BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21708_g1_i2 len=1406 path=[1372:0-249 3039:250-363 1736:364-402
2834:403-447 1820:448-483 3176:484-612 1973:613-1405]

Length=1406
                                                                      Score     E

dbj|BAD06944.1|  gibberellin 3-oxidase-like protein                     632   0.0      Ipomoea nil [qian niu]
ref|XP_006476108.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    350   1e-113   
ref|XP_007013295.1|  Gibberellin 3-beta hydroxylase, putative           343   8e-111   
ref|XP_010254241.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    340   5e-109   
ref|XP_004288825.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    338   6e-109   
ref|XP_002299619.1|  gibberellin 3-beta-hydroxylase family protein      338   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_009339604.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    335   3e-107   
gb|AFS18537.1|  gibberellin 3-oxidase                                   335   4e-107   
ref|XP_011045367.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    334   8e-107   
gb|AEW67998.1|  gibberellin 3 oxidase 1                                 333   9e-107   
ref|XP_008377587.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        333   1e-106   
gb|AGN95009.1|  gibberellin 3-beta-dioxygenase                          332   2e-106   
ref|XP_006427125.1|  hypothetical protein CICLE_v10027153mg             332   2e-106   
ref|XP_010098950.1|  Gibberellin 3-beta-dioxygenase 3                   332   3e-106   
ref|XP_008228615.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        332   4e-106   
ref|XP_002303276.1|  gibberellin 3-beta-hydroxylase family protein      332   7e-106   Populus trichocarpa [western balsam poplar]
gb|AAR12160.1|  gibberellin 3-oxidase                                   332   7e-106   Populus tremula x Populus tremuloides
dbj|BAD91162.1|  gibberellin 3-beta hydroxylase                         331   1e-105   Prunus subhirtella [Higan cherry]
gb|AHC32022.1|  gibberellin 3-oxidase 1                                 330   2e-105   
ref|XP_007215556.1|  hypothetical protein PRUPE_ppa007336mg             330   3e-105   
ref|XP_010110310.1|  Gibberellin 3-beta-dioxygenase 1                   330   4e-105   
gb|KDP32333.1|  hypothetical protein JCGZ_13258                         328   4e-105   
ref|XP_007203364.1|  hypothetical protein PRUPE_ppa020624mg             328   5e-105   
gb|AEK70423.1|  GA3ox1                                                  328   1e-104   
ref|XP_009343425.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    328   1e-104   
gb|ACT99991.1|  gibberellin 3-oxidase                                   328   2e-104   
ref|NP_001269085.1|  uncharacterized protein LOC100265167               327   2e-104   
ref|XP_008365721.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    327   2e-104   
ref|XP_010249916.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    328   2e-104   
gb|KHG10231.1|  Gibberellin 3-beta-dioxygenase 1 -like protein          327   3e-104   
ref|XP_009374076.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        327   4e-104   
emb|CAN80137.1|  hypothetical protein VITISV_028510                     326   1e-103   Vitis vinifera
ref|XP_007024019.1|  Gibberellin 3-oxidase 1, putative                  324   4e-103   
ref|XP_008242694.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    323   5e-103   
gb|KDP37169.1|  hypothetical protein JCGZ_06225                         324   5e-103   
gb|AEK70424.1|  GA3ox2                                                  323   7e-103   
gb|AHC32023.1|  gibberellin 3-oxidase 2                                 323   1e-102   
dbj|BAA37129.1|  gibberelin 3beta-hydroxylase                           323   1e-102   Lactuca sativa [cultivated lettuce]
ref|XP_004486708.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    323   2e-102   
ref|XP_011039983.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    326   2e-102   
ref|XP_004486709.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    321   8e-102   
ref|XP_010061961.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    320   1e-101   
ref|XP_004302950.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    318   8e-101   
ref|XP_002515559.1|  gibberellin 3-beta hydroxylase, putative           317   1e-100   Ricinus communis
gb|ABP37820.1|  gibberellin 3-beta-hydroxylase                          317   4e-100   Medicago sativa subsp. caerulea
dbj|BAG48320.1|  gibberellin 3-oxidase1                                 316   5e-100   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABB00360.1|  gibberellin 3-oxidase                                   316   5e-100   Fragaria x ananassa
gb|ACF71491.1|  gibberellin 3-beta hydroxylase                          315   1e-99    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003546239.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    315   1e-99    
ref|XP_011026517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    313   3e-99    
ref|XP_002324270.1|  gibberellin 3 beta-hydroxylase family protein      313   3e-99    Populus trichocarpa [western balsam poplar]
ref|XP_010914990.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    313   4e-99    
gb|ABG46320.1|  gibberellin 3-oxidase 1                                 314   4e-99    Rumex palustris
ref|XP_009355033.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    313   5e-99    
gb|ABP37818.1|  gibberellin 3-beta-hydroxylase                          314   6e-99    Medicago falcata [sickle alfalfa]
ref|XP_003597810.1|  Gibberellin 3-beta-hydroxylase                     313   6e-99    
gb|ABP37819.1|  gibberellin 3-beta-hydroxylase                          313   7e-99    Medicago sativa subsp. caerulea
ref|XP_010459098.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    312   1e-98    
dbj|BAG48321.1|  gibberellin 3-oxidase2                                 312   2e-98    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010476647.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        311   5e-98    
gb|ACN89834.1|  gibberellin 3-oxidase                                   310   9e-98    Solanum tuberosum subsp. andigenum
emb|CDX81720.1|  BnaC08g38810D                                          310   9e-98    
ref|XP_010691237.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    313   1e-97    
ref|XP_002514367.1|  gibberellin 3-beta hydroxylase, putative           310   1e-97    Ricinus communis
ref|XP_006341659.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    309   2e-97    
ref|XP_010254240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    309   2e-97    
ref|XP_010249910.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    310   2e-97    
ref|XP_008804067.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    309   2e-97    
ref|XP_009117822.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    308   6e-97    
ref|XP_011072274.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    308   7e-97    
gb|EYU21574.1|  hypothetical protein MIMGU_mgv1a017804mg                308   7e-97    
ref|XP_003543662.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    307   9e-97    
ref|NP_001275412.1|  gibberellin 3-beta-hydroxylase 2                   307   1e-96    
ref|XP_010497240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    307   1e-96    
gb|KFK43811.1|  hypothetical protein AALP_AA1G176200                    306   2e-96    
emb|CDY36572.1|  BnaA06g10250D                                          306   2e-96    
ref|XP_006416894.1|  hypothetical protein EUTSA_v10008008mg             306   3e-96    
ref|XP_009148952.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        306   3e-96    
dbj|BAQ02990.1|  gibberellin 3-oxidase                                  306   3e-96    
sp|O24648.1|G3OX_PEA  RecName: Full=Gibberellin 3-beta-dioxygenas...    306   4e-96    Pisum sativum [garden pea]
ref|XP_009377503.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    305   4e-96    
gb|AAN87570.1|  gibberellin 3-oxidase                                   306   4e-96    Spinacia oleracea
ref|XP_002892873.1|  hypothetical protein ARALYDRAFT_471756             305   6e-96    
gb|AAC96017.1|  defective gibberellin 3B-hydroxylase                    306   7e-96    Pisum sativum [garden pea]
dbj|BAG32267.1|  gibberellin 3-oxidase                                  305   7e-96    Allium fistulosum [Japanese bunching onion]
ref|NP_001233855.1|  3b-hydroxylase                                     305   9e-96    
gb|AAC86820.1|  gibberellin 3 beta-hydroxylase                          305   1e-95    Pisum sativum [garden pea]
dbj|BAJ65442.1|  gibberellin 3-oxidase                                  305   1e-95    
gb|AAC49794.1|  gibberellin 3 beta-hydroxylase                          305   2e-95    Pisum sativum [garden pea]
gb|ABO70984.1|  gibberellin 3-oxidase 2                                 304   2e-95    Nicotiana tabacum [American tobacco]
ref|XP_009588350.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    304   3e-95    
ref|XP_011081703.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    304   3e-95    
dbj|BAD30035.1|  gibberellin 3beta-hydroxylase1                         303   3e-95    Daucus carota [carrots]
ref|XP_009788819.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    303   3e-95    
ref|XP_006382066.1|  gibberellin 3 beta-hydroxylase family protein      303   3e-95    
dbj|BAA89316.1|  gibberellin 3beta-hydroxylase                          304   4e-95    Nicotiana tabacum [American tobacco]
ref|NP_173008.1|  gibberellin 3-beta-dioxygenase 1                      303   4e-95    Arabidopsis thaliana [mouse-ear cress]
dbj|BAM73280.1|  gibberellin 3 oxidase 1                                303   4e-95    
emb|CDP18939.1|  unnamed protein product                                303   4e-95    
emb|CDY39663.1|  BnaC05g11920D                                          303   5e-95    
ref|XP_008347459.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    302   1e-94    
gb|AAM12872.1|AF494089_1  gibberellin 3-oxidase 1                       302   2e-94    Nicotiana sylvestris
ref|XP_007013765.1|  Gibberellin 3-oxidase 3, putative                  301   2e-94    
dbj|BAA37130.1|  gibberellin 3beta-hydroxylase                          301   3e-94    Lactuca sativa [cultivated lettuce]
ref|XP_009596383.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    301   3e-94    
ref|XP_008356836.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    301   3e-94    
ref|XP_010925284.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    301   3e-94    
ref|XP_009771250.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    300   6e-94    
ref|XP_002284981.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        299   1e-93    Vitis vinifera
ref|XP_008346007.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    299   2e-93    
emb|CAC83089.1|  gibberellin 3-oxidase                                  300   2e-93    Cucurbita maxima [Boston marrow]
gb|KDO58203.1|  hypothetical protein CISIN_1g043985mg                   299   2e-93    
ref|XP_009355149.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    299   2e-93    
gb|AGQ42612.1|  GA3ox3                                                  298   4e-93    
ref|XP_009372969.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    298   4e-93    
ref|XP_003527798.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    297   6e-93    
ref|XP_007150692.1|  hypothetical protein PHAVU_005G173500g             298   7e-93    
ref|XP_006305164.1|  hypothetical protein CARUB_v10009532mg             297   1e-92    
ref|XP_008785607.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    297   1e-92    
ref|XP_003533057.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    298   1e-92    
ref|XP_011019738.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    296   1e-92    
ref|XP_006427126.1|  hypothetical protein CICLE_v10027361mg             296   1e-92    
ref|NP_001233848.1|  3b-hydroxylase                                     297   2e-92    
ref|XP_006465424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    296   2e-92    
dbj|BAD06943.1|  gibberellin 3-oxidase-like protein                     296   3e-92    Ipomoea nil [qian niu]
ref|XP_006356177.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    296   3e-92    
emb|CAN73736.1|  hypothetical protein VITISV_025221                     297   6e-92    Vitis vinifera
ref|XP_008352044.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    294   7e-92    
ref|XP_006366661.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    294   9e-92    
gb|KHN47796.1|  Gibberellin 3-beta-dioxygenase 1                        295   1e-91    
ref|XP_008387508.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    293   2e-91    
gb|ABI64150.1|  gibberellin 3-oxidase                                   293   4e-91    Pisum sativum [garden pea]
ref|XP_010537953.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        292   5e-91    
ref|XP_006355748.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    292   7e-91    
gb|ACN89835.1|  gibberellin 3-oxidase                                   292   1e-90    Solanum tuberosum subsp. andigenum
ref|XP_010051203.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    291   1e-90    
gb|KDP32294.1|  hypothetical protein JCGZ_13219                         291   1e-90    
gb|KCW53766.1|  hypothetical protein EUGRSUZ_J03019                     291   2e-90    
ref|XP_010049018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    290   3e-90    
ref|XP_009400517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    291   4e-90    
ref|XP_010915137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        290   6e-90    
ref|XP_004135830.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    290   6e-90    
ref|XP_008461056.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    290   6e-90    
ref|NP_001275108.1|  gibberellin 3-beta-hydroxylase 1                   290   7e-90    
ref|XP_006285095.1|  hypothetical protein CARUB_v10006427mg             289   8e-90    
ref|XP_002515599.1|  gibberellin 3-beta hydroxylase, putative           289   1e-89    Ricinus communis
ref|XP_010537951.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    290   1e-89    
ref|XP_004158763.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    289   2e-89    
ref|XP_002282411.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        288   2e-89    Vitis vinifera
ref|XP_007161254.1|  hypothetical protein PHAVU_001G055000g             288   2e-89    
ref|XP_010049027.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    288   3e-89    
gb|AGQ42610.1|  GA3ox2                                                  288   3e-89    
ref|XP_004253252.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    288   3e-89    
ref|XP_003529820.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    288   6e-89    
dbj|BAD30036.1|  gibberellin 3beta-hydroxylase2                         287   7e-89    Daucus carota [carrots]
ref|XP_003522638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    286   7e-89    
ref|XP_009409327.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    288   7e-89    
ref|XP_009108486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        287   7e-89    
ref|XP_006361220.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    286   8e-89    
ref|XP_010049031.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    286   2e-88    
ref|NP_193900.1|  gibberellin 3-beta-dioxygenase 3                      286   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28643.1|  unknown                                                 286   2e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008219863.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    285   3e-88    
emb|CDX76441.1|  BnaA08g09590D                                          285   3e-88    
emb|CDY31424.1|  BnaC03g64000D                                          285   4e-88    
emb|CDY38661.1|  BnaC02g23180D                                          285   5e-88    
ref|XP_002869872.1|  gibberellin 3-oxidase 3                            285   6e-88    
ref|XP_007135716.1|  hypothetical protein PHAVU_010G152200g             285   6e-88    
dbj|BAD30037.1|  gibberellin 3beta-hydroxylase3                         283   1e-87    Daucus carota [carrots]
ref|XP_006301281.1|  hypothetical protein CARUB_v10021682mg             283   1e-87    
ref|XP_007227245.1|  hypothetical protein PRUPE_ppa018007mg             283   1e-87    
ref|XP_009128433.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2        283   2e-87    
emb|CDY37589.1|  BnaA02g19810D                                          283   2e-87    
gb|AFK49394.1|  unknown                                                 283   3e-87    
ref|XP_008811603.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        282   3e-87    
ref|XP_004498636.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    283   4e-87    
gb|ADK71016.1|  gibberellin 3-beta-hydroxylase                          280   4e-87    
ref|XP_004240225.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    282   4e-87    
gb|AGH39958.1|  gibberellin 3-beta-hydroxylase                          279   2e-86    
ref|XP_006413746.1|  hypothetical protein EUTSA_v10026853mg             280   2e-86    
gb|ADK71017.1|  gibberellin 3-beta-hydroxylase                          279   2e-86    
ref|NP_001274405.1|  gibberellin 3-beta-dioxygenase 1-like              280   3e-86    
gb|KGN62899.1|  hypothetical protein Csa_2G379300                       281   3e-86    
gb|ADK71025.1|  gibberellin 3-beta-hydroxylase                          278   3e-86    
gb|ADK71013.1|  gibberellin 3-beta-hydroxylase                          278   4e-86    
ref|XP_010670743.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    280   5e-86    
ref|XP_010434144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        280   5e-86    
ref|XP_003588693.1|  Gibberellin 3-beta-dioxygenase                     280   5e-86    
ref|XP_006338004.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    279   7e-86    
ref|XP_009385827.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    279   8e-86    
ref|XP_008445137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    279   1e-85    
ref|XP_006829636.1|  hypothetical protein AMTR_s00122p00090120          279   1e-85    
gb|ADK71024.1|  gibberellin 3-beta-hydroxylase                          276   1e-85    
gb|ADK70973.1|  gibberellin 3-beta-hydroxylase                          276   1e-85    
ref|XP_004292966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    278   2e-85    
ref|XP_010532144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    278   2e-85    
ref|XP_008219864.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    277   2e-85    
gb|AGH39959.1|  gibberellin 3-beta-hydroxylase                          276   2e-85    
ref|XP_004229097.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    277   3e-85    
gb|AGH39956.1|  gibberellin 3-beta-hydroxylase                          276   3e-85    
ref|XP_010439443.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    278   3e-85    
ref|XP_006389782.1|  hypothetical protein EUTSA_v10019816mg             278   3e-85    
gb|ADK70985.1|  gibberellin 3-beta-hydroxylase                          275   3e-85    
emb|CDY37588.1|  BnaA02g19820D                                          277   4e-85    
ref|XP_002887835.1|  predicted protein                                  277   5e-85    
gb|KFK42430.1|  hypothetical protein AALP_AA2G255300                    277   6e-85    
ref|XP_007221040.1|  hypothetical protein PRUPE_ppa015241mg             277   6e-85    
gb|ADK70993.1|  gibberellin 3-beta-hydroxylase                          275   6e-85    
gb|ADK71011.1|  gibberellin 3-beta-hydroxylase                          275   7e-85    
gb|ADK71002.1|  gibberellin 3-beta-hydroxylase                          274   8e-85    
gb|ADK70977.1|  gibberellin 3-beta-hydroxylase                          274   8e-85    
gb|ADK70999.1|  gibberellin 3-beta-hydroxylase                          274   9e-85    
gb|ADK71010.1|  gibberellin 3-beta-hydroxylase                          274   1e-84    
gb|AGH39957.1|  gibberellin 3-beta-hydroxylase                          274   1e-84    
ref|XP_007226257.1|  hypothetical protein PRUPE_ppa018610mg             276   1e-84    
ref|XP_010449018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    276   1e-84    
ref|NP_001267625.1|  gibberellin 3-beta-dioxygenase 1-like              276   1e-84    
ref|XP_006450547.1|  hypothetical protein CICLE_v10010629mg             275   2e-84    
gb|ADK70960.1|  gibberellin 3-beta-hydroxylase                          273   2e-84    
gb|ADK70964.1|  gibberellin 3-beta-hydroxylase                          273   2e-84    
gb|ADM47338.1|  gibberellin 3-oxidase 2                                 276   3e-84    
ref|XP_006389781.1|  hypothetical protein EUTSA_v10019663mg             275   3e-84    
ref|XP_008461055.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    276   3e-84    
gb|ADK71023.1|  gibberellin 3-beta-hydroxylase                          273   3e-84    
gb|ADK70998.1|  gibberellin 3-beta-hydroxylase                          273   3e-84    
ref|XP_009128435.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        275   3e-84    
gb|ADK71008.1|  gibberellin 3-beta-hydroxylase                          273   4e-84    
gb|ADK70984.1|  gibberellin 3-beta-hydroxylase                          273   5e-84    
gb|ADK71001.1|  gibberellin 3-beta-hydroxylase                          272   5e-84    
ref|XP_008231797.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    275   5e-84    
gb|ADK70968.1|  gibberellin 3-beta-hydroxylase                          272   6e-84    
gb|ADK70983.1|  gibberellin 3-beta-hydroxylase                          272   6e-84    
ref|XP_006476223.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    273   8e-84    
gb|ADK70991.1|  gibberellin 3-beta-hydroxylase                          271   9e-84    
emb|CBL59327.1|  Gibberellin 3-oxidase                                  273   9e-84    
gb|ADK70959.1|  gibberellin 3-beta-hydroxylase                          272   9e-84    
gb|ADK70956.1|  gibberellin 3-beta-hydroxylase                          271   1e-83    
gb|ADK70970.1|  gibberellin 3-beta-hydroxylase                          271   1e-83    
gb|ADK70995.1|  gibberellin 3-beta-hydroxylase                          271   1e-83    
gb|ADK70971.1|  gibberellin 3-beta-hydroxylase                          271   1e-83    
ref|XP_009396646.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    273   1e-83    
gb|ADK70955.1|  gibberellin 3-beta-hydroxylase                          271   2e-83    
gb|ADK70980.1|  gibberellin 3-beta-hydroxylase                          271   2e-83    
gb|ADK70986.1|  gibberellin 3-beta-hydroxylase                          271   2e-83    
gb|ADK71012.1|  gibberellin 3-beta-hydroxylase                          271   2e-83    
gb|ADK71019.1|  gibberellin 3-beta-hydroxylase                          271   2e-83    
gb|ADK70989.1|  gibberellin 3-beta-hydroxylase                          271   2e-83    
ref|XP_006301563.1|  hypothetical protein CARUB_v10021997mg             273   2e-83    
gb|ADK70988.1|  gibberellin 3-beta-hydroxylase                          270   3e-83    
ref|XP_002887836.1|  gibberellin 3-oxidase 4                            272   3e-83    
ref|XP_010112080.1|  Gibberellin 3-beta-dioxygenase 1                   273   5e-83    
gb|ADK70958.1|  gibberellin 3-beta-hydroxylase                          270   5e-83    
gb|ADK71027.1|  gibberellin 3-beta-hydroxylase                          269   6e-83    
gb|ADK70994.1|  gibberellin 3-beta-hydroxylase                          270   6e-83    
gb|ADK70962.1|  gibberellin 3-beta-hydroxylase                          269   8e-83    
gb|ADK70966.1|  gibberellin 3-beta-hydroxylase                          269   8e-83    
gb|ADK70992.1|  gibberellin 3-beta-hydroxylase                          269   1e-82    
emb|CAB92914.1|  gibberellin 3-beta-hydroxylase                         271   1e-82    Cucurbita maxima [Boston marrow]
gb|ADK71003.1|  gibberellin 3-beta-hydroxylase                          268   1e-82    
gb|ADK71018.1|  gibberellin 3-beta-hydroxylase                          268   1e-82    
gb|ADK71009.1|  gibberellin 3-beta-hydroxylase                          269   2e-82    
gb|ADK70978.1|  gibberellin 3-beta-hydroxylase                          268   2e-82    
gb|ADK71006.1|  gibberellin 3-beta-hydroxylase                          268   2e-82    
ref|XP_008461419.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    271   2e-82    
ref|XP_004291422.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    270   2e-82    
gb|ADK70972.1|  gibberellin 3-beta-hydroxylase                          268   2e-82    
gb|ADK70990.1|  gibberellin 3-beta-hydroxylase                          268   3e-82    
gb|EYU21920.1|  hypothetical protein MIMGU_mgv1a009050mg                270   3e-82    
ref|XP_010532143.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    270   3e-82    
emb|CDY38660.1|  BnaC02g23190D                                          270   4e-82    
gb|ADK70954.1|  gibberellin 3-beta-hydroxylase                          267   6e-82    
gb|ADK70997.1|  gibberellin 3-beta-hydroxylase                          267   6e-82    
gb|ADK71022.1|  gibberellin 3-beta-hydroxylase                          267   6e-82    
gb|ADK70969.1|  gibberellin 3-beta-hydroxylase                          266   7e-82    
gb|ADK71015.1|  gibberellin 3-beta-hydroxylase                          266   8e-82    
ref|XP_004291423.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    268   9e-82    
gb|ADK70982.1|  gibberellin 3-beta-hydroxylase                          266   1e-81    
gb|ADK71005.1|  gibberellin 3-beta-hydroxylase                          266   2e-81    
gb|ADK71004.1|  gibberellin 3-beta-hydroxylase                          266   2e-81    
ref|XP_010520599.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        269   2e-81    
ref|XP_010417722.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    267   2e-81    
ref|XP_004291424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    267   2e-81    
gb|EPS71653.1|  gibberellin 3-oxidase                                   266   3e-81    
gb|ADM47339.1|  gibberellin 3-oxidase 3                                 267   3e-81    
gb|ADK71020.1|  gibberellin 3-beta-hydroxylase                          264   3e-81    
ref|XP_003550162.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    267   4e-81    
gb|ADK70981.1|  gibberellin 3-beta-hydroxylase                          265   4e-81    
gb|ADK70979.1|  gibberellin 3-beta-hydroxylase                          264   5e-81    
gb|ADK70965.1|  gibberellin 3-beta-hydroxylase                          264   7e-81    
gb|ADK70967.1|  gibberellin 3-beta-hydroxylase                          264   9e-81    
gb|ADK70974.1|  gibberellin 3-beta-hydroxylase                          263   1e-80    
gb|ADK70976.1|  gibberellin 3-beta-hydroxylase                          263   2e-80    
gb|ADK71007.1|  gibberellin 3-beta-hydroxylase                          263   2e-80    
ref|XP_003544624.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    265   2e-80    
ref|XP_007137069.1|  hypothetical protein PHAVU_009G097100g             264   3e-80    
gb|ADK71014.1|  gibberellin 3-beta-hydroxylase                          261   9e-80    
gb|ADK70963.1|  gibberellin 3-beta-hydroxylase                          261   1e-79    
ref|XP_010429980.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        263   1e-79    
gb|ADK71000.1|  gibberellin 3-beta-hydroxylase                          259   3e-79    
emb|CDP04846.1|  unnamed protein product                                262   3e-79    
ref|XP_010429978.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    261   5e-79    
ref|XP_004158764.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    262   5e-79    
ref|XP_004136072.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    263   6e-79    
ref|XP_010472948.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2        261   6e-79    
dbj|BAB12439.1|  gibberellin 3b-hydroxylase No3                         261   7e-79    
gb|ADK70961.1|  gibberellin 3-beta-hydroxylase                          258   9e-79    
gb|AAC83647.1|  gibberellin 3 beta-hydroxylase                          260   1e-78    
ref|NP_001275523.1|  gibberellin 3-beta-dioxygenase 1-like              260   1e-78    
ref|XP_010941486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    260   2e-78    
ref|NP_178150.1|  gibberellin 3-beta-dioxygenase 2                      260   2e-78    
gb|ADK71021.1|  gibberellin 3-beta-hydroxylase                          257   2e-78    
ref|XP_007137070.1|  hypothetical protein PHAVU_009G097200g             259   2e-78    
emb|CAH69705.1|  gibberellin 3-oxidase                                  259   4e-78    
gb|ADK71026.1|  gibberellin 3-beta-hydroxylase                          255   1e-77    
emb|CDP19027.1|  unnamed protein product                                257   2e-77    
gb|AAF80661.1|AF074710_1  putative gibberellin 3 beta hydroxylase       256   4e-77    
ref|NP_178149.1|  gibberellin 3-beta-dioxygenase 4                      256   5e-77    
gb|ADK70975.1|  gibberellin 3-beta-hydroxylase                          253   8e-77    
ref|XP_008445138.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    255   2e-76    
gb|AHW42464.1|  GA3ox2                                                  253   5e-76    
gb|AHW42463.1|  GA3ox1                                                  253   6e-76    
ref|XP_004290878.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    248   5e-74    
gb|ADM47337.1|  gibberellin 3-oxidase 1                                 246   3e-73    
gb|AAB64347.1|  gibberellin 2beta,3beta-hydroxylase                     246   5e-73    
gb|KHN44143.1|  Gibberellin 3-beta-dioxygenase 1                        243   2e-72    
ref|XP_004136071.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    239   9e-71    
ref|XP_008461418.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    239   1e-70    
ref|XP_004968405.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    240   2e-70    
emb|CDM81908.1|  unnamed protein product                                238   9e-70    
ref|XP_008350339.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    233   2e-69    
sp|Q3I409.1|G3O23_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    236   3e-69    
sp|Q3I410.1|G3O22_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    235   1e-68    
emb|CAX46400.1|  putative GA3OX protein                                 229   4e-68    
dbj|BAB17075.1|  GA 3beta-hydroxylase                                   232   1e-67    
dbj|BAB62072.1|  GA 3beta-hydroxylase                                   232   1e-67    
ref|NP_001042186.1|  Os01g0177400                                       229   3e-66    
sp|Q3I411.1|G3O21_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    229   3e-66    
gb|ADK70957.1|  gibberellin 3-beta-hydroxylase                          224   4e-66    
gb|AAT49061.1|  GA 3-oxidase 2                                          224   1e-64    
ref|NP_001266453.1|  GA 3-oxidase 1                                     223   3e-64    
ref|XP_002455082.1|  hypothetical protein SORBIDRAFT_03g004020          223   4e-64    
gb|ABV64512.1|  gibberellin 3-beta-hydroxylase                          223   5e-64    
gb|AAT49060.1|  GA 3-oxidase 1                                          220   5e-63    
ref|XP_003569638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    219   2e-62    
dbj|BAK06541.1|  predicted protein                                      218   3e-62    
gb|ABE97176.1|  putative gibberellin 3-beta-dioxygenase/gibberell...    216   5e-62    
ref|XP_008647746.1|  PREDICTED: GA 3-oxidase 2 isoform X1               216   2e-61    
ref|NP_001146525.1|  GA 3-oxidase 2                                     216   3e-61    
gb|ABX10776.1|  gibberellin 3-oxidase-like protein                      215   5e-61    
ref|XP_002987280.1|  hypothetical protein SELMODRAFT_450789             214   6e-61    
ref|XP_002989203.1|  hypothetical protein SELMODRAFT_450793             213   3e-60    
gb|ACG46320.1|  gibberellin 3-beta-dioxygenase 2-2                      212   8e-60    
gb|ADE18861.1|  putative 2-oxoglutarate dependent dioxygenase           211   1e-59    
ref|XP_004963513.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    207   3e-58    
gb|ACL54258.1|  unknown                                                 206   2e-57    
gb|ABY49031.1|  GA3-oxidase                                             199   3e-56    
gb|ABY49032.1|  GA3-oxidase                                             195   9e-55    
gb|ABY49023.1|  GA3-oxidase                                             193   4e-54    
gb|ABY49028.1|  GA3-oxidase                                             192   1e-53    
gb|ABY49030.1|  GA3-oxidase                                             192   1e-53    
dbj|BAQ20604.1|  gibberellin 3 oxidase 1                                195   3e-53    
gb|ABY49024.1|  GA3-oxidase                                             190   6e-53    
dbj|BAB62073.1|  GA 3beta-hydroxylase                                   193   8e-53    
gb|EEC78618.1|  hypothetical protein OsI_18664                          192   2e-52    
ref|NP_001054798.1|  Os05g0178100                                       192   2e-52    
dbj|BAJ65443.1|  gibberellin 3-oxidase                                  184   2e-51    
gb|ABY49029.1|  GA3-oxidase                                             185   4e-51    
gb|ABY49026.1|  GA3-oxidase                                             185   4e-51    
gb|KDO80406.1|  hypothetical protein CISIN_1g043986mg                   183   4e-51    
gb|ABY49025.1|  GA3-oxidase                                             185   6e-51    
ref|XP_006451038.1|  hypothetical protein CICLE_v10010731mg             182   1e-50    
gb|ABY49027.1|  GA3-oxidase                                             182   3e-50    
ref|XP_006451039.1|  hypothetical protein CICLE_v10010488mg             173   1e-47    
gb|KDO80407.1|  hypothetical protein CISIN_1g036755mg                   171   4e-47    
ref|XP_002440702.1|  hypothetical protein SORBIDRAFT_09g005400          177   9e-47    
ref|XP_003552185.2|  PREDICTED: protein SRG1-like isoform X1            174   1e-45    
ref|XP_008337346.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    169   1e-45    
ref|XP_001768518.1|  predicted protein                                  174   1e-45    
ref|XP_001769181.1|  predicted protein                                  172   2e-45    
ref|XP_006411026.1|  hypothetical protein EUTSA_v10016867mg             172   3e-45    
gb|EMS54967.1|  Protein SRG1                                            172   4e-45    
ref|NP_001045319.1|  Os01g0935400                                       171   1e-44    
gb|EAY77129.1|  hypothetical protein OsI_05094                          171   1e-44    
ref|XP_007044805.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    170   1e-44    
ref|XP_004976588.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    170   2e-44    
gb|ACG44904.1|  flavonol synthase/flavanone 3-hydroxylase               171   2e-44    
gb|EMT24263.1|  Protein SRG1                                            170   3e-44    
ref|XP_006468196.1|  PREDICTED: protein SRG1-like                       169   3e-44    
gb|KDO78008.1|  hypothetical protein CISIN_1g018099mg                   169   4e-44    
gb|ACN30002.1|  gibberellin 2-beta-dioxygenase                          167   1e-43    
gb|KCW79673.1|  hypothetical protein EUGRSUZ_C01027                     166   1e-43    
ref|XP_006482819.1|  PREDICTED: protein SRG1-like                       168   1e-43    
ref|XP_003529241.1|  PREDICTED: codeine O-demethylase-like              168   2e-43    
ref|XP_003531421.1|  PREDICTED: protein SRG1-like                       167   2e-43    
emb|CDM86075.1|  unnamed protein product                                167   2e-43    
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                       167   2e-43    
ref|XP_006439037.1|  hypothetical protein CICLE_v10031934mg             167   2e-43    
ref|XP_002459057.1|  hypothetical protein SORBIDRAFT_03g045170          167   3e-43    
ref|XP_003580379.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    166   3e-43    
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                       167   3e-43    
ref|XP_007149079.1|  hypothetical protein PHAVU_005G039300g             167   3e-43    
ref|XP_006652690.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    166   4e-43    
ref|XP_002313472.1|  hypothetical protein POPTR_0009s02780g             166   4e-43    
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                       166   5e-43    
ref|XP_002268288.1|  PREDICTED: protein SRG1                            166   7e-43    
gb|EMS57783.1|  Naringenin,2-oxoglutarate 3-dioxygenase                 164   1e-42    
ref|XP_003565023.1|  PREDICTED: protein SRG1                            164   4e-42    
ref|XP_004310153.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    163   4e-42    
gb|EEE61552.1|  hypothetical protein OsJ_15896                          163   5e-42    
ref|XP_010517112.1|  PREDICTED: protein SRG1-like                       163   5e-42    
ref|NP_001053651.1|  Os04g0581000                                       163   6e-42    
ref|XP_002300323.2|  hypothetical protein POPTR_0001s36520g             163   6e-42    
emb|CBI16708.3|  unnamed protein product                                162   8e-42    
dbj|BAJ98644.1|  predicted protein                                      163   8e-42    
ref|XP_006449602.1|  hypothetical protein CICLE_v10018344mg             163   9e-42    
gb|KFK36717.1|  hypothetical protein AALP_AA4G160400                    162   1e-41    
gb|KEH33162.1|  2OG-Fe(II) oxygenase family oxidoreductase              162   1e-41    
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg             162   1e-41    
ref|XP_001768771.1|  predicted protein                                  160   1e-41    
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                     162   1e-41    
ref|XP_010528915.1|  PREDICTED: protein SRG1                            162   1e-41    
gb|AAD45425.1|  gibberellin 2-oxidase                                   161   2e-41    
gb|KEH22932.1|  2OG-Fe(II) oxygenase family oxidoreductase              162   2e-41    
sp|D4N501.1|DIOX2_PAPSO  RecName: Full=Probable 2-oxoglutarate/Fe...    162   2e-41    
ref|XP_010040043.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    161   2e-41    
gb|KDP21186.1|  hypothetical protein JCGZ_21657                         162   2e-41    
ref|XP_009133236.1|  PREDICTED: protein SRG1-like                       162   2e-41    
emb|CDY07746.1|  BnaA03g17650D                                          161   2e-41    
gb|AHW42455.1|  GA2ox5                                                  162   2e-41    
gb|KCW45529.1|  hypothetical protein EUGRSUZ_L00738                     161   2e-41    
ref|XP_009595967.1|  PREDICTED: 1-aminocyclopropane-1-carboxylate...    161   3e-41    
ref|XP_009396510.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    160   3e-41    
ref|XP_011042009.1|  PREDICTED: protein SRG1-like                       161   3e-41    
gb|ABB20895.1|  flavanone 3-hydroxylase                                 160   3e-41    
ref|XP_009384465.1|  PREDICTED: S-norcoclaurine synthase 1-like         161   4e-41    
gb|KEH38429.1|  plant gibberellin 2-oxidase                             160   4e-41    
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                       161   4e-41    
gb|KHN29183.1|  Protein SRG1                                            160   6e-41    
sp|Q9SQ80.1|G2OX1_PEA  RecName: Full=Gibberellin 2-beta-dioxygena...    160   6e-41    
ref|XP_010919857.1|  PREDICTED: S-norcoclaurine synthase 1-like         160   6e-41    
ref|XP_002862263.1|  oxidoreductase                                     160   7e-41    
gb|ABN80396.1|  gibberellin beta-hydroxylase                            154   7e-41    
ref|XP_010327726.1|  PREDICTED: leucoanthocyanidin dioxygenase is...    160   7e-41    
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                       160   7e-41    
dbj|BAG68574.1|  GA20 oxidase-like protein                              160   8e-41    
gb|AAM63604.1|  putative anthocyanidin synthase                         160   8e-41    
emb|CDY14476.1|  BnaC03g21190D                                          160   8e-41    
ref|NP_181359.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    160   8e-41    
ref|XP_010505441.1|  PREDICTED: protein SRG1-like                       160   9e-41    
gb|AAF08609.1|AF056935_1  gibberellin 2-beta-hydroxylase                159   9e-41    
emb|CDP14583.1|  unnamed protein product                                159   9e-41    
ref|XP_009400481.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    159   1e-40    
ref|XP_006855491.1|  hypothetical protein AMTR_s00057p00196790          160   1e-40    
ref|XP_002881570.1|  oxidoreductase                                     160   1e-40    
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...    160   1e-40    
ref|XP_008245738.1|  PREDICTED: hyoscyamine 6-dioxygenase-like is...    159   1e-40    
emb|CBI30780.3|  unnamed protein product                                158   1e-40    
ref|XP_006355623.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    160   1e-40    
ref|XP_009394604.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    159   1e-40    
ref|XP_009397555.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    160   1e-40    
ref|XP_011046706.1|  PREDICTED: codeine O-demethylase-like              160   1e-40    
gb|ABX10773.1|  gibberellin 3-oxidase-like protein                      159   1e-40    
gb|KDP21182.1|  hypothetical protein JCGZ_21653                         159   1e-40    
ref|XP_010027975.1|  PREDICTED: protein SRG1-like                       159   1e-40    
ref|XP_006442333.1|  hypothetical protein CICLE_v10020840mg             159   1e-40    
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    160   2e-40    
ref|XP_004249074.1|  PREDICTED: leucoanthocyanidin dioxygenase is...    159   2e-40    
emb|CAC85924.1|  Gibberellin 2-oxidase                                  158   2e-40    
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2            159   2e-40    
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1            159   2e-40    
ref|XP_007211571.1|  hypothetical protein PRUPE_ppa008414mg             159   2e-40    
tpg|DAA54956.1|  TPA: hypothetical protein ZEAMMB73_256851              159   2e-40    
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                       159   2e-40    
ref|XP_010036328.1|  PREDICTED: protein SRG1-like                       159   2e-40    
ref|XP_001754794.1|  GA 2-oxidase                                       159   2e-40    
ref|XP_007209285.1|  hypothetical protein PRUPE_ppa008091mg             159   2e-40    
gb|KCW47843.1|  hypothetical protein EUGRSUZ_K01583                     159   2e-40    
ref|XP_008242510.1|  PREDICTED: protein SRG1-like                       159   2e-40    
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                       159   2e-40    
ref|XP_010925657.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    158   2e-40    
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                       159   2e-40    
ref|XP_008226238.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    158   3e-40    
ref|XP_007211193.1|  hypothetical protein PRUPE_ppa008100mg             158   3e-40    
ref|XP_002269432.1|  PREDICTED: protein SRG1                            158   3e-40    
emb|CAC83090.1|  gibberellin 2-oxidase                                  157   3e-40    
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                       159   3e-40    
ref|XP_002269890.1|  PREDICTED: protein SRG1                            159   3e-40    
ref|XP_008225388.1|  PREDICTED: protein SRG1-like                       159   3e-40    
ref|XP_010466382.1|  PREDICTED: protein SRG1-like                       159   3e-40    
gb|AFS65097.1|  gibberellin 2-beta-dioxygenase                          158   3e-40    
ref|XP_010050489.1|  PREDICTED: protein SRG1-like                       159   3e-40    
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1            158   4e-40    
gb|AFK38817.1|  unknown                                                 158   4e-40    
ref|XP_007009259.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    158   4e-40    
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988    163   4e-40    
ref|XP_006442330.1|  hypothetical protein CICLE_v10020843mg             158   4e-40    
ref|XP_010034113.1|  PREDICTED: protein SRG1-like                       158   4e-40    
ref|XP_010509205.1|  PREDICTED: protein SRG1-like                       159   5e-40    
emb|CBI16709.3|  unnamed protein product                                158   5e-40    
ref|XP_003546763.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1        157   5e-40    



>dbj|BAD06944.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=367

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/363 (85%), Positives = 329/363 (91%), Gaps = 5/363 (1%)
 Frame = +2

Query  191   MNQEIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACE  370
             MNQEID+IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACE
Sbjct  1     MNQEIDNIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACE  60

Query  371   TWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  550
             TWGIFQVTNHGVP  LLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ
Sbjct  61    TWGIFQVTNHGVPWSLLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  120

Query  551   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP---  718
             MWSEGFTVAGSPLEHARQVWPQDYSDFCSV++DYQ +MR LA+ +AALMFK + + P   
Sbjct  121   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVIDDYQEKMRGLAEKIAALMFKSLGLSPGED  180

Query  719   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  898
             + W     +    TQAYLQMNW P CPDPTRAMG AQHTDTSLVTLLYQTSNI GLQVYG
Sbjct  181   VEWFEPNGLS-NSTQAYLQMNWYPKCPDPTRAMGLAQHTDTSLVTLLYQTSNIRGLQVYG  239

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
             PNLNW+DV+P S+AIVVNLGDLMQIISNG FKSVLHRAIVS+AH+RISV YFFG SKNVE
Sbjct  240   PNLNWVDVKPISDAIVVNLGDLMQIISNGRFKSVLHRAIVSEAHNRISVGYFFGSSKNVE  299

Query  1079  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALASGSEAPVG  1258
             I+PSLKLIK +EFPMY+PISWN YLDIK KYF K+LEMIGFNSDVEKSNALASG EAP+G
Sbjct  300   ISPSLKLIKGSEFPMYKPISWNEYLDIKNKYFNKSLEMIGFNSDVEKSNALASGDEAPLG  359

Query  1259  SEV  1267
             SEV
Sbjct  360   SEV  362



>ref|XP_006476108.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Citrus sinensis]
Length=355

 Score =   350 bits (899),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 175/342 (51%), Positives = 229/342 (67%), Gaps = 9/342 (3%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW-LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETW  376
              +  IIP+DF  A +LPDSH W L DH P+    TH +VP+IDL  PQA   I+ ACE W
Sbjct  14    HLKHIIPLDFKTALKLPDSHAWTLPDH-PMADPLTHAAVPVIDLGGPQAATLIRQACEKW  72

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G FQVTNHG+P++LL Q+E Q RR F L   QKL A RSP    GYG  RIS FF   MW
Sbjct  73    GAFQVTNHGIPIKLLNQVEFQTRRLFALPANQKLLAGRSPEDFTGYGLPRISTFFSKLMW  132

Query  557   SEGFTVAGSPLEHARQVWPQDYS--DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  721
             +EGFT+ GSPL+HARQ+WP +Y   +FC V+ +YQ +++ LA+ +  LMF+ +      I
Sbjct  133   TEGFTILGSPLDHARQLWPHEYDHINFCQVMVEYQKELKGLAEKILGLMFRSLGLTQEDI  192

Query  722   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
              W +    G +  Q  LQ+N  P+CPDP RAMG A HTD+SL+T LYQ  N +GLQVY  
Sbjct  193   AWFK-PKYGCKSPQGVLQLNSYPVCPDPNRAMGLAPHTDSSLLTSLYQ-GNTSGLQVYRD  250

Query  902   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1081
             N+ W+ V P S A+VV +GDLMQI  NG FKS LHRA+V+   HRIS AYF+GP ++V+I
Sbjct  251   NVGWVPVHPVSGALVVIVGDLMQITCNGRFKSALHRALVNNTRHRISTAYFYGPPQDVKI  310

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1207
             +PS+KL       +YRP++W  YLD K  +F KA+E+I +++
Sbjct  311   SPSVKLTDHDHPILYRPVTWREYLDAKATHFNKAIELIRYDA  352



>ref|XP_007013295.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
 gb|EOY30914.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
Length=355

 Score =   343 bits (881),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 221/335 (66%), Gaps = 7/335 (2%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             +  IP+DF    +LPDSH W   H P++   T E +P+IDL  P     ++ ACE WG F
Sbjct  21    EHTIPLDFTNVPKLPDSHAWTLPHQPIDPF-TQEPLPIIDLAKPDVSKLVRHACEEWGAF  79

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             Q+TNHG+P+ LL +IE+Q RR F L  E KL AVRSP    GYG  RIS FF   MWSEG
Sbjct  80    QITNHGIPICLLNEIEYQTRRLFSLPAESKLLAVRSPEGFTGYGLARISPFFSKLMWSEG  139

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*R  733
             F++ GSP+EHA Q+WP+D++ FC V+E +Q +M+ L++ + A+M   +       + W  
Sbjct  140   FSIIGSPVEHASQLWPEDHAKFCEVMEQFQEEMKALSEKMVAIMLSSLGLTHEEDVKWFE  199

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LN  910
                 G   +   LQ+N  P+CPDP RAMG A HTD+S++TLLYQ  NI+GLQV   +   
Sbjct  200   PMKEGCDQSTCVLQLNSYPVCPDPGRAMGLAPHTDSSVLTLLYQ-GNISGLQVQRDDAAG  258

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ VEP   A+VVN+GDLM I+SNG FKSVLHRA+V+  HHR+S AYF+GP ++ +++P 
Sbjct  259   WMPVEPVEGALVVNVGDLMHIVSNGRFKSVLHRALVNNEHHRVSTAYFYGPPRDAKVSPL  318

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KLI     P+YRP++W  YL+ K K+F KALE I
Sbjct  319   RKLIDRDHPPLYRPVTWKDYLEAKSKHFSKALESI  353



>ref|XP_010254241.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=370

 Score =   340 bits (871),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 168/346 (49%), Positives = 220/346 (64%), Gaps = 30/346 (9%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             +D     ++PDSH W  LDD+  V+SS   ESVP+IDL DP AV  +  AC+TWG+FQVT
Sbjct  21    LDLESVREVPDSHAWPQLDDYPSVHSSFDVESVPVIDLSDPNAVKLVGHACKTWGVFQVT  80

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
             NHG+P+ LL  +E   RR F L P+QKL+A R P  ++GYG  RIS FF   MWSEGFT+
Sbjct  81    NHGIPMRLLEDVESHGRRLFALPPQQKLKAARLPDGISGYGLARISSFFPKLMWSEGFTI  140

Query  575   AGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG--  748
              GSP+EHARQ+WPQD++ FC V+E+Y   M+ LA+ L  LM             G +G  
Sbjct  141   VGSPIEHARQLWPQDHTRFCDVMEEYGKCMKQLARKLFWLML------------GSLGIN  188

Query  749   ---LQWTQ----------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQ  889
                + W            A LQ+N  P CPDPTRAMG A HTD++L+T+LYQ S  +GLQ
Sbjct  189   KDDINWASPQGGESGAMCAALQLNSYPACPDPTRAMGLAAHTDSTLLTVLYQNST-SGLQ  247

Query  890   VYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSK  1069
             V      W+ V P   A+VVN+GDL+ I+SNG+F SVLHRA+V++  HR+SVAY +GP  
Sbjct  248   VLRDGAGWVTVPPLPGALVVNVGDLLHILSNGIFPSVLHRAVVNRTRHRLSVAYLYGPPT  307

