQEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQLGS  242
            V I+QEGCKGLLYMVLHARV++DL E  E+EI FEQVE    ++Q +++  Q GS
Sbjct  209  VRIMQEGCKGLLYMVLHARVVMDLRENFEQEIRFEQVE----AYQCRFV-TQTGS  258



>gb|AFW82753.1| hypothetical protein ZEAMMB73_019077, partial [Zea mays]
Length=174

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 59/115 (51%), Gaps = 14/115 (12%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRG----VISFFCIDETRFTHITKFRCLPYFR  1500
             CG CGY L L S +RNT+ I      A  R     V++F  ID+ RF H  +FRC+   R
Sbjct  49    CGACGYDLRLRSSDRNTAGIVGAGGAAYGRAARRGVVAFDAIDDARFGHADEFRCVD-LR  107

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
             ++    LF R T+LLCR+CG  +G          +  DG    R YDI I +L P
Sbjct  108   ARR---LFVRRTRLLCRKCGAGLG-----FGYDDRGQDGARPPR-YDIKIRALQP  153



>ref|WP_015156436.1| cyclase/dehydrase [Chroococcidiopsis thermalis]
 ref|YP_007093765.1| cyclase/dehydrase [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY89896.1| cyclase/dehydrase [Chroococcidiopsis thermalis PCC 7203]
Length=189

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = +3

Query  90   QEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQ---LGSHHTLLK  260
            Q G + LL     ARV+LDL EK   EI F+ VEGD  ++ GKW+LE      +  T L 
Sbjct  92   QVGTQRLLRFNFSARVVLDLEEKFPHEIHFDMVEGDLKAYSGKWLLEPYFVCENPGTNLC  151

Query  261  YSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERL  380
            Y+V  ++     +  AI+E  + +DL SNL AIR  +E L
Sbjct  152  YTV--RVLPKRTMPVAIVERRLRQDLRSNLLAIRRRVEEL  189



>ref|WP_039714602.1| cyclase, partial [Scytonema millei]
Length=189

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 5/100 (5%)
 Frame = +3

Query  90   QEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQ---LGSHHTLLK  260
            Q G + LL     ARV+LDL EK   EI F+ VEGD  ++ GKW+LE      +  T L 
Sbjct  92   QVGTQRLLRFNFSARVVLDLEEKFPHEIHFDMVEGDLKAYSGKWLLEPYFVCENPGTNLC  151

Query  261  YSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERL  380
            Y+V  ++     +  AI+E  + +DL SNL AIR  +E L
Sbjct  152  YTV--RVLPKRTMPVAIVERRLRQDLRSNLLAIRRRVEEL  189



>ref|NP_001142862.1| uncharacterized protein LOC100275257 [Zea mays]
 gb|ACG27140.1| hypothetical protein [Zea mays]
Length=172

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 59/115 (51%), Gaps = 14/115 (12%)
 Frame = -1

Query  1667  CGCCGYALNLSSCNRNTSVIGSEYDKAMKRG----VISFFCIDETRFTHITKFRCLPYFR  1500
             CG CGY L L S +RNT+ I      A  R     V++F  ID+ RF H  +FRC+   R
Sbjct  46    CGACGYDLRLRSSDRNTAGIVGAGGAAYGRAARRGVVAFDAIDDARFGHADEFRCVD-LR  104

Query  1499  SKHSWGLFRRHTKLLCRECGNYIGTLPSSLNPQSQQWDGLSACRSYDINISSLTP  1335
             ++    LF R T+LLCR+CG  +G          +  DG    R YDI I +L P
Sbjct  105   ARR---LFVRRTRLLCRKCGAGLG-----FGYDDRGQDGARPPR-YDIKIRALQP  150



>ref|XP_007511700.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17821.1| predicted protein [Bathycoccus prasinos]
Length=1011

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 67/137 (49%), Gaps = 10/137 (7%)
 Frame = +3

Query  543  GLQRDIEILRAELLGFISEHGQEGF--------MPMRKQLRKHGRVDIEKAITRMGGFRR  698
             L+ DIE   A LL    E G+           +P +  LR++GR D+EK I  +GG++ 
Sbjct  863  ALRVDIEAFNATLLLKSKEDGKTQQQQQQQQQRIPQKLLLREYGREDLEKRIRELGGYKI  922

Query  699  IAFLMNLSLAYKHRKPKGYWDNLENLQDEISRFQRSWGMDPSYMPSRKSFERAGRYDIAR  878
            ++            KP+GYW +LEN++ E+  F  S  +    +PSR  F   GR DI +
Sbjct  923  VS--EKFGWDKNMPKPRGYWRDLENVRVELESFIESLELPLDELPSRGVFMENGREDIYQ  980

Query  879  ALEKWGGLHEVSRLLSL  929
            +    GG  EV+  L L
Sbjct  981  SFRFHGGASEVAMKLGL  997



>ref|WP_015122294.1| oligoketide cyclase/lipid transport protein [Rivularia sp. PCC 
7116]
 ref|YP_007059292.1| oligoketide cyclase/lipid transport protein [Rivularia sp. PCC 
7116]
 gb|AFY58745.1| oligoketide cyclase/lipid transport protein [Rivularia sp. PCC 
7116]
Length=188

 Score = 61.2 bits (147),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = +3

Query  90   QEGCKGLLYMVLHARVILDLCEKIEEEISFEQVEGDFDSFQGKWILEQL---GSHHTLLK  260
            Q G + LL +   ARV+LDL E     ISF+ VEGDF  F G W L          TLL 
Sbjct  88   QVGSQRLLKLNFSARVVLDLEESFPNVISFQMVEGDFKDFSGNWHLSNCVLDDKTGTLLC  147

Query  261  YSVESKMHKNSFLSEAIMEEVIYEDLPSNLCAIRDYIERL  380
            Y+V  K+     +   I+E  + +D+ SNL A+R  +E+L
Sbjct  148  YTV--KVWPKLTMPIRIIEPRLAQDMQSNLLAVRQRVEKL  185



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5356758103970