Query  1070  NVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1207
             N +I+P   L+ P   P+YRP++W  YL  K K+F KAL  +   S
Sbjct  308   NAQISPLSSLVDPNHPPLYRPVTWAEYLGTKAKHFNKALSSVRLCS  353



>ref|XP_004288825.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score =   338 bits (868),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 174/354 (49%), Positives = 232/354 (66%), Gaps = 34/354 (10%)
 Frame = +2

Query  188   TMNQEIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMAC  367
             T  + +  IIP+DFN  D LPDSHTW  D SP +   T E VP+IDL+DP A   I++A 
Sbjct  6     TSTRNLSHIIPLDFNSVDTLPDSHTW--DSSPDHHLFT-EFVPIIDLHDPNAATLIRLAS  62

Query  368   ETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDS  547
             E WG+FQVTNHGVP+ L+ + E QAR  FEL  +QKLRA+RSP S +GYG+   +  F  
Sbjct  63    EQWGVFQVTNHGVPMNLVQEAEVQARGLFELPRDQKLRALRSPESFSGYGSAGNAANFSK  122

Query  548   QMWSEGFTVAGSPLEHARQVWPQDYS---DFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  718
              MWSEGFT+ GSP+EHA Q+WP D S    FC V+E+YQ +M+ L+  L  LM       
Sbjct  123   LMWSEGFTIMGSPVEHAAQLWPDDQSVQTHFCDVMEEYQKKMKGLSGKLIRLML------  176

Query  719   ICW*RCGMVGL-----QWTQ----------AYLQMNW*PICPDPTRAMGFAQHTDTSLVT  853
                   G +GL     +W              LQ+N+ P+CPDPTRAMG A HTDTS+ T
Sbjct  177   ------GSLGLDKEDVKWLNRPKRSSTNFPQVLQLNYYPVCPDPTRAMGLAPHTDTSVFT  230

Query  854   LLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHH  1033
             +L Q  +I+GLQV+   + W+ V+P   A+VVN+GDLM I+SNG FK+ +HRA+V++ HH
Sbjct  231   VLNQC-DISGLQVFQEGIGWMSVQPIPGALVVNVGDLMHILSNGRFKTTIHRAVVNELHH  289

Query  1034  RISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             RIS+AYF+GP  +V+I+P +KLI     P+YRP++W  YL IK  +F +ALE+I
Sbjct  290   RISIAYFYGPPYDVKISPLMKLIGQDHPPLYRPVTWKEYLGIKGTHFNRALELI  343



>ref|XP_002299619.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE84424.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=372

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 219/332 (66%), Gaps = 10/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL---DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             +DF    ++PDSH W    D+  P+      ESVP+IDL DP  +  I  AC+TWG+ QV
Sbjct  23    IDFTSLQEIPDSHKWTQIDDEQHPLVDPLNTESVPVIDLSDPNVLQNIGHACKTWGVLQV  82

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P  LL  IE  +R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  83    TNHGIPTSLLENIESASRSLFSLPIQQKLKAARSPDGVSGYGVARISSFFSKLMWSEGFT  142

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPLEH RQ+W QDY+ FC ++E+Y+ +M+ LA+ L  LM   +    + + W   G 
Sbjct  143   IVGSPLEHFRQLWSQDYTKFCDIIEEYKKEMQKLARRLTWLMLGSLGIAKKDLKW--AGS  200

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N+ P CPDP +AMG A HTD++L+T+LYQ SN +GLQV    + WI 
Sbjct  201   TGESKKGSAALQLNYYPACPDPDQAMGLAAHTDSTLLTILYQ-SNTSGLQVLKEGIGWIT  259

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+A+ +GP  +VEI+P  KL
Sbjct  260   VPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQKL  319

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P   P+YRP++WN YL  K KYF KAL  +
Sbjct  320   VGPNHPPLYRPVTWNEYLGTKAKYFNKALSSV  351



>ref|XP_009339604.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score =   335 bits (858),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 224/332 (67%), Gaps = 11/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSPVNSSS--THESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DFN   +LPDS+ W   DDH P + SS    +SVP+IDL +P A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSSLSSFGVDDSVPVIDLSEPNALKLTGHACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P +LL  IE   +  F L  EQKL+A R P  ++GYG  RIS FF   MWSEGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVEQKLKAARPPDGISGYGFARISSFFRKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RCGM  742
             + GSP++H RQ+WPQDY  FC+++E+Y+ +M+ LA  L  LM   + I P  + W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYEKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISPEDVKW--AGS  199

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLRDGTGWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P + A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY FGP  +V+I+P  KL
Sbjct  259   VPPMAGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASVQISPLSKL  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P+  P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPITWNEYLGTKAKHFNKALSSV  350



>gb|AFS18537.1| gibberellin 3-oxidase [Pyrus communis]
Length=371

 Score =   335 bits (858),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 224/332 (67%), Gaps = 11/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSPVNSSS--THESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DFN   +LPDS+ W   DDH P + SS    +SVP+IDL +P A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSSLSSFGVDDSVPVIDLSEPNALKLTGHACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P +LL  IE   +  F L  EQKL+A R P  ++GYG  RIS FF   MWSEGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVEQKLKAARPPDGISGYGFARISSFFRKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RCGM  742
             + GSP++H RQ+WPQDY  FC+++E+Y+ +M+ LA  L  LM   + I P  + W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYEKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISPEDVKW--AGS  199

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLRDGTGWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P + A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY FGP  +V+I+P  KL
Sbjct  259   VPPMAGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASVQISPLSKL  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P+  P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPITWNEYLGTKAKHFNKALSSV  350



>ref|XP_011045367.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=372

 Score =   334 bits (856),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 217/332 (65%), Gaps = 10/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL---DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             +DF    ++PDSH W    D+  P+      ESVP+IDL DP  +  I  AC+TWG+ QV
Sbjct  23    IDFTSLQEIPDSHKWTQIDDEQRPLVDPLITESVPVIDLSDPNVLQNIGHACKTWGVVQV  82

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P  LL  IE  +R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  83    TNHGIPTSLLENIESASRSLFSLPIQQKLKAARSPDGVSGYGVPRISSFFSKLMWSEGFT  142

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPLEH R +W QDY+ FC ++E+Y+ +M+ LA+ L  LM   +    + + W   G 
Sbjct  143   IVGSPLEHFRHLWSQDYTKFCDIIEEYKKEMQKLARRLTRLMLGSLGITKKDLKW--AGS  200

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N+ P CPDP +AMG A HTD++L+T+LYQ SN +GLQV    + W+ 
Sbjct  201   TGESKKGSAALQLNYYPACPDPDQAMGLAAHTDSTLLTILYQ-SNTSGLQVLKEGIGWVT  259

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+A+ +GP  +VEI+P  KL
Sbjct  260   VPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQKL  319

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P   P+YRP++WN YL  K  YF KAL  +
Sbjct  320   VGPNHPPLYRPVTWNEYLGTKATYFNKALSSV  351



>gb|AEW67998.1| gibberellin 3 oxidase 1 [Castanea mollissima]
Length=368

 Score =   333 bits (855),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 223/331 (67%), Gaps = 12/331 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             DFN   +LPDS+ W   D  P   S + ESVPLIDL DP A+  +  AC+TWG+FQVTNH
Sbjct  22    DFNSLQELPDSYKWTQLDEYPSCESFSSESVPLIDLTDPNALTLVGHACKTWGVFQVTNH  81

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
             G+P +LL  IE  +R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT+ G
Sbjct  82    GIPTKLLDDIESVSRCLFSLPQQQKLKAARSPDGVSGYGLARISSFFPKLMWSEGFTIVG  141

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPIC-----W*RCGMV  745
             SPLEH RQ+WPQ+YS FC ++E+Y+ +M+ LA  L  L+   +   IC     W   G  
Sbjct  142   SPLEHFRQLWPQEYSKFCDIIEEYEKEMKKLAGRLMWLILGSL--GICNEDIKW--AGPK  197

Query  746   G-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
             G  Q   A LQ+N  P CPDP +AMG A HTD++L+T+L+Q +N +GLQV      W+ V
Sbjct  198   GEFQGASAALQLNSYPACPDPDQAMGLAAHTDSTLLTILHQ-NNTSGLQVLREGTGWVTV  256

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
             +P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  +R+S+AY +GP  +V+I+P  KL+
Sbjct  257   DPVQGALVVNIGDLLHILSNGLYPSVLHRAMVNRTRYRLSMAYLYGPPDSVQISPLSKLL  316

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              P+  P+YRP++WN YL  K K+F KAL  +
Sbjct  317   GPSHPPLYRPVTWNEYLGTKAKHFNKALSCV  347



>ref|XP_008377587.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Malus domestica]
Length=371

 Score =   333 bits (854),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 221/332 (67%), Gaps = 11/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSPVNSSS--THESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DFN   +LPDS+ W   DDH P + SS    +SVP+IDL +P A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSSLSSFGADDSVPVIDLSEPNAIKLTGHACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P +LL  IE   +  F L  EQKL+A R P  ++GYG  RIS FF   MWSEGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVEQKLKAARPPDGISGYGFARISSFFRKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSP++H RQ+WPQDY  FC+++E+Y+ +M+ LA  L  LM   +      + W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYEKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISTEDVKW--AGS  199

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLRDGTGWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASIQISPLSKL  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P+  P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPITWNEYLGTKAKHFNKALSSV  350



>gb|AGN95009.1| gibberellin 3-beta-dioxygenase, partial [Prunus salicina]
Length=331

 Score =   332 bits (850),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 223/333 (67%), Gaps = 12/333 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDH---SPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF+   +LPDS+ W   DD    SP +  +  +SVP+IDL DP A+     AC TWG+FQ
Sbjct  1     DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  60

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHG+P +LL  IE   R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGF
Sbjct  61    VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  120

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL+H RQ+WPQDY+ FC+++E+Y+ +M+ LA  L  LM   +      + W   G
Sbjct  121   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKEMKKLAGRLMWLMLGSLGISKEDVKW--AG  178

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  179   PKGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTRWV  237

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  238   TVPPLPGALVVNVGDLIHILSNGLYPSVLHRAVVNRSRHRLSIAYLYGPPDSVQISPLSK  297

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  298   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  330



>ref|XP_006427125.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|ESR40365.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|KDO58202.1| hypothetical protein CISIN_1g036286mg [Citrus sinensis]
Length=352

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 219/330 (66%), Gaps = 8/330 (2%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +DF    +LPDS+ W   D  P+  S   ESVP+IDL DP A+  +  AC+TWG FQV N
Sbjct  21    LDFTSLQELPDSYAWTQRDEYPIGDSLISESVPVIDLNDPNALTLVGNACKTWGAFQVIN  80

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P  LL   E  +R  F L  +QKL+A RSP  +AGYG  RIS FF   MWSEGFTVA
Sbjct  81    HGIPTNLLDNTESTSRSLFSLPTQQKLKAARSPDGVAGYGLARISSFFSKLMWSEGFTVA  140

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  748
             GSPL+H R++WPQD+   C ++E+Y+ +M+ LA  L  L+   +    + + W   G  G
Sbjct  141   GSPLDHFRKLWPQDFCKHCDIIEEYEQEMKKLAGRLMWLVLGSLGITTQDVKW--AGPKG  198

Query  749   -LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  925
                   A LQ+N+ P CPDP RAMG A+HTD++L+T+LYQ +N +GLQV      W+ V 
Sbjct  199   HFTDASAALQLNYYPACPDPDRAMGLAEHTDSTLLTILYQ-NNTSGLQVLKEGTGWVMVP  257

Query  926   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1105
             P   A+VVN+GDL+ I+SNG + SVLHRA+V++A HR+S+AY +GP  +V+I+P  KL+ 
Sbjct  258   PIPGALVVNVGDLIHILSNGSYPSVLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQKLVG  317

Query  1106  PTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P+  P+YRPI+W+ YLD K K+F KAL  +
Sbjct  318   PSHPPLYRPITWSEYLDTKAKHFNKALSSV  347



>ref|XP_010098950.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
 gb|EXB76252.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
Length=359

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 174/340 (51%), Positives = 227/340 (67%), Gaps = 11/340 (3%)
 Frame = +2

Query  209   SIIPMDFNKADQLPDSHTWLDDHS--PVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             +I+P+DFN    LPDSHTW    S  P  +   H SVP+IDL+DP AV  I+ ACE WG 
Sbjct  20    NIVPLDFNSVPTLPDSHTWTPCTSADPSFTGDDH-SVPVIDLFDPNAVSLIRQACERWGA  78

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQVTNHGVP + L ++E Q+RRFF L  E+KLR VRS  S+ GYG V ISKFF   MWSE
Sbjct  79    FQVTNHGVPYDHLKEVESQSRRFFALPAERKLRVVRSAESVTGYGLVPISKFFPKMMWSE  138

Query  563   GFTVAGSPLEHARQVWP-QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             GF++ GSP E+ARQ+WP +D   FCSV+E YQ +M+ L++ L  L+ + +      I W 
Sbjct  139   GFSMTGSPEEYARQLWPHEDCRQFCSVMEMYQKEMKGLSEKLLELILRSLGVNYEDIKW-  197

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV-YGPNL  907
                  GL   QA LQ+N  P+CPDPTRAMG A HTD+SL+T+LYQ+    GLQV    ++
Sbjct  198   ANPKNGLSSYQALLQLNSYPVCPDPTRAMGLAPHTDSSLLTVLYQS--CMGLQVQRKEDI  255

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              W+ V     A++VNLGDLM I+SNG FKS +HRA+V+K HHR+SVAYF GP K  +I+ 
Sbjct  256   GWVPVHTVDGALIVNLGDLMHIMSNGRFKSAMHRAVVNKTHHRVSVAYFCGPPKEEKISS  315

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1207
              +++I      MYR ++W  YL+I+  +F KALE I  N+
Sbjct  316   LIQMIDDDRPRMYRGVTWKEYLEIRAAHFDKALEFIKNNN  355



>ref|XP_008228615.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Prunus mume]
Length=372

 Score =   332 bits (851),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 223/333 (67%), Gaps = 12/333 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDH---SPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF+   +LPDS+ W   DD    SP +  +  +SVP+IDL DP A+     AC TWG+FQ
Sbjct  22    DFSSLQELPDSYAWSQNDDQYASSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHG+P +LL  IE   R  F L   QKL+A RSP  ++GYG  RIS FF   MWSEGF
Sbjct  82    VTNHGIPSKLLDDIESAGRSLFSLPVHQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL+H RQ+WPQDY+ FC+++E+Y+ +M+ LA  L  LM   +   +  + W   G
Sbjct  142   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISMEDVKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  200   PRGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTGWV  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  259   TVPPLPGALVVNVGDLIHILSNGLYPSVLHRAVVNRSRHRLSIAYLYGPPDSVQISPLSK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  351



>ref|XP_002303276.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE78255.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=373

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 223/335 (67%), Gaps = 14/335 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDD----HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             +DF+   ++PDSH W  LDD    H  V S  T ESVP+IDL DP  +  I  AC+TWG+
Sbjct  22    LDFSSLQEIPDSHKWTQLDDIEQQHPSVESFIT-ESVPVIDLLDPNVLQNIGNACKTWGV  80

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
              QVTNHG+P+ LL  +E  +R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSE
Sbjct  81    LQVTNHGIPISLLESVEGVSRSLFSLPVQQKLKAARSPDGVSGYGVARISSFFSKLMWSE  140

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSPLEH RQ+WPQDY+ FC V+E+++ +M+ LA+ L  LM   +    + + W  
Sbjct  141   GFTIVGSPLEHFRQLWPQDYTKFCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNW--  198

Query  734   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              G  G  +   A LQ+N  P CPDP  AMG A HTD++L+T+LYQ +N +GLQV    + 
Sbjct  199   AGPKGESKEGGAALQLNSYPACPDPDLAMGLAAHTDSTLLTILYQ-NNTSGLQVLKEGIG  257

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +V+I+P 
Sbjct  258   WVTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAYLYGPPSSVQISPI  317

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+ P   P+YRPI+WN YL  K K+F KAL  +
Sbjct  318   QKLVGPNHPPLYRPITWNEYLVAKAKHFNKALSSV  352



>gb|AAR12160.1| gibberellin 3-oxidase [Populus tremula x Populus tremuloides]
Length=373

 Score =   332 bits (850),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 223/335 (67%), Gaps = 14/335 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDD----HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             +DF+   ++PDSH W  LDD    H  V S  T ESVP+IDL DP  +  I  AC+TWG+
Sbjct  22    LDFSSLQEIPDSHKWTQLDDIEQQHPSVESFIT-ESVPVIDLLDPNVLQNIGNACKTWGV  80

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
              QVTNHG+P+ LL  +E  +R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSE
Sbjct  81    LQVTNHGIPISLLESVEGVSRSLFSLPVQQKLKAARSPDGVSGYGVARISSFFSKLMWSE  140

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSPLEH RQ+WPQDY+ FC V+E+++ +M+ LA+ L  LM   +    + + W  
Sbjct  141   GFTIVGSPLEHFRQLWPQDYTKFCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNW--  198

Query  734   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              G  G  +   A LQ+N  P CPDP  AMG A HTD++L+T+LYQ +N +GLQV    + 
Sbjct  199   AGPKGESKEGGAALQLNSYPACPDPDLAMGLAAHTDSTLLTILYQ-NNTSGLQVLKEGIG  257

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +V+I+P 
Sbjct  258   WVTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAYLYGPPSSVQISPI  317

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+ P   P+YRPI+WN YL  K K+F KAL  +
Sbjct  318   QKLVGPNHPPLYRPITWNEYLVAKAKHFNKALSSV  352



>dbj|BAD91162.1| gibberellin 3-beta hydroxylase [Prunus subhirtella]
Length=372

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 223/333 (67%), Gaps = 12/333 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDH---SPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF+   +LPDS+ W   DD    SP +  +  +SVP+IDL DP A+     AC TWG+FQ
Sbjct  22    DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHG+P +LL  IE   R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGF
Sbjct  82    VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL+H RQ+WPQDY+ FC+++E+Y+  M+ LA  L  LM   +   +  + W   G
Sbjct  142   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKVMKRLAGRLMWLMLGSLGISMEDVKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  200   PKGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTGWV  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  259   TVPPLPGALVVNVGDLIHILSNGLYPSVLHRAVVNRSRHRLSIAYLYGPPASVQISPLSK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  351



>gb|AHC32022.1| gibberellin 3-oxidase 1 [Camellia sinensis]
Length=361

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 226/335 (67%), Gaps = 13/335 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNS----SSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             +DFN  ++LP+SH W  L+ +S  +S    + T ESVP+IDL DP A++ +  AC TWG+
Sbjct  21    LDFNSLEELPESHAWTSLEKYSSSDSVETITGTKESVPVIDLNDPNAMELVGHACRTWGV  80

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQVTNHG+   +L ++E   +  F L  +QKL+A RSP  ++GYG  RIS FF   MWSE
Sbjct  81    FQVTNHGINTSVLNRVESAGKSLFSLPIQQKLKAARSPEGVSGYGVARISPFFPKLMWSE  140

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSPLEHA Q+WPQDYS+FC V+E+Y+ +M+ LA+ L  LM   +      + W  
Sbjct  141   GFTIFGSPLEHACQLWPQDYSNFCDVIEEYEKEMKILARRLMWLMLGSLDISKEDVKW--  198

Query  734   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              G  G  +   A +Q+N  P CP+P RAMG A HTD++L+T+LYQ +N +GL+V+     
Sbjct  199   AGPKGDFKGANAAVQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLEVHRDGYG  257

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P  + +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P 
Sbjct  258   WVTVPPIPDTLVVNIGDLLHILSNGLYPSVLHRAMVNRTRHRLSVAYLYGPPPNVQISPL  317

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+  T  P+YRP++W  YL  K KYF KAL  +
Sbjct  318   SKLVDLTHPPLYRPVTWTEYLGTKAKYFDKALSSV  352



>ref|XP_007215556.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
 gb|EMJ16755.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
Length=372

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/333 (49%), Positives = 223/333 (67%), Gaps = 12/333 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDH---SPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF+   +LPDS+ W   DD    SP +  +  +SVP+IDL DP A+     AC TWG+FQ
Sbjct  22    DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHG+P +LL  IE   R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGF
Sbjct  82    VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL+H RQ+WPQDY+ FC+++E+Y+ +M+ LA  L  LM   +      + W   G
Sbjct  142   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKEMKKLAGRLMWLMLGSLGISKEDVKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  200   PKGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTRWV  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL+ I+SNG++ SVLH+A+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  259   TVPPLPGALVVNVGDLIHILSNGLYPSVLHQAVVNRSRHRLSIAYLYGPPDSVQISPLSK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  351



>ref|XP_010110310.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC25830.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=372

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 222/343 (65%), Gaps = 12/343 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             DF+   +LPDS+ W   DDH    S    +S+P++DL DP A+  I  AC+TWG+FQVTN
Sbjct  25    DFSSLQELPDSYAWNQPDDHPSDRSIFASKSIPVVDLNDPNALKLIGHACKTWGVFQVTN  84

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+  ELL  IE   R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT+ 
Sbjct  85    HGISTELLDDIESAGRSLFSLPLQQKLKAARSPDGVSGYGVARISSFFPKLMWSEGFTIV  144

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  748
             GSP++H RQ+WPQDYS FC V+E+Y+A+++ LA  L  LM   +      I W   G  G
Sbjct  145   GSPVDHFRQLWPQDYSKFCDVIEEYEAEVKRLAGRLMWLMLGSLGISRADIKW--AGPKG  202

Query  749   -LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  925
               +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ S  +GLQV      W+ V 
Sbjct  203   NFKGASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQNST-SGLQVLREGTGWVTVP  261

Query  926   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1105
             P   A VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +V+I+P  +L+ 
Sbjct  262   PIHGAFVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSIAYLYGPPSSVKISPLPRLVG  321

Query  1106  PTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALA  1234
             P + P+YRPI+W  YL  K K+F KAL  +   S V   N LA
Sbjct  322   PGQPPLYRPITWTEYLGTKAKHFNKALSSVRVFSPV---NGLA  361



>gb|KDP32333.1| hypothetical protein JCGZ_13258 [Jatropha curcas]
Length=348

 Score =   328 bits (842),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 218/336 (65%), Gaps = 5/336 (1%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW-LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETW  376
             +++ I P+DF    +LPDSH W L   +P     T ESVP+IDL DP A   I+ A E W
Sbjct  2     QLNQITPLDFKNVAKLPDSHRWTLSSENPSQDPLTQESVPIIDLNDPHAPSLIREANENW  61

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G+FQ+TNHGVP+ L+ +I+ Q +R F L  +QKL A RSP  L GYG  RIS F + Q+W
Sbjct  62    GMFQLTNHGVPITLMQEIQSQTQRLFALPADQKLLAARSPDGLTGYGMARISSFLNKQLW  121

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
              EGFT+ GSP +HA Q WP DY+ FC VVE+YQ +M+ L++ L  LMFK +      + W
Sbjct  122   FEGFTIIGSPAQHASQFWPNDYTTFCDVVEEYQKEMKGLSERLIGLMFKSLGLAQEDVKW  181

Query  728   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  907
                        Q+ LQ+N  PICP+  +AMG A HTD++L+TL++Q +N +GLQV+    
Sbjct  182   FTTKSETQHQPQSVLQLNSYPICPEAGQAMGLAPHTDSTLLTLVHQ-NNASGLQVFREGS  240

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              W+ V P   A+VVN+GDLMQI+SNG FKSVLHRA+V++ +HR SV +F+GP  + E++P
Sbjct  241   GWVPVHPVDGALVVNIGDLMQILSNGRFKSVLHRAVVNETYHRTSVVHFYGPPMDAEVSP  300

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              + LI      +YR +SW  YLD K  +F K L+ I
Sbjct  301   LMHLIDFDHPVLYRAVSWKEYLDAKKIHFDKTLDFI  336



>ref|XP_007203364.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
 gb|EMJ04563.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
Length=341

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/341 (49%), Positives = 225/341 (66%), Gaps = 16/341 (5%)
 Frame = +2

Query  191   MNQEIDS---IIPMDFNKADQLPDSHTWL---DDHSPVNSSSTHESVPLIDLYDPQAVDK  352
             MN  + S   +IP+DF     LP+SHTW     DH P       ESVP+IDL DP A   
Sbjct  1     MNIHLSSHHHLIPLDFKSLVTLPNSHTWAPSSSDHHPFP-----ESVPVIDLSDPNATPL  55

Query  353   IKMACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRIS  532
             +++ACE WG+FQVTNHGVP+ L+ Q + Q  R F L  +QKLR +RSP    GYG+ RIS
Sbjct  56    VRLACEKWGVFQVTNHGVPMNLIKQTQLQTHRLFALPRDQKLRVLRSPDGFTGYGSARIS  115

Query  533   KFFDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II  712
               F   MWSEGF++ GSPLEHARQ+WP  +++FC+V+E+YQ +M+ LA  L  LM    +
Sbjct  116   DNFPKLMWSEGFSMMGSPLEHARQLWPLHHANFCNVMEEYQMEMKGLAAKLIELM----L  171

Query  713   RPICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  892
             R +      +  L+  ++ LQ+N  P+CPDPTRAMG A HTD+S +  L   +   GLQV
Sbjct  172   RSLGLNNEDVKWLRHPRSLLQLNSYPVCPDPTRAMGLAPHTDSS-LLTLLYQTTTGGLQV  230

Query  893   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1072
                 ++W  V P + A+VVN+GDLM I+SNG FKSV+HRAIV+K HHRIS+AYF+GP  +
Sbjct  231   LVDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPPWD  290

Query  1073  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             V+I+P +KLI     P+Y+P++W  YL  K  +F KALE+I
Sbjct  291   VKISPLMKLIDHNHPPLYQPVTWKEYLGYKATHFNKALELI  331



>gb|AEK70423.1| GA3ox1 [Gossypium hirsutum]
Length=364

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 219/338 (65%), Gaps = 10/338 (3%)
 Frame = +2

Query  206   DSIIPM--DFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACET  373
             D+II +  DF    +LP+S+ W   DD    +  S+ ESVP+IDL DP A+  I  AC T
Sbjct  7     DAIIRLHPDFTSLQELPESYAWNQRDDIDYPSFDSSAESVPIIDLNDPNALQNIGHACRT  66

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG+FQV NHGV   LL  +E  +R  F L   QKL+A RSP  ++GYG  RIS FF   M
Sbjct  67    WGVFQVINHGVSTTLLDMVESTSRTLFSLPVNQKLKAARSPDGVSGYGFARISSFFSKLM  126

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPI  721
             WSEGFT+ GSP EH RQ+WP DY++ C V+++Y+ +M+ LA  L  LM   +     + I
Sbjct  127   WSEGFTIVGSPDEHFRQLWPHDYTNHCDVIKEYKQEMKKLAGRLMCLMLGSLGITAKQDI  186

Query  722   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
              W        +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ S  +GLQV   
Sbjct  187   KW-AGPKSEFKEASAALQLNYYPACPDPDRAMGLAAHTDSTLLTILYQNST-SGLQVLKE  244

Query  902   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1081
              + WI V P  + +V+N+GDLM I+SNG + SVLHRA+V++  HR+S+AY +GP  +V+I
Sbjct  245   GVGWIKVSPVPDGLVINVGDLMHILSNGSYPSVLHRAMVNRTRHRLSIAYLYGPPSSVKI  304

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +P  KL+ PT  P+YRPI+WN YLD K KYF KAL  +
Sbjct  305   SPHPKLVGPTHPPLYRPITWNEYLDTKAKYFNKALSWV  342



>ref|XP_009343425.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 219/332 (66%), Gaps = 11/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSP--VNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DFN   +LPDS+ W   DD  P  + S    +SVP+IDL D  A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDLYPSFLTSFGADDSVPVIDLSDTNALKLTGHACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P +LL  IE   +  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVQQKLKAARSPDGISGYGFARISSFFKKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSP++H RQ+WPQDY  FC+++E+Y+ +M+ LA  L  LM   +   +  I W   G 
Sbjct  142   IFGSPVDHFRQLWPQDYDKFCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKW--AGS  199

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ SN +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-SNTSGLQVLREGTGWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+V+N+GDL  I+SNG++ SVLHRA+V++  HR+S+AY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSIAYLFGPPASLQISPLSKL  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P+  P+YRPISWN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPISWNEYLGTKAKHFNKALSSV  350



>gb|ACT99991.1| gibberellin 3-oxidase [Malus domestica]
Length=369

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 218/332 (66%), Gaps = 11/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSP--VNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DFN   +LPDS+ W   DDH P  + S    +SVP+I+L D   +     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSFLTSFGADDSVPVINLSDTNVLKLTGHACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+  +LL  IE   +  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  82    TNHGIQQKLLDDIESAGKSLFSLPVQQKLKAARSPDGISGYGFARISSFFKKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSP++H RQ+WPQDY  FC+++E+Y+ +M+ LA  L  LM   +   +  I W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYDKFCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKW--AGS  199

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ SN +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-SNTSGLQVLREGTGWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+V+N+GDL  I+SNG++ SVLHRA+V++  HR+SVAY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSVAYLFGPPASIQISPLSKL  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P+  P+YRPISWN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPISWNEYLGTKAKHFNKALSSV  350



>ref|NP_001269085.1| uncharacterized protein LOC100265167 [Vitis vinifera]
 emb|CBI36201.3| unnamed protein product [Vitis vinifera]
 gb|AGQ42611.1| GA3ox1 [Vitis vinifera]
Length=365

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/337 (48%), Positives = 215/337 (64%), Gaps = 25/337 (7%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +D N   +LPD + W   D +P   S   ESVP+IDL DP A + +  AC++WG+FQVTN
Sbjct  21    LDLNSVQELPDLYAWAGVDENPSGDSLITESVPVIDLTDPNASELVGHACKSWGVFQVTN  80

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P  LL  IE   R  F L  +QKL+A RSP  +AGYG  RIS FF+  MW EGFT+ 
Sbjct  81    HGIPGSLLDDIESAGRSLFSLPAQQKLKAARSPDGVAGYGLARISSFFNKLMWYEGFTIF  140

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG---  748
             GSPLEHARQ+WPQDY+ FC V E+++ +M  LA+ L  LM             G +G   
Sbjct  141   GSPLEHARQLWPQDYTKFCDVTEEFEKEMNQLAERLMWLML------------GSLGITK  188

Query  749   --LQWT------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
               L W       +A LQ+N  P CP+P RAMG A HTD+SL T+LYQ + ++GLQV    
Sbjct  189   EDLNWAGSKGDFKAALQLNSYPACPEPDRAMGLAAHTDSSLFTILYQNT-VSGLQVQREG  247

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               WI V P   A+V+N+GDL+ I+SNG+F SV+HRA+V++  HR+SVAY +GP   V I+
Sbjct  248   AGWITVPPLPGALVINVGDLLHILSNGVFPSVVHRALVNRTKHRLSVAYLYGPPAGVPIS  307

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P  KL+  T  P+YRP++W+ YL  K K+F KAL ++
Sbjct  308   PVPKLVDSTHPPLYRPVTWSEYLCTKAKHFDKALSLV  344



>ref|XP_008365721.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=371

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 218/332 (66%), Gaps = 11/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSP--VNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DFN   +LPDS+ W   DDH P  + S    +SVP+I+L D   +     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSFLTSFGADDSVPVINLSDTNVLKLTGHACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+  +LL  IE   +  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  82    TNHGIQQKLLDDIESAGKSLFSLPVQQKLKAARSPDGISGYGFARISSFFKKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSP++H RQ+WPQDY  FC+++E+Y+ +M+ LA  L  LM   +   +  I W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYDKFCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKW--AGS  199

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ SN +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-SNTSGLQVLREGTGWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+V+N+GDL  I+SNG++ SVLHRA+V++  HR+SVAY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSVAYLFGPPASIQISPLSKL  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P+  P+YRPISWN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPISWNEYLGTKAKHFNKALSSV  350



>ref|XP_010249916.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=378

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/337 (50%), Positives = 218/337 (65%), Gaps = 13/337 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPV----NSSSTHESVP-LIDLYDPQAVDKIKMACETWG  379
             +D     ++PDSH W  LDD+       +S+   ESVP +IDL DP AV  +  AC+TWG
Sbjct  22    LDLESVREVPDSHAWPELDDYPSAVTVEDSNFDVESVPPVIDLTDPNAVKLVGHACKTWG  81

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             +FQVTNHG+P+ LL  +E Q RR F L P QKL+A R P  ++GYG  RIS FF   MWS
Sbjct  82    VFQVTNHGLPMRLLDDVESQGRRLFSLPPHQKLKAARPPDGISGYGLARISSFFPKLMWS  141

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSP+EHARQ+WP DYS+FC V+E+Y+ +M+ LA  L  LM   +      I W 
Sbjct  142   EGFTIVGSPVEHARQLWPLDYSNFCDVMEEYEKEMKQLAGRLMWLMLGSLGISKDDIKWA  201

Query  731   RCGMVGLQ-WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-  904
                  G      A LQ+N  P CPDP+RAMG A HTD++L+T+LYQ S  +GLQV     
Sbjct  202   AAASKGESGGVCAALQLNSYPACPDPSRAMGLAAHTDSTLLTVLYQNST-SGLQVLRDGA  260

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P   A+VVN+GDL+ I+SNG + SVLHRAIV++ HHR+SVAY +GP  N +I+
Sbjct  261   AGWVTVPPLRGALVVNVGDLLHILSNGKYPSVLHRAIVNRTHHRLSVAYLYGPPTNAQIS  320

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P   L+ P   P+YRP++W  YL  K K+F KAL  +
Sbjct  321   PISSLVDPNHPPLYRPVTWAEYLGTKAKHFNKALSSV  357



>gb|KHG10231.1| Gibberellin 3-beta-dioxygenase 1 -like protein [Gossypium arboreum]
Length=364

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 161/330 (49%), Positives = 214/330 (65%), Gaps = 8/330 (2%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             DF    +LP+S+ W   DD    +  S+ ESVP+IDL DP A+  I  AC TWG+FQV N
Sbjct  15    DFTSLQELPESYAWNQRDDIDYPSFDSSAESVPIIDLNDPNALQSIGHACRTWGVFQVIN  74

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGV   LL  +E  +R  F L   QKL+A RSP  ++GYG  RIS FF   MWSEGFT+ 
Sbjct  75    HGVSTTLLDMVESTSRTLFSLPVNQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIV  134

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RCGMV  745
             GSP EH RQ+WP DY++ C V+++Y+ +M+ LA  L  LM   +     + I W      
Sbjct  135   GSPDEHFRQLWPHDYTNHCDVIKEYKQEMKKLAGRLMCLMLGSLGITAKQDIKW-AGPKS  193

Query  746   GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  925
               +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ S  +GLQV    + WI V 
Sbjct  194   DFKEASAALQLNYYPACPDPDRAMGLAAHTDSTLLTILYQNST-SGLQVLKEGVGWIKVP  252

Query  926   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1105
             P  + +V+N+GDLM I+SNG + SVLHRA+V++  HR+S+AY +GP  +V+I+P  KL+ 
Sbjct  253   PVPDGLVINVGDLMHILSNGSYPSVLHRAMVNRTRHRLSIAYLYGPPSSVKISPHPKLVG  312

Query  1106  PTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             PT  P+YRPI+WN YLD K KYF KAL  +
Sbjct  313   PTHPPLYRPITWNEYLDTKAKYFNKALSWV  342



>ref|XP_009374076.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Pyrus x bretschneideri]
Length=385

 Score =   327 bits (839),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 168/369 (46%), Positives = 229/369 (62%), Gaps = 50/369 (14%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWL-----------------DDHSPVNSSSTHESVPLIDLY  331
             +  IIP+DF     LPDSH W                   + +P N+ S    VP+IDL+
Sbjct  18    LSHIIPLDFESVHALPDSHIWTHTKEVEVPVSKSICNMKSNPTPYNTPSL-VCVPVIDLF  76

Query  332   DPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAG  511
             +  A   ++ ACE WG+FQVTNHG+P++L+ + E Q RR F L  +QKLRA+RSP  + G
Sbjct  77    NSNAASLVRRACEKWGVFQVTNHGIPMQLMKEAEFQTRRLFALPRDQKLRALRSPEGVTG  136

Query  512   YGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAA  691
             YG  RISK F   MWSEGFT+ GSP EHARQ+WP+ +++FC  +E+YQ +M+ LA  L  
Sbjct  137   YGLARISKNFPMLMWSEGFTIMGSPAEHARQLWPRHHANFCGAMEEYQKEMKGLALKLIG  196

Query  692   LMFK*IIRPICW*RCGMVGLQWT-------------QAYLQMNW*PICPDPTRAMGFAQH  832
             LM             G +GL +              +A LQ+N  P+CPDPTRA+G A H
Sbjct  197   LML------------GSLGLNYEDVKWLKPKNRSGPRALLQLNSYPVCPDPTRAIGLAPH  244

Query  833   TDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRA  1012
             TD+SL+TLL Q+S I+GLQV    + W+ V P   A+VVN+GDLM I+SNG FKS +HRA
Sbjct  245   TDSSLLTLLNQSS-ISGLQVLLDGIRWVPVHPIPGALVVNVGDLMHILSNGQFKSAVHRA  303

Query  1013  IVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             +V++ HHRIS+AYF+GP  +V+I+P +        P+YRP++W  YL+ K  +F KALE+
Sbjct  304   VVNEVHHRISMAYFYGPPMDVKISPLID----HNHPLYRPVTWKEYLEYKATHFDKALEV  359

Query  1193  IGFNSDVEK  1219
             I   +D EK
Sbjct  360   I--RTDAEK  366



>emb|CAN80137.1| hypothetical protein VITISV_028510 [Vitis vinifera]
Length=365

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 214/337 (64%), Gaps = 25/337 (7%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +D N   +LPD + W   D +P   S   ESVP+IDL DP A + +  AC++WG+FQVTN
Sbjct  21    LDLNSVQELPDLYAWAGVDENPSGDSLITESVPVIDLTDPNASELVGHACKSWGVFQVTN  80

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P  LL  IE   R  F L  +QKL+A RSP  +AGYG  RIS FF+  MW EGFT+ 
Sbjct  81    HGIPGSLLDDIESAGRSLFSLPAQQKLKAARSPDGVAGYGLARISSFFNKLMWYEGFTIF  140

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  751
             GSPLEHARQ+WPQDY+ FC V E+++ +M  LA+ L  LM             G +G+  
Sbjct  141   GSPLEHARQLWPQDYTKFCDVTEEFEKEMNQLAERLMWLML------------GSLGITK  188

Query  752   ---QWT------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
                 W       +A LQ+N  P CP+P RAMG A HTD+SL T+LYQ + ++GLQV    
Sbjct  189   EDVNWAGSKGDFKAALQLNSYPACPEPDRAMGLAAHTDSSLFTILYQNT-VSGLQVQREG  247

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               WI V P   A+V+N+GDL+ I+SNG F SV+HRA+V++  HR+SVAY +GP   V I+
Sbjct  248   AGWITVPPLPGALVINVGDLLHILSNGXFPSVVHRALVNRTKHRLSVAYLYGPPAGVPIS  307

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P  KL+  T  P+YRP++W+ YL  K K+F KAL ++
Sbjct  308   PVPKLVDSTHPPLYRPVTWSEYLCTKAKHFDKALSLV  344



>ref|XP_007024019.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
 gb|EOY26641.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
Length=371

 Score =   324 bits (831),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 217/330 (66%), Gaps = 9/330 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW-LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             DF    +LPD + W   D  P   +   ESVP+IDL DP A+  I  AC+TWG+FQV NH
Sbjct  23    DFTSLQELPDLYAWNQRDDYPCGDAFAAESVPIIDLDDPNALQGIGHACKTWGVFQVINH  82

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
             G+P  LL  +E   R  F L   QKL+A RSP  ++GYG  RIS FF   MWSEGFT+ G
Sbjct  83    GIPPSLLDMVECTGRTLFSLPVHQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIVG  142

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP---ICW*RCGMVG  748
             SP EH RQ+WPQDYS++C V+++Y+ +M+ LA  L  L+   + IR    + W   G  G
Sbjct  143   SPDEHFRQLWPQDYSNYCDVIKEYKEEMKKLAGRLMWLVLGSLGIRAKQDMKW--AGPKG  200

Query  749   -LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  925
               +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+ V 
Sbjct  201   DFREASAALQLNFYPACPDPERAMGLAAHTDSTLLTILYQ-NNTSGLQVLKEGAEWVTVP  259

Query  926   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1105
             P    +V+N+GDLM I+SNG + SVLHRA+V+++ HR+S+AY +GP  +V+I+P  KL+ 
Sbjct  260   PVPGGLVINVGDLMHILSNGSYPSVLHRAMVNRSRHRLSIAYLYGPPSSVKISPHPKLVG  319

Query  1106  PTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P+  P+YRP++WN YLD K K+F KAL  +
Sbjct  320   PSHPPLYRPVTWNEYLDTKAKHFNKALSSV  349



>ref|XP_008242694.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=338

 Score =   323 bits (827),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/340 (49%), Positives = 224/340 (66%), Gaps = 17/340 (5%)
 Frame = +2

Query  191   MNQEIDS--IIPMDFNKADQLPDSHTWL---DDHSPVNSSSTHESVPLIDLYDPQAVDKI  355
             MN  + S  +IP+DF     LP+SHTW     DH P       +SVP+IDL DP A   +
Sbjct  1     MNIHLSSHHLIPLDFKSLVSLPNSHTWAPSSSDHHPFP-----DSVPVIDLSDPNATPLV  55

Query  356   KMACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISK  535
             + ACE WG+FQVTNHGVP+ L+ Q + Q  R F L  +QKLR +RSP   +GYG+ RIS 
Sbjct  56    RRACEKWGVFQVTNHGVPMNLIKQTQLQTHRLFALPRDQKLRVLRSPDGFSGYGSARISD  115

Query  536   FFDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIR  715
              F   MWSEGF++ GSPLEHARQ+WP+ +++FC+V+E+YQ +M+ LA  L  LM    +R
Sbjct  116   NFPKLMWSEGFSMMGSPLEHARQLWPRHHANFCNVMEEYQKEMKGLAAKLIELM----LR  171

Query  716   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
              +      +  L   Q+ LQ+N  P+CPDPTRAMG A HTD+S +  L   +   GLQV 
Sbjct  172   SLGLNNEDVKWLTHPQSLLQLNSYPVCPDPTRAMGLAPHTDSS-LLTLLYQTTTGGLQVL  230

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                ++W  V P + A+VVN+GDLM I+SNG FKSV+HRAIV+K HHRIS+AYF+GP  +V
Sbjct  231   VDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPPWDV  290

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +I+P +KL      P+Y+P++W  YL  K  +F KALE+I
Sbjct  291   KISPLMKLTD--HPPLYQPVTWKEYLGYKATHFNKALELI  328



>gb|KDP37169.1| hypothetical protein JCGZ_06225 [Jatropha curcas]
Length=375

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 216/331 (65%), Gaps = 9/331 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDD--HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             DF    +LPDS+ W  LD+  HS    S   ES+P+IDL D  A+  I  AC+TWG+FQV
Sbjct  22    DFTSLQELPDSYKWTQLDEETHSYSGDSFMKESIPVIDLLDSNALKNIGYACKTWGVFQV  81

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHGV   LL  IE  +R  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  82    INHGVSTCLLDNIEKVSRDLFSLPMQQKLKAARSPDGVSGYGIARISSFFSKLMWSEGFT  141

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPL+H RQ+WPQDY+ FC  +E YQ +M+ LA  L  L+   +      I W     
Sbjct  142   IVGSPLDHFRQLWPQDYTKFCGTIEVYQVEMQKLAAKLMWLVLGSLDITKEDITW-AGPK  200

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
                +   A LQ+N+ P CPDP +AMG A HTD++L+T+LYQ +N +GLQV      W+ V
Sbjct  201   ADFREASAALQLNYYPACPDPDQAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTGWVTV  259

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
              P S  +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +++I+P  KL+
Sbjct  260   PPISGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSMAYLYGPPSSIQISPLSKLV  319

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  320   GPSQPPLYRPITWNEYLGTKAKHFNKALSWV  350



>gb|AEK70424.1| GA3ox2 [Gossypium hirsutum]
Length=368

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 161/350 (46%), Positives = 216/350 (62%), Gaps = 13/350 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHG  403
             DF    +LPDS+ W     P   +   ESVPL+DL D  A+  I  AC+TWGIFQVTNHG
Sbjct  21    DFTSLHELPDSYAWNQRDDPSPETFATESVPLVDLNDSNALQVIGHACKTWGIFQVTNHG  80

Query  404   VPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGS  583
             +   LL  +EH  R  F L   QKL+A RSP  ++GYG  RIS FF   MWS+GFT+ G 
Sbjct  81    ISTSLLDMVEHTCRSLFSLPVHQKLKAARSPDGVSGYGFARISSFFSKLMWSQGFTIVGP  140

Query  584   PLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RCGMVGL  751
             P EH  Q+WPQD+S  C V+++Y+ +M+ LA  L  LM   +       I W        
Sbjct  141   PDEHFCQLWPQDFSYHCDVIKEYKEEMKKLAGRLMWLMLGSLGIIAKEDIKW-AGPKADF  199

Query  752   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  931
             +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ S  +GLQV+     W+ V P 
Sbjct  200   KGASAALQLNYYPACPDPDRAMGLAPHTDSTLLTILYQNST-SGLQVFKEGAGWVAVPPV  258

Query  932   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1111
                +V+N+GDLM I+SNG ++SVLHRA+V+++HHR+S AY +GP   VEI+P  KL+ PT
Sbjct  259   PGGLVINVGDLMHILSNGSYQSVLHRAMVNRSHHRLSSAYLYGPPSTVEISPHPKLVGPT  318

Query  1112  EFPMYRPISWNAYLDIKYKYFGKALEMI-------GFNSDVEKSNALASG  1240
               P+YRP++WN YL  K K+F KAL  +       G     E++N++  G
Sbjct  319   HPPLYRPVTWNEYLHTKAKHFNKALSSVRVCVPLNGLGDVNEQNNSVTVG  368



>gb|AHC32023.1| gibberellin 3-oxidase 2 [Camellia sinensis]
Length=373

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 212/331 (64%), Gaps = 8/331 (2%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             +DFN   +LP+SH W   L D+     S    SVP+IDL DP A   +  AC TWG+FQV
Sbjct  14    LDFNSVKELPESHAWTSLLGDYPSGPDSCGVGSVPIIDLDDPNAQKLVGHACSTWGVFQV  73

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHGV   LL  IE   +  F L  +QKL+A RSP  ++GYG  RIS FF   MWSEGFT
Sbjct  74    TNHGVKNSLLNSIEAAGKSLFSLPIQQKLKAARSPDGVSGYGVARISSFFPKLMWSEGFT  133

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPLEHARQ+WPQD++ FC V+E+Y+  M+ LA  L  LM   +      I W     
Sbjct  134   IFGSPLEHARQLWPQDHNQFCHVIEEYEKVMQQLAGRLMWLMLGSLGITKEDIKW-AGPK  192

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
                +   A +Q+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV      W+ V
Sbjct  193   ADFKGASAAIQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVLREGAGWVTV  251

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
              P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  NV+I+P  KL+
Sbjct  252   PPQPGTLVVNIGDLLHILSNGLYPSVLHRAMVNRTQHRLSIAYLYGPPTNVQISPLSKLV  311

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              P+  P+YRP++W  YL  K K+F KAL  +
Sbjct  312   DPSHPPLYRPVTWTEYLGTKAKHFNKALSSV  342



>dbj|BAA37129.1| gibberelin 3beta-hydroxylase [Lactuca sativa]
Length=363

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 216/329 (66%), Gaps = 10/329 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +D     +LP+SH WL  D SP   SS+ E VP+I+L DP A+  +  AC+TWG+FQVTN
Sbjct  20    LDLKSMKELPESHAWLSQDGSPSYGSSSSEQVPVINLKDPNAMKLVGHACKTWGVFQVTN  79

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGVP  LL ++E   R+ F L  +QKL+A R+P  ++GYG  RIS FF   MWSEGFT+ 
Sbjct  80    HGVPTNLLEEMEAAGRKLFALPIQQKLKAARAPDGVSGYGVARISSFFPKLMWSEGFTII  139

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  748
             GSP EHAR++WP  YS FC V+E Y+ +M +LAQ L  LM   +      + W      G
Sbjct  140   GSPYEHARKLWPNRYSRFCDVIEGYKHEMNNLAQRLMWLMLGSLGVTTEDVKW-----DG  194

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              Q +   LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQ +     W+ V P
Sbjct  195   SQGSCPALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQAHREGAGWVTVPP  253

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P  KL   
Sbjct  254   IPGALVVNVGDLLHILSNGLYPSVLHRAMVNRTQHRLSVAYLYGPPSNVQISPLSKLTDH  313

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                P+YRP++W+ YL  K K+F KAL  +
Sbjct  314   VHPPLYRPVTWSEYLGTKAKHFNKALSSV  342



>ref|XP_004486708.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=371

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 223/354 (63%), Gaps = 17/354 (5%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSS----THESVPLIDLYDPQAVDKIKMACETWGI  382
             +DFN   +LP+S+TW  LDDH+ +NS++    ++ SVP+IDL DP A   I  AC+TWG+
Sbjct  20    LDFNSLQELPESYTWTHLDDHTIINSNNIMKESNSSVPVIDLNDPNASKLIGHACKTWGV  79

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             +Q+ NHG+P+ LL  I+   +  F L P QKL+A+RSP  ++GYG  RIS FF   MWSE
Sbjct  80    YQIVNHGIPISLLDDIQWVGQTLFSLPPHQKLKALRSPDGVSGYGLARISSFFPKLMWSE  139

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSP EH RQ+WPQDY+ +C +V  Y+  M+ LA  L  LM   +      I W  
Sbjct  140   GFTIVGSPFEHFRQLWPQDYAKYCDIVLQYEETMKKLAGKLMWLMLDSLGITKEDIKW-A  198

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
                   +   A +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    + W
Sbjct  199   GSKAQFEKACAAMQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGIGW  257

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
             + V P    +VVN+GDL  I+SNG++ SVLHR +V++   R S+AY +GP  NVEI P  
Sbjct  258   VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSIAYLYGPPSNVEICPHT  317

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSNALAS  1237
             KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV KSN +  
Sbjct  318   KLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSYVRICATINGLFDVNKSNKVVG  371



>ref|XP_011039983.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=465

 Score =   326 bits (835),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 166/366 (45%), Positives = 225/366 (61%), Gaps = 40/366 (11%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDD----HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             +DF+   ++PDSH W  LDD    H  V S  T ESVP+IDL DP  +  I  AC+TWG+
Sbjct  114   LDFSTLQEIPDSHKWTQLDDIEQQHPSVESFIT-ESVPVIDLLDPNVLQNIGNACKTWGV  172

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
               VTNHG+P+ LL  +E  + + F L  +QKL+A RSP  ++GYG  RIS FF   MWSE
Sbjct  173   LHVTNHGIPISLLENVESVSSKLFSLPIQQKLKAARSPDGVSGYGVARISSFFSKLMWSE  232

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GSPLEH RQ+WPQDY+ FC V+E+++ +M+ LA+ L  LM             G 
Sbjct  233   GFTIVGSPLEHFRQLWPQDYTKFCDVIEEHEKEMQKLARRLTWLML------------GS  280

Query  743   VG-----LQWT---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNIT  880
             +G     L W           A LQ+N  P CPDP  AMG A HTD++L+T+LYQ +N +
Sbjct  281   LGITKKDLNWAGPKGESKEGGAALQLNSYPACPDPDLAMGLAAHTDSTLLTILYQ-NNTS  339

Query  881   GLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFG  1060
             GLQV    + W+ V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +G
Sbjct  340   GLQVLKEGIGWVTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRNKHRLSIAYLYG  399

Query  1061  PSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKS  1222
             P   V I+P  KL+ P   P+YRP++WN YL  K K+F KAL  +   +      DV   
Sbjct  400   PPSTVLISPIQKLVGPNHPPLYRPVTWNEYLVAKAKHFNKALSSVRICAPLNGLVDVNDH  459

Query  1223  NALASG  1240
             N++  G
Sbjct  460   NSVKVG  465



>ref|XP_004486709.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=375

 Score =   321 bits (823),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/334 (47%), Positives = 216/334 (65%), Gaps = 11/334 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSS----THESVPLIDLYDPQAVDKIKMACETWGI  382
             +DFN   +LP+S+TW  LDDH+ +NS++    ++ SVP+IDL DP A   I  AC+TWG+
Sbjct  20    LDFNSLQELPESYTWTHLDDHTVINSNNIMKESNSSVPVIDLNDPNASKLIGHACKTWGV  79

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             +Q+ NHG+P+ LL  I+   +  F L P QKL+A+RSP  ++GYG  RIS FF   MWSE
Sbjct  80    YQIVNHGIPISLLDDIQWVGQTLFSLPPHQKLKALRSPDGVSGYGLARISSFFPKLMWSE  139

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSP EH RQ+WPQDY+ +C +V  Y+  M+ LA  L  LM   +      I W  
Sbjct  140   GFTIVGSPFEHFRQLWPQDYAKYCDIVLQYEETMKKLAGKLMWLMLDSLGITKEDIKW-A  198

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
                   +   A +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    + W
Sbjct  199   GSKAQFEKGCAAIQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGIGW  257

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
             + V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  
Sbjct  258   VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHT  317

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             KL+ PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  318   KLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSYV  351



>ref|XP_010061961.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW69008.1| hypothetical protein EUGRSUZ_F02568 [Eucalyptus grandis]
Length=370

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 161/341 (47%), Positives = 220/341 (65%), Gaps = 11/341 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL---DDHSPVNSSSTHE-SVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +DF+   +LPDS+TW    +D+   NS S  E +VP+IDL+ P A++ I  AC+TWG FQ
Sbjct  21    LDFSSVKELPDSYTWTTQPEDYPCPNSPSGQEVTVPVIDLHHPNALELIGHACKTWGAFQ  80

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHG+P  LL  I+   +  F L   QK +A RSP  + GYG  RIS FF   MWSEGF
Sbjct  81    VTNHGIPKRLLDSIQSAGKNLFSLPVHQKHKAARSPNGVPGYGVARISSFFPKLMWSEGF  140

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  748
             T+ GSPLEHARQ+WP D+++FC V+E+YQ +MR LA  L  LM   +   IC       G
Sbjct  141   TIIGSPLEHARQLWPNDHAEFCDVIEEYQKEMRKLAGRLMWLMLGSL--GICKGDIKWAG  198

Query  749   LQWTQA----YLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
              +   A     LQ+N  P CPDP RAMG A HTD++L+T+L+Q S  +GLQV      W+
Sbjct  199   PKGDFAGACNALQLNSYPACPDPDRAMGLAPHTDSTLLTILFQNST-SGLQVLKEGSGWV  257

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              + P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P  +
Sbjct  258   TIPPIPGALVINVGDLLHILSNGLYPSVLHRAVVNRTWHRLSVAYLYGPPSNVQISPLSQ  317

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEK  1219
             LI  +  P+YRP++W+ YL  K K+F KAL  +     + K
Sbjct  318   LINSSNPPLYRPVTWSEYLGTKAKHFNKALSSVRLCGPMNK  358



>ref|XP_004302950.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   318 bits (814),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 221/336 (66%), Gaps = 9/336 (3%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTW---LDDHSPVNSS-STHESVPLIDLYDPQAVDKIKMACETWGIF  385
             P DFN   +LPDS+ W   LD+   ++S   +   VP+IDL D   +  I  AC+TWG+F
Sbjct  18    PADFNSLHELPDSYAWTNQLDEFPSLDSPFGSDLCVPVIDLNDQNVIKLIGHACKTWGVF  77

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QVTNHGVP +L+  IE   R  F L  +QKL+A R    ++GYG  RIS FF   MWSEG
Sbjct  78    QVTNHGVPQKLVHDIESTCRSLFSLPVQQKLKAARPADGISGYGIHRISSFFQKLMWSEG  137

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPLEH RQ+WPQDY+ FC +VE+Y+ +M+ LA  L  L+F  +      + W   
Sbjct  138   FTLVGSPLEHFRQLWPQDYNKFCCMVEEYETEMKKLAGRLMWLIFGSLGISKEDVSW-AG  196

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                G +     LQ+N  P CPDP+RAMG A+HTD++L+T+++Q SNI+GLQV      W+
Sbjct  197   PKGGFEDASNALQLNSYPACPDPSRAMGLAEHTDSTLLTIIHQ-SNISGLQVLREGAGWL  255

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P + A+V+N+GDL+ I+SNG +++VLHRAIV+++  R+SVAY +GP  NV+I+P  K
Sbjct  256   TVPPVAGALVINIGDLIHILSNGEYQNVLHRAIVNRSQQRLSVAYLYGPPINVQISPHSK  315

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFN  1204
             L+ P+   +YRP++W  YL IK K + KAL  I F+
Sbjct  316   LVTPSHPSLYRPVTWKEYLGIKGKLYNKALSSIKFH  351



>ref|XP_002515559.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47008.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=354

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 213/335 (64%), Gaps = 8/335 (2%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESV-PLIDLYDPQAVDKIKMACETWGI  382
             ++I P+DF     LPDSH W    S    +S  +S+ P+IDL  P A+  IK A E WG+
Sbjct  15    NNIFPLDFTSILTLPDSHAWTTPPSLDPLTSQDDSIIPVIDLNSPNALILIKEASENWGM  74

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQVTNH +P+ L   IE Q R  F L   QKL A RSPG L GYG  RIS FF  +MW E
Sbjct  75    FQVTNHDIPIHLFHHIEGQTRCLFGLPSSQKLLAARSPGGLTGYGRARISDFFKREMWYE  134

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GSP EHA Q+WP   + FC  V+ YQ +M+ L++ +  LMFK +   +       
Sbjct  135   GFTIMGSPAEHASQLWPNQDTSFCDAVKAYQKEMKGLSERIIGLMFKSL--GLIEEDVKF  192

Query  743   VGL----QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
             +GL    Q+ Q  LQ+N  P CPDP RAMG A HTD+SL+T+L+Q   ++GLQV+   + 
Sbjct  193   LGLKDESQYPQGALQLNSYPKCPDPDRAMGLAPHTDSSLITVLHQ-DGVSGLQVFKDGIG  251

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   A+VVN+GDLM IISNG FK   H+A+V+K HHRISVAYF+GP  +V+I+P 
Sbjct  252   WMPVCPVDGALVVNIGDLMHIISNGRFKCAQHQAVVNKTHHRISVAYFYGPPGDVKISPL  311

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             ++L+      +YRP++W  YLD K  YF KAL+ I
Sbjct  312   MQLVDFDHPVLYRPVTWKEYLDAKTIYFDKALDFI  346



>gb|ABP37820.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 162/351 (46%), Positives = 218/351 (62%), Gaps = 18/351 (5%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWG  379
             DFN   +LP+S+TW  LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG
Sbjct  21    DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWG  80

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             ++QV NHG+P+ LL +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWS
Sbjct  81    VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWS  140

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSPL+H RQ+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W 
Sbjct  141   EGFTIVGSPLDHFRQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWA  200

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                    +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV G    
Sbjct  201   GSKAQFDEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSG  259

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P 
Sbjct  260   WVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPH  319

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1225
              KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV  SN
Sbjct  320   EKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSVSLCAPINGLFDVNDSN  370



>dbj|BAG48320.1| gibberellin 3-oxidase1 [Chrysanthemum x morifolium]
Length=356

 Score =   316 bits (809),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 215/329 (65%), Gaps = 10/329 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTH-ESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +D N    LP+SH WL   S    SS   + VP+I L DP A++ +  AC+TWG+FQVTN
Sbjct  13    LDLNSMKVLPESHAWLSLESSPLYSSLSPDLVPVISLTDPNAMNLVGHACKTWGVFQVTN  72

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGVP+ LL ++E   R+ F L  +QKL+A R+P  ++GYG  RIS FF   MWSEGFT+ 
Sbjct  73    HGVPINLLEKMEAAGRKLFALPIQQKLKAARAPDGVSGYGVARISSFFPKLMWSEGFTIM  132

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  748
             GSP EHA ++WP  Y+ FC V+E+Y+ +M  LAQ L +LM   +   +  + W      G
Sbjct  133   GSPYEHALKLWPNSYTRFCDVIEEYKEEMNKLAQTLMSLMLGSLGVTMEDVKW-----AG  187

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              Q +   LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQ +     W+ V P
Sbjct  188   SQGSCPALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQAHRDGAGWVTVPP  246

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P  KL   
Sbjct  247   IPGALVINVGDLLHILSNGLYPSVLHRAMVNRTKHRLSVAYLYGPPSNVQISPLSKLTDQ  306

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                P+YRP++W+ YL  K K+F KAL  +
Sbjct  307   VHPPLYRPVTWSEYLGTKAKHFNKALSSV  335



>gb|ABB00360.1| gibberellin 3-oxidase [Fragaria x ananassa]
Length=358

 Score =   316 bits (809),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 222/337 (66%), Gaps = 11/337 (3%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTW---LDDHSPVNSS-STHESVPLIDLYDPQAVDKIKMACETWGIF  385
             P DFN   +LPDS+ W   LD+   ++SS  +   VP+IDL D   +  I  AC+TWG+F
Sbjct  18    PADFNSLHELPDSYAWTNQLDECPSLDSSFGSDLCVPVIDLNDQNVIKLIGHACKTWGVF  77

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QVTNHGVP +L+  IE   R  F L  +QKL+A R    ++GYG  RIS FF   MWSEG
Sbjct  78    QVTNHGVPQKLVHDIESTCRSLFSLPVQQKLKAARPADGISGYGIHRISSFFQKLMWSEG  137

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPLEH RQ+WPQDY+ FC +VE+Y+ +M+ LA  L  L+F  +      + W   
Sbjct  138   FTLVGSPLEHFRQLWPQDYNKFCCMVEEYETEMKKLAGRLMWLIFGSLGISKEDVSW--A  195

Query  737   GMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
             G  G  +     LQ+N  P CPDP+RAMG A+HTD++L+T+++Q SNI+GLQV      W
Sbjct  196   GPKGDFEDASNALQLNSYPACPDPSRAMGLAEHTDSTLLTIIHQ-SNISGLQVLREGAGW  254

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
             + V P + A+V+N+GDL+ I+SNG +++V HRAIV+++  R+SVAY +GP  NV+I+P  
Sbjct  255   LTVPPVAGALVINIGDLIHILSNGEYQNVFHRAIVNRSQQRLSVAYLYGPPINVQISPHS  314

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFN  1204
             KL+ P+   +YRP++W  YL I+ K + KAL  I F+
Sbjct  315   KLVTPSHPSLYRPVTWKEYLGIEGKLYNKALSSIKFH  351



>gb|ACF71491.1| gibberellin 3-beta hydroxylase [Chrysanthemum x morifolium]
Length=358

 Score =   315 bits (807),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/346 (45%), Positives = 221/346 (64%), Gaps = 31/346 (9%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             D +   +LPDS+ W  +DD   ++ SS  E VP+I+L DP  +  +  AC+TWG+F VTN
Sbjct  13    DLSSMKELPDSYAWSSVDDDCLLSCSS--EPVPVINLEDPNVMKHVGHACKTWGVFHVTN  70

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P+ +L  +E   R+ F L  +QKL+A R+P  ++GYG VRIS FF   MWSEGFT+ 
Sbjct  71    HGIPMAVLDDMEASVRKLFYLPIQQKLKAARAPDGVSGYGAVRISSFFHKHMWSEGFTII  130

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  751
             GSP EHA+++WPQDY +FC VV++Y  +M+ L   L  L+             G +G+  
Sbjct  131   GSPYEHAKKLWPQDYKNFCVVVDEYNKEMKKLTNRLMWLVL------------GSLGITE  178

Query  752   ---QWTQAY---------LQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
                +W +           LQ+N  P CPDP RAMG A HTD+SL+T+L+Q +N +GLQV 
Sbjct  179   GDVKWARQTRDTKEACPALQLNSYPACPDPDRAMGLAAHTDSSLLTILHQ-NNTSGLQVQ  237

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                + W+ V P   A+VV++GDL+ I+SNG++ SVLHRAIV++A HR+S+AY +GP  NV
Sbjct  238   REGMGWVTVPPIKGALVVHVGDLLHILSNGLYSSVLHRAIVNRAQHRLSIAYIYGPPSNV  297

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDV  1213
              I+P  KL      P+Y+P++W+ YL IK KYF K L ++  ++ V
Sbjct  298   RISPLSKLTSIVRPPLYQPVTWSEYLAIKAKYFNKTLSIVRLSAPV  343



>ref|XP_003546239.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHM98787.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=353

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 209/332 (63%), Gaps = 13/332 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL----DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             D N   +LP+S+TW     DDH+  NS +++ESVP+IDL DP A   I  AC TWG +QV
Sbjct  21    DLNSLQELPESYTWTHHGHDDHT--NSPASNESVPVIDLNDPNASKLIHHACTTWGAYQV  78

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P+ LL  I+      F L   QK +A RSP  + GYG  RIS FF   MWSEGFT
Sbjct  79    LNHGIPMSLLQDIQWVGETLFSLPSHQKHKAARSPDGVDGYGLARISSFFPKLMWSEGFT  138

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPLEH RQ+WPQDY  +C  V  Y   M+ L   L  LM   +      + W   G 
Sbjct  139   IVGSPLEHFRQLWPQDYDKYCDFVMQYDEAMKKLVGKLMLLMLDSLGITKEDLKW--AGS  196

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  + T A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +NI+GLQV+   + W+ 
Sbjct  197   KGQFEKTCAALQLNSYPTCPDPDRAMGLAAHTDSTLLTILYQ-NNISGLQVHRKGVGWVT  255

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P S  +V+N+GDL+ I+SNG++ SVLHR +V++   R+SVAY  GP  NVEI P  KL
Sbjct  256   VPPLSGGLVINVGDLLHILSNGLYPSVLHRVLVNRIQRRLSVAYLCGPPPNVEICPHAKL  315

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P + P+Y+ ++WN YL  K K+F KAL  +
Sbjct  316   VGPNKPPLYKAVTWNEYLGTKAKHFNKALSTV  347



>ref|XP_011026517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=341

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 210/338 (62%), Gaps = 26/338 (8%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             IIP+DF+    +PDSH W   H+    S    S+P +DL DP AV  +  ACETWG+FQV
Sbjct  18    IIPLDFDSVRTVPDSHVWPTSHA--FESDDQLSIPTVDLMDPDAVKLVGHACETWGVFQV  75

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P++++ ++E +ARR F L    KL+A+RSPG   GYG  RIS FF  +MW EGFT
Sbjct  76    INHGIPLDVIDEVESEARRLFSLPTGHKLKALRSPGGATGYGLARISPFFSKKMWHEGFT  135

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK----------*IIRPI  721
             V GSP++HAR++WP DY  FC V+EDYQ +M++LA  L  L+ K           ++ P 
Sbjct  136   VMGSPVDHARELWPTDYQRFCDVMEDYQKKMKELAITLMHLILKSLDLSEEEISKVVSPG  195

Query  722   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
             C               LQ+N  P CPDP+R MG A HTDTSL+T+L+Q S I GL+++  
Sbjct  196   C-----------ASTALQLNSYPFCPDPSRVMGLAPHTDTSLLTILHQ-STINGLEIFKD  243

Query  902   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1081
              + W+ V P + ++VVN+GDL+ I+SN  F S+LHR ++ +   R+S+AYF+ P  +  +
Sbjct  244   GVGWVLVSPTNGSLVVNVGDLLHILSNAQFPSILHRVVLKEKQQRLSLAYFYSPPTDFHV  303

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +P    + P E P+YR +S   Y+ IK K   KAL ++
Sbjct  304   SP--LALNPAEIPLYRSVSVREYIHIKAKNLEKALSLV  339



>ref|XP_002324270.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEF02835.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=341

 Score =   313 bits (802),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 211/331 (64%), Gaps = 12/331 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             IIP+DF+    +PDSH W   H+    S    S+P +DL DP AV  +  ACETWG+FQV
Sbjct  18    IIPLDFDSVRTVPDSHVWPTSHA--FESDDQLSIPTVDLMDPDAVKLVGHACETWGVFQV  75

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P++++ ++E +ARR F L    KL+A+RSPG   GYG  RIS FF  +MW EGFT
Sbjct  76    INHGIPLDIIDEVESEARRLFSLPTGHKLKALRSPGGATGYGLARISPFFSKKMWHEGFT  135

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             V GSP++HAR++WP DY  FC V+EDYQ +M++LA  L  L+ K +      I      +
Sbjct  136   VMGSPVDHARELWPNDYQRFCDVMEDYQKKMKELAITLMHLILKSLDLSEEEI----SKV  191

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
             V        LQ+N  P CPDP+R MG A HTDTSL+T+LYQ S I GL+++   + W+ V
Sbjct  192   VSPGGASTALQLNSYPFCPDPSRVMGLAPHTDTSLLTILYQ-STINGLEIFKDGVGWVLV  250

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
              P + ++VVN+GDL+ I+SN  F SVLHR ++ +   R+S+AYF+ P  + +++P    +
Sbjct  251   SPTNGSLVVNVGDLLHILSNAQFPSVLHRVVLKEKQQRLSLAYFYSPPTDFDVSP--LAL  308

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              P + P+YR +S   Y+ IK K   KAL +I
Sbjct  309   NPAQIPLYRSVSVREYIHIKAKNVEKALSLI  339



>ref|XP_010914990.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=360

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 163/337 (48%), Positives = 219/337 (65%), Gaps = 10/337 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS-PVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
              +F    ++PDSH W D H  P    S  +SVP++DL  P AV ++  ACE WG+FQVT 
Sbjct  20    FEFESVREVPDSHAWPDLHDHPSVEPSGPDSVPVVDLASPDAVPRVGRACEEWGVFQVTG  79

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGVP +LL ++E Q RR F L   QKL+A RSPG+++GYG   IS FF   MWSEGFT+A
Sbjct  80    HGVPSDLLDRLESQTRRLFSLPTHQKLKAARSPGNISGYGLAPISSFFSKLMWSEGFTIA  139

Query  578   GSPLEHARQVW-PQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMV  745
             GSPLEHAR++W P+D  +FC V+E+Y+  M++LA  L  LM   +      I W   G V
Sbjct  140   GSPLEHARKLWRPEDSGEFCDVIEEYKEVMKELAGRLLHLMLLSLGLTEEDISW--AGPV  197

Query  746   GLQWT-QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWID  919
                    A LQ+N  P CP+P RA+G A HTD+SL+T+LYQ+S  +GLQV  P+   W+ 
Sbjct  198   RETGDLPAVLQLNSYPACPEPDRAIGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVT  256

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL  I+SNG F+SVLHRA+V++  HR+S AY  GP  +V+++P  KL
Sbjct  257   VPPLPGALVVNVGDLSHILSNGQFRSVLHRAVVNRTRHRLSAAYICGPPAHVKVSPVDKL  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1210
             + P+E P YR ++W  YL +K K F KAL  I  + +
Sbjct  317   VGPSEGPAYRAVTWPEYLGLKRKLFNKALASIKISKE  353



>gb|ABG46320.1| gibberellin 3-oxidase 1 [Rumex palustris]
Length=368

 Score =   314 bits (804),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 210/340 (62%), Gaps = 28/340 (8%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             +DF   ++LPD++ W    S        + VP++DL  P A + I  AC++WG FQV NH
Sbjct  23    LDFQSVEELPDAYEWGPLESHGGPVGADQGVPIVDLKGPNARELIGSACKSWGAFQVINH  82

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
             GVP   L ++E   RR F L   QKL+A R+P  + GYG  RIS FF   +WSEGFT+ G
Sbjct  83    GVPQRFLEEVESAGRRLFSLPLHQKLKAARAPDGVTGYGPARISSFFPKLLWSEGFTIFG  142

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL---  751
             SP +HARQ+WPQDY +FC ++E+Y   M+ LA  L  L+             G +G+   
Sbjct  143   SPEDHARQLWPQDYQNFCEIIEEYDRDMKRLAGRLMWLVL------------GSLGIAKD  190

Query  752   --QWT----------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
               +W            A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N TGLQV+
Sbjct  191   DVEWAGPTGDFNDTCSAALQLNSYPKCPNPGRAMGLAAHTDSTLLTILYQ-NNTTGLQVH  249

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                L W+ V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++ HHR+SVAY FGP ++V
Sbjct  250   RDGLGWVMVPPVPGALVVNIGDLLHILSNGLYPSVLHRAVVNRTHHRLSVAYLFGPPQSV  309

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              I+P  +L+ P    +YRPISW  YL  K K+F KAL  +
Sbjct  310   RISPLERLVDPDHPALYRPISWTEYLSTKAKHFNKALSSV  349



>ref|XP_009355033.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=362

 Score =   313 bits (803),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 218/336 (65%), Gaps = 12/336 (4%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             P DF+   +LP+++ W   L+++    S S  ESVP+IDL DP  V+ +  AC+TWGIFQ
Sbjct  22    PDDFSSLQELPEAYAWTSQLNEYPSFESLSCSESVPVIDLTDPNVVELVGNACKTWGIFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
              TNHGVP +L+  +E   R  F L P+QKL+A R P   +GYG  RIS F +   WSE F
Sbjct  82    ATNHGVPQKLVDDMESTVRSLFSLPPQQKLKATRLPDGFSGYGFHRISAFCEKLTWSESF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T  GSPLEH RQ+WPQDY+ FC + E+Y+ +M+ LA  L  LM   +      I W   G
Sbjct  142   TTVGSPLEHFRQLWPQDYTKFCCIAEEYEREMKRLAARLMWLMLGSLGISKEDIKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY---GPNL  907
               G  +   A LQ N  P CPDP R MG AQHTD++L+++++Q+SN +GLQV+       
Sbjct  200   PRGEFEDASAVLQFNSYPACPDPDRTMGLAQHTDSTLISIVHQSSNASGLQVFRQGEQGR  259

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              W+ V P   A V+N+GD + ++SNG++++VLHRA+V+++ HR+SVAY +GPS+NV+++P
Sbjct  260   GWLMVPPVPGAFVINVGDFIHMLSNGLYQNVLHRAVVNRSQHRVSVAYLYGPSENVQVSP  319

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               KL+ P+  P+Y P++WN YL  K K   KALE +
Sbjct  320   LSKLLGPSCPPLYPPLTWNEYLGTKAKLHNKALESL  355



>gb|ABP37818.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=377

 Score =   314 bits (804),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 217/351 (62%), Gaps = 18/351 (5%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWG  379
             DFN   +LP+S+TW  LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG
Sbjct  21    DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPIIDLNDPNASKLIGHACKTWG  80

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             ++QV NHG+P+ LL +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWS
Sbjct  81    VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWS  140

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSPL+H RQ+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W 
Sbjct  141   EGFTIVGSPLDHFRQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWA  200

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                    +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      
Sbjct  201   GSKAQFDEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSG  259

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P 
Sbjct  260   WVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPH  319

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1225
              KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV  SN
Sbjct  320   EKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSVSLCAPINGLFDVNDSN  370



>ref|XP_003597810.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 ref|XP_003597814.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 gb|AES68061.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=371

 Score =   313 bits (803),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 158/345 (46%), Positives = 212/345 (61%), Gaps = 12/345 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             DFN   +LP+S+TW  LDDH+ +   +T   VP+IDL DP A   I  AC+TWG++QV N
Sbjct  21    DFNSLQELPESYTWNHLDDHTLIKEGTTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVN  80

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P+ LL +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ 
Sbjct  81    HGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIV  140

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  748
             GSPL+H +Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W       
Sbjct  141   GSPLDHFQQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQF  200

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P
Sbjct  201   DEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPP  259

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                 +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ P
Sbjct  260   LHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGP  319

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1225
             T+ P+YR ++WN YL  K KYF KAL  +   +      DV  SN
Sbjct  320   TQPPLYRSVTWNEYLGTKAKYFNKALSSVSLCAPINGLFDVNDSN  364



>gb|ABP37819.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score =   313 bits (803),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 161/351 (46%), Positives = 217/351 (62%), Gaps = 18/351 (5%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWG  379
             DFN   +LP+S+TW  LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG
Sbjct  21    DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWG  80

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             ++QV NHG+P+ LL +I+   +  F L   QKL+A+RSP  ++GY   RIS FF   MWS
Sbjct  81    VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYDLARISSFFPKLMWS  140

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSPL+H RQ+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W 
Sbjct  141   EGFTIVGSPLDHFRQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWA  200

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                    +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV G    
Sbjct  201   GSKAQFDEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSG  259

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P 
Sbjct  260   WVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPH  319

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1225
              KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV  SN
Sbjct  320   EKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSVSLCAPINGLFDVNDSN  370



>ref|XP_010459098.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   312 bits (800),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 214/333 (64%), Gaps = 9/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS++W   DD    +  +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ LL  +E      F L  ++KL+A RS   ++GYG  RI+ FF+ QMWSEGF
Sbjct  83    IANHGVPLSLLQDVEFLTGSLFGLPVQRKLKAARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE+Y+ +M+ LA  L  L    +      + W    
Sbjct  143   TITGSPLNDFRKLWPQHHLNYCDIVEEYEERMKKLASKLMWLALNSLGVSEEDVEWASLN  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI 
Sbjct  203   SADLSWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWIT  261

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  262   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVSKL  321

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIG  1198
             + P E P+YR ++W  YL  K  +F KAL MIG
Sbjct  322   VSPLESPLYRSVTWREYLQTKATHFNKALSMIG  354



>dbj|BAG48321.1| gibberellin 3-oxidase2 [Chrysanthemum x morifolium]
Length=358

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 220/338 (65%), Gaps = 11/338 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             MD +   +LPDS+ W  +DD   ++ SS  E VP+I+L DP  +  +  AC+TWG+F VT
Sbjct  12    MDLSSMKELPDSYAWASVDDGCLLSCSS--EPVPVINLDDPNVMKHVGHACKTWGVFYVT  69

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
             NHG+P+ ++  +E   R+ F L  +QKL+A R+P  ++GYG VRIS FF   MWSEGFT+
Sbjct  70    NHGIPMAVVDDMEASVRKLFYLPIQQKLKAARAPDGVSGYGAVRISSFFHKHMWSEGFTI  129

Query  575   AGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMV  745
              GSP EHA+++WP DY +FC VV++Y  +M+ L   L  L+   +      + W   G  
Sbjct  130   IGSPYEHAKKLWPHDYKNFCEVVDEYNKEMKKLTNRLMWLVLGSLGITEGDVKW--AGPA  187

Query  746   G-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
             G L+     LQ+N  P CPDP RAMG A HTD+SL+T+L+Q +N +GLQV    + W+ V
Sbjct  188   GDLKEACPALQLNSYPACPDPDRAMGLAAHTDSSLLTILHQ-NNTSGLQVQREGMGWVTV  246

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
              P   A+VV++GDL+ I+SNG++ SVLHRAIV++  HR S+AY +GP  NV I+P  KL 
Sbjct  247   PPIKGALVVHVGDLLHILSNGLYSSVLHRAIVNRTQHRFSIAYLYGPPSNVRISPLSKLT  306

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1216
                  P+Y+P++W+ YL IK KYF K L ++  ++ V+
Sbjct  307   SIVRPPLYQPVTWSEYLAIKAKYFNKTLSVVRLSAPVD  344



>ref|XP_010476647.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Camelina sativa]
 gb|ADE80896.1| GA3ox1-like protein [Camelina sativa]
Length=358

 Score =   311 bits (796),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 215/332 (65%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS++W   DD    +  +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ LL  +E      F L  ++KL+A RS   ++GYG  RI+ FF+ QMWSEGF
Sbjct  83    IANHGVPLSLLQDVEFLTESLFGLPVKRKLKAARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQD+ ++C +VE+Y+ +M+ LA  L  L    +      + W R  
Sbjct  143   TITGSPLNDFRKLWPQDHLNYCDIVEEYEERMKKLASKLMWLALNSLGVTEEDVEWARL-  201

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI 
Sbjct  202   TSDLSWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWIT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPLESPLYRSVTWREYLQTKATHFNKALSMI  352



>gb|ACN89834.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=356

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 215/338 (64%), Gaps = 14/338 (4%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQ-AVDKIKMACE  370
             I S   +D     +LP+SH W   LDD    N +   ES+P+IDL D + A+D+I  AC+
Sbjct  5     ISSEKQLDLYSIKELPESHAWRSSLDDDGSRNINV--ESIPVIDLNDDKFAIDRIGHACK  62

Query  371   TWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  550
             TWG FQ+ NH +   LL  +E    R F L  +QKL+A RS   +AGYG  RIS FF   
Sbjct  63    TWGAFQIINHNISQRLLNDMETCGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFSKL  122

Query  551   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  721
             MWSEGFT+ GSPLEHARQ+WP +Y+ FC V+E+Y+ +M  LA  L  LM   +      +
Sbjct  123   MWSEGFTIFGSPLEHARQLWPHNYNKFCDVIEEYENEMEKLAGTLMGLMLGSLGITKEDV  182

Query  722   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
              W     VG +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+  
Sbjct  183   KW----AVGPRSGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFRE  237

Query  902   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1081
                W+ V P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I
Sbjct  238   GNGWVTVPPLRGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKI  297

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +P  KL+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  298   SPLSKLVDQRNPPMYRPVTWSEYLGTKAKHFDKALSSV  335



>emb|CDX81720.1| BnaC08g38810D [Brassica napus]
Length=358

 Score =   310 bits (794),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 209/332 (63%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNSS-----STHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW     P+ ++        ES+PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTSKDDPLFTAPPSPPGAGESIPLIDLNHPDAANQIGRACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F+L  + KL A RS    +GYG  RIS FF+ +MWSEGF
Sbjct  83    IANHGVPLELLQDIEFLTGSLFQLPVQHKLEAARSDAGFSGYGVARISSFFNKKMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE Y+ QM+ LA  L  L    +      I W R  
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEQYEEQMQKLASKLMWLSLNSLGVSEEDIKWARVS  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L W+ 
Sbjct  203   S-DLNWAQSALQLNHYPVCPEPDRAMGLAPHTDSTLLTILYQ-NNTAGLQVFRDDLGWVT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSV+HR  V++   R+SVA+ +GP  + +I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVIHRVRVNQTRPRLSVAFLWGPRSDTKISPVPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPDESPLYRSVTWTEYLRTKATHFNKALSMI  352



>ref|XP_010691237.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   313 bits (801),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/325 (47%), Positives = 211/325 (65%), Gaps = 8/325 (2%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSST---HESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             +DF  + +LPDS  W     P +  S    HE VP+I+L DP+A   I +AC++WG FQ+
Sbjct  85    LDFQSSKELPDSFAWAPHGDPCSLESNAFGHEHVPVINLEDPRAQQLIGVACKSWGAFQI  144

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNHG+P  LL  IE   +  F L   QKL+A RSP  + GYG  RIS FF  +MWSEGFT
Sbjct  145   TNHGIPKSLLDDIEFAGKNLFALPVHQKLKAARSPHGITGYGPARISSFFPKRMWSEGFT  204

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCGMVG  748
             + GSPL+HARQ+WP DY+ FC ++E+YQ +M  LA+ L  L+   + I      +   + 
Sbjct  205   ILGSPLDHARQLWPNDYNKFCDIIEEYQKEMNHLAKRLMQLILGSLGISNQDIMKWADLL  264

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
             L+     +Q+N  P+CPDP RAMG A HTD++L+T+L+Q+S  TGLQV+   + WI V P
Sbjct  265   LKGANGAIQLNSYPVCPDPNRAMGLAAHTDSTLLTILHQSST-TGLQVFKEQVGWITVPP  323

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
              S  +V+N+GDL+ I+SNG + SV HRA+V++  HR+SVAY +GP+  V I P   L   
Sbjct  324   LSGGLVINIGDLLHILSNGQYPSVYHRAMVNRVQHRLSVAYLYGPAPGVRIQP---LPNT  380

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKA  1183
             T  P+YRP++W+ YL IK ++F KA
Sbjct  381   THPPIYRPVTWSEYLGIKGEHFNKA  405



>ref|XP_002514367.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF48321.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=356

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 213/335 (64%), Gaps = 8/335 (2%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESV-PLIDLYDPQAVDKIKMACETWGI  382
             ++I+P+DF     LPDSH W    S    +S  +S+ P+IDL  P  +  IK A E WG+
Sbjct  15    NNIVPLDFTSILTLPDSHAWTTPPSLDPLTSQDDSIIPVIDLNGPNVLILIKEASENWGM  74

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQVTNH +P+ L   IE Q R  F L   QKL A RSPG L GYG  RIS FF  +MW E
Sbjct  75    FQVTNHDIPIHLFHHIEGQTRCLFGLPSTQKLLAARSPGGLTGYGRARISDFFTREMWYE  134

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GSP EHA Q+WP   + FC+V+E  Q +M+ L++ +  +MFK +   +       
Sbjct  135   GFTIMGSPAEHASQLWPNQDTSFCNVMEACQKEMKGLSERIIGIMFKSL--GLNEEDVKF  192

Query  743   VGL----QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
             +GL    Q+ Q  LQ+N  P CPDP RAMG A HTD+SL+T+L+Q   ++GLQV+   + 
Sbjct  193   LGLKDGSQYPQGALQLNSYPKCPDPDRAMGLAPHTDSSLITVLHQ-GGVSGLQVFKEGIG  251

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P  +A+VVN+GDLM IISNG FK   H+A+V+K  HRISVAYF+GP  +V+I+P 
Sbjct  252   WVPVSPVDDALVVNIGDLMHIISNGRFKCAQHQAVVNKTRHRISVAYFYGPPGDVKISPL  311

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             ++L+      +Y P++W  YLD K  YF KAL+ I
Sbjct  312   MQLVDFDHPVLYCPVTWKEYLDAKAIYFDKALDFI  346



>ref|XP_006341659.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=356

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 215/338 (64%), Gaps = 14/338 (4%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQ-AVDKIKMACE  370
             I S   +D     +LP+SH W   LDD    N +   ES+P+IDL D + A+D+I  AC+
Sbjct  5     ISSEKQLDLYSIKELPESHAWRSSLDDDGSRNINV--ESIPVIDLNDDKFAIDRIGHACK  62

Query  371   TWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  550
             TWG FQ+ NH +   LL  +E    R F L  +QKL+A RS   +AGYG  RIS FF   
Sbjct  63    TWGAFQIINHNISQRLLNDMETCGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFSKL  122

Query  551   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  721
             MWSEGFT+ GSPLEHARQ+WP +Y+ FC V+E+Y+ +M  LA  L  LM   +      +
Sbjct  123   MWSEGFTIFGSPLEHARQLWPHNYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGITKEDV  182

Query  722   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
              W     VG +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+  
Sbjct  183   KW----AVGPRSGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFRE  237

Query  902   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1081
                W+ V P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I
Sbjct  238   GNGWVTVPPLCGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKI  297

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +P  KL+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  298   SPLSKLVDQRNPPMYRPVTWSEYLGTKAKHFDKALSSV  335



>ref|XP_010254240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=352

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 219/338 (65%), Gaps = 11/338 (3%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETW  376
             +D I P+DF    ++P+S  W  L D+   NS+   E VP IDL DP+A   ++ ACE  
Sbjct  16    LDHITPIDFESIKEVPESFIWPLLSDYPSCNSADI-EPVPSIDLCDPKATKLMRRACERS  74

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G+FQ+TNHG+P  LL ++E Q  R F L   QKL+ +RSP    GYG    S F+   +W
Sbjct  75    GVFQITNHGIPTRLLHKLESQVWRLFSLPTGQKLKTLRSPDGFTGYGLANHSSFYPKLLW  134

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
             SEGFT+ GSP+EHARQ+WPQDY++FC V+E+YQ +M  L+  L  L+   +      + W
Sbjct  135   SEGFTIFGSPVEHARQLWPQDYTNFCDVIEEYQKEMSKLSGRLTVLLLNSLGLTTDDLEW  194

Query  728   *RCGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
                G  G +   ++ L++N  P CP+PTRAMG A HTD+SL T++YQ +  TGLQV    
Sbjct  195   --VGATGEINGARSALRLNSYPPCPEPTRAMGLAPHTDSSLFTVIYQ-NGTTGLQVSVEG  251

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
             + W+ V P + A+VVN+GD++ IISNG F S +HRA+V +A HR+S+A+F+GP  N +++
Sbjct  252   VGWVTVRPVTGALVVNVGDILHIISNGRFVSSVHRAVVDRAQHRLSIAHFYGPPVNAQLS  311

Query  1085  PSLKLIKPTEFP-MYRPISWNAYLDIKYKYFGKALEMI  1195
             P+ KL+ P + P +YR ++   YL IK K+F KAL +I
Sbjct  312   PAKKLVDPPDHPILYRTVTSQEYLAIKAKHFDKALALI  349



>ref|XP_010249910.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=376

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/344 (44%), Positives = 210/344 (61%), Gaps = 13/344 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW-----LDDHSPVNSSST---HESVPLIDLYDPQAVDKI  355
              +  IIP+DF+   +LPDSH W     LDD       S       +P+IDL D   V  +
Sbjct  17    HLQHIIPLDFSSVRELPDSHAWTSSLLLDDKPHGRRGSVIGVGGPIPVIDLADANVVKLV  76

Query  356   KMACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISK  535
               ACETWG+FQ+TNHG P+ LL  +E ++ R F L  EQKL+A+RSP    GYG  RI+ 
Sbjct  77    GRACETWGVFQITNHGQPISLLEAVESESLRLFSLPAEQKLKALRSPDGATGYGRARITP  136

Query  536   FFDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLA--QNLAALMFK*I  709
             FF   MW EGFT+ GSP EHA Q+WP +Y+ FC V+++YQ +M+ L+       L    +
Sbjct  137   FFSKLMWHEGFTIMGSPAEHAHQLWPHNYTRFCGVMDEYQKEMKQLSVRLLRLILSSLGL  196

Query  710   IRPICW*RCGMVG--LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  883
              R       G  G   Q     LQ+N  P CPDP R MG A HTDTS+ T+LYQ SN +G
Sbjct  197   AREDLTKWVGPAGEFTQGATTALQLNSYPACPDPNRTMGLAAHTDTSMFTILYQ-SNTSG  255

Query  884   LQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1063
             LQ++     W+ V P + A++VN+GDL+QI+SN  F +VLHRA+V++ + R+S+AYF+GP
Sbjct  256   LQIFRDGFGWVSVPPLAGALIVNVGDLLQILSNARFPAVLHRAVVNRTNQRLSIAYFYGP  315

Query  1064  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             S    I P  KLI P + P+YR ++W  Y+ IK K+  +AL ++
Sbjct  316   STETRIMPLSKLIGPGDPPLYRSLTWKEYIGIKAKHLYRALSLV  359



>ref|XP_008804067.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=359

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/337 (47%), Positives = 214/337 (64%), Gaps = 11/337 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
              +F    ++PDSH W  L DH  V  S   +SVP++DL  P AV  +  ACE WG FQVT
Sbjct  20    FEFESVREVPDSHAWPGLHDHPSVEPSGP-DSVPVVDLASPDAVLLVGRACEEWGAFQVT  78

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
              HG+  +LL ++E+Q RR F L   QKL+A RSPG+++GYG   IS FF   MWSEGFT+
Sbjct  79    GHGISSDLLDRLEYQIRRLFSLPTHQKLKAARSPGNISGYGLAPISSFFSKFMWSEGFTI  138

Query  575   AGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMV  745
             AGSPLEHAR++WP+D   FC V+E+Y+  M++LA  L  LM   +      I W   G V
Sbjct  139   AGSPLEHARKLWPKDSGGFCDVMEEYKEVMKELAGRLMHLMLLSLGLTEEDISW--AGPV  196

Query  746   GLQWT-QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWID  919
                    A LQ+N  P CP+P RAMG A HTD+SL+T+LYQ+S  +GLQV  P+   W+ 
Sbjct  197   RDSGELSAVLQLNSYPACPEPDRAMGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVT  255

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL  I+SNG F++VLHRA+V++  HR+S AY  GP  +V ++P  KL
Sbjct  256   VPPLPGALVVNVGDLSHILSNGQFRTVLHRAVVNRTRHRLSAAYICGPPAHVGVSPVDKL  315

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1210
             + P + P YR ++W  YL +K K F  AL  I  + +
Sbjct  316   VGPGQGPAYRTVTWPEYLSLKRKLFNNALASIKLSKE  352



>ref|XP_009117822.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Brassica rapa]
 emb|CDY68965.1| BnaA09g57140D [Brassica napus]
Length=358

 Score =   308 bits (789),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 210/332 (63%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNSS-----STHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW     P+ ++        ES+PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTSKDDPLFTAPPSPPDAGESIPLIDLNHPDAANQIGRACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F+L  ++KL+A RS    +GYG  RIS FF+ +MWSEGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSDTGFSGYGVARISSFFNKKMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE Y+ QM+ LA  L  L    +      I W    
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEQYEEQMQKLASKLMWLSLNSLGVTEEDIKWATVS  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +  W+ 
Sbjct  203   S-DLNWAQSALQLNHYPVCPEPDRAMGLAPHTDSTLLTILYQ-NNTAGLQVFRDDFGWVT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSV+HRA V++   R+SVA+ +GP  + +I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVIHRARVNQTRPRLSVAFLWGPRSDTKISPVPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPDESPLYRSVTWTEYLRTKATHFNKALSMI  352



>ref|XP_011072274.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Sesamum indicum]
Length=378

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 159/349 (46%), Positives = 216/349 (62%), Gaps = 37/349 (11%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDH---SPVNSSST--HESVPLIDLYDPQAVDKIKMACETW  376
             +D N   +LPD+H W   LD +   SP     T   E VP+IDL +  A + I  AC++W
Sbjct  22    LDLNSVKELPDTHAWTSQLDGYPLSSPGGCGGTCHSEMVPIIDLNNENATELIGHACKSW  81

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G+FQV NH +P+ LL ++E    + F L   QKLRA R P  ++GYG  RIS FF   MW
Sbjct  82    GVFQVINHNIPMNLLDEVELAGNKLFSLPMHQKLRAARPPDGISGYGVARISSFFSKLMW  141

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RC  736
             SEGFTV GSPLEHARQ+WP DY +FC  +EDYQ  M+ LA  L  LM             
Sbjct  142   SEGFTVVGSPLEHARQLWPHDYHEFCDTIEDYQKSMKKLAGRLMWLML------------  189

Query  737   GMVG------LQWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTS  871
             G +G      ++W           A +Q+N  P CPDP RAMG A HTD++L+T+L+Q S
Sbjct  190   GSLGITNEDDIKWASPAGEAGGGNAAIQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-S  248

Query  872   NITGLQVYGP-NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVA  1048
             N +GLQV+   +  WI V P+  A+V+++GDLM I+SNG++ SVLHRA+V++  HR+S+A
Sbjct  249   NTSGLQVFQEGSKRWITVPPHPGALVIHVGDLMHILSNGLYPSVLHRAVVNRTRHRLSIA  308

Query  1049  YFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             Y +GP  +V+I+P  KL+     P+YRPI+W+ YL  K K+F KAL  +
Sbjct  309   YLYGPPSSVKISPLPKLVDHFHPPLYRPITWSEYLGTKAKHFDKALTSV  357



>gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Erythranthe guttata]
Length=380

 Score =   308 bits (790),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/351 (44%), Positives = 216/351 (62%), Gaps = 39/351 (11%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS--PVN----SSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             +D +   +LP+SH W   ++  P +    +  + E+VP++DL    A + I  AC+TWG+
Sbjct  22    LDLSSVKELPESHAWTSQNNDYPFSGGGAADGSSETVPIVDLNSGNATELIGHACKTWGV  81

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQV NHG+P  LL +IE      F L   QKLRA R+   ++GYG  RIS FF  +MWSE
Sbjct  82    FQVVNHGIPNNLLEEIEAAGSSLFSLPMHQKLRAARAADGVSGYGVARISSFFSKRMWSE  141

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GSPLE+AR++WP DY+ FC  +EDY+ +M+ LA  L  LM             G 
Sbjct  142   GFTIVGSPLENARKIWPDDYNKFCQTIEDYEKEMKKLAGRLMWLML------------GS  189

Query  743   VGL-------QWTQ------------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQ  865
             +G+       +W              A LQMN  P CPDP RAMG A HTD++++T+L+Q
Sbjct  190   LGITKEEEEVKWADPKEESESGSGCAAALQMNSYPACPDPDRAMGLAAHTDSTILTVLHQ  249

Query  866   TSNITGLQVYGPNLN-WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRIS  1042
              SNI+GLQV     N W+ VEP+  A+VV++GDLM I+SNG + SVLHRA+V++  HR+S
Sbjct  250   -SNISGLQVLREGGNRWVTVEPHPGALVVHVGDLMHILSNGSYPSVLHRAVVNRTRHRLS  308

Query  1043  VAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             VAY +GP   V+I+P  KL+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  309   VAYLYGPPPGVKISPLSKLVDQYNPPMYRPVTWSEYLGTKAKHFDKALTSV  359



>ref|XP_003543662.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=352

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 156/332 (47%), Positives = 207/332 (62%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL----DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             D N   +LP+S+TW     DDH+P   ++++ESVP+IDL DP A   I  AC TWG +QV
Sbjct  21    DLNSLQELPESYTWTHHSHDDHTP---AASNESVPVIDLNDPNASKLIHHACITWGAYQV  77

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NH +P+ LL  I+      F L   QK +A RSP    GYG  RIS FF   MWSEGFT
Sbjct  78    VNHAIPMSLLQDIQWVGETLFSLPCHQKQKAARSPDGADGYGLARISSFFPKLMWSEGFT  137

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPLEH RQ+WPQDY  +C +V+ Y   M+ L   L  LM   +      + W   G 
Sbjct  138   IVGSPLEHFRQLWPQDYHKYCDIVKRYDEAMKKLVGKLMWLMLDSLGITKEDLKW--AGS  195

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  + T A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +NI+GLQV+     W+ 
Sbjct  196   KGQFKKTCAALQLNSYPTCPDPDRAMGLAAHTDSTLLTILYQ-NNISGLQVHRKGGGWVT  254

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P    +V+N+GDL+ I+SNG++ SVLHR +V++   R+SVAY  GP  NVEI P  KL
Sbjct  255   VAPVPEGLVINVGDLLHILSNGLYPSVLHRVLVNRIQQRLSVAYLCGPPPNVEICPHAKL  314

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P + P+Y+ ++WN YL  K K+F KAL  +
Sbjct  315   VGPNKPPLYKAVTWNEYLGTKAKHFNKALSTV  346



>ref|NP_001275412.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
 gb|AAK91506.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
Length=355

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 213/333 (64%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDL-YDPQAV-DKIKMACETWGIF  385
             +D     +LP+SH W   LDD    N ++  ES+P+IDL +D + V D I  AC+TWG F
Sbjct  9     LDLYSIKELPESHAWKSSLDDDGSRNINA--ESIPVIDLNHDHKFVMDTIGHACKTWGAF  66

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             Q+ NH +   LL  +E    R F L  +QKL+A RS   +AGYG  RIS FFD  MWSEG
Sbjct  67    QIVNHNISHRLLNHMETHGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFDKLMWSEG  126

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPLEHARQ+WP DY+ FC V+E+Y+ +M  LA  L  LM   +      + W   
Sbjct  127   FTIFGSPLEHARQLWPYDYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKW---  183

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               VG +   + LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV+     W+
Sbjct  184   -AVGPRSGSSALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVFKEGNGWV  241

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+V+N+GDL+ I+SNG++ SVLHRAIV++  HR+SVAY +GP   V+I+P  K
Sbjct  242   TVLPLRGALVLNVGDLVHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSK  301

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+      MYRP++W+ YL  K K+F KAL  +
Sbjct  302   LVDQRNPQMYRPVTWSEYLGTKAKHFDKALSSV  334



>ref|XP_010497240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 212/332 (64%), Gaps = 9/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS++W   DD    +  +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ LL  +E      F L  ++KL+A RS   ++GYG  RI+ FF+ QMWSEGF
Sbjct  83    IANHGVPLSLLQDVEFLTGSLFGLPVQRKLKAARSDTGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE+Y+ +M+ LA  L  L    +      + W    
Sbjct  143   TITGSPLNDFRKLWPQHHLNYCDIVEEYEERMKKLASKLMWLALNSLGVSEEDVEWASLN  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI 
Sbjct  203   SADLSWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWIT  261

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SV + +GP  +++I+P  KL
Sbjct  262   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVDFLWGPQSDIKISPVPKL  321

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  322   VSPLESPLYRSVTWKKYLQTKATHFNKALSMI  353



>gb|KFK43811.1| hypothetical protein AALP_AA1G176200 [Arabis alpina]
Length=358

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 213/332 (64%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW   DD    +  +  +T E++PLIDL +P A  +I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYTWTPKDDLLFAAAPSPRATGENIPLIDLNNPDAASQIGHACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F L  ++KL+A RS   ++GYG  RI+ FF+ QMWSEGF
Sbjct  83    IANHGVPLELLEGIEFLTGSLFRLPVQRKLKAARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T++GSPL   R++WP+ + ++C +VE+Y+  M+ LA  L  L    +      I W R  
Sbjct  143   TISGSPLNDFRKLWPKLHLNYCDIVEEYEEHMQKLASKLMWLALNSLGVSEEDIKWARLN  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                  W QA LQ+N  P+CP P RAMG A HTD+SL+T+LYQ +N  GLQ++  ++ W+ 
Sbjct  203   -SDYNWAQAALQLNHYPVCPQPDRAMGLAAHTDSSLLTILYQ-NNTAGLQLFRDDIGWVT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  + +I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDTKISPVPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPFESPLYRSVTWTEYLRTKATHFNKALSMI  352



>emb|CDY36572.1| BnaA06g10250D [Brassica napus]
Length=359

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 216/338 (64%), Gaps = 11/338 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPV-----NSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW     P+     +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F+L  ++KL+A RS    +GYG  RIS FF+ QMWSEGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSETGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             T+ GSPL   R++WPQ + +++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLNNYCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKW-AS  201

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                 L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANPDLNWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P  +++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPDSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1210
             L+ P   P+YR ++W  YL  K  +F +AL MI  + D
Sbjct  321   LVSPVGSPLYRSVTWTEYLRTKATHFNEALSMIKNDID  358



>ref|XP_006416894.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
 gb|ESQ35247.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
Length=361

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 157/340 (46%), Positives = 216/340 (64%), Gaps = 10/340 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW   DD    +  +  +T E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYTWTLKDDLLFAAAPSPPATGENIPLIDLNHPDAANQIGCACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F L  ++KL+A RS   ++GYG  RIS FF+ QMWSEGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFRLPVQRKLKAARSETGVSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWP-QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             T+AGSPL   R++WP Q + ++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TIAGSPLNDFRKLWPKQLHLNYCDIVEEYEEQMQKLASKLMWLALNSLGVTEDDIKWASV  202

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                 L W Q+ LQ+N  P+CP P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI
Sbjct  203   DDSDLNWAQSALQLNHYPVCPQPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWI  261

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   ++VVN+GDL  I++NG+FKSVLHRA V++   R+SVA+ +GP  + +I+P  K
Sbjct  262   TVPPIPGSLVVNVGDLFHILTNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDTKISPVPK  321

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1216
             L+ P   P+YR ++W  YL  K  +F KAL MI  + + E
Sbjct  322   LVSPVGSPLYRSVTWTEYLRTKAVHFNKALSMIRNHKEEE  361



>ref|XP_009148952.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Brassica rapa]
Length=359

 Score =   306 bits (784),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 215/338 (64%), Gaps = 11/338 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPV-----NSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW     P+     +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F+L  ++KL+A RS    +GYG  RIS FF+ QMWSEGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSETGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             T+ GSPL   R++WPQ + +++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLNNYCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKW-AS  201

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                 L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANPDLNWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1210
             L+ P   P+YR ++W  YL  K  +F +AL MI  + D
Sbjct  321   LVSPVGSPLYRSVTWTEYLRTKATHFNEALSMIKNDID  358



>dbj|BAQ02990.1| gibberellin 3-oxidase [Rorippa aquatica]
Length=356

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 214/332 (64%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW   DD    +  +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTALRELPDSYTWTPKDDILFPAAPSPPAASETIPLIDLNQPDAANQIGRACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ LL  IE      F L  ++KL+A RS   ++GYG  RI+ FF+ QMWSEGF
Sbjct  83    IANHGVPLGLLEDIEFLTSSLFRLPVQRKLKAARSDTGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE+Y+ QMR LA  L  L+   +      + W R  
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEEYEEQMRKLASKLLWLVLNSLGVSEEDVKWARLN  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                  W QA LQ+N  P+CP P +AMG A HTD++L+T+LYQ +N  GLQV+  +L W+ 
Sbjct  203   SDS-NWAQAALQLNHYPVCPQPDQAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWVT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL+ I+SNG+FKSVLHRA V++   R SVA+ +GP  +++I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLLHILSNGLFKSVLHRARVNQTRSRFSVAFLWGPQSDIQISPIPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+Y+ ++W  YL IK  +F KAL MI
Sbjct  321   VGPFESPLYQSVTWTHYLQIKATHFNKALSMI  352



>sp|O24648.1|G3OX_PEA RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; AltName: Full=Gibberellin 3 beta-hydroxylase 
1 [Pisum sativum]
 gb|AAB65829.1| 2-oxoglutarate-dependent dioxygenase [Pisum sativum]
 gb|AAC49792.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 208/333 (62%), Gaps = 11/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSS----THESVPLIDLYDPQAVDKIKMACETWGIF  385
             DFN   +LP+S+ W  LDDH+ ++S++    +  +VP+IDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QV NHG+P+ LL  I+   +  F L   QK +A RSP  ++GYG  RIS FF   MW EG
Sbjct  81    QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPL+H R++WPQDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                  +   A LQ+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>ref|XP_009377503.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 215/338 (64%), Gaps = 11/338 (3%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTWLD-DHSPVNS--SSTHESVPLIDLYDPQAVDKIKMACE  370
              +  IIP+DFN   +LP+SH W D  H  +    S+    VP+IDL D +A   +  ACE
Sbjct  11    HLHHIIPIDFNSVQKLPESHVWHDISHESLFGVPSADPLPVPVIDLMDSEASSLMIQACE  70

Query  371   TWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  550
             TWGIFQV  HG+  +L+  +E +A + F L  +QKL+A+RSPG   GYG   IS FFD  
Sbjct  71    TWGIFQVIGHGL-TKLMEDVEFEAEKLFGLPVDQKLKALRSPGGATGYGRPHISPFFDRH  129

Query  551   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  721
             MW EGFT+ GSP++HA+Q+WPQDY  FC  ++DYQ QM+ LA+ L  + FK +    + +
Sbjct  130   MWQEGFTIMGSPIDHAKQLWPQDYQGFCDTIDDYQNQMKALAEKLIRIFFKSLNINFKEL  189

Query  722   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
              W      GL      LQ+N  P CPDPTRAMG A HTDTSLVT++ Q S  +GLQV+  
Sbjct  190   NW--LNDSGLSSPGTALQLNSYPPCPDPTRAMGMAAHTDTSLVTIV-QQSKTSGLQVFKD  246

Query  902   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1081
              + W+ V+P   A+ VNLGD + I+SNGM+ SVLHRA+V++   R S+AYF+ P ++  +
Sbjct  247   GVGWVLVQPVPGALTVNLGDYLHILSNGMYTSVLHRAVVNQQIQRFSMAYFYAPPRDFTV  306

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +P L  +   + P YR ++   Y+DIK K+F KAL +I
Sbjct  307   SPVLSRVM-GQMPKYRSLTVKEYVDIKGKHFEKALSLI  343



>gb|AAN87570.1| gibberellin 3-oxidase [Spinacia oleracea]
Length=382

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 218/360 (61%), Gaps = 29/360 (8%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTH--ESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +D    ++LPDS  W   +D   +++ S +  +SVP+I+L DPQA   + +AC +WG+FQ
Sbjct  20    LDLESLNELPDSFAWGSFEDPCSIDNPSGYGPDSVPVINLQDPQAQQLVGLACRSWGVFQ  79

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHG+   LL  IE   +  F L   QKL+A RS   + GYG   IS FF  +MWSEGF
Sbjct  80    VTNHGIQKSLLDDIEAAGKSLFALPVNQKLKAARSSCGVTGYGPAGISSFFPKRMWSEGF  139

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  748
             T+ GSPL+HARQ+WP +Y+ FC ++E YQ +M  LA+ L  L+             G +G
Sbjct  140   TILGSPLDHARQLWPNNYNKFCDIIEKYQKEMNQLAKKLMQLV------------VGSLG  187

Query  749   ------------LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  892
                         L+     +Q+N  PI PDP RAMG A HTD++L+T+L+Q SN TGLQV
Sbjct  188   ISNQDIMNWADLLEGANGAMQLNSYPIRPDPNRAMGLAAHTDSTLLTILHQ-SNTTGLQV  246

Query  893   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1072
             +     W+ V P S  +V+N+GDL+ I+SNG + SV HRA+V++  HR+SVAY +GP+  
Sbjct  247   FRERSGWVTVPPISGGLVINIGDLLHILSNGRYPSVYHRAMVNRVQHRLSVAYLYGPASG  306

Query  1073  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALASGSEAP  1252
             V + P  KLI  T  P+YRP++W+ YL IK ++  KAL +I  N +   S     G++ P
Sbjct  307   VRVQPLPKLIDATHPPLYRPVTWSEYLGIKSEHLTKALSLIRINHNTNPSLTGLIGNDEP  366



>ref|XP_002892873.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69132.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   305 bits (782),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 213/332 (64%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD---HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+ W   DD    +  +  +T E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYKWTPKDDLLFAAAPSPPTTGENIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ LL  IE      F L  ++KL+A RS   ++GYG  RI+ FF+ +MWSEGF
Sbjct  83    IANHGVPLGLLQDIEFLTGSLFRLPVQRKLKAARSETGVSGYGVARIASFFNKKMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE+Y+ QM+ LA  L  L  K +      + W    
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEEYEEQMKKLASKLMWLALKSLGVSEEDVEWASLN  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+L Q +N  GLQV+  +L W+ 
Sbjct  203   S-DLNWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILCQ-NNTAGLQVFRDDLGWVT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPVELPLYRSVTWTEYLRTKATHFNKALSMI  352



>gb|AAC96017.1| defective gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC96015.1| gibberellin 3B-hydroxylase [Pisum sativum]
Length=374

 Score =   306 bits (783),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 208/333 (62%), Gaps = 11/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSS----THESVPLIDLYDPQAVDKIKMACETWGIF  385
             DFN   +LP+S+ W  LDDH+ ++S++    +  +VP+IDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QV NHG+P+ LL  I+   +  F L   QK +A RSP  ++GYG  RIS FF   MW EG
Sbjct  81    QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPL+H R++WPQDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                  +   A LQ+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>dbj|BAG32267.1| gibberellin 3-oxidase [Allium fistulosum]
Length=365

 Score =   305 bits (782),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 159/343 (46%), Positives = 215/343 (63%), Gaps = 15/343 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHG  403
             D   A ++PDSHTW     P   +  +ES+P+IDL  P  +  I  ACE+WG+FQV +HG
Sbjct  23    DLGSAHEVPDSHTW-PTIQPNPPNGPNESIPVIDLSSPDVISLIGHACESWGVFQVISHG  81

Query  404   VPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGS  583
             V + LL  +E QARR F L  +QKL+A RSP S++GYG   IS  F   MWSEGFT++GS
Sbjct  82    VDLNLLHNLESQARRLFSLPTQQKLKAGRSPNSISGYGLAPISSLFSKLMWSEGFTISGS  141

Query  584   PLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQ  754
             PL+HAR +WP DY +FC V+E+Y  +M+ +A+ L  LM   +      I W    M  LQ
Sbjct  142   PLDHARSLWPDDYFNFCEVIEEYNKEMKRVAERLMQLMLLSLGLTEETIKW-AGPMNELQ  200

Query  755   WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-----LNWID  919
                + LQ+N  P CP+P RA+G A HTD+SL+T+LYQ SN +GLQV  PN       W+ 
Sbjct  201   DISSVLQLNSYPACPNPDRAIGLAAHTDSSLLTILYQ-SNTSGLQVLRPNKESSPTQWVT  259

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL  I+SNG F SV+HRA+V++  HR S AY  GP  +V+++P   +
Sbjct  260   VPPIPGALVVNVGDLCHILSNGRFHSVVHRAVVNRTEHRYSAAYICGPPAHVKVSP---I  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNA  1228
             +KP   P YRPI+W  YL IK + F KAL  +  + +    N+
Sbjct  317   VKPVG-PAYRPITWREYLGIKARLFDKALASVIISEEDHNDNS  358



>ref|NP_001233855.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34125.1| 3b-hydroxylase [Solanum lycopersicum]
Length=355

 Score =   305 bits (781),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 212/333 (64%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDL-YDPQAV-DKIKMACETWGIF  385
             +D     +LP+SH W   LDD    N ++  ES+P+IDL +D + V D I  AC+TWG F
Sbjct  9     LDLYSIKELPESHAWKSSLDDDGSRNINA--ESIPVIDLNHDHKFVMDTIGHACKTWGAF  66

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             Q+ NH +   LL  +E    R F L  +QKL+A RS   +AGYG  RIS FFD  MWSEG
Sbjct  67    QIVNHNISHRLLNHMETHGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFDKLMWSEG  126

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPLEHARQ+WP DY+ FC V+E+Y+ +M  LA  L  LM   +      + W   
Sbjct  127   FTIFGSPLEHARQLWPYDYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKW---  183

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               VG +   + LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV+     W+
Sbjct  184   -AVGPRSGSSALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVFKEGNGWV  241

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V     A+V+N+GDL+ I+SNG++ SVLHRAIV++  HR+SVAY +GP   V+I+P  K
Sbjct  242   TVPLLRGALVINVGDLLHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSK  301

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+      MYRP++W+ YL  K K+F KAL  +
Sbjct  302   LVDQRNPQMYRPVTWSEYLGTKAKHFDKALSSV  334



>gb|AAC86820.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
 gb|AAC49793.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 207/333 (62%), Gaps = 11/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSS----THESVPLIDLYDPQAVDKIKMACETWGIF  385
             DFN   +LP+S+ W  LDDH+ ++S++    +  +VP+IDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QV NHG+P+ LL  I+   +  F L   QK +A RSP  ++GYG  RIS FF   MW EG
Sbjct  81    QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPL+H R++WPQDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                  +   A LQ+N  P CPDP  AMG   HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLTPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>dbj|BAJ65442.1| gibberellin 3-oxidase [Torenia fournieri]
 dbj|BAJ76663.1| gibberellin 3-oxidase [Torenia fournieri]
Length=382

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/356 (44%), Positives = 217/356 (61%), Gaps = 11/356 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             +D +   +LP++H W         +   E+VP+IDL D  A++ I  AC TWG+FQV NH
Sbjct  28    LDLSSVKELPETHAWTSSKLDDEETCDAENVPIIDLNDENAIELIGRACRTWGVFQVINH  87

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
              +P  LL +IE + ++ F L  +QKLRA RSP  ++GYG  RIS FF   MWSEGFT+ G
Sbjct  88    NIPKSLLDEIEFEGKKLFSLPMQQKLRAARSPDGVSGYGVARISSFFSKLMWSEGFTILG  147

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RCGMVG  748
             S  EHAR +WP DY+ FC  +E+YQ  M+ LA  L  LM   +       + W       
Sbjct  148   SVSEHARLLWPNDYNKFCDTIEEYQKAMKRLAGRLMWLMLGSLGITEDDDLKWAAQKEPD  207

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWIDVE  925
              Q   A LQ+N  P CPDP RAMG A HTD++++T+L+Q SN +GLQV       W+ V 
Sbjct  208   DQGGSAALQLNSYPSCPDPDRAMGLAAHTDSTILTILHQ-SNTSGLQVAREGRAGWVTVP  266

Query  926   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1105
             P + A+VV++GDL+ I+SNG++ SV+HRA+V++  HR+SVAY +GP  +V+I+P  KL+ 
Sbjct  267   PLAGALVVHVGDLLHILSNGLYPSVVHRAVVNRTRHRLSVAYLYGPPSSVKISPLRKLVD  326

Query  1106  PTEFPMYRPISWNAYLDIKYKYFGKALEMIGF-----NSDVEKSNALASGSEAPVG  1258
                 P+YRPI+W+ YL  K K+F KAL  +       N  V+ SN   S +   VG
Sbjct  327   KYHPPLYRPITWSEYLGTKAKHFDKALTSVRLLCAPRNGFVDTSNDHTSSTVQLVG  382



>gb|AAC49794.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 207/333 (62%), Gaps = 11/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSS----THESVPLIDLYDPQAVDKIKMACETWGIF  385
             DFN   +LP+S+ W  LDDH+ ++S++    +  +VP+IDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QV NHG+P  LL  I+   +  F L   QK +A RSP  ++GYG  RIS FF   MW EG
Sbjct  81    QVMNHGIPFSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSPL+H R++WPQDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                  +   A LQ+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>gb|ABO70984.1| gibberellin 3-oxidase 2 [Nicotiana tabacum]
Length=360

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 209/329 (64%), Gaps = 13/329 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQ-AVDKIKMACETWGIFQ  388
             +D     +LP+SH W   LD     N S   ES+P+IDL D + A++ I  AC+TWG FQ
Sbjct  14    LDLYTIKELPESHAWRSSLDHDYQCNDSL--ESIPVIDLNDEKFAIENIGHACKTWGAFQ  71

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NH +   LL  +E   +R F L  +QKL+A RS   +AGYG  RIS FF   MWSEGF
Sbjct  72    IINHNISQRLLDNMEEAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGF  131

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSP +HARQ+WP DY  FC V+E+Y+ +M  LA  L  LM   +      + W  CG
Sbjct  132   TIVGSPFDHARQLWPHDYKKFCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCG  191

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
               G     + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+ 
Sbjct  192   PRG---ECSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWVT  247

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P S A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I+P  KL
Sbjct  248   VPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKL  307

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKAL  1186
             +     P+YR ++W+ YL  K K+F KAL
Sbjct  308   VDQGHPPLYRSVTWSEYLGTKAKHFDKAL  336



>ref|XP_009588350.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   304 bits (779),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 205/335 (61%), Gaps = 11/335 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS-PVNSSSTHESVPLIDL------YDPQAVDKIKMACETWG  379
             +D N   +LP+SH W   +  P  +S   ES+P+IDL       +   ++ I  AC+ WG
Sbjct  17    LDLNSIKELPESHAWTSSNDYPSENSCNFESIPVIDLDNYINNNNINVLEHIGQACKKWG  76

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
              FQ+ NH +   LL  IE   +  F L   QKL+A RSP  + GYG  RIS FF   MWS
Sbjct  77    AFQIINHNISERLLQDIELAGKSLFSLPMHQKLKAARSPEGVTGYGVARISSFFSKLMWS  136

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSPLEHARQ+WP DY  FC V+E+Y+ +M  LA  L  LM   +      + W 
Sbjct  137   EGFTIVGSPLEHARQIWPHDYQKFCDVIEEYEREMEKLAGRLMWLMLGSLGITKEEVKWA  196

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              C     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     
Sbjct  197   VCPKGESKGGSAALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGSG  255

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+++P 
Sbjct  256   WVTVPPFPGALVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPL  315

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+     P+YR ++W+ YL  K K+F KAL  +
Sbjct  316   AKLVDQRHPPLYRAVTWSEYLGTKAKHFDKALSSV  350



>ref|XP_011081703.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like, partial [Sesamum 
indicum]
Length=369

 Score =   304 bits (779),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 146/347 (42%), Positives = 218/347 (63%), Gaps = 33/347 (10%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSS-----STHESVPLIDLYDPQAVDKIKMACETWGIF  385
             +D +  + LPDSH W  + +  +SS     S  ES+P+I+L D  A++ I++AC TWG+F
Sbjct  22    VDLSSVEILPDSHAWTSEANKYSSSCGGDISRLESIPIINLKDENAMELIRLACTTWGVF  81

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             Q+ NH VP  L+ ++E    + F L  ++KL A R+P  ++GYG  RIS FF   MWSEG
Sbjct  82    QIVNHNVPKNLVDEVELAGEKLFSLPMDRKLMAERTPNGVSGYGMARISSFFSKSMWSEG  141

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  745
             FT+ GSPLEHA ++WP DY +FC+ +E+YQ +M++LA  L  L+             G +
Sbjct  142   FTIVGSPLEHAAKLWPHDYHNFCNTIEEYQKEMKNLASRLMGLIL------------GSL  189

Query  746   G-----LQWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  883
             G     ++W +         A LQ+N  P CPDP +AMG A HTD++++ +L+Q SN +G
Sbjct  190   GVTEDDVKWVEPKGELKERGAALQLNSYPPCPDPDKAMGMAAHTDSTILNILHQ-SNTSG  248

Query  884   LQVY-GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFG  1060
             LQV+ G  + W+ ++P+  A++V +GDLM I+SNG + + LHRA+V++  HR+SV Y  G
Sbjct  249   LQVFRGDGIGWVTLQPHPGALIVVIGDLMHILSNGSYLNALHRAVVNQTQHRLSVVYLHG  308

Query  1061  PSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGF  1201
             P  +V++ P  +L+     P+YRPI+WN YL IK +YF KAL  I  
Sbjct  309   PPSSVKMGPLPQLVDSNHPPLYRPITWNEYLGIKAQYFDKALTTISL  355



>dbj|BAD30035.1| gibberellin 3beta-hydroxylase1 [Daucus carota]
Length=344

 Score =   303 bits (776),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 213/331 (64%), Gaps = 14/331 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             +D N   +LP+SHTW  L D      S+  ES+P+IDL DP  +  ++ ACETWG+ QV 
Sbjct  12    LDLNSIKELPESHTWTSLQDDCTDCLSNESESLPIIDLNDPDVLALVRHACETWGVLQVK  71

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLR-AVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             NHGV + LL  +E    + F L  EQKL+ ++ S   ++GY   +IS FF   MW EGFT
Sbjct  72    NHGVSLRLLEDMEAATTKLFSLPIEQKLKVSLSSSNDISGYRLPKISPFFPKFMWREGFT  131

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSP+EHA ++WPQDY  FC +VE+Y  +M++LA+ L  LM K +      I W   G 
Sbjct  132   IFGSPVEHAVKLWPQDYKPFCDLVEEYGKEMKNLAERLMWLMLKSLGITEEDINWSSLG-  190

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
                    A +Q+N  P+CPDP RAMG A+HTD+SL+T+LYQ +N TGLQ++     W+ V
Sbjct  191   ------GAAIQLNSYPVCPDPDRAMGLAEHTDSSLLTILYQ-NNTTGLQIFREGTGWLTV  243

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
             +P++  +VVN+GDLM I+SNG++ SVLHRA+V++   RISVAY + P  NV I+P  KL+
Sbjct  244   QPHTGVLVVNIGDLMHILSNGLYPSVLHRALVNRKQQRISVAYIYRPPANVLISPLPKLV  303

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                   ++RPI+W  YL++K K+F   L +I
Sbjct  304   DHYHLCLFRPITWTEYLELKSKHFTNTLSLI  334



>ref|XP_009788819.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
Length=360

 Score =   303 bits (777),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 209/326 (64%), Gaps = 7/326 (2%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQ-AVDKIKMACETWGIFQ  388
             +D     +LP+SH W   LD     N S   ES+P+IDL D + A++ I  AC+TWG FQ
Sbjct  14    LDLYTIKELPESHAWRSSLDHDYQCNDSL--ESIPVIDLNDEKFAIENIGHACKTWGAFQ  71

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NH +   LL  +E   +R F L  +QKL+A RS   +AGYG  RIS FF   MWSEGF
Sbjct  72    IINHNISQRLLDNMEEAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGF  131

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  748
             T+ GSP +HARQ+WP DY  FC V+E+Y+ +M  LA  L  LM   +       +  +VG
Sbjct  132   TIVGSPFDHARQLWPHDYKKFCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWAVVG  191

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+ V P
Sbjct  192   PRGGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWVTVPP  250

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
              S A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I+P  KL+  
Sbjct  251   LSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQ  310

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKAL  1186
                P+YR ++W+ YL  K K+F KAL
Sbjct  311   GHPPLYRSVTWSEYLGTKAKHFDKAL  336



>ref|XP_006382066.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|ERP59863.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=342

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 209/332 (63%), Gaps = 13/332 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE---SVPLIDLYDPQAVDKIKMACETWGI  382
             IIP+DF+    LPDSH W     P + +S  E   S+P +DL DP A   I  ACE WG 
Sbjct  18    IIPLDFDSVRTLPDSHVW----QPTSHASESEDRLSIPTVDLKDPDAGKLIGHACEAWGA  73

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQVTNH +P++L  ++E +ARR F L   QKL+A+RSPG   GYG  RIS FF+  MW E
Sbjct  74    FQVTNHDIPLDLFHEVESEARRLFSLPTGQKLKALRSPGGATGYGLARISPFFNKYMWHE  133

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCG  739
             GFT+ GS ++HAR +WP DY  FC V+EDYQ +M++LA  L  L+ K + I      R  
Sbjct  134   GFTIMGSSIDHARDLWPNDYQRFCDVMEDYQKKMKELAVTLMHLVLKSLDISEEEISRVV  193

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
               G   T   LQ+N  P+CPDP RAMG A HTDTSL+T+L+Q S + GLQ++   + W+ 
Sbjct  194   SAGGDSTA--LQLNSYPLCPDPNRAMGLAPHTDTSLLTILHQ-STVNGLQIFKEGVGWVL  250

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P + ++VVN+GDL+ I+SN  F+SVLHR ++ +   R+S+AYF+    +  I+P    
Sbjct  251   VSPTNGSLVVNVGDLLHILSNAQFRSVLHRVVMKENQQRLSLAYFYCLPSDFHISP--LA  308

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +  T+ P+YR +S   Y+ IK K   KAL +I
Sbjct  309   LNSTQMPLYRSVSVRDYIGIKAKNLEKALSLI  340



>dbj|BAA89316.1| gibberellin 3beta-hydroxylase [Nicotiana tabacum]
Length=371

 Score =   304 bits (778),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 206/335 (61%), Gaps = 11/335 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS-PVNSSSTHESVPLIDL------YDPQAVDKIKMACETWG  379
             +D N   +LP+SH W   +  P  +S   ES+P+IDL       +   ++ I  AC+ WG
Sbjct  17    LDLNSIKELPESHAWTSSNDYPSENSCNFESIPVIDLDNYINNNNINVLEHIGQACKKWG  76

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
              FQ+ NH +   LL  IE   +  F L  +QKL+A RSP  + GYG  RIS FF   MWS
Sbjct  77    AFQIINHNISERLLQDIELAGKSLFSLPMQQKLKAARSPEGVTGYGVARISSFFSKLMWS  136

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSPLEHARQ+WP DY  FC V+E+Y+ +M  LA  L  LM   +      + W 
Sbjct  137   EGFTIVGSPLEHARQIWPHDYQKFCDVIEEYEREMEKLAGRLMWLMLGSLGITKEEVKWA  196

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              C     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     
Sbjct  197   VCPKGESKGGSAALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGSG  255

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+++P 
Sbjct  256   WVTVPPFPGALVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPL  315

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+     P+YR ++W+ YL  K ++F KAL  +
Sbjct  316   AKLVDQRHPPLYRAVTWSEYLGTKARHFDKALSSV  350



>ref|NP_173008.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
 sp|Q39103.2|G3OX1_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; Short=AtGA3ox1; AltName: Full=Gibberellin 3 
beta-hydroxylase 1 [Arabidopsis thaliana]
 gb|AAF71980.1|AC013453_5 GA4 protein [Arabidopsis thaliana]
 gb|AAC37506.1| GA4 [Arabidopsis thaliana]
 gb|AAO64762.1| At1g15550 [Arabidopsis thaliana]
 dbj|BAE99582.1| Gibberillin 3 beta-hydroxylase [Arabidopsis thaliana]
 gb|AEE29335.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
Length=358

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 212/332 (64%), Gaps = 10/332 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNSSS-----THESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+ W      + S++     T E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYKWTPKDDLLFSAAPSPPATGENIPLIDLDHPDATNQIGHACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             ++NHGVP+ LL  IE      F L  ++KL++ RS   ++GYG  RI+ FF+ QMWSEGF
Sbjct  83    ISNHGVPLGLLQDIEFLTGSLFGLPVQRKLKSARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL   R++WPQ + ++C +VE+Y+  M+ LA  L  L    +      I W    
Sbjct  143   TITGSPLNDFRKLWPQHHLNYCDIVEEYEEHMKKLASKLMWLALNSLGVSEEDIEWASLS  202

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L W+ 
Sbjct  203   S-DLNWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWVT  260

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  261   VPPFPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVPKL  320

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P E P+Y+ ++W  YL  K  +F KAL MI
Sbjct  321   VSPVESPLYQSVTWKEYLRTKATHFNKALSMI  352



>dbj|BAM73280.1| gibberellin 3 oxidase 1 [Raphanus sativus]
Length=359

 Score =   303 bits (776),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 211/333 (63%), Gaps = 11/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPV-----NSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW     P+     +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F+L  ++KL+A RS    +GYG  RIS FF+ QMWSEGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSDTGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             T+ GSPL   R++WPQ +  ++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLKNYCDIVEEYEEQMQTLASKLMWLSLTSLGVSEEDIKW-AT  201

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                 L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANPDLNWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRFSVAFLWGPQSDIKISPVPK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+   E P+YR ++W  YL  K  +F +AL MI
Sbjct  321   LVSLVESPLYRSVTWTEYLRTKATHFNEALSMI  353



>emb|CDP18939.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   303 bits (777),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 207/333 (62%), Gaps = 10/333 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL----DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +D ++  +LPDSH W      D  P       E+VP++DL D  A D +  AC TWG+FQ
Sbjct  21    LDLSRVKKLPDSHAWTTAPPKDDYPRGELLNVETVPVVDLADKNAQDLLGHACRTWGVFQ  80

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             V NHG+   LL +IE   +  F L   QKL+A RSP  ++GYG  RIS FF   MWSEGF
Sbjct  81    VKNHGISKNLLDEIESAGKGLFSLPMHQKLKAARSPEGVSGYGVARISSFFPKLMWSEGF  140

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCG  739
             T+ GSPLEHARQ+WP DY  FC+V+++Y+ +M+ LA  L  L+   +      + W    
Sbjct  141   TIVGSPLEHARQLWPHDYHKFCNVMKEYEKEMKKLAGKLMWLILGSLGVTEEEVKW-ASP  199

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY-GPNLNWI  916
                 +   A +Q+N  P CP+P RAMG A HTD++++T+L+Q +N +GLQV       W+
Sbjct  200   KGAFEGGNAAIQLNSYPACPEPDRAMGLAAHTDSTILTILHQ-NNTSGLQVLRDGGAGWV  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR SVAY +GP   V I+P  K
Sbjct  259   TVPPLPGALVVNIGDLLHILSNGLYPSVLHRAVVNRTRHRFSVAYLYGPPSGVTISPLQK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+     P+YRP++W  YL  K K+F KAL ++
Sbjct  319   LVDQGRPPLYRPVTWTEYLGTKAKHFDKALSLV  351



>emb|CDY39663.1| BnaC05g11920D [Brassica napus]
Length=359

 Score =   303 bits (776),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 211/333 (63%), Gaps = 11/333 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPV-----NSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DF    +LPDS+TW     P+     +  +  E++PLIDL  P A ++I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP+ELL  IE      F+L   +KL+A RS    +GYG  RIS FF+ QMWSEGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVHRKLKAARSETGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             T+ GSPL   R++WPQ + +++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLNNYCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKW-AS  201

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                   W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANSDSDWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ P   P+YR ++W  YL  K  +F +AL MI
Sbjct  321   LVSPVGSPLYRSVTWTEYLRTKATHFNEALSMI  353



>ref|XP_008347459.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score =   302 bits (774),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/337 (45%), Positives = 212/337 (63%), Gaps = 13/337 (4%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             P DF+   +LP S+ W   L+++    S S  ESVP+IDL DP  V+ +  AC+TWG+FQ
Sbjct  22    PDDFSSLXELPKSYAWTSQLNEYPSFESLSCSESVPVIDLTDPNVVELVGHACKTWGMFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
               NHGVP +L+  +E   R  F L P+QKL+A R P   +GYG  RIS F +  MWSE F
Sbjct  82    AXNHGVPQKLVDDMESTVRSLFSLPPQQKLKAARLPDGFSGYGFHRISAFCEKLMWSESF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T  GSPLEH RQ+WPQDY+ FC + E+Y+ +M  LA  L  LM   +      I W   G
Sbjct  142   TTVGSPLEHFRQLWPQDYTKFCCIAEEYEREMIRLAAXLMWLMLGSLGISKEDIKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY----GPN  904
               G  +   A LQ N  P CPDP R +G AQHTD+SL+++++Q+SN +GLQV+       
Sbjct  200   PRGEFEDASAVLQFNSYPACPDPDRTIGLAQHTDSSLISIVHQSSNASGLQVFRQGEEEG  259

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P   A V+N+GD M ++SNG++++V HRA+V+++ HR+SVA  +GP +N +++
Sbjct  260   RGWLMVPPVPGAFVINVGDFMHMLSNGLYQNVFHRAVVNRSQHRVSVACLYGPPENAQVS  319

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P  KL+ P+  P+Y P++WN YL  K K   KALE +
Sbjct  320   PLSKLLGPSCPPLYPPLTWNEYLGTKAKLHNKALESL  356



>gb|AAM12872.1|AF494089_1 gibberellin 3-oxidase 1 [Nicotiana sylvestris]
Length=360

 Score =   302 bits (773),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 209/329 (64%), Gaps = 13/329 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQ-AVDKIKMACETWGIFQ  388
             +D     +LP+SH W   LD     N S   ES+P+IDL D + A++ I  AC+TWG FQ
Sbjct  14    LDLYTIKELPESHAWRSSLDHDYQCNDSL--ESIPVIDLNDEKFAIENIGHACKTWGAFQ  71

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NH +   LL  +E   +R F L  +QKL+A RS   +AGYG  RIS FF   MWSEGF
Sbjct  72    IINHNISQRLLDNMEEAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGF  131

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSP +HARQ+WP DY  FC V+E+Y+ +M  LA  L  LM   +      + W  CG
Sbjct  132   TIVGSPFDHARQLWPHDYKKFCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCG  191

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                 +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+ 
Sbjct  192   P---RXECSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWVT  247

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P S A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I+P  KL
Sbjct  248   VPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKL  307

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKAL  1186
             +     P+YR ++W+ YL  K K+F KAL
Sbjct  308   VDQGHPPLYRSVTWSEYLGTKAKHFDKAL  336



>ref|XP_007013765.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
 gb|EOY31384.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
Length=342

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/335 (45%), Positives = 208/335 (62%), Gaps = 19/335 (6%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             I+P+DF+    +PDSH W   DD S    S    S+P+IDL DP AV     ACETWG F
Sbjct  18    IVPLDFHSVRTVPDSHVWPKSDDFS----SDDQLSIPIIDLKDPLAVKLAGHACETWGAF  73

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QV NHG+P  L+ ++E +ARR F L  +QK++A+R P    GYG  RIS FF   MW EG
Sbjct  74    QVINHGIPSNLVEEVESEARRLFSLPAQQKMKALREPAGATGYGLARISPFFPKYMWHEG  133

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  745
             FTV GSP++HAR +WP D + FC V+E YQ +M+ LA+ L  L+ + +          + 
Sbjct  134   FTVMGSPVDHARALWPNDNARFCDVIERYQKKMKVLAEQLTHLILESL-------DVSLE  186

Query  746   GLQWT----QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
              L W        LQ+N  P CPDP R MG A HTDTS +TLL+Q+S I+GLQ++   + W
Sbjct  187   DLSWDVGSPSTALQLNSYPSCPDPNRTMGLAPHTDTSFLTLLHQSS-ISGLQIFKEGVGW  245

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSK-AHHRISVAYFFGPSKNVEIAPS  1090
             + V P + A+VVN+GDL+ I+SN  F SVLHRA+V++   HR+SVAYF+G   +  ++P 
Sbjct  246   LSVRPIAGALVVNVGDLLHILSNARFPSVLHRAVVNRDGCHRLSVAYFYGIPTDCNVSPL  305

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+     P YR ++   Y+ +K K F +AL +I
Sbjct  306   AKLLNSGHTPRYRSVTVKEYVILKAKNFEEALSLI  340



>dbj|BAA37130.1| gibberellin 3beta-hydroxylase [Lactuca sativa]
Length=362

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 214/340 (63%), Gaps = 31/340 (9%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +D N   +LP+S+ W  +D+ P  SSS  E VP+I+L D  A+  +  AC+TWG+FQVTN
Sbjct  14    LDLNSIKELPESYAWSSEDNCP--SSSNSEPVPVINLKDSNAMKHVGYACKTWGVFQVTN  71

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             H +P+ LL  +E   R+ F L  +QKL+A RS   ++GYG  RIS FF   MWSEGFT+ 
Sbjct  72    HDIPITLLNNMEASGRKLFSLPFQQKLKAARSLDGVSGYGVARISSFFPKLMWSEGFTLI  131

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG---  748
              SP +HA+++WPQ   +FC V+E+Y  +M  L+              + W   G +G   
Sbjct  132   DSPHQHAQKLWPQGSGNFCDVIEEYNKEMNKLSNR------------VMWLILGSLGIKK  179

Query  749   --LQWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
               ++W           A LQ+N  P CPDP RAMG A HTD++L+T+L+Q SN +GLQV 
Sbjct  180   GDIKWANQEGEIKEACAALQLNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-SNTSGLQVQ  238

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                + W+ V+P + A+VVN+GDL+QI+SNG++ SVLHRA+V++  HR+SVAY +GP  NV
Sbjct  239   -RGVGWVTVKPIAGALVVNIGDLIQILSNGLYSSVLHRAMVNRTQHRLSVAYLYGPPSNV  297

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              IAP  KL      P+YRP++W+ YL  K K+F KAL  +
Sbjct  298   RIAPLSKLTDNVHPPLYRPVTWSEYLGTKAKHFNKALLFV  337



>ref|XP_009596383.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=363

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 214/333 (64%), Gaps = 11/333 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD--DHSPVNSSSTHESVPLIDLYDPQ-AVDKIKMACETWGIFQV  391
             +D     +LP+SH W    DH    S+ + ES+P+IDL D + A++KI  AC+TWG FQ+
Sbjct  13    LDLYTIKELPESHAWRSSLDHD-YQSNDSLESIPVIDLNDNKFAMEKIGHACKTWGAFQI  71

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NH +   LL  +E   +R F L  +QKL+A RS   +AGYG  RIS FF   MWSEGFT
Sbjct  72    INHNISQSLLDNMEGAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGFT  131

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPL+HARQ+WP DY  FC ++E+Y+ +M  LA  L  LM   +      + W   G 
Sbjct  132   IVGSPLDHARQLWPHDYKKFCEIIEEYEKEMEKLAGRLMWLMLGSLGINKDDVKW-AVGP  190

Query  743   VGLQWTQ--AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
              G++     + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+
Sbjct  191   RGVESKGGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWV  249

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP   V+I+P  K
Sbjct  250   AVPPLPGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSMAYLYGPPSWVKISPLSK  309

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  310   LVDQGHPPMYRPVTWSEYLGTKAKHFDKALSSV  342



>ref|XP_008356836.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 218/341 (64%), Gaps = 13/341 (4%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             P DF+   +LP+S+ W   L+++    S S  ESVP+IDL DP  V+ +  AC+TWG+FQ
Sbjct  22    PDDFSSLQELPESYAWTSQLNEYPSFESLSCSESVPVIDLADPNVVELVGHACKTWGMFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
              TNHGVP +L+  +E   R  F L P+QKL+A R P  ++GYG  RIS F +  MWSE F
Sbjct  82    ATNHGVPQKLVDDMESTVRSLFSLPPQQKLKAARLPDGISGYGFHRISAFCEKLMWSESF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCG  739
             T+ GS L+H  Q+WPQD++ FC V E+Y+ +M+ LA  L  LM   +      I W   G
Sbjct  142   TIVGSXLQHFCQLWPQDHTKFCCVTEEYEKEMKRLAARLMWLMLGSLXISKEDIKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN--  910
               G  +   A LQ+N  P CPDP R MG AQHTD++L+++++Q++  +GLQV+    +  
Sbjct  200   PRGEFEDASAALQLNSYPACPDPDRTMGLAQHTDSNLLSIIHQSAKASGLQVFQEGKDEG  259

Query  911   --WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P   A V+N+GD + I+SNG++++ LHRA+V+++ HR+SVAY +GP +N +++
Sbjct  260   RGWLMVPPVPGAFVINVGDFIHILSNGLYQTPLHRAVVNRSQHRVSVAYLYGPPENAQVS  319

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1207
             P  KL+ P   P+Y P++WN YL  K K   KAL+ +  N+
Sbjct  320   PLSKLLGPXCPPLYAPVTWNEYLGTKAKLNNKALQSLRLNA  360



>ref|XP_010925284.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=362

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 214/337 (64%), Gaps = 24/337 (7%)
 Frame = +2

Query  227   FNKADQLPDSHTWLDDHS-PVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHG  403
             F    ++PDSH W D H  P    S  +SVP++DL  P A+  +  AC+ +G+FQ+T+HG
Sbjct  24    FESIRKVPDSHAWPDLHDHPSVEPSGPDSVPVVDLASPDALLLVGRACQDFGVFQITSHG  83

Query  404   VPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGS  583
             +P +LL ++E Q RR F L   QKL+A RSPGS++GYG V IS FF   MWSEGFT+AGS
Sbjct  84    IPTDLLDRLESQIRRLFSLPTHQKLKAARSPGSISGYGLVPISSFFPKLMWSEGFTIAGS  143

Query  584   PLEHARQVWP-QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV--GLQ  754
             PLEHAR++WP + Y++FC+V+E+Y   M+ LA  L  LM             G+    + 
Sbjct  144   PLEHARKLWPNESYAEFCNVIEEYSKVMKKLAGRLMHLMLL---------SLGLTEEDIS  194

Query  755   WT---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-  904
             W             +Q+N  P CP+P RA+G A HTD+SL+T+LYQ S  +GLQV  P+ 
Sbjct  195   WAGPTKDSGDLSTVMQLNSYPACPEPDRAVGLAAHTDSSLLTVLYQ-SRTSGLQVLRPDP  253

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P    ++V++GDL  I+SNG F+SVLHRA+V++ HHR+S AY  GP  +V+++
Sbjct  254   PRWVTVPPLPGVLIVHVGDLSHILSNGRFRSVLHRAVVNRTHHRLSAAYICGPPAHVKVS  313

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P  KL+ P++ P YR ++W  YL +K K F +AL  I
Sbjct  314   PVKKLLGPSQGPAYRAVTWPEYLALKGKLFNEALASI  350



>ref|XP_009771250.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
 gb|AAM12873.1|AF494090_1 gibberellin 3-oxidase 2 [Nicotiana sylvestris]
Length=370

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 204/334 (61%), Gaps = 10/334 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS-PVNSSSTHESVPLIDLYDPQ-----AVDKIKMACETWGI  382
             +D N   +LP+SH W   +  P  +S   ES+P+IDL +        ++ I  AC+ WG 
Sbjct  17    LDLNSIKELPESHAWTSSNDYPSENSCNFESIPVIDLNNNNHNNINVLEHIGQACKKWGA  76

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQ+ NH +   LL  IE   +  F L  +QKL+A RSP  + GYG  RIS FF   MWSE
Sbjct  77    FQIINHNISERLLQDIELAGKNLFSLPMQQKLKAARSPDGVTGYGVARISSFFSKLMWSE  136

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSPLEHARQ+WPQDY  FC  +E+Y+ +M  LA  L  LM   +      + W  
Sbjct  137   GFTIVGSPLEHARQIWPQDYKKFCDAIEEYEREMEKLAGRLMWLMLGSLGITKEDVNWAV  196

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
                   +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W
Sbjct  197   GPKGESKGGSAALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGSGW  255

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
             + V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  HR+SVAY +GP   V+I+P  
Sbjct  256   VTVPPFLGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLA  315

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             KL+     P+YR I+W+ YL  K K+F KAL  +
Sbjct  316   KLVDQRHPPLYRAITWSEYLGTKAKHFDKALSSV  349



>ref|XP_002284981.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI36204.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/332 (47%), Positives = 210/332 (63%), Gaps = 11/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             +D N   +LPDSH W  L +H P   S   ESVP+IDL DP A+  +  AC++WG+FQV 
Sbjct  21    LDLNSIQELPDSHAWASLGEH-PCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVI  79

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
             NHG+P+ LL  IE  +R  F L  EQKL+A R P   +G+G  RI+ FF  QMW EGFTV
Sbjct  80    NHGIPISLLEAIEDASRNLFALPAEQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTV  139

Query  575   AGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  742
              GSPLE   ++WP++Y + FC V E+Y  QM+ LA  L  L+   +      + W   G 
Sbjct  140   LGSPLELVSKLWPEEYCTKFCEVTEEYDKQMKQLANKLLWLLLGSLGINKEDVEW--AGP  197

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G L+   A LQ+N  P CP P +AMG A+HTD+SL+T+LYQ S  +GLQV      WI 
Sbjct  198   EGQLEGAHAALQLNSYPACPQPDKAMGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWIT  256

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL+ I+SN  F SVLHRA+V+ +  RISVAYF+GP   + +AP  KL
Sbjct  257   VPPLPGALVVNIGDLLHILSNAAFPSVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKL  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +  +  P+YR ++W+ +L  K K+F KAL ++
Sbjct  317   VDSSHPPVYRSVTWSEFLATKAKHFNKALSLV  348



>ref|XP_008346007.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=360

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/331 (46%), Positives = 212/331 (64%), Gaps = 14/331 (4%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +P DFN   +LPDS+ W  L++H  ++S    +SVP++DL DP A+  +  AC+TWG+FQ
Sbjct  26    VPDDFNSLHELPDSYAWTTLNEHPSLDS----DSVPVVDLNDPNALQLLGHACKTWGVFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             +TNHG+P  L+  +E  AR  F L  +QKL+  RSPG ++GYG   I+ F+D Q WSE F
Sbjct  82    LTNHGIPQTLVHDMESAARSLFSLPAQQKLKVARSPGQISGYGFHLIAAFWDKQQWSECF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPLEH  Q+WPQDY+ FC + E+++ +++ LA  L  LM   +      + W   G
Sbjct  142   TIVGSPLEHYEQLWPQDYTKFCCITEEFEKEIKKLASRLMWLMLASLGISKDDVEW--DG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  Q   A  Q N  P CPDP R +G   HTD+SLV++++Q SNI GLQV+     W 
Sbjct  200   PKGDDQNASAVFQFNSYPSCPDPDRTLGLVPHTDSSLVSIVHQ-SNIDGLQVFREGTGWF  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              ++P   A+VVN+GDLM I+SNG++ SVLHR +V +A HRIS+ Y +GP   V+IAP  K
Sbjct  259   TIQPVPGALVVNVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPPAAVKIAPLEK  318

Query  1097  LIKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1186
             L  P+  P+Y P++ WN Y+  K K  GKAL
Sbjct  319   LFGPSHPPLYPPVTNWNEYISTKAKLKGKAL  349



>emb|CAC83089.1| gibberellin 3-oxidase [Cucurbita maxima]
Length=377

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 152/348 (44%), Positives = 206/348 (59%), Gaps = 36/348 (10%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTH---------ESVPLIDLYDPQAVDKIKMACET  373
             +DF+   +LPDS+ W+   S  + +  H         +SVPLIDL  P A   I  A  +
Sbjct  22    LDFDSLHELPDSYAWIQPDSFPSPTHKHHNSILDSDSDSVPLIDLSLPNAAALIGNAFRS  81

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG FQV NHGVP+ LL  IE  A   F L P  KL+A R+P  ++GYG VRIS FF  +M
Sbjct  82    WGAFQVINHGVPISLLQSIESSADTLFSLPPSHKLKAARTPDGISGYGLVRISSFFPKRM  141

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             WSEGFT+ GSPL+H RQ+WP DY   C +VE+Y  +MR L   L             W  
Sbjct  142   WSEGFTIVGSPLDHFRQLWPHDYHKHCEIVEEYDREMRSLCGRL------------MWLG  189

Query  734   CGMVG-----LQW---------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTS  871
              G +G     ++W         + A  Q N  P+CPDP RAMG   HTDTSL+T++YQ S
Sbjct  190   LGELGITRDDMKWAGPDGDFKTSPAATQFNSYPVCPDPDRAMGLGPHTDTSLLTIVYQ-S  248

Query  872   NITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAY  1051
             N  GLQV      W+ VEP +  +VV +GDL+ I++NG++ S LH+A+V++   R+SVAY
Sbjct  249   NTRGLQVLREGKRWVTVEPVAGGLVVQVGDLLHILTNGLYPSALHQAVVNRTRKRLSVAY  308

Query  1052  FFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              FGP ++ EI+P  KL+ PT+ P+YRP++W  YL  K ++F  AL  +
Sbjct  309   VFGPPESAEISPLKKLLGPTQPPLYRPVTWTEYLGKKAEHFNNALSTV  356



>gb|KDO58203.1| hypothetical protein CISIN_1g043985mg [Citrus sinensis]
Length=350

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 154/332 (46%), Positives = 214/332 (64%), Gaps = 11/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDK--IKMACETWGIFQV  391
             +DF    +LPD +TW + D  P   S   ESVP+IDL  P AV+   I  AC+TWG+FQV
Sbjct  21    LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGPTAVNVNLIGHACKTWGVFQV  80

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P  LL      +R  F L  EQKL+  RSP +  GYG  RIS FF   MW EGFT
Sbjct  81    INHGIPTALLHNAMCTSRSLFTLPNEQKLKVARSPDAFEGYGFARISSFFSKLMWYEGFT  140

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
               GSPL+H  Q+WPQDY+  C+VVE+Y+ +M+ LA+ L  L+ + +      I W   G+
Sbjct  141   NVGSPLDHFCQLWPQDYNMHCNVVEEYKKEMKKLAERLMCLILRSLGTTREDIKW--PGL  198

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   + L  N+ P CPDP RAMG A HTD+SL T+LYQ S ++GLQV      W+ 
Sbjct  199   NGDFKDHPSPLNFNYYPACPDPDRAMGLAAHTDSSLFTILYQNS-VSGLQVLREGTGWVT  257

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P S+A+VVN+GD++ I+SNG++ SVLHRA+ ++  +R+S+AYF+G   +++I+P   L
Sbjct  258   VPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATRK-NRLSIAYFYGLPSDLQISPLENL  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P++ P+YR ISW+ YL +K K+F KAL  +
Sbjct  317   VGPSQPPLYRSISWSEYLRMKAKHFNKALSFV  348



>ref|XP_009355149.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=360

 Score =   299 bits (765),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 212/331 (64%), Gaps = 14/331 (4%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +P DFN   +LPDS+ W  L++H  + S    +SVP++DL DP ++  +  AC+TWG+FQ
Sbjct  26    VPDDFNSLHELPDSYAWTTLNEHPSLES----DSVPVVDLNDPNSLQLLGHACKTWGVFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             +TNHG+P  L+  +E  AR  F L  +QKL+  RSPG ++GYG   I+ F+D Q WSE F
Sbjct  82    LTNHGIPQSLVHAMESAARSLFSLPAQQKLKVARSPGQISGYGFHLIAAFWDKQQWSECF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPLEH  Q+WPQDY+ FC + E+++ +++ LA  L  LM   +      + W   G
Sbjct  142   TIVGSPLEHYAQLWPQDYTKFCCITEEFEREIKRLASRLVWLMLASLGISKDDVEW--DG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  Q   A  Q N  P CPDP R +G   HTD+SLV++++Q SNI GLQV+     W 
Sbjct  200   PKGDDQNASAVFQFNSYPSCPDPDRTLGLVPHTDSSLVSIVHQ-SNIDGLQVFREGTGWF  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              ++P   A+V+N+GDLM I+SNG++ SVLHR +V +A HRIS+ Y +GP   V+IAP  K
Sbjct  259   TIQPVPGALVINVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPPAAVKIAPLAK  318

Query  1097  LIKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1186
             L+ P+  P+Y P++ WN Y+  K K  GKAL
Sbjct  319   LVGPSNSPLYPPVTNWNEYISTKAKLKGKAL  349



>gb|AGQ42612.1| GA3ox3 [Vitis vinifera]
Length=359

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 210/332 (63%), Gaps = 11/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             +D N   +LPDSH W  L +H P   S   ESVP+IDL DP A+  +  AC++WG+FQV 
Sbjct  21    LDLNSIQELPDSHAWASLGEH-PCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVI  79

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
             NHG+P+ +L  IE  +R  F L  EQKL+A R P   +G+G  RI+ FF  QMW EGFTV
Sbjct  80    NHGIPISILEAIEDASRNLFALPAEQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTV  139

Query  575   AGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  742
              GSPLE   ++WP++Y + FC V E+Y  QM+ LA  L  L+   +      + W   G 
Sbjct  140   LGSPLELVSKLWPEEYCTKFCEVTEEYDKQMKQLANKLLWLLLGSLGINKEDVEW--AGP  197

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G L+   A LQ+N  P CP P +AMG A+HTD+SL+T+LYQ S  +GLQV      WI 
Sbjct  198   EGQLEGAHAALQLNSYPACPQPDKAMGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWIT  256

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL+ I+SN  F SVLHRA+V+ +  RISVAYF+GP   + +AP  KL
Sbjct  257   VPPLPGALVVNIGDLLHILSNAAFPSVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKL  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +  +  P+YR ++W+ +L  K K+F KAL ++
Sbjct  317   VDSSHPPVYRSVTWSEFLATKAKHFNKALSLV  348



>ref|XP_009372969.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 208/335 (62%), Gaps = 13/335 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHES----VPLIDLYDPQAVDKIKMACETWG  379
             IIP+DFN    LP+SH W  DHS  +SS    +    VP+IDL DP+A   +  ACE WG
Sbjct  15    IIPIDFNTIQTLPESHVW-HDHSDESSSRVPSADPLFVPVIDLMDPEAPSLMIQACEEWG  73

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             IFQV  HG+  +L+  +E +A + F L  +QKL+A+RSPG   GYG   IS FFD  MW 
Sbjct  74    IFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKALRSPGGATGYGCPHISPFFDKHMWQ  132

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSP++HA+Q+WPQDY  FC  ++DYQ QM+ LAQ L  + FK +        W 
Sbjct  133   EGFTIMGSPVDHAKQLWPQDYQGFCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDW-  191

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                  GL      LQ+N  P CPDPTRA+G A HTDTSLVT++ Q S  +GLQV+     
Sbjct  192   -LNDSGLSSPSTALQLNSYPPCPDPTRALGMATHTDTSLVTIV-QQSKTSGLQVFKDGAG  249

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V+P   A+ VNLGD + I+SNGMF SV HR +V++   R S+AYF+ P ++  ++P 
Sbjct  250   WVLVQPIPGALTVNLGDYLHILSNGMFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPV  309

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L  +   + P YR ++   Y+DIK K+  KA  +I
Sbjct  310   LSRVL-EKVPKYRSLTVKEYVDIKGKHLEKAFSLI  343



>ref|XP_003527798.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN16493.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=347

 Score =   297 bits (761),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 208/335 (62%), Gaps = 15/335 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWL------DDHSPVNSSSTHES-VPLIDLYDPQAVDKIKMACE  370
             IIP+DF+ A  LPDSH W       DD+   N  ++  S +P+IDL DP A+++I  ACE
Sbjct  19    IIPLDFSSAHSLPDSHAWSHSQPNDDDYVSFNDDASSSSFIPIIDLMDPNAMEQIGHACE  78

Query  371   TWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  550
              WG FQ+ NHG+P  ++  +E +A+R F L  EQKL+A+RSPG   GYG  RIS FF   
Sbjct  79    KWGAFQLKNHGIPFCVIEDVEEEAKRLFALPTEQKLKALRSPGGATGYGRARISPFFPKF  138

Query  551   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*  730
             MW EGFT+ GSP   A+++WP D++ FC ++E+Y+ QM+ LA+ L  +MF   +  I   
Sbjct  139   MWHEGFTIIGSPSHDAKKIWPNDHAGFCDLMENYEKQMKVLAERLTQMMFS--LMDISEE  196

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
             +   VG       +Q+N+ P CP+P RAMG A HTDTSL T+L+Q S ITGLQ++     
Sbjct  197   KTKWVGASNISGAVQLNFYPSCPEPNRAMGLAPHTDTSLFTILHQ-SRITGLQIFKEGKE  255

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P+ N +VV+ GDL+ IISN  F+S LHR  V+    R SVAYF+ P  +  ++P 
Sbjct  256   WVPVHPHPNTLVVHTGDLLHIISNARFRSALHRVTVNSTRERYSVAYFYSPPLDYVVSPL  315

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +  +       +R ++   Y+ IK K FG+AL +I
Sbjct  316   VDSVA-----RFRDVTVKEYIGIKAKNFGEALSLI  345



>ref|XP_007150692.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
 gb|ESW22686.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
Length=365

 Score =   298 bits (762),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 210/340 (62%), Gaps = 11/340 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSST--HESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             D N   +LP+S+TW  ++D +  + S+   +E VP+IDL DP A   I  AC +WG++QV
Sbjct  21    DLNSLQELPESYTWTQMEDQANNHPSNCGLNEGVPVIDLNDPNAPKLIGHACISWGVYQV  80

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P  LL +I+      F L    K RA RSP  + GYG  RIS FF   MWSEGFT
Sbjct  81    VNHGIPFTLLDEIQCLGETLFSLPSHHKHRAARSPDGVDGYGLARISSFFPKLMWSEGFT  140

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
             + GSPLE  RQ+WPQDY+ +C  V  Y   M+ LA+ L  LM + +      + W   G 
Sbjct  141   IVGSPLERFRQLWPQDYNKYCDTVMQYDETMKKLAEKLMWLMLESLGITKEDLKW--AGA  198

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  + T A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +NI+GLQV+     W+ 
Sbjct  199   KGQFKNTCAALQLNSYPTCPDPDRAMGLAAHTDSTLLTILYQ-NNISGLQVHRKGTGWVT  257

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P    +V+N+GDL+ I+SNG++ SVLHR +V++   R+SVAY  GP  NV I P  KL
Sbjct  258   VPPVPGGLVINVGDLLHILSNGLYPSVLHRVLVNRVQQRLSVAYLCGPPPNVSICPHEKL  317

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEK  1219
             + P +  +Y+ ++WN YL  K K+F KAL  +  +S + +
Sbjct  318   VGPNQPRLYKSVTWNEYLGTKAKHFNKALSTVLVSSAISE  357



>ref|XP_006305164.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
 gb|EOA38062.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
Length=362

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 211/335 (63%), Gaps = 13/335 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DD------HSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWG  379
             DF    +LPDS++W   DD       +P   ++  E++P IDL  P A ++I  AC TWG
Sbjct  24    DFTSLRELPDSYSWTPKDDILFAAAAAPSPPTAVDETIPFIDLDHPDAANQIGHACRTWG  83

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
              FQ+ NHGVP+ LL  IE      F L  ++KL+A RS   ++GYG  RI+ FF+ QMWS
Sbjct  84    AFQIANHGVPLRLLQDIEFLTGSLFGLPVQRKLKAARSETGVSGYGVARIASFFNKQMWS  143

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSPL   R++WPQ + ++C +VE+Y+ +M+ LA  L  L    +      + W 
Sbjct  144   EGFTITGSPLNDFRKLWPQLHLNYCDIVEEYEERMKKLASKLMWLALSSLGVSEEDVQWA  203

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                     W QA LQ+N  P+CP P RAMG A HTD++L+T+LYQ +N  GLQV+  +L 
Sbjct  204   SLNSDS-NWAQAALQLNHYPVCPQPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLG  261

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P 
Sbjct  262   WVTVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPV  321

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+ P + P+YR ++W  YL  K  +F KAL MI
Sbjct  322   PKLVSPVDTPLYRSVTWTEYLQTKATHFNKALSMI  356



>ref|XP_008785607.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=362

 Score =   297 bits (760),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/337 (45%), Positives = 212/337 (63%), Gaps = 10/337 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS-PVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
              DF    ++PDSH W D H  P    S  +SVP++DL  P AV  +  AC+ WG+FQVT 
Sbjct  22    FDFESIREVPDSHAWPDLHDHPSVEPSGPDSVPVVDLDSPDAVLLVGRACQEWGVFQVTG  81

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P +LL ++E Q RR F L   QKL+A RSPG +AGYG   IS FF   MWSEGFT+A
Sbjct  82    HGIPTDLLDRLESQIRRLFSLPTHQKLKAARSPGDIAGYGLAPISSFFPKLMWSEGFTIA  141

Query  578   GSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMV  745
             GSP EHAR++ P++Y ++FC+V+E+Y    ++LA  L  LM   +      I W   G +
Sbjct  142   GSPFEHARKLLPKEYCAEFCNVIEEYNKVAKELAGRLMHLMLLSLGLTEEDISW--AGPI  199

Query  746   GLQWT-QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWID  919
                    A +Q+N  P CP+P RA+G A HTD+SL+T+LYQ S  +GLQV  P+   W+ 
Sbjct  200   RDSGDLSAVIQLNSYPACPEPDRALGLAAHTDSSLLTVLYQ-SGTSGLQVLRPDPARWVT  258

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P    ++V++GDL  I+SNG F+SVLHRA+V++ HHR+S AY  GP  +V+++P    
Sbjct  259   VPPLPGVLIVHVGDLSHILSNGHFRSVLHRAVVNRRHHRLSAAYICGPPAHVKVSPIDIF  318

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1210
             + P++ P YR ++W  YL +K K F KAL  I    +
Sbjct  319   LGPSQGPAYRAVTWPEYLALKGKLFNKALASIKLRRE  355



>ref|XP_003533057.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=375

 Score =   298 bits (762),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/342 (45%), Positives = 208/342 (61%), Gaps = 14/342 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL----DDHSPVNSSSTHES---VPLIDLYDPQAVDKIKMACETWGI  382
             DFN   +LPDS+ W     DDH   N  S +++   VP+IDL DP A + I  AC+TWG+
Sbjct  21    DFNSLQELPDSYAWTQPDDDDHRLTNYPSNNKTKTVVPIIDLNDPNAPNLIGHACKTWGV  80

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQV NHG+P  L + I+  +   F L   QKL+A RSP  ++GYG  RIS FF   MWSE
Sbjct  81    FQVVNHGIPTSLFSDIQRASLALFSLPLHQKLKAARSPDGVSGYGRARISSFFPKLMWSE  140

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP---ICW*R  733
              FT+  SPL+   ++WPQDY+ +C +V +Y+A M+ LA  L  LM   +  P   I W  
Sbjct  141   CFTILDSPLDLFLKLWPQDYAKYCDIVVEYEAAMKKLAAKLMCLMLASLGIPKEDIKW--  198

Query  734   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              G  G      A L  N  P CPDP RAMG A HTD++L+T+L+Q +N+ GLQV      
Sbjct  199   AGPKGEFNGACAALHWNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVNGLQVLKEGEG  257

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +V+N+GDL+ I+SNG++ SVLHR  V++   R SVAY +GP  NV+I+P 
Sbjct  258   WVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVNRTRQRFSVAYLYGPPTNVQISPQ  317

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1216
             +KL+ PT   +YR ++WN YL  K K F KAL  +  +S + 
Sbjct  318   VKLVGPTRPVLYRSVTWNEYLGTKAKLFNKALSAVRLSSSIN  359



>ref|XP_011019738.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=342

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/329 (46%), Positives = 206/329 (63%), Gaps = 7/329 (2%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             I+P+DF+    LPDSH W    S    S    S+P +DL DP A + I  AC+ WG FQV
Sbjct  18    IVPLDFDSVRTLPDSHVW-PPTSHAFESEDRLSIPSVDLKDPDAGELIGHACKAWGAFQV  76

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             TNH +P++L  ++E +ARR F L   QKL+A+RSPG   GYG  RIS FF+  MW EGFT
Sbjct  77    TNHDIPLDLFHEVESEARRLFSLPTGQKLKALRSPGGATGYGLARISPFFNKYMWHEGFT  136

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCGMVG  748
             + GS ++HAR +WP DY  FC V+EDYQ +M++LA  L  L+ K + I      R    G
Sbjct  137   IMGSSIDHARDLWPNDYQRFCDVMEDYQKKMKELAITLMHLVLKSLDISEEEISRVVSAG  196

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
                T   LQ+N  P+CPDP RAMG A HTDTSL+T+L+Q S + GLQ++   + W+ V P
Sbjct  197   GDSTA--LQLNSYPLCPDPNRAMGLAPHTDTSLLTILHQ-STVNGLQIFKEGVGWVLVSP  253

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
              + ++VVN+GDL+ I+SN  F SVLHR ++ +   R+S+AYF+    +  I+P    +  
Sbjct  254   TNGSLVVNVGDLLHILSNAQFPSVLHRVVMKENQQRLSLAYFYCLPSDFHISP--LALNS  311

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             T+ P+YR +S   Y+ IK K   KAL +I
Sbjct  312   TQMPLYRSVSVRDYIGIKAKNLEKALSLI  340



>ref|XP_006427126.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
 gb|ESR40366.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
Length=350

 Score =   296 bits (758),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 213/332 (64%), Gaps = 11/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDK--IKMACETWGIFQV  391
             +DF    +LPD +TW + D  P   S   ESVP+IDL  P AV+   I  AC+TWG+FQV
Sbjct  21    LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGPTAVNVNLIGHACKTWGVFQV  80

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P  LL      +R  F L  EQKL+  RSP +  GYG  RIS FF   MW EGFT
Sbjct  81    INHGIPTALLHNAMCTSRSLFTLPNEQKLKVARSPDAFEGYGFARISSFFSKLMWYEGFT  140

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
               GSPL+H  Q+WPQDY+  C+VVE+Y+ +M+ LA+ L  L+ + +      I W   G+
Sbjct  141   NVGSPLDHFCQLWPQDYNMHCNVVEEYKKEMKKLAERLMCLILRSLGTTREDIKW--AGL  198

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   + L  N+ P CPDP RAMG A HTD+SL T+L Q S ++GLQV      W+ 
Sbjct  199   NGDFKDHPSPLNFNYYPACPDPDRAMGLAAHTDSSLFTILCQNS-VSGLQVLREGTGWVT  257

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P S+A+VVN+GD++ I+SNG++ SVLHRA+ ++  +R+S+AYF+G   +++I+P   L
Sbjct  258   VPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATRK-NRLSIAYFYGLPSDLQISPLENL  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P++ P+YR ISW+ YL +K K+F KAL  +
Sbjct  317   VGPSQPPLYRSISWSEYLRMKAKHFNKALSFV  348



>ref|NP_001233848.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34124.1| 3b-hydroxylase [Solanum lycopersicum]
Length=373

 Score =   297 bits (760),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/336 (44%), Positives = 206/336 (61%), Gaps = 12/336 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL--DDHSPVNSSSTHESVPLIDL------YDPQAVDKIKMACETW  376
              D N   +LP+SH W   +DH    +S   ES+P+IDL       +   +D I  AC+ W
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNNILDHIGHACKKW  77

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G FQ+ NH +  +LL  IE   +  F L  +QKL+A RSP  + GYG  RIS FF   MW
Sbjct  78    GAFQIINHSISEKLLQDIEVAGKTLFSLPMQQKLKAARSPDGVTGYGAARISSFFSKLMW  137

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
             SEGFT+ GSP+EHARQ+WP+DY+ FC V+E+Y+ +M  LA  L  L+   +      + W
Sbjct  138   SEGFTIVGSPIEHARQLWPKDYNKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKW  197

Query  728   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  907
                     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY    
Sbjct  198   AVGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGN  256

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  +R+SVAY +GP   V ++P
Sbjct  257   GWITVPPIPGALVVNIGDLLHILSNGSYPSVLHRAVVNRTRYRLSVAYLYGPPSGVRVSP  316

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               KL+     P+YR ++W+ YL  K KYF KAL  +
Sbjct  317   LSKLVDHRHPPLYRAVTWSEYLGTKAKYFDKALSSV  352



>ref|XP_006465424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
Length=350

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 214/332 (64%), Gaps = 11/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDK--IKMACETWGIFQV  391
             +DF    +LPD +TW + D  P   S   ESVP+IDL    AV+   I  AC+TWG+FQV
Sbjct  21    LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGLTAVNVNLIGHACKTWGVFQV  80

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+P  LL  +   +R FF L  EQKL+  RSP +  G G  RIS FF   MW EGFT
Sbjct  81    INHGIPTALLHNVMCTSRSFFTLPTEQKLKVARSPDAFEGNGFARISSFFSKLMWYEGFT  140

Query  572   VAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  742
               GSPL+H RQ WPQDY+  C+VVE+Y+ +M+ LA+ L  L+ + +      I W   G+
Sbjct  141   NVGSPLDHFRQFWPQDYNMHCNVVEEYKKEMKKLAERLMCLILRSLGTTREDIKW--PGL  198

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G  +   + L +N+ P CPDP RAMG A HTD+SL T+LYQ S ++GLQV      W+ 
Sbjct  199   NGDFKDHPSPLNLNYYPACPDPDRAMGLAAHTDSSLFTILYQNS-VSGLQVLREGTGWVT  257

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P  +A+VVN+GD++ I+SNG++ SVLHRA+ ++  +R+S+AYF+G   +++I+P   L
Sbjct  258   VPPVWDALVVNVGDMLHILSNGLYPSVLHRAVATRK-NRLSIAYFYGLPSDLQISPLENL  316

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P++ P+YR ISW+ YL +K K+F KAL  +
Sbjct  317   VGPSQPPLYRSISWSEYLRMKAKHFNKALSFV  348



>dbj|BAD06943.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=372

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 214/333 (64%), Gaps = 10/333 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDL------YDPQAVDKIKMACETWGI  382
             +D     +LP+SH W  D    ++S   ES+P+IDL       +   +D I  AC+ WG 
Sbjct  20    LDLYSIKELPESHAWSSDDHTGSNSINFESIPVIDLDNYNHDNNFNILDTIGHACKKWGA  79

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQ+ NH +  +LL  IE   RR F L  +QKL+A RSP  ++GYG  RIS FFD  MWSE
Sbjct  80    FQLINHNISEKLLEDIEIAGRRLFSLPMQQKLKAARSPDGVSGYGLARISSFFDKLMWSE  139

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GSPLEH+R +WPQD++ FC VVE+Y+ +M+ LA  +  L+ + +       + G+
Sbjct  140   GFTIVGSPLEHSRLLWPQDFNSFCEVVEEYEKEMKKLAGRMMKLILESLGVAEEDAKWGV  199

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY--GPNLNWI  916
                    A LQ+N  P CPDP RAMG A+HTD++++T+L+Q +N +GLQV+  G    W+
Sbjct  200   ESKGRCSA-LQLNSYPACPDPGRAMGLAEHTDSTVLTILHQ-NNTSGLQVFREGAAGGWV  257

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+V+N GDL+ I+SNG++ SVLHRA+V+++ HR+SVAY +GP   ++I+P  K
Sbjct  258   TVPPIPGALVINAGDLLHILSNGLYHSVLHRAVVNRSSHRLSVAYLYGPPPGIKISPLPK  317

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+   + P++R I+W+ YL  K K+F KAL  +
Sbjct  318   LVAEGQPPLFRAITWSEYLRTKAKHFDKALSSV  350



>ref|XP_006356177.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=372

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 204/335 (61%), Gaps = 11/335 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL--DDHSPVNSSSTHESVPLIDL-----YDPQAVDKIKMACETWG  379
              D N   +LP+SH W   +DH    +S   ES+P+IDL      +   +D I  AC+ WG
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNILDHIGHACKKWG  77

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
              FQ+ NH +   LL  I+   +  F L  +QKL+A RSP  + GYG  RIS FF   MWS
Sbjct  78    AFQIINHSISERLLQDIDVAGKTLFSLPMQQKLKAARSPDGVTGYGVARISSFFSKLMWS  137

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSP+EHARQ+WP+DY  FC V+E+Y+ +M  LA  L  L+   +      + W 
Sbjct  138   EGFTIVGSPIEHARQLWPKDYKKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKWA  197

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                    +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY     
Sbjct  198   VGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGNG  256

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  HR+SVAY +GP   V ++P 
Sbjct  257   WVTVPPIPGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPL  316

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+     P+YR ++W+ YL  K KYF KAL  +
Sbjct  317   SKLLDHRHPPLYRAVTWSEYLGTKAKYFDKALSSV  351



>emb|CAN73736.1| hypothetical protein VITISV_025221 [Vitis vinifera]
Length=416

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 210/332 (63%), Gaps = 11/332 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             +D N   +LPDSH W  L +H P   S   ESVP+IDL DP A+  +  AC++WG+FQV 
Sbjct  78    LDLNSIQELPDSHAWASLGEH-PCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVI  136

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
             NHG+P+ +L  IE  +R  F L  EQKL+A R P   +G+G  RI+ FF  QMW EGFTV
Sbjct  137   NHGIPISILEAIEDASRNLFALPAEQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTV  196

Query  575   AGSPLEHARQVWPQDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  742
              GSPLE   ++WP++Y + FC V E+Y  QM+ LA  L  L+   +      + W   G 
Sbjct  197   LGSPLELVSKLWPEEYCTKFCEVTEEYDKQMKQLANKLLWLLLGSLGINKEDVEW--AGP  254

Query  743   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
              G L+   A LQ+N  P CP P +AMG A+HTD+SL+T+LYQ S  +GLQV      WI 
Sbjct  255   EGQLEGAHAALQLNSYPACPQPDKAMGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWIT  313

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL+ I+SN  F SVLHRA+V+ +  RISVAYF+GP   + +AP  KL
Sbjct  314   VPPLPGALVVNIGDLLHILSNAAFPSVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKL  373

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +  +  P+YR ++W+ +L  K K+F KAL ++
Sbjct  374   VDSSHPPVYRSVTWSEFLATKAKHFNKALSLV  405



>ref|XP_008352044.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score =   294 bits (753),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 151/342 (44%), Positives = 209/342 (61%), Gaps = 27/342 (8%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHES-----------VPLIDLYDPQAVDKIK  358
             IIP+DFN   +LP+SH W D         +HES           VP+IDL D +A   + 
Sbjct  15    IIPIDFNSVQKLPESHVWHD--------KSHESLFGVPSADPLPVPVIDLMDSEASSLMI  66

Query  359   MACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKF  538
              ACETWGIFQV  HG+  +    +E +A + F L  +QKL+A+RSPG   GYG   IS F
Sbjct  67    QACETWGIFQVIGHGL-TKFXEDVESEAEKLFGLPVDQKLKALRSPGGATGYGRPHISPF  125

Query  539   FDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---  709
             FD  MW EGFT+ GSP++HA+Q+WPQDY  FC  ++DYQ QM+ LA+ +  + FK +   
Sbjct  126   FDRHMWQEGFTIMGSPIDHAKQLWPQDYQGFCDTIDDYQNQMKALAEKIIRIFFKSLNIN  185

Query  710   IRPICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQ  889
                + W      GL      LQ+N  P CPDPTRAMG A HTDTSLVT++ Q S  +GLQ
Sbjct  186   FEELNW--LNDSGLSSPGTALQLNSYPPCPDPTRAMGMAAHTDTSLVTIV-QQSKTSGLQ  242

Query  890   VYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSK  1069
             V+   + W+ V+P   A+ V LGD + I+SNGM+ +VLHRA+V++   R S+AYF+ P +
Sbjct  243   VFKDGVGWVLVQPVPGALTVXLGDYLHILSNGMYTNVLHRAVVNQQIQRFSMAYFYAPPR  302

Query  1070  NVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +  ++P L  +   + P YR ++   Y+D+K K+  KAL +I
Sbjct  303   DFTVSPVLSRVT-GQMPKYRSLTVKEYVDLKGKHLEKALSLI  343



>ref|XP_006366661.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   294 bits (753),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 149/341 (44%), Positives = 211/341 (62%), Gaps = 13/341 (4%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACET  373
             Q +  I+P+DF+   ++P+SH W D ++SP++    + +VP+IDL  P  V+ I  AC+T
Sbjct  16    QSLQHILPIDFHSIQEVPNSHLWPDINNSPISHDEKNPNVPMIDLLAPNVVELIGHACKT  75

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WGIFQV NHGV +EL  ++E QARR F L  EQK++ VRS     GYGT RI+ FF   M
Sbjct  76    WGIFQVVNHGVSLELFDEVESQARRLFALPAEQKVKVVRSTSGATGYGTARITPFFSKFM  135

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+  SPL+HA+++WP DY   C V+E+YQ +M+ L+  L  L+    ++P     
Sbjct  136   WHEGFTIMDSPLDHAKKLWPHDYQKICEVMENYQKKMKALSFQLWLLILN-YLQPSQ--E  192

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
               +   + T A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   N  W
Sbjct  193   HSIKSFESTGA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKNQVW  251

Query  914   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  252   TSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMIVP-  310

Query  1091  LKLIKPTE----FPMYRPISWNAYLDIKYKYFGKALEMIGF  1201
               L+   +     P YR +    YLD+K K+  K   MI F
Sbjct  311   --LVSSEDNVGAIPKYRNVKVKEYLDLKAKHLEKVFSMIRF  349



>gb|KHN47796.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=375

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 152/342 (44%), Positives = 208/342 (61%), Gaps = 14/342 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL----DDHSPVNSSSTHES---VPLIDLYDPQAVDKIKMACETWGI  382
             DFN   +LPDS+ W     DDH   N  S +++   VP+IDL DP A + I  AC+TWG+
Sbjct  21    DFNSLQELPDSYAWTQPDDDDHRLTNYPSNNKTKTVVPIIDLNDPNAPNLIGHACKTWGV  80

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQV NH +P+ L + I+  +   F L   QKL+A RSP  ++GYG  RIS FF   MWSE
Sbjct  81    FQVVNHDIPMSLFSDIQRASLALFSLPLHQKLKAARSPDGVSGYGRARISSFFPKLMWSE  140

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP---ICW*R  733
              FT+  SPL+   ++WPQDY+ +C +V +Y+A M+ LA  L  LM   +  P   I W  
Sbjct  141   CFTILDSPLDLFLKLWPQDYAKYCDIVVEYEAAMKKLAAKLMCLMLASLGIPKEDIKW--  198

Query  734   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
              G  G      A L  N  P CPDP RAMG A HTD++L+T+L+Q +N+ GLQV      
Sbjct  199   AGPKGEFNGACAALHWNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVNGLQVLKEGEG  257

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P    +V+N+GDL+ I+SNG++ SVLHR  V++   R SVAY +GP  NV+I+P 
Sbjct  258   WVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVNRTRQRFSVAYLYGPPTNVQISPQ  317

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1216
             +KL+ PT   +YR ++WN YL  K K F KAL  +  +S + 
Sbjct  318   VKLVGPTRPVLYRSVTWNEYLGTKAKLFNKALSAVRLSSSIN  359



>ref|XP_008387508.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 154/335 (46%), Positives = 206/335 (61%), Gaps = 13/335 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE----SVPLIDLYDPQAVDKIKMACETWG  379
             IIP+DFN    LP+SH W  DHS  +SS        SVP+IDL DP+A   +  ACE WG
Sbjct  15    IIPIDFNSIQTLPESHVW-HDHSDESSSGVPSADPLSVPVIDLMDPEAPSLMIQACEEWG  73

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             IFQV  HG+  +L+  +E +A + F L  +QKL+A+RSPG   GYG   IS FFD  MW 
Sbjct  74    IFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKALRSPGGATGYGRPHISPFFDKHMWQ  132

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSP++HA+Q+WPQDY  FC  ++DYQ QM+ LAQ L  + FK +        W 
Sbjct  133   EGFTIMGSPVDHAKQLWPQDYQGFCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDW-  191

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                  G       LQ+N  P CPDPTRA+G A HTDTSLVT++ Q S  +GLQV+     
Sbjct  192   -LNDSGSSNPSTALQLNSYPPCPDPTRALGMATHTDTSLVTIV-QQSKTSGLQVFKDGAG  249

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V+P   A+ VNLGD + I SNG+F SV HR +V++   R S+AYF+ P ++  ++P 
Sbjct  250   WVLVQPIPGALTVNLGDYLHIXSNGVFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPV  309

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L  +   + P YR ++   Y+DIK K+  KA  +I
Sbjct  310   LSRVL-EKVPKYRSLTVKEYVDIKGKHLEKAFSLI  343



>gb|ABI64150.1| gibberellin 3-oxidase [Pisum sativum]
Length=349

 Score =   293 bits (749),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 209/331 (63%), Gaps = 11/331 (3%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             IIP+DF+    LPDSH W    DD+  + S+ +   +P+IDL DP A+++I +ACE WG 
Sbjct  19    IIPLDFSSFRTLPDSHAWPQSKDDNDHLTSNGS--CIPIIDLNDPNAMEQIGLACEKWGA  76

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQ+ NHGVP+ L+ ++E +A++ F L  ++K++A+RS G   GYG  RIS FF   MW E
Sbjct  77    FQLKNHGVPLNLIEEVEEEAKKLFSLPSKEKIKALRSAGGATGYGRARISPFFPKYMWHE  136

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GSP    +++WP DY  FC ++EDYQ QM+ LA+ +  ++F   I  I   +   
Sbjct  137   GFTIMGSPSNDVKKIWPNDYEYFCDIMEDYQKQMKTLAEKITNIIFN--ILGISKEQNKW  194

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
             VG       LQ+N+ P CPDP +AMG A HTDTSL T+L+Q S  +GLQ++   + ++ V
Sbjct  195   VGSNNHCEALQLNFYPCCPDPKKAMGLAPHTDTSLFTILHQ-SQTSGLQIFKEGVGYVTV  253

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
             +P+ N +VVN GD++ I+SN  F+  LHRA+V+    R SVAYF+GP  +  ++P   L+
Sbjct  254   DPHPNTLVVNTGDILHILSNSRFRCSLHRAVVNDVKDRYSVAYFYGPPVDYLVSP---LV  310

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                  P +R +S   Y+ IK K  G AL +I
Sbjct  311   VDGSLPRFRSLSVKDYIGIKAKNLGGALSLI  341



>ref|XP_010537953.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Tarenaya hassleriana]
Length=335

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 142/328 (43%), Positives = 203/328 (62%), Gaps = 9/328 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHG  403
             D      LP+S+ W     P  SS+  ES+P+IDL D   V +I  ACETWG FQ+ NHG
Sbjct  6     DLRNLKTLPESYKW----KPTTSSNDRESIPVIDLADSDVVTRIGNACETWGAFQIANHG  61

Query  404   VPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT-VAG  580
             +P +LL  +E  +   F L  EQKL        + GYG  RI+ FFDS+MWSEGFT VAG
Sbjct  62    IPSKLLDDVESLSSSLFGLPTEQKLETATQKNGIGGYGEARIAPFFDSKMWSEGFTIVAG  121

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMVGL  751
             S  +H   +WP DY  +C ++E+Y+ +M+ LA  L  L+   I      I W      GL
Sbjct  122   SYRQHFPTLWPHDYDKYCGIIEEYEEEMQKLAGKLMGLILGSIGVTEEDIKWTGPNNSGL  181

Query  752   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  931
                   +++N  P+CP+P +AMG A HTD+++VT+L+Q +N  GLQ++     W+ V+P 
Sbjct  182   GSGSGAIRLNHYPVCPEPDQAMGLAAHTDSTMVTILHQ-NNAAGLQMFKEGTGWVLVKPV  240

Query  932   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1111
                +VVN+GDL+ I+SNG  +S LH+A+V+K   R S+AY +GPS +++I+P  KL+ P 
Sbjct  241   PGLLVVNVGDLLHILSNGKLRSSLHQALVNKNKSRFSIAYLWGPSGDIDISPISKLVSPI  300

Query  1112  EFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             E  MYRP++W  YL++K ++F KAL MI
Sbjct  301   EPAMYRPVTWKEYLEMKARHFDKALSMI  328



>ref|XP_006355748.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   292 bits (747),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 210/339 (62%), Gaps = 8/339 (2%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACET  373
             Q +  I+P+DF+   ++P+SH W + ++SP+N    + +VP+IDL  P  V+ I  AC T
Sbjct  15    QSLQHILPIDFHLIQEVPNSHLWPNINNSPINHDEKNPNVPIIDLLAPNVVELIGHACRT  74

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
              GIFQV NHGVP+E   + E QARR F L  EQK++ VRS     GYGT RI+ FF   M
Sbjct  75    LGIFQVVNHGVPLEFFDEAESQARRLFALPAEQKVKVVRSTSGATGYGTARITPFFSKFM  134

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+  SPL+HA+++WP DY +FC V+E+YQ +M+ L+  L  L+    ++P     
Sbjct  135   WHEGFTIMDSPLDHAKELWPHDYQEFCDVMENYQKKMKALSFQLWLLILN-YLQPSQ--E  191

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
               +   ++TQA LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W
Sbjct  192   HLINSFEFTQA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGW  250

Query  914   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  251   TSIAPISNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSTIVPL  310

Query  1091  LKLIKPTE--FPMYRPISWNAYLDIKYKYFGKALEMIGF  1201
             +   K      P YR +    YL +K K+  K   +I +
Sbjct  311   VSFEKNVGVVVPKYRKVKVKEYLSLKAKHLEKVFSLIRY  349



>gb|ACN89835.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=372

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/335 (44%), Positives = 203/335 (61%), Gaps = 11/335 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL--DDHSPVNSSSTHESVPLIDL-----YDPQAVDKIKMACETWG  379
              D N   +LP+SH W   +DH    +S   ES+P+IDL      +   +D I  AC+ WG
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNILDHIGHACKKWG  77

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
              FQ+ NH +   LL  I+   +  F L  +QKL+A RSP  + GYG  +IS  F   MWS
Sbjct  78    AFQIINHSISERLLQDIDVAGKTLFSLPMQQKLKAARSPDGVTGYGAAQISSLFSKLMWS  137

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  730
             EGFT+ GSP+EHARQ+WP+DY  FC V+E+Y+ +M  LA  L  L+   +      + W 
Sbjct  138   EGFTIVGSPIEHARQLWPKDYKKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDEVKWA  197

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
                    +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY     
Sbjct  198   VGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGNG  256

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  HR+SVAY +GP   V ++P 
Sbjct  257   WVTVPPIPGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPL  316

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+     P+YR ++W+ YL  K KYF KAL  +
Sbjct  317   SKLLDHRHPPLYRAVTWSEYLGTKAKYFDKALSSV  351



>ref|XP_010051203.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81486.1| hypothetical protein EUGRSUZ_C02844 [Eucalyptus grandis]
Length=355

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 209/343 (61%), Gaps = 15/343 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW--LDDHSP---VNSSSTHESVPLIDLYDPQAVDKIKMA  364
              +  IIP+DF+   ++P SH+W   DD SP    N    H S+P IDL  P A++    A
Sbjct  14    HLQHIIPIDFDSVKEVPQSHSWPQSDDESPRRMFNFDGDHFSIPAIDLDSPDAIEMAGHA  73

Query  365   CETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFD  544
             C+  GIFQVTNHG+P  LL ++E QA RFF L    K++A+RSP    GYG  RI+ FF+
Sbjct  74    CKIMGIFQVTNHGIPSSLLREVESQAWRFFTLPARAKVKALRSPSGATGYGVARIAPFFN  133

Query  545   SQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  715
               MW EGFT+ GSPLEHAR+VWP  Y  FC V+EDYQ +M+ L++ L A++ K +     
Sbjct  134   KFMWHEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGMSEH  193

Query  716   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
              + W R            LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+
Sbjct  194   DVDWPRLRSNAC----TALQLNSYPRCPDPRQAMGLAPHTDTFLLTILHQNHSAHGLQVH  249

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  W+ V P + A+VVN+GD++ I+SN MF SV+HRAI S+  HR++V YF+GP  + 
Sbjct  250   REGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRAIPSENTHRLTVGYFYGPPTDF  309

Query  1076  EIAPSLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              + P  +L + +   +   +R ++   Y+ +K K   KAL MI
Sbjct  310   HVGPIHRLTQASGREDAAQFRSVTVKDYIQMKAKNLDKALSMI  352



>gb|KDP32294.1| hypothetical protein JCGZ_13219 [Jatropha curcas]
Length=350

 Score =   291 bits (746),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/341 (45%), Positives = 205/341 (60%), Gaps = 15/341 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWG  379
              +  IIP+DF+    +PDSH W +     ++     S+P IDL DP     I  ACETWG
Sbjct  14    HLHQIIPLDFDSVRAVPDSHVWPESGELESNDHHWLSIPTIDLNDPDRAKLIGHACETWG  73

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             +FQ+TNH +P+ LL ++E + +R F L   QKL+A+RSPG   GYG  RIS FF+  MW 
Sbjct  74    VFQLTNHNIPLNLLNEVEFEIKRLFSLPARQKLKALRSPGGAIGYGIARISPFFNKYMWH  133

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*  730
             EGFT+ GSP++HA Q+WP  Y  FC V+EDYQ +M +LA  L  L+ + I        W 
Sbjct  134   EGFTIMGSPVDHAMQLWPNGYQRFCDVMEDYQKKMEELATTLIHLILQNISMSEEETKW-  192

Query  731   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  910
               G  G   +   LQ+N  P CPDP RAMG A HTDTSL+T+L+Q S I+GLQ++     
Sbjct  193   -LGSPG--GSSTALQLNSYPNCPDPHRAMGLAPHTDTSLLTILHQ-STISGLQIFKEGFG  248

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P + A+VVN+GDL+ I+SNG F SVLHR I+ +   R SVA+F+ P  +  + P 
Sbjct  249   WVLVYPTNGALVVNIGDLLHILSNGRFISVLHRVIMKEPKQRFSVAFFYCPRTDFHVFP-  307

Query  1091  LKLIKPTE------FPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L L    E       P+YR +S   Y+ IK K   KAL +I
Sbjct  308   LGLSSGDEDDDHGQVPLYRSVSVAEYVGIKSKNLDKALSLI  348



>gb|KCW53766.1| hypothetical protein EUGRSUZ_J03019 [Eucalyptus grandis]
Length=349

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 210/340 (62%), Gaps = 46/340 (14%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +DF+ A++LPDS+ W +    P +   + ES+P+IDL DP A+  I  AC++WG++QVTN
Sbjct  21    LDFSSAEELPDSYAWTELGEYPSSHCPSKESLPIIDLNDPNALKLIGHACKSWGVYQVTN  80

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P ELL  +E  A+  F L  +QKL+A RSP  ++GYG  +IS FF  QMWSEGFT+ 
Sbjct  81    HGIPEELLHDVERAAKNLFSLPVQQKLKASRSPEGISGYGVAKISAFFPKQMWSEGFTIM  140

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  751
             GSP+EHAR++WPQDYS FC V+E YQ +M+ LA+ L  LM             G +GL  
Sbjct  141   GSPMEHARRLWPQDYSLFCDVIEKYQKEMKQLAERLMWLML------------GSLGLTK  188

Query  752   ---QWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
                +W+          A LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV 
Sbjct  189   EDIKWSSPKGEFTGAVAALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVL  247

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  WI V P    + V+               VLHRA+V++  HR+SVAY +GP   V
Sbjct  248   KEGSGWITVPP----LPVHF--------------VLHRAMVNRTEHRLSVAYLYGPPSWV  289

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +++P  +LI     P+Y+P++W+ YL  K K+F KAL ++
Sbjct  290   QVSPLPELIDSNHPPLYKPVTWSEYLGTKAKHFNKALSLV  329



>ref|XP_010049018.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81481.1| hypothetical protein EUGRSUZ_C02840 [Eucalyptus grandis]
Length=355

 Score =   290 bits (743),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/343 (44%), Positives = 208/343 (61%), Gaps = 15/343 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW--LDDHSP---VNSSSTHESVPLIDLYDPQAVDKIKMA  364
              +  IIP+DF+  +++P SH+W   DD SP    N    H S+P IDL  P A++    A
Sbjct  14    HLQHIIPIDFDSVEEVPQSHSWPQSDDESPRRMFNLDGDHFSIPAIDLDSPDAIEMAGHA  73

Query  365   CETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFD  544
             C+  GIFQVTNHG+P  LL +IE QA RFF L    K++A+RSP    GYG  RI+ FF+
Sbjct  74    CKIMGIFQVTNHGIPSSLLREIESQAWRFFTLPARAKVKALRSPSGATGYGVARIAPFFN  133

Query  545   SQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  715
               MW EGFT+ GSPLEHAR+VWP  Y  FC V+EDYQ +M+ L++ L A++ K +     
Sbjct  134   KFMWHEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGISEH  193

Query  716   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
              + W R            LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+
Sbjct  194   DVDWPRLRSNAC----TALQLNSYPRCPDPGQAMGLAPHTDTLLLTILHQNHSAHGLQVH  249

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  W+ V P + A+VVN+GD++ I+SN MF SV+HR I S+  HR++V YF+GP  + 
Sbjct  250   REGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPPTDF  309

Query  1076  EIAPSLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              + P   L + +   +   +R I+   Y+ +K K   KAL MI
Sbjct  310   HVGPIHGLTQTSGQEDAARFRSITVKDYVQMKAKNLDKALSMI  352



>ref|XP_009400517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 150/344 (44%), Positives = 208/344 (60%), Gaps = 18/344 (5%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDL--YDPQAVDKIKMACETWGIFQV  391
             P+DF    ++PDSH W D H    +S+    VP+IDL       ++++  ACE+WG FQV
Sbjct  17    PLDFESVREVPDSHAWPDLHDHPTASAQGAVVPVIDLSATATNVLEQLARACESWGAFQV  76

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             T HGVP  LL ++E  AR  F L   +KL A R    ++GYG  RIS FF   MWSEGFT
Sbjct  77    TGHGVPPGLLRRVEAAARGVFALPTNRKLEAARPADGVSGYGRARISCFFPKLMWSEGFT  136

Query  572   VAGSPLEHARQVWPQDYS-DFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RC  736
             +AGSP++HAR +WP D +  FC V+E+Y+ +M+ LA+ L  +M   +             
Sbjct  137   IAGSPVDHARTLWPDDDALAFCDVIEEYKEEMKQLARKLMRMMLMSLGLTEAEAEAETET  196

Query  737   GMVG----LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQ--TSNITGLQVYG  898
             G +G         A LQ+N  P+CPDP RAMG A HTD++L+TLL+Q  TS +  LQV G
Sbjct  197   GWIGPGDEAGGMSAVLQLNSYPVCPDPDRAMGMAAHTDSTLLTLLFQSNTSGLQVLQVVG  256

Query  899   PN-----LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1063
                      W+ V P   A++VN+GDL QI+SNG ++SV+HRA+V++  HR+SVAY  GP
Sbjct  257   DTGRDRAARWVTVPPMPGALIVNVGDLFQILSNGRYRSVIHRAVVNRTSHRVSVAYMCGP  316

Query  1064  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                 ++ P +KL+ P   P+YRP++W  YL +K K F KAL  +
Sbjct  317   PAASKVEPIVKLVGPGSGPVYRPVTWPEYLSVKGKLFDKALASV  360



>ref|XP_010915137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Elaeis guineensis]
Length=350

 Score =   290 bits (741),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 156/337 (46%), Positives = 203/337 (60%), Gaps = 22/337 (7%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +F    +LP+SH W  L DH  V+     E VP+IDL DP+A + +  AC +WG FQVT 
Sbjct  17    EFESVRELPESHAWPTLHDHPCVS-----EPVPVIDLADPKAAEFMARACVSWGAFQVTG  71

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGV   LL  I+ + RR F L  +QKL+A R P  ++GYG V IS FF   MWSEGFT+A
Sbjct  72    HGVAPRLLEAIDSEMRRLFALPIQQKLKAARPPDGISGYGLVPISSFFAKLMWSEGFTIA  131

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMVG  748
             GSPL+HAR++WP D   FC V+E Y   M+ LA  L  LM   +      + W   G  G
Sbjct  132   GSPLDHARKLWPHDPDQFCDVIERYDQVMKALAGRLITLMLLSLGLRHEELEW--AGQTG  189

Query  749   --LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY------GPN  904
               L      L++N  P CPDP RAMG A H D+SL+T+LYQ+S  +GLQ+       GP 
Sbjct  190   KLLPDLAGVLRLNSYPACPDPDRAMGMAAHADSSLLTILYQSST-SGLQLLRAEDQNGPA  248

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P   A+VV +GDL  I+SNG FKSV+HR +V+++  R+SVAYF GP   V ++
Sbjct  249   -RWVTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSVAYFSGPPAGVRVS  307

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P  KL+ P   P YR ++W  YL +K K F KAL  I
Sbjct  308   PIGKLVGPGRAPAYRAVTWAEYLGLKRKLFDKALATI  344



>ref|XP_004135830.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CBX88045.1| gibberellin 3-oxidase, partial [Cucumis sativus]
 gb|KGN45321.1| hypothetical protein Csa_7G434970 [Cucumis sativus]
Length=374

 Score =   290 bits (743),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 209/333 (63%), Gaps = 11/333 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS----PVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +DF+   +LPDS+ W+   S     ++++   +S+PLIDL  P A   I  A  TWG FQ
Sbjct  24    LDFDSLHELPDSYDWIQPDSFPSSSLSNNHLSDSIPLIDLSLPNAPQLIGNAFRTWGAFQ  83

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             V NHGVP+ LL  IE  A   F L P  KL+A R    ++GYG VRIS FF  +MWSEGF
Sbjct  84    VINHGVPISLLHSIESSANSLFSLPPPHKLKAARPSDGISGYGLVRISSFFPKRMWSEGF  143

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNL--AALMFK*IIRP-ICW*RCG  739
             T+ GSPLEH R++WP DY+ +C +VE+Y  +M+ L   L   AL    I R  + W   G
Sbjct  144   TIVGSPLEHFRKLWPHDYTRYCDIVEEYDREMKSLCGRLMWVALGELGITREDVNW--AG  201

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  + + A  Q+N  P+CPDP RAMG   HTDTSL+T++YQ +N  GLQV      W+
Sbjct  202   PNGDFKTSNAATQLNSYPVCPDPDRAMGLGAHTDTSLLTIVYQ-NNTRGLQVLREGNRWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              VEP   A+VV +GDL+ I++NG++ S +H+A+V++   R+SVAY FGP ++ EI+P  K
Sbjct  261   TVEPVPGALVVQVGDLLHILTNGLYPSPVHQAVVNRTRKRLSVAYVFGPPESAEISPLKK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ PT+ P+YR ++W  YL  K ++F  AL  +
Sbjct  321   LLGPTQPPLYRTVTWTEYLRKKAEHFNNALSSV  353



>ref|XP_008461056.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=374

 Score =   290 bits (743),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 206/333 (62%), Gaps = 11/333 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTH----ESVPLIDLYDPQAVDKIKMACETWGIFQ  388
              DF+   +LPDS+ W+   S  NSS ++    +S+PLIDL  P A   I  A  TWG FQ
Sbjct  24    FDFDSLQELPDSYDWIQPDSFPNSSLSNNHLSDSIPLIDLSLPNAPHLIGNAFRTWGAFQ  83

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             V NHGVP+ LL  IE  A   F L    KL+A R    ++GYG VRIS FF  +MWSEGF
Sbjct  84    VINHGVPISLLHSIESSANSLFSLPAPHKLKAARPSDGISGYGLVRISSFFPKRMWSEGF  143

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNL--AALMFK*IIRP-ICW*RCG  739
             T+ GSPLEH R++WP DY+ +C +VE+Y  +M+ L   L   AL    I R  + W   G
Sbjct  144   TIVGSPLEHFRKLWPHDYTRYCDIVEEYDQEMKSLCGRLMWVALGELGITREDVNW--AG  201

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G    + A  Q N  P+CPDP RAMG   HTDTSL+T++YQ +N  GLQV      W+
Sbjct  202   PNGDFMTSNAATQFNSYPVCPDPERAMGLGAHTDTSLLTIVYQ-NNTRGLQVLREGNRWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              VEP   A+VV +GDL+ I++NG++ S +H+A+V++   R+SVAY FGP ++ EI+P  K
Sbjct  261   TVEPVPGALVVQVGDLLHILTNGLYPSPVHQAVVNRTRKRLSVAYVFGPPESAEISPLKK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ PT+ P+YR ++W  YL  K ++F  AL  +
Sbjct  321   LLGPTQPPLYRTVTWTEYLRKKAEHFNNALSSV  353



>ref|NP_001275108.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
 gb|AAK91507.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
Length=373

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 147/336 (44%), Positives = 204/336 (61%), Gaps = 12/336 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWL--DDHSPVNSSSTHESVPLIDL------YDPQAVDKIKMACETW  376
              D N   +LP+SH W   +DH    +S   ES+P+IDL       +   +D I  AC+ W
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNNILDHIGHACKKW  77

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G FQ+ NH +  +LL  IE   +  F L  +QKL+A RSP  + GYG  RIS FF   MW
Sbjct  78    GAFQIINHSISEKLLQDIEVAGKTLFSLPMQQKLKAARSPDGVTGYGAARISSFFSKLMW  137

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
              EGFT+ GSP+EHARQ+W +DY+ FC V+E+Y+ +M  LA  L  L+   +      + W
Sbjct  138   FEGFTIVGSPIEHARQLWLKDYNKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKW  197

Query  728   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  907
                     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY    
Sbjct  198   AVGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGN  256

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  +R+SVAY +GP   V ++P
Sbjct  257   GWITVPPIPGALVVNIGDLLHILSNGSYPSVLHRAVVNRTRYRLSVAYLYGPPSGVRVSP  316

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               KL+     P+YR ++W+ YL  K KYF KAL  +
Sbjct  317   LSKLVDHRHPPLYRAVTWSEYLGTKAKYFDKALSSV  352



>ref|XP_006285095.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
 gb|EOA17993.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
Length=353

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 203/338 (60%), Gaps = 12/338 (4%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W            +  +P+I+L DP     ++ ACE WG+F
Sbjct  16    DRIIPLDFTSTKTLPDSHVWSKTEPETKPKPVNLPIPVINLSDPDQHVLLRQACEEWGVF  75

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGVP  LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  76    HITDHGVPGYLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  135

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             F+V GS L  HA  +WP D++DFC+V+E+YQ  M DL+  L  ++   +      + W  
Sbjct  136   FSVLGSSLRRHATLLWPDDHADFCNVMEEYQKAMDDLSLRLITMLMGSLGITHEDLGWLV  195

Query  734   CGMVGLQWT--QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP--  901
                 G +    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P  
Sbjct  196   PDKTGSETNSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIQSPQE  254

Query  902   -NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 WI VEP   ++V+ +GDL  IISNG+F++ +HRA+V+K HHR+S AYF GP KN++
Sbjct  255   EGPRWIGVEPIEGSLVIIMGDLSHIISNGLFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQ  314

Query  1079  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             I P +        P+YR + W  YL  K  +F K L +
Sbjct  315   IGPLIG--DKNHPPIYRRLVWEEYLAAKATHFNKTLTL  350



>ref|XP_002515599.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47048.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=345

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/334 (44%), Positives = 203/334 (61%), Gaps = 6/334 (2%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWG  379
              +  IIP+DF+    LP+SH W  +      +    S+P IDL DP A + I  ACETWG
Sbjct  14    HLHQIIPLDFDSIRTLPESHVW-PESGEFEFNDGQLSIPTIDLNDPDAGNLIGHACETWG  72

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             +FQV +H +P+ LL ++E + RR F L   QKL+A+RS G   GYG  RIS FF+  MW 
Sbjct  73    VFQVIHHNIPLNLLHEVESETRRLFSLPARQKLKALRSAGGAVGYGRARISHFFNKHMWH  132

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  739
             EGFT+ GSP++HARQ+WP DY  FC V+E Y+ +M++LA  L  ++FK +   I   +  
Sbjct  133   EGFTIMGSPVDHARQLWPHDYQRFCDVMEGYEKKMKELATTLMRVIFKYL--GISEEQTK  190

Query  740   MVGL-QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
              VG    + A LQ+N  P CPDP RAMG A HTDTS +T+L+Q+S   GLQ++   + W+
Sbjct  191   WVGSPGCSSAALQLNSYPYCPDPNRAMGLAPHTDTSFLTILHQSST-KGLQIFKEGVGWV  249

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKA-HHRISVAYFFGPSKNVEIAPSL  1093
              V P S A+VVN+GD + I+SN  F +VLHR I+ +    R SVA+F  PS +  + P  
Sbjct  250   LVYPTSGALVVNVGDFLHILSNARFPNVLHRVIMKECKQQRFSVAFFHCPSTDFSLFPLG  309

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                   EFP+YR +S   Y+ IK K     L +I
Sbjct  310   LSSSCGEFPLYRSVSAAEYIGIKAKNIDNPLALI  343



>ref|XP_010537951.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Tarenaya hassleriana]
Length=367

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 214/357 (60%), Gaps = 33/357 (9%)
 Frame = +2

Query  218   PMDFNKADQLPDSHTWLDDHSPVNSSST---HESVPLIDLYD-PQAVDKIKMACETWGIF  385
             P DF    +LPDS TW      + S++T    +S+P++DL D   A   +  AC TWG F
Sbjct  22    PHDFTSLCELPDSFTWTHKDDLLFSAATPDYADSLPVVDLSDHDSAASAVGHACMTWGAF  81

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QVTNHGVP+ LL  IE  +R  F+L P +K +A R    ++GYG  RI+ FF  QMWSEG
Sbjct  82    QVTNHGVPLPLLDDIEFLSRSLFQLPPHRKFKAARPENGISGYGVARIASFFHKQMWSEG  141

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  745
             FT+AGSPL+H R++WP+ +  +C+++++Y+ QM+ LA+ L             W   G +
Sbjct  142   FTLAGSPLDHFRKLWPRHHLRYCNIIKEYEEQMQKLARRL------------TWLVLGSL  189

Query  746   G-----LQW---------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  883
             G     ++W          QA +Q+N  P+CP+P RAMG A HTD++L+T+LYQ SN  G
Sbjct  190   GVTEGDIKWAGPNSDFNGAQAAIQLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQ-SNTAG  248

Query  884   LQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1063
             LQV+     W+ V P   ++VVN+GDL+ I+SNG   S LHR  V++   R SVAY +GP
Sbjct  249   LQVFKDGFGWLTVPPIPGSLVVNIGDLLHILSNGRLSSALHRVRVNQDRPRFSVAYLWGP  308

Query  1064  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALA  1234
               +V+I+P  KL+ P + P+YRP++W  YL  K  +F  AL  I    D  K+N + 
Sbjct  309   QADVQISPLPKLVSPVKPPLYRPVTWKEYLGTKATHFNNALSAI--RVDDNKNNVVG  363



>ref|XP_004158763.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
1-like [Cucumis sativus]
Length=374

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 208/333 (62%), Gaps = 11/333 (3%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHS----PVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +DF+   +LPDS+ W+   S     ++++   +S+PLIDL  P A   I  A  TWG FQ
Sbjct  24    LDFDSLHELPDSYDWIQPDSFPSSSLSNNHLSDSIPLIDLSLPNAPQLIGNAFRTWGAFQ  83

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             V NHGVP+ LL  IE  A   F L P  KL+A R    ++GYG VRIS FF  +MWSEGF
Sbjct  84    VINHGVPISLLHSIESSANSLFSLPPPHKLKAARPSDGISGYGLVRISSFFPKRMWSEGF  143

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNL--AALMFK*IIRP-ICW*RCG  739
             T+ GSPLEH R++WP DY+ +C +VE+Y  +M+ L   L   AL    I R  + W   G
Sbjct  144   TIVGSPLEHFRKLWPHDYTRYCDIVEEYDREMKSLCGRLMWVALGELGITREDVNW--AG  201

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  + + A  Q+N  P+CPDP RAMG   HTDTSL+T++YQ +N  GLQV      W+
Sbjct  202   PNGDFKTSNAATQLNSYPVCPDPDRAMGLGAHTDTSLLTIVYQ-NNTRGLQVLREGNRWV  260

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              VEP   A+VV +GDL+ I++NG++ S +H+A+V++   R+SVAY FGP ++ EI+P  K
Sbjct  261   TVEPVPGALVVQVGDLLHILTNGLYPSPVHQAVVNRTRKRLSVAYVFGPPESAEISPLKK  320

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ PT+ P YR ++W  YL  K ++F  AL  +
Sbjct  321   LLGPTQPPXYRTVTWTEYLRKKAEHFNNALSSV  353



>ref|XP_002282411.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI20992.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 210/339 (62%), Gaps = 9/339 (3%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHE--SVPLIDLYDPQAVDKIKMACET  373
             ++ IIP+DF     LP+SH W   D  P  ++   E  S+P+IDL DP A   +  ACE 
Sbjct  16    LNHIIPLDFTSVHSLPESHVWPAFDGFPFGTTYPGEKFSIPIIDLMDPNAAQLVGHACEK  75

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG FQ+T+HG+P  L   +E Q RR F L   +K++A+R P    GYG  RIS F+   M
Sbjct  76    WGAFQLTSHGLPSILTDDVESQTRRLFALPAHEKMKALRLPSGGTGYGQARISPFYPKFM  135

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+ GS ++HAR++WP DY  FC V+EDYQ +M++LA++L  +  + +       R
Sbjct  136   WHEGFTIMGSAVDHARKLWPDDYKGFCDVMEDYQKKMKELAESLLHIFLESLDISKEEYR  195

Query  734   CGMV--GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  907
                +  G +     LQ+N  P CPDP RAMG A HTD+ L T+++Q S+ +GLQ+    +
Sbjct  196   STTIQRGREACNTALQLNSYPPCPDPNRAMGLAPHTDSLLFTIVHQ-SHTSGLQILRDGV  254

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++A HRIS+AYF+GP  +  I+P
Sbjct  255   GWITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPPADSLISP  314

Query  1088  SLKLIKPTE---FPMYRPISWNAYLDIKYKYFGKALEMI  1195
                L+   +    P YR +S   Y+D+K K+  KAL ++
Sbjct  315   LCNLVSSGQQVVAPRYRSVSVKEYVDLKEKHKEKALSLL  353



>ref|XP_007161254.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
 gb|ESW33248.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
Length=351

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 206/339 (61%), Gaps = 14/339 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTH-------ESVPLIDLYDPQAVDKIK  358
              +  IIP+DF+    LPDSH W       +              +P+IDL DP A++ I 
Sbjct  15    HLHHIIPLDFSSLRTLPDSHAWPQTEDGHHHDDHDDDDHGGGSCIPIIDLMDPNAMELIG  74

Query  359   MACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKF  538
             +ACE WG FQ+ NHG+P+ ++ ++E +A++ F L  ++KL+A+RS     GYG  RIS F
Sbjct  75    LACENWGAFQLKNHGIPLNVVEEVEKEAKKLFALPADRKLKALRSAAGATGYGRARISSF  134

Query  539   FDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  718
             F   MW EGFT+ GSP + A+++WP D++ FC+++E+YQ QM+ LA+ L  +M +  +  
Sbjct  135   FPKHMWHEGFTIMGSPCDDAKKIWPNDHTRFCNIMENYQKQMKMLAEKLTQMMLR--LLG  192

Query  719   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  898
             IC    G VG +     +Q+N+ P CP+P RAMG A HTDTSL+T+L+Q S   GLQ++ 
Sbjct  193   ICEDEKGWVGSRNLCEAVQLNFYPCCPEPNRAMGLAPHTDTSLLTILHQ-SQTNGLQIFK  251

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 W+ V P+ N +VV+ GD++ I+SN  F   LHR +V+    R SVAYF+GP  +  
Sbjct  252   EGAGWVPVHPHPNTLVVHTGDILHILSNSRFPCALHRVMVNSERQRYSVAYFYGPPLDYV  311

Query  1079  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             ++P L     + FP +R +S   Y+ IK K  G+AL +I
Sbjct  312   LSPLLL----SSFPRFRSLSVKEYIAIKAKNLGQALSLI  346



>ref|XP_010049027.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81490.1| hypothetical protein EUGRSUZ_C02851 [Eucalyptus grandis]
Length=355

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 208/339 (61%), Gaps = 15/339 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTW--LDDHSP---VNSSSTHESVPLIDLYDPQAVDKIKMACETW  376
             IIP+DF+  +++P SH+W   DD SP    N    H S+P IDL  P A++    AC+  
Sbjct  18    IIPIDFDSVEEVPQSHSWPQSDDESPRRMFNLDGDHFSIPAIDLDSPDAIEMAGHACKIM  77

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             GIFQVTNHG+P  LL ++E QA RFF L    K++A+RSP    GYG  RI+ FF+  MW
Sbjct  78    GIFQVTNHGIPSSLLREVESQAWRFFTLPARAKVKALRSPSGATGYGIARIAPFFNKFMW  137

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
              EGFT+ GSPLEHAR+VWP  Y  FC V+EDYQ +M+ L++ L A++ K +      + W
Sbjct  138   HEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGISEHDVDW  197

Query  728   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  907
              R            LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+    
Sbjct  198   PRLRSNAC----TALQLNSYPRCPDPRQAMGLAPHTDTFLLTILHQNHSAHGLQVHMEGR  253

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              W+ V P + A+VVN+GD++ I+SN MF SV+HR I S+  HR++V YF+GP  +  + P
Sbjct  254   GWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPPTDFHVGP  313

Query  1088  SLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               +L + +   +   +R I+   Y+ +K +   KAL MI
Sbjct  314   IHELTQASGREDAARFRSITVKDYVQMKAENLEKALSMI  352



>gb|AGQ42610.1| GA3ox2 [Vitis vinifera]
Length=355

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 210/339 (62%), Gaps = 9/339 (3%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHE--SVPLIDLYDPQAVDKIKMACET  373
             ++ IIP+DF     LP+SH W   D  P  ++   E  S+P+IDL DP A   +  ACE 
Sbjct  16    LNHIIPLDFTSVHSLPESHVWPAFDGFPFGTTYPGEKFSIPIIDLMDPNAAQLVGHACEK  75

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG FQ+T+HG+P  L   +E Q RR F L   +K++A+R P    GYG  RIS F+   M
Sbjct  76    WGAFQLTSHGLPSILTDDVESQTRRLFALPAHEKMKALRLPSGGTGYGQARISPFYPKFM  135

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+ GS ++HAR++WP DY  FC V+EDYQ +M++LA++L  +  + +       R
Sbjct  136   WHEGFTIMGSAVDHARKLWPDDYKGFCDVMEDYQKKMKELAESLLHIFLESLDISKEEYR  195

Query  734   CGMV--GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  907
                +  G +     LQ+N  P CPDP RAMG A HTD+ L T+++Q S+ +GLQ+    +
Sbjct  196   STTIQRGHKACNTALQLNSYPPCPDPNRAMGLAPHTDSLLFTIVHQ-SHTSGLQILRDGV  254

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++A HRIS+AYF+GP  +  I+P
Sbjct  255   GWITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPPADSLISP  314

Query  1088  SLKLIKPTE---FPMYRPISWNAYLDIKYKYFGKALEMI  1195
                L+   +    P YR +S   Y+D+K K+  KAL ++
Sbjct  315   LCNLVSSGQQVVAPRYRSVSVKEYVDLKEKHKEKALSLL  353



>ref|XP_004253252.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 210/339 (62%), Gaps = 13/339 (4%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWG  379
             +  I+P+DF+   ++P+SH W + ++SP++      ++P+IDL  P  V+ I  AC+TWG
Sbjct  18    LQHILPIDFHSIQEVPNSHLWPNINNSPISHDEKKPTIPIIDLLAPNVVELIGHACKTWG  77

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             IFQV NHG+ +EL  ++E QARR F L  ++K++ VRS     GYGT RI+ FF   MW 
Sbjct  78    IFQVVNHGISLELFDEVESQARRLFALPAKEKVKVVRSTTGATGYGTARITPFFSKFMWH  137

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  739
             EGFT+  SPL+HA+++WP DY  FC V+ DYQ +M+ L+  L  L+    ++P       
Sbjct  138   EGFTIMDSPLDHAKELWPHDYKKFCDVMGDYQKKMKALSFQLWMLILN-YLQPSQ--EHS  194

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
             +   + T A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +L W  
Sbjct  195   IKSFESTGA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDLGWTS  253

Query  920   VEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
             + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P   
Sbjct  254   ITPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSVIVP---  310

Query  1097  LIKPTE----FPMYRPISWNAYLDIKYKYFGKALEMIGF  1201
             L+   +     P YR +    Y+D+K K+  K   MI F
Sbjct  311   LVSSKDNVGVVPKYRNVKVKEYIDLKAKHMEKVFSMIRF  349



>ref|XP_003529820.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN01362.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=378

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 206/340 (61%), Gaps = 12/340 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLD--DHSPVNSSSTHES---VPLIDLYDPQAVDKIKMACETWGIFQ  388
             DFN   +LPDS++W    DH   N  S +++   VP+IDL  P A + I  AC+TWG+FQ
Sbjct  21    DFNSLQELPDSYSWTQPHDHHLPNYPSNNKTKIFVPVIDLNHPNAPNLIGHACKTWGVFQ  80

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             V NH +P+ L + I+  +   F L   QKL+A RSP  ++GYG  RIS FF   MWSE F
Sbjct  81    VVNHDIPMSLFSDIQRASLALFSLPLHQKLKAARSPDGVSGYGRARISSFFPKLMWSECF  140

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+  SPL+   ++WPQDY+ +C +V +Y+A M+ LA  L  LM   +        W   G
Sbjct  141   TILDSPLDLFLKLWPQDYAKYCDIVVEYEAAMKKLAAKLMCLMLASLGITKEDTKW--AG  198

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G      A L +N  P CPDP RAMG A HTD++L+T+L+Q +N+ GLQV      W+
Sbjct  199   PKGEFNGACAALHLNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVNGLQVLKEGEGWV  257

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P    +V+N+GDL+ I+SNG++ SVLHR  V++   R SVAY +GP  NV+I+P +K
Sbjct  258   AVPPLHGGLVINVGDLLHILSNGLYPSVLHRVRVNRTQQRFSVAYLYGPPANVQISPHVK  317

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1216
             L+ PT   +YRP++WN YL  K   F KAL  +  ++ + 
Sbjct  318   LVGPTRPALYRPVTWNEYLGTKANLFNKALSAVRLSASIN  357



>dbj|BAD30036.1| gibberellin 3beta-hydroxylase2 [Daucus carota]
Length=353

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 206/330 (62%), Gaps = 12/330 (4%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW---LDDHSPVNSSSTHESVPLIDLYDP-QAVDKIKMACETWGIFQ  388
             +D N  ++LPDSH W   LD  S         ++P+IDL D       +  AC+TWG FQ
Sbjct  23    LDLNSLEELPDSHAWSSELDKLSSSPDDHGESNLPVIDLSDSINGPKHLVHACKTWGAFQ  82

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHG+  +L+  +E   R+ F L  EQKL+A R  G   GYG  RIS FF  +MWSEGF
Sbjct  83    LINHGISNQLIDSMEAATRKLFSLPIEQKLKAERQEGG-CGYGPFRISSFFPKRMWSEGF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPL+HAR +WP+DYS FC V E+YQ +M+ LA  +  +M + +      I W   G
Sbjct  142   TIVGSPLQHARLLWPEDYSVFCDVTEEYQKEMKKLAGKIMWIMLEALGITKEDIIW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G  + + A LQ+N  P+CPDP RAMG A HTD++L+++L+Q SN +GLQV+   + W+
Sbjct  200   PNGEFEASGAALQLNSYPVCPDPDRAMGLADHTDSTLLSILHQ-SNQSGLQVFQEEMGWV  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL+ I++NG + SVLHR  V++  HR S+AY +GP  + EI+P  K
Sbjct  259   TVPPVEGALVVNIGDLLHILTNGSYPSVLHRVTVNRERHRYSMAYLYGPPHSAEISPLSK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKAL  1186
             L+     P+YRP++W+ YL +K   F  AL
Sbjct  319   LVDHQHPPLYRPVTWSEYLGMKAILFYNAL  348



>ref|XP_003522638.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN08099.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=341

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 206/334 (62%), Gaps = 10/334 (3%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACET  373
              +  IIP+DF+ A  LPDSH W     +   +SSS+  S+P+IDL DP A+D I  ACE 
Sbjct  14    HLSHIIPLDFSSALSLPDSHAWPHCQPNDDASSSSSSSSIPIIDLMDPNAMDLIGHACEK  73

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG FQ+ NHG+P  ++  +E +A+R F L  EQKL+A+RSPG   GYG  RIS FF   M
Sbjct  74    WGAFQLKNHGIPFGVIEDVEEEAKRLFALPTEQKLKALRSPGGATGYGRARISPFFPKFM  133

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+ GSP   A+++WP DY+ FC ++E+Y+ QM+ LA  L  ++F   +  I   +
Sbjct  134   WHEGFTIIGSPSHDAKKIWPNDYARFCDLMENYEKQMKVLADRLTEMIFN--LMDISEEK  191

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
                VG       +Q+N+ P CP+P RAMG A HTDTSL T+L+Q S ITGLQ++     W
Sbjct  192   RKWVGASNISEAVQLNFYPSCPEPNRAMGLAPHTDTSLFTILHQ-SQITGLQIFKEGKGW  250

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
             + V P+ N +VV+ GDL+ IISN  F+  LHR  V++   R SVAYF+ P  +  ++P +
Sbjct  251   VPVHPHPNTLVVHTGDLLHIISNARFRCALHRVTVNRTWERYSVAYFYSPPMDYVVSPLV  310

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               +       +R ++   Y+ IK K FG+AL  I
Sbjct  311   HSVA-----RFRDVTVKEYIGIKAKNFGEALSFI  339



>ref|XP_009409327.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   288 bits (736),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 206/358 (58%), Gaps = 41/358 (11%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTH--ESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
              +F    ++PDSH W     PV +   H  ++VP+IDL  P A   I  ACE WG FQ+T
Sbjct  16    FEFKTLTEVPDSHAW-----PVVNDHPHGDDAVPVIDLACPDAARLIGQACEEWGAFQIT  70

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
              HGVPV+LL ++E Q RR F L   QKL+A RSPG + GYG   IS FF    WSEGFT+
Sbjct  71    GHGVPVDLLDRLEAQTRRLFSLPTGQKLKAARSPGGVTGYGIANISAFFSKLFWSEGFTI  130

Query  575   AGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGLQ  754
              GSP + AR++WP D ++FC  +E+Y + M+ L   L  LM               +GL 
Sbjct  131   VGSPHDEARKLWPDDSAEFCGAIEEYTSWMKPLGCRLMLLML------------ASLGLS  178

Query  755   -----WT-----------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGL  886
                  W               +Q+N  P CPDP RAMG A+HTD+SL T+LYQ S + GL
Sbjct  179   EGEIDWAVPSNDTTHEAPAPVIQLNSYPACPDPDRAMGLAEHTDSSLFTVLYQGS-VRGL  237

Query  887   QVYGPN-----LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAY  1051
             Q+   N       W+ V P   A+VVN+GDL  I+SNG F+SV HRAIV++   RISVAY
Sbjct  238   QLLHGNHPTRRARWVTVPPLPGALVVNVGDLSHILSNGRFQSVTHRAIVNRTQTRISVAY  297

Query  1052  FFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSN  1225
             F+GP  + +IAP  KL+ P + P YR ++W  YL +K + + +AL  I   ++ E+ +
Sbjct  298   FYGPPAHFKIAPIEKLMGPQQGPAYRAVTWPEYLTLKRRLYNQALASIRLPTEGEEES  355



>ref|XP_009108486.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Brassica rapa]
Length=350

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 209/339 (62%), Gaps = 17/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W      +        +P+I +  P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW--SKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVF  72

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGVP+ LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  73    HITDHGVPLSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  132

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             F+V  S L  HA  +WP D+++FC+V+E+YQ +M +L+  L +++   +    + + W  
Sbjct  133   FSVMDSSLRRHATLIWPDDHAEFCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKELRWLV  192

Query  734   CGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV---YG  898
               + G +   +Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++     
Sbjct  193   PNITGSRTDSSQSFLQLNSYPVCPDPDLAMGLAPHTDSSLLTILYQ-GNIPGLEIQNLQA  251

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 WI VEP    +VV +GDL  IISNG FKS +HRA+V+K HHR+S AYF GP KN++
Sbjct  252   EKSRWIGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQ  311

Query  1079  IAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1192
             I P   L   T+  P+YR ++W  YL  K  +F KAL +
Sbjct  312   IGP---LTADTDHPPLYRRLTWEEYLAAKATHFNKALSL  347



>ref|XP_006361220.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   286 bits (733),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 211/341 (62%), Gaps = 13/341 (4%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACET  373
             Q +  I+P+DF+   ++P+SH W + ++SP++    + +VP+IDL  P  V+ I  AC+T
Sbjct  16    QSLQHILPIDFHSIQEVPNSHLWHNINNSPISHDEKNPNVPIIDLLAPNVVELIGHACKT  75

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WGIFQV NHGV +EL  ++E QARR F L  EQK++ +RS     GYGT RI  FF   M
Sbjct  76    WGIFQVVNHGVSLELFDEVEFQARRLFALQVEQKVKVMRSTTGATGYGTARIMPFFSKFM  135

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+  SPL+HA+++WP DY  FC V+E+YQ +++ L+  L  L+    ++P     
Sbjct  136   WHEGFTIMDSPLDHAKELWPHDYQIFCDVMENYQKKIKALSFQLWLLILN-YLQPSQ--E  192

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
               +   +  +A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W
Sbjct  193   HSIKSFESRRA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGW  251

Query  914   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  252   TSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMIVP-  310

Query  1091  LKLIKPTE----FPMYRPISWNAYLDIKYKYFGKALEMIGF  1201
               L+   +     P YR +    YLD+K K+  K   MI F
Sbjct  311   --LVSSKDNVGVVPKYRNVKVKEYLDLKAKHLEKVFSMIRF  349



>ref|XP_010049031.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81493.1| hypothetical protein EUGRSUZ_C02855 [Eucalyptus grandis]
Length=355

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/343 (44%), Positives = 206/343 (60%), Gaps = 15/343 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW--LDDHSP---VNSSSTHESVPLIDLYDPQAVDKIKMA  364
              +  IIP+DF+   ++P SH+W   DD S     N    H S+P IDL  P A++    A
Sbjct  14    HLQHIIPIDFDSVKEVPQSHSWPQSDDESTRRMFNLDGDHFSIPAIDLDSPDAIETAGHA  73

Query  365   CETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFD  544
             C+  GIFQVTNHG+   LL ++E QA RFF L    K++A+RSP    GYG  RI+ FF+
Sbjct  74    CKIMGIFQVTNHGILSSLLREVESQAWRFFTLPARAKVKALRSPSGATGYGVARIAPFFN  133

Query  545   SQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  715
               MW EGFT+ GSPLEHAR+VWP  Y  FC V+EDYQ +M+ L++ L A++ K +     
Sbjct  134   KFMWHEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGISEH  193

Query  716   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
              I W R          A LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+
Sbjct  194   DIDWPRLRSNAC----AALQLNSYPRCPDPRQAMGLAPHTDTFLLTILHQNHSAHGLQVH  249

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  W+ V P + A+VVNLGD++ I+SN MF SV+HR I S+  HR++V YF+GP  + 
Sbjct  250   MEGRGWVPVFPMNGALVVNLGDMLHIMSNAMFPSVVHRVIPSEKRHRLTVGYFYGPPTDF  309

Query  1076  EIAPSLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              + P   L + +   +   +R ++   Y+ +K K   KAL MI
Sbjct  310   HVGPIHGLTQSSGREDAARFRSVTVKDYVQMKAKNLDKALSMI  352



>ref|NP_193900.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
 sp|Q9SVS8.1|G3OX3_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 3; AltName: Full=GA 
3-oxidase 3; Short=AtGA3ox3; Short=AtGA3ox4; AltName: Full=Gibberellin 
3 beta-hydroxylase 3 [Arabidopsis thaliana]
 emb|CAB36813.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 emb|CAB81276.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 gb|ABE66082.1| gibberellin 3 beta-hydroxylase family protein [Arabidopsis thaliana]
 gb|AEE84490.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
Length=349

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 205/339 (60%), Gaps = 18/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W    S     +T   +P+I L +P+    ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW----SKPEPETTSGPIPVISLSNPEEHGLLRQACEEWGVF  71

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGV   LL  ++ Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  72    HITDHGVSHSLLHNVDCQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  131

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  727
             F+V GS L  HA  +WP D+++FC+V+E+YQ  M DL+  L +++   +      + W  
Sbjct  132   FSVMGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLV  191

Query  728   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  901
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  192   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIESPQ  249

Query  902   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  WI VEP   ++VV +GDL  IISNG F+S +HRA+V+K HHR+S AYF GP KN+
Sbjct  250   EEGSRWIGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNL  309

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  310   QIGPLTS--DKNHPPIYRRLIWEEYLAAKATHFNKALTL  346



>gb|ABK28643.1| unknown [Arabidopsis thaliana]
Length=350

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 150/339 (44%), Positives = 205/339 (60%), Gaps = 18/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W    S     +T   +P+I L +P+    ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW----SKPEPETTSGPIPVISLSNPEEHGLLRQACEEWGVF  71

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGV   LL  ++ Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  72    HITDHGVSHSLLHNVDCQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  131

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  727
             F+V GS L  HA  +WP D+++FC+V+E+YQ  M DL+  L +++   +      + W  
Sbjct  132   FSVMGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLV  191

Query  728   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  901
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  192   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIESPQ  249

Query  902   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  WI VEP   ++VV +GDL  IISNG F+S +HRA+V+K HHR+S AYF GP KN+
Sbjct  250   EEGSRWIGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNL  309

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  310   QIGPLTS--DKNHPPIYRRLIWEEYLAAKATHFNKALTL  346



>ref|XP_008219863.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=344

 Score =   285 bits (729),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 205/334 (61%), Gaps = 14/334 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLD--DHSPVNSSSTHE-SVPLIDLYDPQAVDKIKMACETWGI  382
             +IP+D+     LP+SH WLD  D SP  + ST   S P+I+L DP A   I  ACETWG+
Sbjct  17    LIPLDYGSVRTLPESHIWLDQSDESPYVAHSTGPISPPVINLMDPDAPRLIIQACETWGV  76

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             FQ+T HG+P +L+  +E +A + F L  +QKL+A+RSPG  AGYG   IS FF+  MW E
Sbjct  77    FQLTGHGIPTKLMEDVESEAEKLFGLPVDQKLKALRSPGGGAGYGLPHISPFFNKHMWHE  136

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             GFT+ GSP+ H RQ+WPQ Y  FC  + DYQ Q++ L + L  ++FK +      + W  
Sbjct  137   GFTIMGSPIYHTRQLWPQAYQGFCETMVDYQNQLKALTEQLIRIIFKSLNINSEEVDW--  194

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
               +   Q +   LQ+N  P CPDPTRAMG A HTDTSL+T+L   S  +GLQV+     W
Sbjct  195   --LKDSQGSSTALQLNSYPACPDPTRAMGLAPHTDTSLITIL--QSKTSGLQVFKEGAGW  250

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
               V+    A++VN+GD + I+SNG+F +V HR +V+    R S A+F+ P  +V ++P +
Sbjct  251   TLVQSIPGAVIVNVGDFLHILSNGVFTTVRHRVVVTHI-QRFSAAHFYAPPGDVIVSPVM  309

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                   E P YR +S   Y++ K K+F KAL +I
Sbjct  310   SK-DFGEVPRYRSVSVKGYVETKGKHFEKALSLI  342



>emb|CDX76441.1| BnaA08g09590D [Brassica napus]
Length=350

 Score =   285 bits (730),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/339 (44%), Positives = 209/339 (62%), Gaps = 17/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W      +        +P+I +  P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW--SKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVF  72

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGVP+ LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  73    HITDHGVPLSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  132

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             F+V  S L  HA  +WP D+++FC+V+E+YQ +M +L+  L +++   +    + + W  
Sbjct  133   FSVMDSSLRRHATLIWPDDHAEFCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKELRWLV  192

Query  734   CGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV---YG  898
               + G +   +Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++     
Sbjct  193   PNITGSRTDSSQSFLQLNSYPVCPDPDLAMGLAPHTDSSLLTILYQ-GNIPGLEIQNLQA  251

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 WI VEP    +VV +GDL  IISNG FKS +HRA+V+K HHR+S AYF GP KN++
Sbjct  252   EKSRWIGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQ  311

Query  1079  IAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1192
             I P   L   T+  P+YR ++W  YL  K  +F +AL +
Sbjct  312   IGP---LTADTDHPPLYRRLTWEEYLAAKATHFNEALSL  347



>emb|CDY31424.1| BnaC03g64000D [Brassica napus]
Length=350

 Score =   285 bits (728),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 207/339 (61%), Gaps = 17/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W      +        +P+I +  P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW--SKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVF  72

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGVP+ LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  73    HITDHGVPLSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  132

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  733
             F+V  S L  HA  +WP D+++FC+V+E+YQ +M +L+  L +++   +    +   W  
Sbjct  133   FSVMDSSLRRHATLLWPDDHAEFCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKEFRWLV  192

Query  734   CGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV---YG  898
               + G +   +Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++     
Sbjct  193   PNITGSRTNSSQSFLQLNSYPVCPDPDLAMGLAPHTDSSLLTILYQ-GNIPGLEIQNLQA  251

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 WI VEP    +VV +GDL  IISNG FKS +HRA+V+K HHR+S AYF GP KN+ 
Sbjct  252   EKSRWIGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLH  311

Query  1079  IAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1192
             I P   L   T+  P+YR ++W  YL  K  +F KAL +
Sbjct  312   IGP---LTADTDHPPLYRRLTWEEYLAAKATHFNKALSL  347



>emb|CDY38661.1| BnaC02g23180D [Brassica napus]
Length=358

 Score =   285 bits (729),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 144/329 (44%), Positives = 203/329 (62%), Gaps = 8/329 (2%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             DF     LPDS+TW   D    ++SS+ ES+P IDL DP    ++  AC TWG FQ+TNH
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
             GVP  LL  IE      F L   +KL+A R    ++GYG  RI+ FF+ QMWSEGFTV G
Sbjct  83    GVPSRLLDDIEFLTGSLFRLPVHRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIG  142

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG-  748
             SPL+   ++WP+ +  +C ++++Y+  M+ LA  L  L    +    + I W   G +  
Sbjct  143   SPLDDFHKLWPKQHLKYCKIIQEYEEHMQKLAAKLMWLALGSLGVEEKDIEW--AGPISD  200

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQV+  ++ WI V P
Sbjct  201   FQGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLMTILYQ-NNTAGLQVFRDDVGWITVPP  259

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                ++VVNLGDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  KL+ P
Sbjct  260   VPGSLVVNLGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDP  319

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                P+Y  ++W  YL  K  +F ++L  I
Sbjct  320   LHSPLYPSLTWKQYLATKATHFNQSLSFI  348



>ref|XP_002869872.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46131.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 151/339 (45%), Positives = 205/339 (60%), Gaps = 19/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W    S     +T   +P+I L +P+    ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW----SKPEPETTTRPIPVISLSNPEH-GLLRQACEEWGVF  70

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGV   LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  71    HITDHGVSHSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  130

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALM---FK*IIRPICW--  727
             F+V GS L  HA  +WP D+++FC+V+E+YQ  M DL+  L +++    +     + W  
Sbjct  131   FSVMGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLRLTREDLGWLV  190

Query  728   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  901
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  191   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIESPQ  248

Query  902   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  WI VEP   ++VV +GDL  IISNG F+S +HRA+V+K HHR+S AYF GP KN+
Sbjct  249   EEGSRWIGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNL  308

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  309   QIGPLTS--DKNHPPIYRRLIWEEYLAAKATHFNKALNL  345



>ref|XP_007135716.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
 gb|ESW07710.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
Length=374

 Score =   285 bits (730),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 208/339 (61%), Gaps = 12/339 (4%)
 Frame = +2

Query  224   DFNK-ADQLPDSHTWL----DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             DFN    Q P+S+ W     D H   + ++T  +VP+ID  DP A + I  AC+TWG+FQ
Sbjct  22    DFNSLQQQFPESYAWTQPDSDHHHHYSDNTTTNTVPVIDFKDPNASNLIGHACKTWGVFQ  81

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHG+P++L   I+      F L   QKL+A RSP  +AGYG  RIS FF   MWSE F
Sbjct  82    LVNHGIPIKLFTDIQTACLALFSLPLHQKLKAARSPDGVAGYGRARISSFFPKLMWSECF  141

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+  SPL    Q+WPQ+Y+ +C +V++Y+A M+ LA  L  L+   +      I W   G
Sbjct  142   TILDSPLHLFLQLWPQEYAKYCEIVKEYEAAMKKLAAKLMCLVLASLGISKEDIKW--AG  199

Query  740   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
               G      A L +N  P CPDP RAMG A HTD++L+T+L+Q +N++GLQV      W+
Sbjct  200   PRGEFNGACAALHLNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVSGLQVLKDGEGWV  258

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              + P +  +V+N+GDL+ I+SNG++ SVLHR  V+++  R SVAY +GP  NVEI+P+ K
Sbjct  259   ALPPLAGGLVINIGDLLHILSNGLYPSVLHRVRVNRSRQRFSVAYLYGPPTNVEISPNEK  318

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDV  1213
             L+ P    +++ ++WN YL  K K+F KAL  +  +S +
Sbjct  319   LVGPGRPSLFQSVTWNEYLGKKAKHFNKALSAVRVSSSI  357



>dbj|BAD30037.1| gibberellin 3beta-hydroxylase3 [Daucus carota]
Length=344

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/331 (45%), Positives = 206/331 (62%), Gaps = 9/331 (3%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE-SVPLIDLYDPQAVDKIKMACETWGIFQ  388
             IIP+DF+  D +P+SH W   HS V      E S+PL+DL DP A   I  A E WGIFQ
Sbjct  18    IIPLDFHAVDSVPESHEW--PHSDVLRPVIDEISIPLVDLKDPNAQKLIGHASEDWGIFQ  75

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             VTNHGVP+ +L  +E +ARR F L  ++KL+ +RSP    GYG  RIS FF   MW EGF
Sbjct  76    VTNHGVPLGVLMDVEFEARRLFSLPVKEKLKVLRSPEGATGYGAARISPFFSKFMWHEGF  135

Query  569   TVAG-SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCGM  742
             T+ G S ++HA+Q+WP DY  F  V++ YQ +M++LA  +  L+ K + I          
Sbjct  136   TIIGSSSVDHAKQLWPHDYESFTDVIDVYQKKMKELAHQILLLLLKSLEISEEDITSWAA  195

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
                      LQ+N  P CP+P+RA+G A HTD+ L+T+L QT + + LQ++   + WI V
Sbjct  196   STHDSNNGALQLNSYPCCPNPSRAIGLAPHTDSLLLTILSQTHDSSALQIFRDGVGWIAV  255

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
              P  +A+VVN+GDL+ I+SNG F SV H+ IVS+  HRISVAYF+GP  + ++AP  ++ 
Sbjct  256   APVRDALVVNVGDLLHILSNGRFPSVYHQVIVSEKEHRISVAYFYGPRTDAQVAPLSRI-  314

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                E P+YR +S   ++ IK K+  KAL  +
Sbjct  315   ---EVPIYRSLSVKEFIGIKAKHLDKALSFV  342



>ref|XP_006301281.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
 gb|EOA34179.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
Length=355

 Score =   283 bits (725),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/332 (43%), Positives = 203/332 (61%), Gaps = 28/332 (8%)
 Frame = +2

Query  245   LPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             LPDS+TW   D    ++S++ ES+PLIDL DP A   +  AC TWG FQ+TNHGVP  LL
Sbjct  27    LPDSYTWSPKDDLLFSASASDESLPLIDLSDPHATTLVGNACTTWGAFQITNHGVPSRLL  86

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               IE      F L+  QKL+A R    ++GYG  RI+ FF+ +MWSEGFTV GSPL   R
Sbjct  87    DDIELLTGDLFRLSVHQKLKAARLENGVSGYGVARIASFFNKKMWSEGFTVVGSPLHDFR  146

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL----------  751
             ++WP  + ++C ++E Y+  M+ LA  L             W   G +G+          
Sbjct  147   KLWPSHHLEYCEIIEAYKEHMQKLAAKL------------MWLALGSLGVEENDIKWAGP  194

Query  752   ----QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
                 Q TQA +Q+N  PICP+P R+MG A HTD++L+T+LYQ +N  GLQV+  ++ W+ 
Sbjct  195   NSDFQGTQAAIQLNHYPICPEPERSMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDVGWVT  253

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GPS +V I+P  KL
Sbjct  254   VPPIPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPSSDVMISPLPKL  313

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             + P + P+Y  ++W  YL  K  +F  +L +I
Sbjct  314   VDPLQSPLYPSLTWKQYLATKATHFNHSLSII  345



>ref|XP_007227245.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
 gb|EMJ28444.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
Length=344

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 205/336 (61%), Gaps = 20/336 (6%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTWLD--DHSPVNSSSTHE-SVPLIDLYDPQAVDKIKMACETWGIF  385
             IP+D+     LP+SH WLD  D SP  + ST   S P+IDL DP A   I  ACETWG+F
Sbjct  18    IPLDYGSVRTLPESHIWLDQSDESPYVAHSTGPISPPVIDLMDPDAPRLIIQACETWGVF  77

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             Q+  HG+P +L+  +E +A + F L  +QKL+A+RSPG  AGYG   IS FF+  MW EG
Sbjct  78    QLIGHGIPTKLMEDVESEAEKLFGLPVDQKLKALRSPGGGAGYGLPHISPFFNKHMWHEG  137

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FT+ GSP+ H RQ+WPQ Y  FC  + DYQ Q++ L + L  ++FK +      + W   
Sbjct  138   FTIMGSPIYHTRQLWPQAYQGFCETMVDYQNQLKALTEQLIRIIFKSLNINSEEVDW---  194

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
              +   Q +   LQ+N  P CPDPTRAMG A HTDTSL+T+L   S  +GLQV+     WI
Sbjct  195   -LKDSQGSSTALQLNSYPACPDPTRAMGLAPHTDTSLITIL--QSKTSGLQVFKEGAGWI  251

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V+P   A++VN+GD + I+SNG+F +V HR +V+    R S A+F+ P  +V ++P + 
Sbjct  252   LVQPIPGALIVNVGDFLHILSNGVFTTVRHRVVVTHI-QRFSAAHFYAPPGDVIVSPVMS  310

Query  1097  LIKPTEF---PMYRPISWNAYLDIKYKYFGKALEMI  1195
                  +F   P Y  +S   Y++ K K+F KAL +I
Sbjct  311   ----KDFGGVPRYHSVSVKGYVESKGKHFEKALSLI  342



>ref|XP_009128433.1| PREDICTED: gibberellin 3-beta-dioxygenase 2 [Brassica rapa]
Length=358

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 204/329 (62%), Gaps = 8/329 (2%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             DF     LPDS+TW   D    ++SS+ ES+P IDL DP    ++  AC TWG FQ+TNH
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
             GVP  LL  IE      F+L   +KL+A R    ++GYG  RI+ FF+ QMWSEGFTV G
Sbjct  83    GVPSRLLDDIEFLTGSLFQLPVHRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIG  142

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG-  748
             SPL+   ++WP+ +  +C ++++Y+  M+ LA  L  L    +    + I W   G +  
Sbjct  143   SPLDDFHKLWPRQHLKYCKIIQEYEEHMQKLAAKLMWLALGALGVEEKDIEW--AGPISD  200

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQ++  ++ WI V P
Sbjct  201   FQGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQIFRDDVGWITVPP  259

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  KL+ P
Sbjct  260   VPGSLVVNVGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDP  319

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                P+Y  ++W  YL  K  +F ++L  I
Sbjct  320   LHSPLYPSLTWKQYLATKATHFNQSLSFI  348



>emb|CDY37589.1| BnaA02g19810D [Brassica napus]
Length=358

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 203/328 (62%), Gaps = 6/328 (2%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNH  400
             DF     LPDS+TW   D    ++SS+ ES+P IDL DP    ++  AC TWG FQ+TNH
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  401   GVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAG  580
             GVP  LL  IE      F+L   +KL+A R    ++GYG  RI+ FF+ QMWSEGFTV G
Sbjct  83    GVPSRLLDDIEFLTGSLFQLPVNRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIG  142

Query  581   SPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGL  751
             SPL+   ++WP+ +  +C ++++Y+  M+ LA  L  L    +    + I W    +   
Sbjct  143   SPLDDFHKLWPRQHLKYCKIIQEYEEHMQKLAAKLMWLALGALGVEEKDIEW-AGPISDF  201

Query  752   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  931
             Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQ++  ++ WI V P 
Sbjct  202   QGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQIFRDDVGWITVPPV  260

Query  932   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1111
               ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  KL+ P 
Sbjct  261   PGSLVVNVGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPL  320

Query  1112  EFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               P+Y  ++W  YL  K  +F ++L  I
Sbjct  321   HSPLYPSLTWKQYLATKATHFNQSLSFI  348



>gb|AFK49394.1| unknown [Lotus japonicus]
Length=362

 Score =   283 bits (724),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 204/341 (60%), Gaps = 19/341 (6%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTW---LDDHSP--VNSSSTHESVPLIDLYDPQAVDKIKMACETW  376
             IIP+DF+ A  LP+SH W    DDH    +++S+   S+P+IDL DP A++ I  ACE W
Sbjct  24    IIPLDFSSAPNLPESHAWSLSKDDHDDDYLSNSNGSPSIPIIDLMDPNAMELIGHACENW  83

Query  377   GIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMW  556
             G FQ+ NHG+P+ ++ ++E++A+R F L  + KL+A+RS G   GYG+ RIS FF   MW
Sbjct  84    GAFQLKNHGIPLSIIQEVENEAKRLFALPADHKLKALRSSGGATGYGSARISPFFPKFMW  143

Query  557   SEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RC  736
              EGFT+ GSP E  +++WP DY+ FC ++E+YQ QM+ LA+ L  +M   +         
Sbjct  144   HEGFTIMGSPSEDVKKIWPNDYARFCDLMENYQKQMKVLAEQLTRMMLNFLDI-----SN  198

Query  737   GMVGLQW-------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
             G    QW           +Q N+ P CPDPTRAMG A HTDTSL T+L+QT   TGLQV+
Sbjct  199   GENKSQWDIGSSSNMCGVVQPNFYPPCPDPTRAMGLAPHTDTSLFTILHQTQTATGLQVF  258

Query  896   GPNLN-WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1072
                   W+ V P+ N +VVN GDL  I+SN  F+  LHR   +K   R SVAYF  P  +
Sbjct  259   NEGTKAWVPVHPHRNLLVVNTGDLFHIMSNARFRCALHRVTTNKTVQRYSVAYFHCPPSD  318

Query  1073  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               + P +  +       +R ++   Y+ IK K FG+AL +I
Sbjct  319   YVVFPLVGGVN-NSVARFRGVTVKEYVGIKSKNFGEALSLI  358



>ref|XP_008811603.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Phoenix dactylifera]
Length=349

 Score =   282 bits (722),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 198/335 (59%), Gaps = 16/335 (5%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVT  394
             ++F    +LP+SH W  L DH  V+     E VP+ID+ DP+A + +  AC +WG FQVT
Sbjct  15    LEFESVHELPESHAWPTLHDHPCVS-----EPVPVIDMADPKAAEFMARACVSWGAFQVT  69

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
              HGV   LL  I+ + RR F L  +QKL+A R    ++GYG V IS FF   MWSEGFT+
Sbjct  70    GHGVAPRLLESIDSEMRRLFALPTQQKLKAARPADGVSGYGLVPISSFFAKLMWSEGFTI  129

Query  575   AGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMV  745
             AGSPL+HAR++WP D   FC  +E Y  +M+ LA  L  LM   +      + W   G  
Sbjct  130   AGSPLDHARKLWPHDPDQFCDAIERYDREMKALAGRLIRLMLLSLGLSDEEVEWAGQGGE  189

Query  746   GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-----LN  910
                     L++N  P CPDP RAMG A H D+SLVT+LYQ+S  +GLQV           
Sbjct  190   LPPDLAGVLRLNSYPACPDPDRAMGMAAHADSSLVTILYQSST-SGLQVLRAEDQNSPAR  248

Query  911   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
             W+ V P   A+VV +GDL  I+SNG FKSV+HR +V+++  R+S AYF GP   V ++P 
Sbjct  249   WVTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSAAYFCGPPAGVTVSPI  308

Query  1091  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              KL+ P   P YR ++W  YL +K + F KAL  I
Sbjct  309   EKLVGPGRAPAYRAVTWAEYLGLKRELFDKALATI  343



>ref|XP_004498636.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=361

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 137/340 (40%), Positives = 206/340 (61%), Gaps = 14/340 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTW------LDDH--SPVNSSSTHESVPLIDLYDPQAVDKI  355
              +  IIP+DF+    LPDSH W       +DH  S +N       +P+IDL DP A+++I
Sbjct  15    HLHHIIPLDFSSFRTLPDSHAWPQSNDDCNDHLTSNINGCFDESCIPIIDLNDPNAMEQI  74

Query  356   KMACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISK  535
              +ACE WG FQ+ NHG+P+ L+ ++E +A+RFF L  ++K++A+RS G   GYG  RIS 
Sbjct  75    GLACEKWGAFQLRNHGIPLNLIEEVEEEAKRFFSLPSKEKVKALRSSGGATGYGRARISP  134

Query  536   FFDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIR  715
             FF   MW EGFT+ GSP   A+++WP DY  FC  +E+Y+ QM+ L++ +  ++F   I 
Sbjct  135   FFPKYMWHEGFTIMGSPSNDAKKIWPNDYKRFCDKMENYENQMKMLSEKVTKMIFN--IL  192

Query  716   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
              I       VG       +Q+N+ P CPDP +AMG A HTDTSL+T+L+Q S  +GLQ++
Sbjct  193   GISQQENKWVGSNNHCGAIQLNFYPSCPDPNKAMGLAPHTDTSLLTILHQ-SQTSGLQIF  251

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                + ++ V P+ N ++V+ GD++ I+SN  F+  LHR +V+   +R SVAYF+ P  + 
Sbjct  252   KEGVGYVPVHPHPNTLIVHTGDILHILSNSRFRCALHRVVVNNVKNRYSVAYFYVPPIDY  311

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              + P    +     P +R +S   Y+ IK K  G AL +I
Sbjct  312   LVQP---FVPTNSLPRFRSLSVKEYIGIKAKNLGGALSLI  348



>gb|ADK71016.1| gibberellin 3-beta-hydroxylase [Trigonella foenum-graecum]
Length=292

 Score =   280 bits (717),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/291 (47%), Positives = 186/291 (64%), Gaps = 4/291 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+  NS+++   VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL  I   
Sbjct  3     THLDDHTLNNSNTSSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIHWL  62

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WPQD
Sbjct  63    GQTLFSLPSHQKLKAIRSPDGVSGYGLARISTFFPKLMWSEGFTIVGSPLDHFRQLWPQD  122

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+ +C +V  Y   M+ LA  L  LM   +      I W       ++   A LQ+N  P
Sbjct  123   YAKYCDIVLQYDETMKILAGKLMFLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYP  182

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A+HTD++ +T+L Q ++I+GLQV   +  W+ V P    +VVN+GDL  
Sbjct  183   SCPDPDHAMGLARHTDSTFLTILSQ-NDISGLQVQREDFGWVTVPPLQGGLVVNVGDLFH  241

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             I+SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   ILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQPPL  292



>ref|XP_004240225.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 207/337 (61%), Gaps = 8/337 (2%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACET  373
             Q    I+P+DF+   ++P+SH W + ++ P+N    + +VP+IDL  P  V  I  AC+T
Sbjct  15    QSPQHILPIDFHLIQEVPNSHLWPNINNFPINHDEKNPNVPIIDLLAPNVVQLIGHACKT  74

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WGIFQV NHG+ ++   ++E QARR F L  E+K++ +RS     GYGT RI+ FF   M
Sbjct  75    WGIFQVINHGISLDFFDEVESQARRLFALPVEEKVKVMRSTSGATGYGTARITPFFSKFM  134

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  733
             W EGFT+  SPL+HA+++WP DY +FC V+E+YQ +M+ L+  L   +    ++P     
Sbjct  135   WHEGFTIMDSPLDHAKKLWPHDYQEFCDVMENYQKKMKALSFQLWLFILN-YLQPSQ--E  191

Query  734   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
               +   ++TQA LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W
Sbjct  192   HLINSFEFTQA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQEW  250

Query  914   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1090
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  251   TSITPISNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSTIVPL  310

Query  1091  LKLIKPTE--FPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +   K      P YR +    YL +K K+  K   +I
Sbjct  311   VSFDKNVGVVVPKYRKVKVKEYLSLKAKHLEKVFSLI  347



>gb|AGH39958.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=293

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 185/291 (64%), Gaps = 4/291 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ +  S+T+ SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+  
Sbjct  4     THLDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWL  63

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H +Q+WPQD
Sbjct  64    GQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQD  123

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  124   YAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYP  183

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++ +T+L Q +NI+GLQV      W+ V P    +VVN+GDL  
Sbjct  184   SCPDPDHAMGLAPHTDSTFLTILSQ-NNISGLQVQREGFGWVTVPPLHGGLVVNVGDLFH  242

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  243   ILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  293



>ref|XP_006413746.1| hypothetical protein EUTSA_v10026853mg [Eutrema salsugineum]
 gb|ESQ55199.1| hypothetical protein EUTSA_v10026853mg [Eutrema salsugineum]
Length=354

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 147/341 (43%), Positives = 210/341 (62%), Gaps = 17/341 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LPDSH W +    +    T   +P+I L +P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVWSEPEPVLEPEPTIRPIPIISLSNPEQV-LLRHACEEWGVF  74

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HG+P  LL  +  Q ++ F L   +K+ A+RSP    GYG  RIS F+D  MWSEG
Sbjct  75    HITDHGIPHSLLQNVGCQMKKLFSLPMHRKILAIRSPDESTGYGVARISMFYDKLMWSEG  134

Query  566   FTVAGSPLE-HARQVW--PQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
             F+V GS L+ HA+ +W  P D++DFC+V+E+YQ +M DL+  L +++   I      + W
Sbjct  135   FSVMGSSLQRHAKILWPDPDDHTDFCNVMEEYQKEMGDLSHRLVSMVMGTIGLTHEELRW  194

Query  728   *RCGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  901
                 + G +    Q++LQ+N  P+C DP  AMG A HTD+SL+T+LYQ  NI+GL++  P
Sbjct  195   LEPDIAGTRTDSIQSFLQLNSYPVCSDPHLAMGLAPHTDSSLLTILYQ-GNISGLEIQNP  253

Query  902   ---NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1072
                   WI V+P  + +VV +GDL  IISNG FKS +HR +V+K HHR++ AYF GP KN
Sbjct  254   QEEESRWIGVDPIEDGLVVIMGDLSHIISNGRFKSTMHRVVVNKTHHRVTAAYFSGPPKN  313

Query  1073  VEIAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1192
             ++I P   LI   +  P+YR + W  YL  K  +F KAL +
Sbjct  314   LQIGP---LINDKDHPPIYRRLIWEEYLAAKATHFNKALTL  351



>gb|ADK71017.1| gibberellin 3-beta-hydroxylase [Trigonella gladiata]
Length=301

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 143/301 (48%), Positives = 191/301 (63%), Gaps = 8/301 (3%)
 Frame = +2

Query  254   SHTW--LDDHSPVNSSSTHES--VPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             S+TW  LDDH+  NS++   S  VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  2     SYTWTHLDDHTLNNSNTNTSSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  61

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               I    +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  62    DDIHCLGQTLFSLPSHQKLKAIRSPDGVSGYGLARISTFFPKLMWSEGFTIVGSPLDHFR  121

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+ +C +V  Y   M+ LA  L +LM   +      I W       ++   A L
Sbjct  122   QLWPQDYAKYCDIVLQYDETMKKLAGKLMSLMLDSLGITKEDIKWASSKAQFVENASAAL  181

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  182   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLQGGLVVN  240

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRP  1132
             +GDL  I+SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+ P+YR 
Sbjct  241   VGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQPPLYRS  300

Query  1133  I  1135
             +
Sbjct  301   V  301



>ref|NP_001274405.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28483.1| GA 3-oxidase [Cucumis sativus]
Length=353

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 199/337 (59%), Gaps = 13/337 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACET  373
             I+P+DF+    +PDSH W +      SSS+H       S+PLIDL DP A+  I  ACET
Sbjct  19    IVPLDFDSLRTIPDSHDWFNSSLETPSSSSHHHTNVNVSIPLIDLTDPNAISLIGNACET  78

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG+FQ+ NH VPV L+ + E + RR F+L   +KL+A+R+PG + GYG  RI+ FF   M
Sbjct  79    WGVFQLINHDVPVSLIERAEGETRRLFDLPMTRKLKALRAPGDVTGYGLPRITPFFSKYM  138

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK--*IIRPICW  727
             W EGFT+ G  + HA Q+WP +Y  FC V+E+YQ +M+ LA+ +   +F    I     W
Sbjct  139   WHEGFTIMGPSIGHASQLWPSNYQPFCDVMEEYQRKMKSLAEQITRSIFNYLKISDGANW  198

Query  728   *R-CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
                 G          LQ+N  P CPDPTR MG A HTDT L+T+L+QT    GLQV+   
Sbjct  199   LHSAGSTEAAACSTALQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQTRT-CGLQVFRDG  257

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P   A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYF+GP  +  ++
Sbjct  258   FGWVPVAPVPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFYGPPPDFCVS  317

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P   L  P E P YR +    Y+ +K K    AL MI
Sbjct  318   P---LYDPPESPCYRSVMVKDYVRLKAKNLENALSMI  351



>gb|KGN62899.1| hypothetical protein Csa_2G379300 [Cucumis sativus]
Length=372

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 147/337 (44%), Positives = 199/337 (59%), Gaps = 13/337 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACET  373
             I+P+DF+    +PDSH W +      SSS+H       S+PLIDL DP A+  I  ACET
Sbjct  38    IVPLDFDSLRTIPDSHDWFNSSLETPSSSSHHHTNVNVSIPLIDLTDPNAISLIGNACET  97

Query  374   WGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQM  553
             WG+FQ+ NH VPV L+ + E + RR F+L   +KL+A+R+PG + GYG  RI+ FF   M
Sbjct  98    WGVFQLINHDVPVSLIERAEGETRRLFDLPMTRKLKALRAPGDVTGYGLPRITPFFSKYM  157

Query  554   WSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK--*IIRPICW  727
             W EGFT+ G  + HA Q+WP +Y  FC V+E+YQ +M+ LA+ +   +F    I     W
Sbjct  158   WHEGFTIMGPSIGHASQLWPSNYQPFCDVMEEYQRKMKSLAEQITRSIFNYLKISDGANW  217

Query  728   *R-CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
                 G          LQ+N  P CPDPTR MG A HTDT L+T+L+QT    GLQV+   
Sbjct  218   LHSAGSTEAAACSTALQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQTRT-CGLQVFRDG  276

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1084
               W+ V P   A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYF+GP  +  ++
Sbjct  277   FGWVPVAPVPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFYGPPPDFCVS  336

Query  1085  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             P   L  P E P YR +    Y+ +K K    AL MI
Sbjct  337   P---LYDPPESPCYRSVMVKDYVRLKAKNLENALSMI  370



>gb|ADK71025.1| gibberellin 3-beta-hydroxylase [Trifolium microdon]
Length=300

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 188/302 (62%), Gaps = 12/302 (4%)
 Frame = +2

Query  245   LPDSHTW--LDDHSP-----VNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHG  403
             LP S+TW  LDDH+      +   S++ SVP+IDL D  A   I  AC+TWG++QV NHG
Sbjct  1     LPQSYTWTNLDDHTTNSNNIMKDPSSNTSVPIIDLSDTNASKLIGHACKTWGVYQVVNHG  60

Query  404   VPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGS  583
             +P+ LL  I+   +  F L   QKL+A+RSP  + GYG  RIS FF   MWSEGFT+ GS
Sbjct  61    IPLSLLDDIQWVGQSLFSLPSHQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGS  120

Query  584   PLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQ  754
             PL+H +Q+WP+DY+ +C +V  Y   M+ LA+ L  LM   +      I W        +
Sbjct  121   PLDHFQQLWPKDYAKYCDIVLQYDEAMKKLAEKLMLLMLDSLGITKEDIIW-ASSKAQFE  179

Query  755   WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNS  934
                A +Q+N  PICPDP RAMG A HTD++ +T+L Q S+I+GLQV      W+ V P  
Sbjct  180   KACAAMQLNSYPICPDPDRAMGLAPHTDSTFLTILSQ-SDISGLQVQREGFGWVTVPPLH  238

Query  935   NAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1114
               +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  239   GGLVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKLVGPTQ  298

Query  1115  FP  1120
              P
Sbjct  299   LP  300



>gb|ADK71013.1| gibberellin 3-beta-hydroxylase [Trigonella corniculata]
Length=297

 Score =   278 bits (711),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 142/298 (48%), Positives = 187/298 (63%), Gaps = 12/298 (4%)
 Frame = +2

Query  260   TWLDDHSPVNS------SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS      S+T  SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  2     THLDDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  61

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               I    +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H +
Sbjct  62    DDIHSVGQTLFSLPSNQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQ  121

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGL-QWTQAY  769
             Q+WPQDY  +C +V  Y   M+ LA  L  LM   +      I W  C      +   A 
Sbjct  122   QLWPQDYXKYCDIVLQYDETMKKLAGKLMWLMLDSLGITKEDIKW-ACSKAQFDEQACAA  180

Query  770   LQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVV  949
             LQ+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    L W+ V P    +VV
Sbjct  181   LQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQQEGLGWVTVPPLHGGLVV  239

Query  950   NLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             N+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P+ KL+ PT+ P+
Sbjct  240   NVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPNAKLVGPTQPPL  297



>ref|XP_010670743.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/339 (42%), Positives = 212/339 (63%), Gaps = 11/339 (3%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKM  361
             E + I P+DF+    +P+SH W+  +    + + ++      SVP+I+L D   ++ I  
Sbjct  14    EHNLIAPLDFSLIKDVPESHAWIQSNDLKENPNINKKELGLISVPIINLEDANVLELIFN  73

Query  362   ACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFF  541
             ACETWG+FQVTNHG+  +LL Q+E +A++ F L  E+K++ +RSP +  GYG  RI+ FF
Sbjct  74    ACETWGMFQVTNHGISKQLLEQVEFEAKKLFNLPFEEKMKTLRSPEAATGYGYPRITPFF  133

Query  542   DSQMWSEGFTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  718
                MW+EGFT+ G+ L +HA+ +WP D+  FC V+E+YQ +M+DL+  L  L+ K +  P
Sbjct  134   SKLMWNEGFTIMGNSLIDHAKILWPNDFQGFCDVMEEYQTRMKDLSDKLMGLLLKSLNIP  193

Query  719   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  898
               + +     L      LQ+N  P CP+PTR MG AQHTDT L T+L+Q++N +GLQV+ 
Sbjct  194   GPYMKEMDNDLC---TALQLNSYPTCPNPTRTMGLAQHTDTFLFTILHQSANASGLQVFI  250

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 W+ V+P+  A+VVN+GDL+ IISN  F S +HRA+V+ A  R+S AYF+GP  + +
Sbjct  251   DGPGWVSVDPHPGALVVNVGDLLHIISNARFPSAIHRAVVNNATQRLSFAYFYGPPLDFQ  310

Query  1079  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +AP L      E P ++ +    Y+ IK KY   AL  +
Sbjct  311   VAPFLDY-PGCEGPTFKSLKVKEYVGIKSKYLDMALSFV  348



>ref|XP_010434144.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Camelina sativa]
Length=351

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 149/339 (44%), Positives = 205/339 (60%), Gaps = 16/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LP+SH W        + S    +P+I L +P     ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPNSHVWSKTEPEPKTMSL--PIPVISLSNPDQHLLLRQACEEWGVF  73

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGVP  LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  74    HITDHGVPRSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  133

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  727
             F+V GS L  HA  +WP D+++FC+V+E+YQ  M DL+  L  ++   +      + W  
Sbjct  134   FSVLGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSLRLITMLMASLGLTHEDLGWLV  193

Query  728   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  901
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  194   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIQSPQ  251

Query  902   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  WI VEP   ++V+ +GDL  IISNG F++ +HRA+V+K HHR+S AYF GP KN+
Sbjct  252   EEGSRWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRVSAAYFAGPPKNL  311

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             +I P L   K    P+YR + W  YL  K  +F +AL +
Sbjct  312   QIGP-LACDK-NHPPIYRRLLWEEYLAAKATHFNRALTL  348



>ref|XP_003588693.1| Gibberellin 3-beta-dioxygenase [Medicago truncatula]
 gb|AES58944.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=359

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 201/339 (59%), Gaps = 17/339 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWL---DDHSPV--------NSSSTHESVPLIDLYDPQAVDKIK  358
             IIP+DF+    LPDSH W    DD S          N       +P+IDL DP A+++I 
Sbjct  19    IIPLDFSSFRTLPDSHAWPQSNDDGSDNFTSNGCYDNDDEDGSCIPIIDLNDPNAMEQIG  78

Query  359   MACETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKF  538
             +ACE WG FQ+ NHG+P+  + ++E +A+R F L  ++KL+A+RS G   GYG  RIS F
Sbjct  79    LACEKWGAFQLKNHGIPLNFIEEVEEEAKRLFSLPSKEKLKALRSAGGGTGYGRARISPF  138

Query  539   FDSQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  718
             F   MW EGFT+ GSP   A+++WP DY  FC  +E+YQ QM+ LA+ L  ++    I  
Sbjct  139   FPKFMWHEGFTIMGSPSNDAKKIWPNDYKRFCDTMENYQKQMKTLAEKLTNMILN--ILG  196

Query  719   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  898
             I   +   +G       +Q+N+ P CPDP +AMG A HTDTSL T+L+Q S   GLQ++ 
Sbjct  197   ISQEQNKWIGSNNHVGAMQLNFYPCCPDPKKAMGLAPHTDTSLFTILHQ-SQTNGLQLFK  255

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
               + ++ V+P+ N +VVN GD++ I+SN  F+  LHR +V+    R SVAYF+GP  +  
Sbjct  256   EGVGYVPVDPHPNTLVVNTGDILHILSNSRFRCSLHRVVVNDISDRYSVAYFYGPPVDYL  315

Query  1079  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             ++P    +     P +R ++   Y+ IK K  G AL +I
Sbjct  316   VSPC---VGDNSLPRFRALTVKDYIGIKAKNLGGALSLI  351



>ref|XP_006338004.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   279 bits (713),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/336 (42%), Positives = 208/336 (62%), Gaps = 6/336 (2%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWLDDHSPVNS-SSTHESVPLIDLYDPQAVDKIKMACETWG  379
             +  I+P+DF    ++P+SH W   ++ + S +  + +VP+IDL  P  V+ +  AC+TWG
Sbjct  17    LQHILPIDFQSIQEVPNSHLWPKINNVLTSHNDKNPNVPIIDLLAPNVVELMGHACKTWG  76

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             IFQV NHGV +EL  ++E+QARRFF L  EQK++ +RS     GYGT RI+ FF   MW 
Sbjct  77    IFQVVNHGVSLELFDEVEYQARRFFALPAEQKVKVMRSTSGATGYGTARITPFFSKFMWH  136

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  739
             EGFT+  SPL+HA+++WP DY  FC V+E+YQ +M+ L+  L   +    ++P    +  
Sbjct  137   EGFTIMDSPLDHAKKLWPHDYHKFCDVMENYQKKMKVLSFQLCLFILN-YLQP-SQDQHS  194

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
             +   ++  A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W  
Sbjct  195   INSFEFAGA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGWTS  253

Query  920   VEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
             + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I+P + 
Sbjct  254   IAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMISPLVS  313

Query  1097  LIKPTEFPM-YRPISWNAYLDIKYKYFGKALEMIGF  1201
                     + YR +    YL +K K+  K   MI F
Sbjct  314   SKDNDGVVLKYRNVKVKEYLGLKAKHLEKVFSMIRF  349



>ref|XP_009385827.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   279 bits (714),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 202/333 (61%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNS-SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             ++ N    +PD++ W    S +N      + VP++DL  P AV  I  ACE WG FQ+T 
Sbjct  12    LELNTLSHVPDAYAW----SALNDLPYGDDVVPVVDLASPDAVGLIGRACEEWGAFQITG  67

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HG+P+ LL ++E Q R  F L   QKL+A R PGSL+GYG    S F+ +  WSEGFT+ 
Sbjct  68    HGIPLHLLDRVEAQTRLLFSLPTAQKLKAARGPGSLSGYGLANTSSFYSNIFWSEGFTII  127

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQN-LAALMFK*IIRPICW*RCGMVGLQ  754
             GSP + AR++WP+DY ++C V+E+Y   ++ L+   L ++M    +        G+  L 
Sbjct  128   GSPYDDARKLWPEDYEEYCCVMEEYNRLIKALSGRLLRSMMLSLGLHEEDMDWAGL--LS  185

Query  755   WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY------GPNLNWI  916
                  LQ+N+ P CP+P RA+G A HTD+S +T+LYQ+S  +GLQ+       GP   W+
Sbjct  186   KADPVLQLNYYPACPEPDRAIGIAHHTDSSFITILYQSSGESGLQLVHREDAAGP-ARWV  244

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V P   A+VVN+GDL +I+ NG  +SV+HRAIV++   R+SVAYF GP +   +AP  K
Sbjct  245   TVPPRRGALVVNVGDLCEIVFNGRIRSVMHRAIVNRTQTRVSVAYFCGPPRQFNVAPIGK  304

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             L+ P E P YR +SW  +L +K K + K LE +
Sbjct  305   LVGPNERPAYRAMSWPEFLSLKRKLYNKTLEYL  337



>ref|XP_008445137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=369

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 201/339 (59%), Gaps = 16/339 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNS---------SSTHESVPLIDLYDPQAVDKIKMA  364
             I+P+DF+    +PDSH WL       S         ++   S+PLIDL D  A+  I  A
Sbjct  34    IVPLDFDSLRTIPDSHDWLHSSPETPSSSSSSSCYHTNVDVSIPLIDLTDHDAIALIGNA  93

Query  365   CETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFD  544
             CETWG+FQ+ NH VP+ L+ + E + RR F+L   +KL+A+R+P  + GYG  RI+ FF 
Sbjct  94    CETWGVFQLINHDVPMSLIEKAEGETRRLFDLPMTRKLKALRTPRDVTGYGLPRITPFFS  153

Query  545   SQMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPIC  724
               MW EGFT+ G P++HA Q+WP +Y  FC V+E+YQ +M+ LA+ +  L+F  +    C
Sbjct  154   KYMWHEGFTIMGPPIDHASQLWPSNYQPFCDVMEEYQRKMKALAEQITNLIFNYLKISDC  213

Query  725   --W*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  898
               W          + A LQ+N  P CPDPTR MG A HTDT L+T+L+QT    GLQ++ 
Sbjct  214   ANWLHSTGAAAACSTA-LQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQTRT-CGLQIFR  271

Query  899   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1078
                 W+ V P   A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYF+GP  +  
Sbjct  272   DGSGWVPVAPLPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTQRRLSMAYFYGPPPDFC  331

Query  1079  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             ++P   L  P E P YRP+    Y+ +K K    AL MI
Sbjct  332   VSP---LNDPPETPCYRPVVVKDYVRLKAKNLENALSMI  367



>ref|XP_006829636.1| hypothetical protein AMTR_s00122p00090120 [Amborella trichopoda]
 gb|ERM97052.1| hypothetical protein AMTR_s00122p00090120 [Amborella trichopoda]
Length=369

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 145/356 (41%), Positives = 209/356 (59%), Gaps = 22/356 (6%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDP--QAVDKIKMACETWGIFQVT  394
             +DF     +P+SH W +       SS  + +P+IDL  P      +I  AC +WG FQV 
Sbjct  17    VDFGSVKTVPESHAWQEPEGFSLESSDLDGIPVIDLSTPWWGVAREIGRACASWGAFQVV  76

Query  395   NHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTV  574
             NHGVP  +L ++E Q  R F L P+QKL+A R P  +AG+G  RI+ FF  +MW+EGFTV
Sbjct  77    NHGVPDNVLKRVEEQGWRLFSLPPDQKLKAERGPDEIAGFGAPRITHFFPKRMWTEGFTV  136

Query  575   AGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGLQ  754
              GSPLE AR++WP D+  FC V+E+YQ++M+ L   L  L+ +       W   G   L 
Sbjct  137   FGSPLEQARRLWPHDHMQFCEVIEEYQSEMKSLTVKLLELILE-------WVGAGKEDLN  189

Query  755   W----TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY-GPNLNWID  919
             W    +    Q+N  P CP+P+RAMG A HTD+SL+T+++Q SN +GLQ+       W+ 
Sbjct  190   WEVGDSSGVTQLNSYPSCPEPSRAMGLAPHTDSSLLTVIHQ-SNTSGLQLLDASGQKWVT  248

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDL+ I+SNG  +S +HRA+V++ HHR+S AYF  PS    + P +  
Sbjct  249   VPPVHGALVVNIGDLLHILSNGRCRSSMHRAVVNRVHHRLSFAYFCFPSPGATVEPLIGP  308

Query  1100  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI-----GFNSDVEKSNALASGSEAP  1252
              +PT   +YR ++W  YL IK   F  AL  +     GF++ +++  +L      P
Sbjct  309   DEPTA--LYRSVTWTEYLRIKGTLFNNALFSLLLPDSGFSTRLQQPFSLLPSQSRP  362



>gb|ADK71024.1| gibberellin 3-beta-hydroxylase [Trifolium incarnatum]
Length=299

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/301 (47%), Positives = 189/301 (63%), Gaps = 14/301 (5%)
 Frame = +2

Query  251   DSHTW--LDDHSPVNSSSTHES------VPLIDLYDPQAVDKIKMACETWGIFQVTNHGV  406
             +S+TW  LDDH+ +NS++  +       VP+IDL DP A   I  AC+TWG++QV NHG+
Sbjct  2     ESYTWTNLDDHT-INSNNIMKDSSSXSSVPIIDLSDPNASKLIGHACKTWGVYQVVNHGI  60

Query  407   PVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSP  586
             P+ LL  I+   +  F L   QKL+A+RSP  + GYG  RIS FF   MWSEGFT+ GSP
Sbjct  61    PLSLLDDIQWVGQTLFSLPSHQKLKAIRSPDGVTGYGLARISSFFSKLMWSEGFTIVGSP  120

Query  587   LEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQW  757
             L+H RQ+WPQDY+ +C +V  Y   M+ LA+ L  LM   +      I W        + 
Sbjct  121   LDHFRQLWPQDYAKYCDIVLQYDETMKKLAEKLMLLMLDSLGITKEDIKW-ASSKAQFEK  179

Query  758   TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSN  937
               A +Q+N  PICPDP RAMG A HTD++ +T+L Q S+I+GLQV      W+ V P   
Sbjct  180   ACAAMQLNSYPICPDPDRAMGLAPHTDSTFLTILSQ-SDISGLQVQREGFGWVTVPPLPG  238

Query  938   AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEF  1117
              +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ 
Sbjct  239   GLVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKLVGPTQP  298

Query  1118  P  1120
             P
Sbjct  299   P  299



>gb|ADK70973.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=292

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/291 (47%), Positives = 184/291 (63%), Gaps = 4/291 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ +  S+T+ SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+  
Sbjct  3     THLDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWL  62

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L   QKL+A+RSP  ++GYG  RIS FF    WSEGFT+ GSPL+H +Q+WPQD
Sbjct  63    GQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLKWSEGFTIVGSPLDHFQQLWPQD  122

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  123   YAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYP  182

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++ +T+L Q +NI+GLQV      W+ V P    +VVN+GDL  
Sbjct  183   SCPDPDHAMGLAPHTDSTFLTILSQ-NNISGLQVQREGFGWVTVPPLHGGLVVNVGDLFH  241

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   ILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  292



>ref|XP_004292966.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   278 bits (710),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 198/341 (58%), Gaps = 21/341 (6%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             I  ++P+DF  A  +PDS  W      V+S     ++P+IDL DP A   I  AC+TWGI
Sbjct  10    IKRLVPLDFGSAKSVPDSFVWPQASDEVHSGDGL-TIPVIDLTDPNAPQLITEACKTWGI  68

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
              QV  HG+P +LL  +E +  R F L  +QK++AVRSPG + GYG   I   F + MW E
Sbjct  69    LQVKGHGIPTKLLEDMESECERLFSLPTDQKMKAVRSPGRITGYGIAHIQSLFSTTMWHE  128

Query  563   GFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             GFT+ GS ++HAR +WP DY  FC  ++DYQ QM+ LA+ L  ++FK +          +
Sbjct  129   GFTIVGSAIDHARLLWPNDYQGFCDTIDDYQKQMKALAEQLMRILFKAL-------SISV  181

Query  743   VGLQW---------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
               L W             LQ+N  P CP+P+R +G A HTDTS+VT+L   +  +GLQV+
Sbjct  182   EELNWLDDPTNSSGCSLSLQLNSYPPCPEPSRTLGLAPHTDTSIVTIL--QAKTSGLQVF  239

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                + WI VE   +A+ VNLGD  +I+SNG F SVLHR +V K   R S+AYFF P  + 
Sbjct  240   KDGVGWILVELEPDALFVNLGDFSRILSNGQFISVLHRVVV-KPIQRYSMAYFFRPPTDF  298

Query  1076  EIAPSL-KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               +P L K + P E P YR ++   YLD+K K+   AL  I
Sbjct  299   VASPLLSKDLGPGEVPRYRSVTVKEYLDLKGKHLENALSFI  339



>ref|XP_010532144.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=354

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/336 (43%), Positives = 199/336 (59%), Gaps = 21/336 (6%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             D     QLPDS TW   DD     +S+   ++P+IDL D  A   I  AC +WG FQVTN
Sbjct  22    DLTSLRQLPDSFTWTHEDDLLFSAASNDQNTLPVIDLSDHAAAAAIGRACMSWGAFQVTN  81

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGVP+ LL  IE      F L   +K+RA R    ++GYG  RI+ FF  QMWSEGFTV 
Sbjct  82    HGVPLSLLDDIESLTVSLFRLPAHRKMRAARPVDGVSGYGVARIASFFHKQMWSEGFTVT  141

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGLQW  757
             GS  +H R++WP  +  +C V+++Y+  M+ LA  L  L+   +             ++W
Sbjct  142   GSARDHFRKLWPLHHLKYCDVIKEYEEHMQKLATKLMWLVLSSL-------GVTEADIKW  194

Query  758   ---------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNIT-GLQVYGPNL  907
                       QA +Q+N  P+CP+P RAMG A HTD++L+T+LYQ  NIT GLQV+   +
Sbjct  195   AGPNSDFNGAQAAIQLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQ--NITAGLQVFKDGV  252

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              W+ V P   ++VVN+GDL+ I+SNG   SVLHR  V+K   R SVAY +GP  +V+I+P
Sbjct  253   GWLTVSPIPGSLVVNIGDLLHILSNGRLPSVLHRVRVNKNRSRFSVAYLWGPQSDVQISP  312

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               KL+ P E P+YRP++W  YL  K  +F  AL +I
Sbjct  313   IWKLVSPVEPPLYRPVTWKEYLRTKATHFNNALSVI  348



>ref|XP_008219864.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=343

 Score =   277 bits (709),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 146/333 (44%), Positives = 207/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTWLD--DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             IP+D+     LPDSH WLD  D SP    +T    P+IDL DP A   I  ACETWG+FQ
Sbjct  18    IPLDYGSVHTLPDSHVWLDESDESPSGVHTT--GPPVIDLADPDAARLIIQACETWGVFQ  75

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSP-GSLAGYGTVRISKFFDSQMWSEG  565
             +  HG+P +L+  ++ +A + F+L  +QK++A+RSP GS +GYG   IS FF+  MW EG
Sbjct  76    LIGHGIPTKLMEDVQSEAEKLFDLPVDQKMKALRSPGGSQSGYGLPPISPFFEKLMWHEG  135

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RC  736
             + + GSP+EHA+ +WP DY  FC  +  Y++Q++ L + L  ++FK + I P  + W   
Sbjct  136   YHIMGSPIEHAKLLWPNDYQGFCGTMVHYRSQLKALTEQLIRIIFKSLNINPEEVAW---  192

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
              +   +     LQ+N  P CPDPTRAMG A HTDTSL+T+L Q S ++GLQV+     W+
Sbjct  193   -LKDTEGLSIGLQLNCYPPCPDPTRAMGIAPHTDTSLITIL-QQSKVSGLQVFKEGAGWV  250

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V+P   AI VNLGD+  I+SNG+F +V HR +V+    R+S AYF+ P  +  ++P L 
Sbjct  251   LVQPVPGAITVNLGDIFHILSNGVFTTVRHR-VVATPIRRLSFAYFYAPPGDFIVSPVLS  309

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                  E P Y+ +S   Y+ IK K+F KAL +I
Sbjct  310   K-DFGEVPRYQTLSVKEYVGIKGKHFEKALSVI  341



>gb|AGH39959.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=299

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 186/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVN------SSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +N       S+T  SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  4     THLDDHTLINPNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  63

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  64    DDIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  123

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  124   QLWPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  183

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  184   QLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVN  242

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI+P  KL+ PT+ P+
Sbjct  243   VGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKLVGPTQPPL  299



>ref|XP_004229097.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=348

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 206/334 (62%), Gaps = 7/334 (2%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWG  379
             +  I+P+DF    ++P+SH W + ++ P + +  + +VP+IDL DP  V+ +  AC+TWG
Sbjct  17    LQHILPIDFQSIQEVPNSHLWPNINNVPTSHNDKNPNVPIIDLIDPNVVELMGHACKTWG  76

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
             IFQV NHG+ ++   ++E QARR F L  EQK++ VRS   + GYGT RI+ FF   MW 
Sbjct  77    IFQVVNHGISLKYFDEVESQARRLFALPTEQKVKVVRSTNGVTGYGTARITPFFSKFMWH  136

Query  560   EGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  739
             EGFT+  SPL+HA+++WP DY  FC V+E+YQ +M+ L+  L   +    ++P       
Sbjct  137   EGFTIVDSPLDHAKELWPNDYKKFCDVMENYQTKMKVLSFQLCMFILN-YLQPSH--EHS  193

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
             +   ++  A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W  
Sbjct  194   INSFEFEGA-LQLNSYPCCPNPYHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGWTS  252

Query  920   VEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
             + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP     I+P + 
Sbjct  253   IAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVESIISPLVS  312

Query  1097  LIKPTEFPM-YRPISWNAYLDIKYKYFGKALEMI  1195
                     + YR ++   YL +K K+  K   MI
Sbjct  313   SQDNDGVVLKYRNVTVKEYLGLKAKHLEKVFSMI  346



>gb|AGH39956.1| gibberellin 3-beta-hydroxylase [Medicago archiducis-nicolai]
Length=299

 Score =   276 bits (705),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 187/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSS------STHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS+      +T  SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  4     THLDDHTLINSNNIMKENTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  63

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  64    DDIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  123

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  124   QLWPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  183

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  184   QLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVN  242

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   ++SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  243   VGDLFHILSNGLYPSVLHRGLVNRTRQKVSVAYLYGPPSNVEICPHEKLVGPTQPPL  299



>ref|XP_010439443.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=353

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 151/353 (43%), Positives = 206/353 (58%), Gaps = 42/353 (12%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTW-LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGI  382
             D IIP+DF     LP+SH W + +  P   S     +P+I L +P     ++ ACE WG+
Sbjct  16    DRIIPLDFTNTKTLPNSHVWSITEPEPKTMSL---PIPVISLSNPDQHVLLRQACEEWGV  72

Query  383   FQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSE  562
             F +T+HGVP  LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSE
Sbjct  73    FHITDHGVPRSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSE  132

Query  563   GFTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  739
             GF+V GS L  HA  +WP D+++FC+V+E+YQ  M DL+  L  ++             G
Sbjct  133   GFSVLGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSLRLITMLM------------G  180

Query  740   MVGLQ-----W--------------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLY  862
              +GL      W               Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LY
Sbjct  181   SLGLTHEDLGWLVPDKTGSGTDSNSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILY  240

Query  863   QTSNITGLQVYGP---NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHH  1033
             Q  NI GL++  P      WI VEP   ++V+ +GDL  IISNG F++ +HRA+V+K HH
Sbjct  241   Q-GNIPGLEIQSPQEEGSRWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHH  299

Query  1034  RISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             R+S AYF GP KN++I P L   K    P+YR + W  YL  K  +F +AL +
Sbjct  300   RVSAAYFAGPPKNLQIGP-LACDK-NHPPIYRRLLWEEYLAAKATHFNRALTL  350



>ref|XP_006389782.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
 gb|ESQ27068.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
Length=358

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/334 (43%), Positives = 205/334 (61%), Gaps = 11/334 (3%)
 Frame = +2

Query  215   IPMDFNKAD--QLPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             IP+  N AD   LPDS+TW  +D    ++S + ES+P IDL DP    ++  AC  WG F
Sbjct  18    IPLS-NLADFRHLPDSYTWTPEDDLLFSASDSDESLPFIDLADPHVAARVGHACTAWGAF  76

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             ++TNHGVP  LL  IE      F L   +KL+A RS   ++GYG  RI+ FF+ QMWSEG
Sbjct  77    RITNHGVPSRLLDDIEFLTGSLFRLPVHRKLKAARSENGISGYGVARIASFFNKQMWSEG  136

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  736
             FTV GSPL+   ++WP  +  +C ++ +Y+  M+ LA  L  L    +    + I W   
Sbjct  137   FTVIGSPLDDFHKLWPMHHLKYCEIITEYEEHMQKLAARLMWLALGSLGVDEKDINW--A  194

Query  737   GMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  913
             G+    Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQV+  ++ W
Sbjct  195   GLSSDFQGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLMTILYQ-NNTIGLQVFRDDVGW  253

Query  914   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1093
             + V P   ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  
Sbjct  254   VTVPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSIAYLWGPPSDLMISPLP  313

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             KL+ P   P+Y  ++W  YL  K  +F ++L  I
Sbjct  314   KLVNPLHSPLYPSLTWKQYLATKATHFNQSLSFI  347



>gb|ADK70985.1| gibberellin 3-beta-hydroxylase [Medicago platycarpos]
Length=295

 Score =   275 bits (704),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/294 (47%), Positives = 185/294 (63%), Gaps = 10/294 (3%)
 Frame = +2

Query  260   TWLDDHSPVNS------SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS      S+T  SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DDIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1114
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI+P  KL+ PT+
Sbjct  242   VGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKLVGPTQ  295



>emb|CDY37588.1| BnaA02g19820D [Brassica napus]
Length=351

 Score =   277 bits (709),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/328 (43%), Positives = 207/328 (63%), Gaps = 11/328 (3%)
 Frame = +2

Query  245   LPDSHTW----LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPV  412
             LPDS TW     D   P +S++  ES+P+IDL DP   + +  AC+TWG FQ+ NHGV  
Sbjct  19    LPDSFTWKLTAADSILPPSSAAVKESIPVIDLSDPDVTNLLGNACKTWGAFQIANHGVSQ  78

Query  413   ELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA-GSPL  589
              LL  +E  ++ FF++  E+KL A  S   ++GYG  RIS FF+ +MWSEG T+A GS  
Sbjct  79    SLLDDVESLSKTFFDMPSERKLEAASSNKGVSGYGEPRISLFFEKKMWSEGLTIADGSYR  138

Query  590   EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RCGMVGLQW  757
                  +WP+DY+ +C ++E+Y+ +M  LA  L + +   +   +  I W  +      + 
Sbjct  139   NQFLTIWPRDYTKYCGIIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKSESKM  198

Query  758   TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSN  937
              Q+ +++N  P+CP+P RAMG A HTD+ L+T+L+Q SN+ GLQV+     W+ VEP   
Sbjct  199   GQSVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQ-SNMGGLQVFKEESGWVTVEPIPG  257

Query  938   AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSLKLIKPTE  1114
              +VVN+GDL  I+SNG F SV+HRA V++   RIS+AY + GP+  VEI+P  K++ P  
Sbjct  258   VLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWGGPAGEVEISPISKIVGPVG  317

Query  1115  FPMYRPISWNAYLDIKYKYFGKALEMIG  1198
               +YRP++W+ YL IK++ F KAL+ IG
Sbjct  318   PCLYRPVTWSEYLRIKFEVFDKALDAIG  345



>ref|XP_002887835.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64094.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   277 bits (709),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/321 (43%), Positives = 201/321 (63%), Gaps = 6/321 (2%)
 Frame = +2

Query  245   LPDSHTWL-DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             LPDS+TW   D    ++S++ E++PLIDL DP     +  AC TWG  Q++NHGVP  LL
Sbjct  27    LPDSYTWTPKDDLLFSASASDETLPLIDLSDPHVTTLVGHACTTWGALQISNHGVPSRLL  86

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               IE      F L  ++KL+A RS   ++GYG  RI+ FF+ +MWSEGFTV GSPL+  R
Sbjct  87    DDIEFLTGSLFRLNVQRKLKAARSENGVSGYGVARIASFFNKKMWSEGFTVIGSPLQDFR  146

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             ++WP  +  +C ++E+Y   M+ LA  L  L    +    + I W        Q TQA  
Sbjct  147   KLWPSHHLKYCEIIEEYGEHMQKLAAKLMWLALGSLGVEEKDIKW-AGPNSDFQGTQAAT  205

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQV+  ++ W+ V P   ++VVN
Sbjct  206   QLNHYPICPEPDRAMGLAAHTDSTLMTILYQ-NNTAGLQVFRDDVGWVTVPPVPGSLVVN  264

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRP  1132
             +GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  +L+ P + P+Y  
Sbjct  265   VGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDIMISPLPRLVDPLQSPLYPS  324

Query  1133  ISWNAYLDIKYKYFGKALEMI  1195
             ++W  YL  K  +F ++L +I
Sbjct  325   LTWKQYLATKATHFNQSLSII  345



>gb|KFK42430.1| hypothetical protein AALP_AA2G255300 [Arabis alpina]
Length=354

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 203/329 (62%), Gaps = 7/329 (2%)
 Frame = +2

Query  224   DFNKADQLPDSHTWL--DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             DF     LPDS+TW   DD     +S++ +S+P I+L DP    ++  AC TWG FQVTN
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSAASASDQSLPSINLDDPHLATRVGHACATWGAFQVTN  82

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGVP  LL  IE      F L   +KL+A RS   ++GYG  RI+ FF+ QMWSEGFTV 
Sbjct  83    HGVPSRLLDDIEFLTGSLFRLPVHRKLKAARSENGVSGYGVARIASFFNKQMWSEGFTVI  142

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  748
             GSPL+  R++WP  +  +C ++++Y+  M+ LA  L  L    +    + I W       
Sbjct  143   GSPLDDFRKLWPNHHVKYCEIIKEYEEHMQKLAAKLMWLALGSLGVEEKDIKW-AWPSSD  201

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
              Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ ++  GLQV+  ++ W+ V P
Sbjct  202   FQGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLLTILYQ-NDTAGLQVFRDDVGWVTVPP  260

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  +L+ P
Sbjct  261   VPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDLMISPLPQLVDP  320

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              + P+Y  ++W  YL  K  +F ++L  I
Sbjct  321   LQSPLYPSLTWKQYLATKATHFNQSLSFI  349



>ref|XP_007221040.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
 gb|EMJ22239.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
Length=356

 Score =   277 bits (708),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 201/330 (61%), Gaps = 13/330 (4%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +P DF    ++P+ + W  L++H  ++S    +SVP+IDL DP A   I  AC TWG+FQ
Sbjct  23    VPDDFKSLHEIPEEYAWTNLNEHPSLDS----DSVPIIDLNDPNASQLISHACTTWGVFQ  78

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP  ++  +E  A+  F L  EQKL+A R PG ++GYG   IS F+D ++WSE F
Sbjct  79    LINHGVPNNVVEDMESVAQSLFSLPAEQKLKAARGPGGISGYGPQLISAFWDKKLWSECF  138

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPLEH  ++WPQ Y+  CS+ E+Y  ++  L   L  +M   +      + W   G
Sbjct  139   TILGSPLEHYAKLWPQGYTKICSITEEYDKELGRLCSRLMWIMLASLGISKEDVKW--SG  196

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
               G       LQ+N  P CPDP RAMG   HTD++LVT+++Q S I GLQV+     W  
Sbjct  197   PKGDNQEAHVLQLNSYPACPDPDRAMGLVAHTDSTLVTIVHQ-SKICGLQVFQEGTGWFT  255

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDLM I+SNG + SVLHR +V++   R+SV Y +GP  NV I+P  KL
Sbjct  256   VPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQPRLSVVYTYGPPDNVPISPIPKL  315

Query  1100  IKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1186
             +  +   +Y P++ W+ Y+D K K  GKAL
Sbjct  316   LSASHPALYPPVTNWSEYIDTKTKLKGKAL  345



>gb|ADK70993.1| gibberellin 3-beta-hydroxylase [Medicago sativa]
Length=298

 Score =   275 bits (703),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 187/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV G    W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>gb|ADK71011.1| gibberellin 3-beta-hydroxylase [Trigonella caerulea]
Length=294

 Score =   275 bits (702),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/293 (47%), Positives = 184/293 (63%), Gaps = 6/293 (2%)
 Frame = +2

Query  260   TWLDDHSPVNSSS--THESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIE  433
             T LDDH+ +NS++     SVP+IDL DP A   I  AC+TWG+FQV NHG+P+ LL  I+
Sbjct  3     THLDDHTLINSNNIMKESSVPVIDLNDPNASKLIGHACKTWGVFQVVNHGIPISLLDDIQ  62

Query  434   HQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWP  613
                +  F L   QKL+A+R P  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WP
Sbjct  63    WVGQTLFSLPSHQKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWP  122

Query  614   QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW  784
             QDY+ +C +V  Y   M+ LA  L  LM   +      I W       ++   A LQ+N 
Sbjct  123   QDYAKYCDIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVENACAALQLNS  182

Query  785   *PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDL  964
              P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL
Sbjct  183   YPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQQEGFGWVTVPPLHGGLVVNVGDL  241

Query  965   MQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
               I+SNG++ SVLHR +V++   R SVAY +G   NVEI P  KL+ PT+ P+
Sbjct  242   FHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGAPSNVEICPHEKLVGPTQPPL  294



>gb|ADK71002.1| gibberellin 3-beta-hydroxylase [Medicago tenoreana]
Length=287

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 182/287 (63%), Gaps = 4/287 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ +  S+T+ SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+  
Sbjct  2     THLDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWL  61

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H +Q+WPQD
Sbjct  62    GQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQD  121

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  122   YAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYP  181

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  
Sbjct  182   SCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVGDLFH  240

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1111
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT
Sbjct  241   ILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPT  287



>gb|ADK70977.1| gibberellin 3-beta-hydroxylase [Medicago minima]
Length=286

 Score =   274 bits (701),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 135/287 (47%), Positives = 182/287 (63%), Gaps = 4/287 (1%)
 Frame = +2

Query  269   DDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQARR  448
             DDH+ V  S+T+ SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+   + 
Sbjct  1     DDHTLVKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQT  60

Query  449   FFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQDYSD  628
              F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WPQ+Y+ 
Sbjct  61    LFTLPSHQKLKAIRSPDGVSGYGLARISSFFTKLMWSEGFTIVGSPLDHFRQLWPQEYAK  120

Query  629   FCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PICP  799
             +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P CP
Sbjct  121   YCDTVLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCP  180

Query  800   DPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIIS  979
             DP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+S
Sbjct  181   DPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILS  239

Query  980   NGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             NG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   NGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  286



>gb|ADK70999.1| gibberellin 3-beta-hydroxylase [Medicago shepardii]
Length=292

 Score =   274 bits (701),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 137/290 (47%), Positives = 182/290 (63%), Gaps = 4/290 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ V  S+T   VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+  
Sbjct  3     THLDDHTLVKESNTSSGVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPINLLDEIQWL  62

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L  +QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WPQD
Sbjct  63    GQTLFTLPSQQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQD  122

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  123   YAKQCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYP  182

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  
Sbjct  183   SCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFH  241

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  242   ILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADK71010.1| gibberellin 3-beta-hydroxylase [Trigonella calliceras]
Length=299

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/298 (46%), Positives = 189/298 (63%), Gaps = 11/298 (4%)
 Frame = +2

Query  260   TWLDDHSPVNS-------SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVEL  418
             T LDDH+ +NS       ++T  +VP+IDL DP A   I  AC+TWG++QV NHG+P+ L
Sbjct  3     THLDDHTLINSNNIMKESTTTTTNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPLSL  62

Query  419   LAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHA  598
             L  I+   +  F L   +KL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H 
Sbjct  63    LDDIQWVGQTLFSLPSHEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHF  122

Query  599   RQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAY  769
             RQ+WPQD++ +C +V  Y   M+ LA  L  LM   +      I W        + + A 
Sbjct  123   RQLWPQDHAKYCDIVLQYDEPMKKLAGKLMWLMLDSLGITKDDIKWASSKAQFEEKSCAA  182

Query  770   LQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVV  949
             +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    L W+ V P    +VV
Sbjct  183   MQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGLGWVTVPPLXGGLVV  241

Query  950   NLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             N+GDL  I+SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   NVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQPPL  299



>gb|AGH39957.1| gibberellin 3-beta-hydroxylase [Medicago edgeworthii]
Length=293

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 182/291 (63%), Gaps = 4/291 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ V  S+T  SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL  I+  
Sbjct  4     THLDDHTLVKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIQWL  63

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H +Q+WPQD
Sbjct  64    GQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQD  123

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  124   YAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYP  183

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  
Sbjct  184   SCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVGDLFH  242

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  243   ILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  293



>ref|XP_007226257.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
 gb|EMJ27456.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
Length=343

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 145/333 (44%), Positives = 206/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTWLD--DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             IP+D+     LPDSH WLD  D SP    ST    P+IDL DP +   I  ACETWG+FQ
Sbjct  18    IPLDYGSVHTLPDSHVWLDESDESPSGVHST--GPPVIDLADPDSARLIIQACETWGVFQ  75

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSP-GSLAGYGTVRISKFFDSQMWSEG  565
             +  HG+P +L+  ++ +A + F+L  +QK++A+RSP GS +GYG   IS FF+  MW EG
Sbjct  76    LIGHGIPTKLMEDVQSEAEKLFDLPVDQKMKALRSPGGSQSGYGLPPISPFFEKLMWHEG  135

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RC  736
             + + GSP++HA+ +WP DY  FC  +  Y++Q++ L + L  ++FK + I P  + W   
Sbjct  136   YHIMGSPIDHAKLLWPNDYQGFCDTMVHYRSQLKALTEQLIRIIFKSLNINPDEVAW---  192

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
              +   Q     LQ+N  P CPDPTRAMG A HTDTSL+T+L Q S ++GLQV+     W+
Sbjct  193   -LKESQGLSIGLQLNCYPPCPDPTRAMGIAPHTDTSLITVL-QQSKVSGLQVFKEGAGWV  250

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1096
              V+P   AI VNLGD   I+SNG+F +V HR + ++   R+S AYF+ P  +  ++P L 
Sbjct  251   LVQPVPGAITVNLGDFFHILSNGVFTTVRHRVVATRI-RRLSFAYFYAPPGDFIVSPVLS  309

Query  1097  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
                  E P Y+ +S   Y+ IK K+F KAL +I
Sbjct  310   K-DFGEVPRYQTLSVKEYVGIKGKHFEKALSVI  341



>ref|XP_010449018.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=351

 Score =   276 bits (705),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 201/339 (59%), Gaps = 16/339 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             D IIP+DF     LP+SH W          S    +P+I L +P     ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPNSHVWSKTEPEPKPMSL--PIPVISLSNPDQHVLLRQACEEWGVF  73

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
              +T+HGVP  LL  +E Q +R F L   +K+ AVRSP    GYG VRIS F+D  MWSEG
Sbjct  74    HITDHGVPRSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  133

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  727
             F+V GS L  HA  +WP D++ FC+V+E+YQ  M DL+  L  ++   +      + W  
Sbjct  134   FSVLGSSLRRHATLLWPDDHAQFCNVMEEYQKAMDDLSLRLITMLMVSLGLTHEDLGWLV  193

Query  728   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  194   PEKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIQSPQ  251

Query  905   LN---WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
              +   WI VEP   ++V+ +GDL  IISNG F++ +HRA+V+K HHR S A+F GP KN+
Sbjct  252   EDGSKWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRFSAAFFAGPPKNL  311

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1192
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  312   QIGPLTG--DKNHPPIYRRLIWEEYLAAKATHFNKALTL  348



>ref|NP_001267625.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28484.1| GA 3-oxidase [Cucumis sativus]
 gb|KGN45325.1| hypothetical protein Csa_7G435500 [Cucumis sativus]
Length=374

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/347 (41%), Positives = 205/347 (59%), Gaps = 31/347 (9%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPV---NSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             ++ +   QLPD++ W+  D  P     + S  +SVPLIDL  P A   I  A +TWG+FQ
Sbjct  25    LNLDSLQQLPDTYDWIQPDAFPSFRDPNISLSDSVPLIDLSLPNAPHLIGNALKTWGVFQ  84

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             V NHGVP+ LL  +E      F+L    KL+A R+P  + GYG  RIS FF  +MWSEGF
Sbjct  85    VINHGVPISLLNSMESFTNTLFDLPSPHKLKAARTPDGVTGYGLPRISTFFPKRMWSEGF  144

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  748
             T+ GSPLEH +++WP +YS +C + E+Y  +M+ L               + W   G +G
Sbjct  145   TIVGSPLEHFQKLWPNEYSKYCDITEEYSREMKSLCGR------------VIWLALGELG  192

Query  749   L-----QWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGL  886
             +      W +         A +Q+N  P+CPDP RAMG   HTDTSL+T+LYQ +N  GL
Sbjct  193   ITREDVNWAEANGDFKTSNAVIQLNSYPVCPDPDRAMGLGAHTDTSLLTILYQ-NNTRGL  251

Query  887   QVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPS  1066
             QV      W+ VEP + A+VV +GDL+ I++NG++ S  H+A+V++   RIS+AYFFGPS
Sbjct  252   QVLREGNRWVMVEPVTGALVVQVGDLLHILTNGLYPSSAHQAVVNQNRKRISIAYFFGPS  311

Query  1067  KNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1207
             ++ EI+P  KL+ PT+  +Y  ++W  YL  K + F   L  I  ++
Sbjct  312   ESAEISPLNKLVTPTQPLLYPTVTWTEYLRKKAQLFNNTLSSIRLSA  358



>ref|XP_006450547.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
 gb|ESR63787.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
Length=342

 Score =   275 bits (703),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 201/329 (61%), Gaps = 10/329 (3%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             IIP+DFN    LP+SH W       ++     SVP+IDL DP+    I  ACE WG+FQ+
Sbjct  21    IIPIDFNSVCSLPESHKWPKSDDLYDNKI---SVPVIDLRDPRVAQLIGRACEKWGVFQL  77

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
               HG+P+ LL   E +ARR F L   QKL+A+R+P    GYG  RI+ FFD  MW EGFT
Sbjct  78    IYHGIPLNLLKDAESEARRLFSLPSRQKLKALRAPAGATGYGIARITPFFDKYMWHEGFT  137

Query  572   VAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  748
             + G+ + +HA+Q+WP +++ FC V+E YQ +M  LA  L  L+FK +   I   +   + 
Sbjct  138   IMGTSIHDHAKQLWPHNHAKFCDVMETYQKKMNILADQLTQLIFKSL--DISEEQAEEMN  195

Query  749   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  928
                + + LQ+N  P CP+P RA+G A HTDTSL+T+L++ S I GLQ++   + W+ V+P
Sbjct  196   WVGSSSALQLNSYPSCPEPNRAVGLAPHTDTSLITILHENS-IAGLQIFKQEVGWVSVKP  254

Query  929   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1108
                A+VVN+GDL  I+SN  F +VLHR  V++   R+S+AYF+ P  +  + P   ++K 
Sbjct  255   VDGALVVNVGDLFHILSNARFPNVLHRVSVNQKRQRLSLAYFYNPPTDSTVVP---IVKS  311

Query  1109  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
              +   YRP++   ++ +K K   KAL  I
Sbjct  312   GQVARYRPVTVKEFISLKAKSPEKALSCI  340



>gb|ADK70960.1| gibberellin 3-beta-hydroxylase [Medicago ciliaris]
Length=292

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/292 (47%), Positives = 183/292 (63%), Gaps = 6/292 (2%)
 Frame = +2

Query  260   TW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIE  433
             TW  LDDH+ +  S+T  +VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+
Sbjct  1     TWANLDDHTLIKDSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQ  60

Query  434   HQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWP  613
                +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WP
Sbjct  61    WLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWP  120

Query  614   QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW  784
             QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N 
Sbjct  121   QDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNS  180

Query  785   *PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDL  964
              P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL
Sbjct  181   YPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDL  239

Query  965   MQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
               I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   FHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADK70964.1| gibberellin 3-beta-hydroxylase [Medicago granadensis]
Length=292

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/292 (47%), Positives = 183/292 (63%), Gaps = 6/292 (2%)
 Frame = +2

Query  260   TW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIE  433
             TW  LDDH+ + +S+T  +VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+
Sbjct  1     TWANLDDHTLIKNSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQ  60

Query  434   HQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWP  613
                   F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WP
Sbjct  61    WLGHTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWP  120

Query  614   QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW  784
             QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N 
Sbjct  121   QDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNS  180

Query  785   *PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDL  964
              P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL
Sbjct  181   YPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDL  239

Query  965   MQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
               I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   FHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADM47338.1| gibberellin 3-oxidase 2 [Marah macrocarpus]
Length=370

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/340 (41%), Positives = 197/340 (58%), Gaps = 28/340 (8%)
 Frame = +2

Query  221   MDFNKADQLPDSHTWLD-DHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTN  397
             +DF+  ++LPD++ W+  D  P  +  + E +PLIDL  P A   +  A  +WG FQ  N
Sbjct  22    LDFDSFNELPDTYEWVQPDSIPSPNDQSQEHLPLIDLSLPNAAALVGDAFRSWGAFQAIN  81

Query  398   HGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA  577
             HGVP+ LL   E      F L P  K +A R+P  + GYG VRIS FF  +MWSEGFT+ 
Sbjct  82    HGVPISLLHSFESTVDTLFSLPPSDKHKAARTPDGVDGYGLVRISSFFPKRMWSEGFTIL  141

Query  578   GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  751
              SPL H +++WP DY+  C + E+Y  +MR L   L             W   G +G+  
Sbjct  142   NSPLHHFQKLWPDDYAKHCEIYEEYDREMRSLCARL------------IWLGLGELGITQ  189

Query  752   ------------QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  895
                         +   A  Q+N  PICPDP RAMG   HTDTSL+T++YQ +N +GLQ  
Sbjct  190   DDVELAGPDRDFKTNPAATQLNSYPICPDPERAMGLGAHTDTSLLTIVYQ-NNTSGLQFL  248

Query  896   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1075
                  W+ VEP   A+VV +GDL+QI++NG++KS LH+A V++   R+S+AY FG  +  
Sbjct  249   REGNRWVTVEPVDGALVVQVGDLLQIMTNGLYKSPLHQAFVNRTRKRLSMAYIFGTPETA  308

Query  1076  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             EI+P  KL+ PT+ P+YR ++W  YL  K ++F  AL+ +
Sbjct  309   EISPLKKLLGPTQPPIYRTVTWTEYLGKKAEHFNNALKSV  348



>ref|XP_006389781.1| hypothetical protein EUTSA_v10019663mg [Eutrema salsugineum]
 gb|ESQ27067.1| hypothetical protein EUTSA_v10019663mg [Eutrema salsugineum]
Length=351

 Score =   275 bits (703),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 204/334 (61%), Gaps = 11/334 (3%)
 Frame = +2

Query  224   DFNKADQLPDSHTW----LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQV  391
             D      LP+S TW     D     +S +  ES+PLIDL DP     +  AC+TWG FQ+
Sbjct  12    DLGSLQTLPESFTWKLTGADSVLSPSSETVEESIPLIDLSDPDVTTLLGNACKTWGAFQI  71

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
              NHG+  +LL  IE  ++ FF++  E+KL A  S   ++GYG  RIS FF  +MWSEGFT
Sbjct  72    ANHGISQKLLDDIESLSKTFFDMPSEKKLEAASSDKGVSGYGEPRISLFFKKKMWSEGFT  131

Query  572   VA-GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RC  736
             +A GS   H   +WP D++ +C ++E+Y+ +M  LA  L   +   +   +  I W  + 
Sbjct  132   IADGSYRNHFLSLWPHDFTKYCGIIEEYEGEMEKLASRLLCCILGSLGVTVDDIEWAYKA  191

Query  737   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  916
                G +  +  +++N  P+CP+P RA+G A HTD++++T+L+Q SN+ GLQV+     W+
Sbjct  192   KNSGSKVGRRAIRLNHYPVCPEPERAIGLAAHTDSTILTILHQ-SNMGGLQVFREECGWV  250

Query  917   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSL  1093
              VEP   A+VVN+GDL  I+SNG   SV+HRA V+    RIS+AY + GP+ +VEI P  
Sbjct  251   TVEPVPGALVVNIGDLFHILSNGKIPSVIHRARVNHNRSRISIAYLWGGPAGDVEIRPIS  310

Query  1094  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             K++ P    +YRPI+WN YL IKY+ F KAL+ I
Sbjct  311   KIVGPVGPSLYRPITWNEYLRIKYQVFDKALDAI  344



>ref|XP_008461055.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
2-like [Cucumis melo]
Length=375

 Score =   276 bits (705),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 149/345 (43%), Positives = 203/345 (59%), Gaps = 34/345 (10%)
 Frame = +2

Query  224   DFNKADQLPDSHTWLDDHSPVNS-----SSTHESVPLIDLYD-PQAVDKIKMACETWGIF  385
             + +  ++LPD++ W+   S  +S      S  +SVPLIDL D P A   I  A +TWG F
Sbjct  23    NLDSFEKLPDTYDWIQPDSFPSSLTDPNVSLSDSVPLIDLSDLPNAPHLIGNALKTWGXF  82

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             QV NHGVP+ LL  +E      F+L    KL+A R+P  +AGYG  RIS FF  +MWSEG
Sbjct  83    QVINHGVPISLLNSMESFTNALFDLPSPHKLKAARTPDGVAGYGLPRISTFFPKRMWSEG  142

Query  566   FTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  745
             FT+ GSPLEH +++WP +YS +C + E+Y  +M  L   L             W   G +
Sbjct  143   FTIVGSPLEHFQKLWPDEYSKYCDLTEEYSREMGSLCGRL------------IWLALGEL  190

Query  746   GL-----QW----------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNIT  880
             G+      W          T A +Q+N  PICPDP RAMG   HTD+SL+T+LYQ +N  
Sbjct  191   GITQEDVNWAGSNGDFKTSTNAVIQLNSYPICPDPDRAMGLGAHTDSSLLTILYQ-NNSR  249

Query  881   GLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFG  1060
             GLQV      W+ VEP + A+VV +GDL+ I++NG++ S +H+A+V++   RIS+AYFFG
Sbjct  250   GLQVLREGNRWVMVEPVNGALVVQVGDLLHILTNGLYLSSVHQAVVNQTQKRISIAYFFG  309

Query  1061  PSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             PS+ VEI+P  KL+ PT   +Y  I+W  YL  K K F   L  I
Sbjct  310   PSEGVEISPINKLVTPTRPLLYPTITWTEYLRKKAKLFNNTLSSI  354



>gb|ADK71023.1| gibberellin 3-beta-hydroxylase [Trifolium albopurpureum]
Length=292

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/291 (47%), Positives = 184/291 (63%), Gaps = 9/291 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTHE---SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEH  436
             LDDH+  NS++  +   SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL  I+ 
Sbjct  4     LDDHT-TNSNNIMKDPSSVPIIDLSDPNASKLIGHACKTWGVYQVVNHGIPLSLLDDIQW  62

Query  437   QARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQ  616
               +  F L   QKL+A+RSP  + GYG  RIS FF   MWSEGFT+ GSPL+H +Q+WPQ
Sbjct  63    VGQTLFSLPSHQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQ  122

Query  617   DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*  787
             DY+ +C +V  Y   M+ LA+ L  LM   +      I W        +   A +Q+N  
Sbjct  123   DYAKYCDIVLQYDGAMKKLAEKLMLLMLDSLGITKEDIIW-ANSKAQFEKACAAMQLNSY  181

Query  788   PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLM  967
             PICPDP RAMG A HTD++ +T+L Q S+I+GLQV      W+ V P    +V+N+GDL 
Sbjct  182   PICPDPDRAMGLAPHTDSTFLTILSQ-SDISGLQVQREGFGWVTVPPLHGGLVINVGDLF  240

Query  968   QIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
              I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  241   HILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKLVGPTQPP  291



>gb|ADK70998.1| gibberellin 3-beta-hydroxylase [Medicago secundiflora]
Length=291

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 182/290 (63%), Gaps = 4/290 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ +  S+T   VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL  I+  
Sbjct  3     THLDDHTLIKESNTSSGVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPIGLLDDIQWL  62

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L  +QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WPQD
Sbjct  63    GQTLFTLPSQQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQD  122

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  123   YTKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYP  182

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++ +T+L Q ++I+GLQV   +  W+ V P    +VVN+GDL  
Sbjct  183   SCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREDSGWVTVPPLHGGLVVNVGDLFH  241

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             I+SNG++ SVLHR +V++ + R SVAY +GP  NVEI P  KL+ P + P
Sbjct  242   ILSNGLYTSVLHRVLVNRTYQRFSVAYLYGPPSNVEICPHEKLVGPNQPP  291



>ref|XP_009128435.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Brassica rapa]
Length=351

 Score =   275 bits (702),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 139/327 (43%), Positives = 206/327 (63%), Gaps = 11/327 (3%)
 Frame = +2

Query  245   LPDSHTW----LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPV  412
             LPDS TW     D   P +S++  ES+P+IDL DP   + +  AC+TWG FQ+ NHGV  
Sbjct  19    LPDSFTWKLTAADSILPPSSAAVKESIPVIDLSDPDVTNLLGNACKTWGAFQIANHGVSQ  78

Query  413   ELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVA-GSPL  589
              LL  +E  ++ FF++  E+KL A  S   ++GYG  RIS FF+ +MWSEG T+A GS  
Sbjct  79    SLLDDVESLSKTFFDMPSERKLEAASSNKGVSGYGEPRISLFFEKKMWSEGLTIADGSYR  138

Query  590   EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RCGMVGLQW  757
                  +WP+DY+ +C ++E+Y+ +M  LA  L + +   +   +  I W  +      + 
Sbjct  139   NQFLTIWPRDYTKYCGIIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKSESKM  198

Query  758   TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSN  937
              Q+ +++N  P+CP+P RAMG A HTD+ L+T+L+Q SN+ GLQV+     W+ VEP   
Sbjct  199   GQSVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQ-SNMGGLQVFKEESGWVTVEPIPG  257

Query  938   AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSLKLIKPTE  1114
              +VVN+GDL  I+SNG F SV+HRA V++   RIS+AY + GP+  VEI+P  K++ P  
Sbjct  258   VLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWGGPAGEVEISPISKIVGPVG  317

Query  1115  FPMYRPISWNAYLDIKYKYFGKALEMI  1195
               +YRP++W+ YL IK++ F KAL+ I
Sbjct  318   PCLYRPVTWSEYLRIKFEVFDKALDAI  344



>gb|ADK71008.1| gibberellin 3-beta-hydroxylase [Trigonella balansae]
Length=302

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/303 (46%), Positives = 190/303 (63%), Gaps = 12/303 (4%)
 Frame = +2

Query  254   SHTW--LDDHSPVNS------SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVP  409
             S+TW  LDDH+ +NS      S+   +VP+IDL DP A   I  AC+TWG++QV NHG+P
Sbjct  1     SYTWTHLDDHTLINSNNIMKDSTISTNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIP  60

Query  410   VELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPL  589
             + LL  I+   +  F L   +KL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL
Sbjct  61    ISLLDDIQWVGQTLFSLPSHEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPL  120

Query  590   EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWT  760
             +H +Q+WPQDY+ +C +V  Y   ++ LA  L  LM   +      I W        +  
Sbjct  121   DHFQQLWPQDYAKYCDIVLQYDETIKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKA  180

Query  761   QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNA  940
              A +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    L W+ V P    
Sbjct  181   CAAMQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGLGWVTVPPLHGG  239

Query  941   IVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL  PT+ P
Sbjct  240   LVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKLGGPTQPP  299

Query  1121  MYR  1129
             ++R
Sbjct  300   LWR  302



>gb|ADK70984.1| gibberellin 3-beta-hydroxylase [Medicago pironae]
Length=298

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 186/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG+F SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>gb|ADK71001.1| gibberellin 3-beta-hydroxylase [Medicago suffruticosa]
Length=288

 Score =   272 bits (696),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/287 (48%), Positives = 180/287 (63%), Gaps = 4/287 (1%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             T LDDH+ +  S+T+ SVP+IDL DP A   I  AC+TWG++QV NHGVP+ LL  I+  
Sbjct  3     THLDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGVPISLLDDIQWL  62

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WPQD
Sbjct  63    GQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQD  122

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             ++ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P
Sbjct  123   HARYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYP  182

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP  AMG A HTD++L+T+L Q + I+GLQV      W+ V P    +VVN+GDL  
Sbjct  183   SCPDPDHAMGLAPHTDSTLLTILSQ-NEISGLQVQREGSGWVTVPPLHGGLVVNVGDLFH  241

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1111
             I+SNG + SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT
Sbjct  242   ILSNGSYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPT  288



>ref|XP_008231797.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=356

 Score =   275 bits (702),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 199/330 (60%), Gaps = 13/330 (4%)
 Frame = +2

Query  215   IPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQ  388
             +P DF    ++P+ + W  L++H  ++S    +SVP+IDL DP A   I  AC TWG+FQ
Sbjct  23    VPDDFKSLHEIPEEYAWTNLNEHPSLDS----DSVPIIDLNDPNASQLISHACRTWGVFQ  78

Query  389   VTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGF  568
             + NHGVP  ++  +E  A+  F L  EQKL+  R PG ++GYG   +S F D ++WSE F
Sbjct  79    LINHGVPNNVVEDMESVAQSLFSLPAEQKLKVARGPGGISGYGLHLVSAFLDKKLWSECF  138

Query  569   TVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  739
             T+ GSPLEH  ++WPQ Y+  CS+ E+Y  ++  L+  L  +M   +      + W   G
Sbjct  139   TILGSPLEHYAKLWPQGYTKICSITEEYDKELGRLSSRLMWIMLASLGISKEDVKW--SG  196

Query  740   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  919
               G       LQ+N  P CPDP R MG   HTD++LVT+++Q S I GLQV+     W  
Sbjct  197   PKGDNHEAHVLQLNSYPACPDPDRVMGLVPHTDSTLVTIVHQ-SKICGLQVFQEGTGWFT  255

Query  920   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1099
             V P   A+VVN+GDLM I+SNG + SVLHR +V++   R+SV Y +GP  NV I+P  KL
Sbjct  256   VPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQQRLSVVYTYGPPDNVPISPIPKL  315

Query  1100  IKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1186
             +  +   +Y P++ W+ Y+D K K  GKAL
Sbjct  316   LSASHPALYPPVTNWSEYIDTKTKLKGKAL  345



>gb|ADK70968.1| gibberellin 3-beta-hydroxylase [Medicago intertexta]
Length=289

 Score =   272 bits (695),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 136/290 (47%), Positives = 182/290 (63%), Gaps = 6/290 (2%)
 Frame = +2

Query  260   TW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIE  433
             TW  LDDH+ +  S+T  +VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+
Sbjct  1     TWANLDDHTLIKDSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQ  60

Query  434   HQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWP  613
                +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WP
Sbjct  61    WLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWP  120

Query  614   QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW  784
             QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N 
Sbjct  121   QDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNS  180

Query  785   *PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDL  964
              P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL
Sbjct  181   YPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDL  239

Query  965   MQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1114
               I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  240   FHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQ  289



>gb|ADK70983.1| gibberellin 3-beta-hydroxylase [Medicago papillosa]
Length=298

 Score =   272 bits (696),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 187/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W++V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQXEGSGWVNVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>ref|XP_006476223.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
 gb|KDO79608.1| hypothetical protein CISIN_1g043251mg [Citrus sinensis]
Length=342

 Score =   273 bits (699),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 201/331 (61%), Gaps = 14/331 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIF  385
             IIP+DFN    LP+SH W   DD           SVP+IDL DP+    I  ACE WG+F
Sbjct  21    IIPIDFNSVCSLPESHKWPKFDD-----LYDNKISVPVIDLRDPRVAQLIGRACEKWGVF  75

Query  386   QVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEG  565
             Q+  HG+P+ +L   E +ARR F L   QKL+A+R+P    GYG  RI+ FFD  MW EG
Sbjct  76    QLIYHGIPLNVLKDAESEARRLFSLPSRQKLKALRAPAGATGYGIARITPFFDKYMWHEG  135

Query  566   FTVAGSPL-EHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  742
             FT+ G+ + +HA+Q+WP +++ FC V+E YQ +M  LA  L  L+FK +   I   +   
Sbjct  136   FTIMGTSIHDHAKQLWPHNHAKFCDVMETYQKKMNILADQLTQLIFKSL--DISEEQAEE  193

Query  743   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  922
             +    + + LQ+N  P CP+P RA+G A HTDTSL+T+L++ S I GLQ++   + W+ V
Sbjct  194   MNWVGSSSALQLNSYPSCPEPNRAVGLAPHTDTSLITILHENS-IAGLQIFKQEVGWVSV  252

Query  923   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1102
             +P   A+VVN+GDL  I+SN  F +VLHR  V++   R+S+AYF+ P  +  + P   ++
Sbjct  253   KPVDGALVVNVGDLFHILSNARFPNVLHRVSVNQKRQRLSLAYFYNPPTDSTVVP---IV  309

Query  1103  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             K  +   YRP++   ++ +K K   KAL  I
Sbjct  310   KSGQVARYRPVTVKEFISLKAKSPEKALSCI  340



>gb|ADK70991.1| gibberellin 3-beta-hydroxylase [Medicago rigidula]
Length=291

 Score =   271 bits (694),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 179/288 (62%), Gaps = 4/288 (1%)
 Frame = +2

Query  266   LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQAR  445
             LDDH+ +   +T   VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+   +
Sbjct  5     LDDHTLIKEGTTSSGVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQDYS  625
               F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H RQ+WPQDY+
Sbjct  65    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  626   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  796
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQLNSYPSC  184

Query  797   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  976
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNIGDLFHIL  243

Query  977   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>emb|CBL59327.1| Gibberellin 3-oxidase [Cucurbita maxima]
Length=350

 Score =   273 bits (699),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 143/341 (42%), Positives = 197/341 (58%), Gaps = 16/341 (5%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHE----SVPLIDLYDPQAVDKIKMAC  367
              +  I+P+DF+    +PDSH W   HS  ++   H     S+PLID+ DP     I   C
Sbjct  15    HLHHIVPLDFDSLRTVPDSHDW--PHSSYDTLKLHTNGDVSIPLIDMSDPNVAMLIGNVC  72

Query  368   ETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDS  547
             +TWG+FQ+TNHGVP  L+ + E +A R F+L   +KL+A+R+PG   GYG  RI+ FF  
Sbjct  73    KTWGVFQLTNHGVPTSLVERAEAEAGRLFDLPMTRKLKALRAPGDATGYGLPRITPFFSK  132

Query  548   QMWSEGFTVAGSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP---  718
              MW EGFT+ GS  EHA Q+W  +Y  FC V+E+YQ  M+ LA+ +  L+   +  P   
Sbjct  133   YMWHEGFTIMGSSAEHASQLWSSNYQPFCDVMEEYQKNMKSLAEKITHLILNFLKIPDDA  192

Query  719   --ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  892
                 W          + A LQ+N  P CPDPTR MG A HTDT L+T+L+Q+S   GLQ+
Sbjct  193   EISNWLHSAGAAAACSTA-LQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQSST-CGLQI  250

Query  893   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1072
             +     WI V P + A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYFFGP  +
Sbjct  251   FRDGFGWIPVTPVAGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFFGPPPD  310

Query  1073  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
               + P      P E P +R +    Y+ +K K    AL MI
Sbjct  311   FCVTP---FNNPPESPRFRSVVVKEYVGLKAKNLECALSMI  348



>gb|ADK70959.1| gibberellin 3-beta-hydroxylase [Medicago cancellata]
Length=298

 Score =   272 bits (695),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 186/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHXKLVGPTQPPL  298



>gb|ADK70956.1| gibberellin 3-beta-hydroxylase [Medicago biflora]
Length=295

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/294 (47%), Positives = 182/294 (62%), Gaps = 10/294 (3%)
 Frame = +2

Query  260   TWLDDHSPVNS------SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+  NS      S+T   VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLTNSNNTMKESNTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCETVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++L+T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTLLTILSQ-NDISGLQVQREGFGWVTVPPLQGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1114
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQ  295



>gb|ADK70970.1| gibberellin 3-beta-hydroxylase [Medicago lanigera]
Length=298

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 183/297 (62%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNS------SSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS      S+T  SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESATTSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
               I+      F L   QKL+A+RSP  ++GYG  R S FF   MWSE FT+ GSPL+H R
Sbjct  63    DDIQWLGETLFTLPSHQKLKAIRSPDGVSGYGLARNSSFFPKLMWSEXFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QFNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFEWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GPS NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPSSNVEICPHEKLVGPTQPPL  298



>gb|ADK70995.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=298

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 186/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSVPIIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>gb|ADK70971.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=292

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/293 (46%), Positives = 182/293 (62%), Gaps = 6/293 (2%)
 Frame = +2

Query  260   TW--LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIE  433
             TW  LDDH+ +   +T   VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+
Sbjct  1     TWNHLDDHTLIKEGTTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQ  60

Query  434   HQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWP  613
                +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H +Q+WP
Sbjct  61    WLGQTLFTLPSHQKLKAIRSPXGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWP  120

Query  614   QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW  784
             QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N 
Sbjct  121   QDYAKHCDTVLQYDEAMKKLAGKLMCLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNS  180

Query  785   *PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDL  964
              P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL
Sbjct  181   YPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDL  239

Query  965   MQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
               I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  240   FHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  292



>ref|XP_009396646.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   273 bits (699),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 204/341 (60%), Gaps = 17/341 (5%)
 Frame = +2

Query  221   MDFNKADQLPDSHTW--LDDHSPVNSSSTHESVPLIDLYDPQA-VDKIKMACETWGIFQV  391
             ++     ++PDSH W  LDDH  V     +E VP++DL  P A V  +   CE+WG FQV
Sbjct  21    LELESVREVPDSHAWPALDDHPTV-----YEPVPVVDLAGPDASVAHLARVCESWGAFQV  75

Query  392   TNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFT  571
             T HG+  +LL ++E + RR F L  +QKL+A R    ++GYG  RIS FF   MWSEGFT
Sbjct  76    TGHGIRSDLLERLESETRRLFALPMDQKLKAARPSNGISGYGLARISCFFSKLMWSEGFT  135

Query  572   VAGSPLEHARQVWPQ-DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  748
             ++GSPL+HA ++WP  D S FC V+++Y  +M+ +A  +  LM   +       +    G
Sbjct  136   ISGSPLDHALKLWPDADPSRFCDVMQEYSDEMKQVAGRVVRLMLLSMGLTPEEMKRAEEG  195

Query  749   LQWTQ--AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-----L  907
              +  Q  A LQ+N  P CPDP RAMG A HTD+SLVTLL+Q S  +GLQ+  P       
Sbjct  196   TRVDQLSAVLQLNSYPPCPDPNRAMGLAAHTDSSLVTLLFQ-SGTSGLQLLRPQDQHGPA  254

Query  908   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1087
              W+ V P   A++V  GDL+QI++NG +KSV HRA+V++ HHR+SVAY  GP  + +++P
Sbjct  255   RWVTVPPRPGALIVLAGDLLQILTNGRYKSVAHRAVVNRNHHRVSVAYICGPPPHHKLSP  314

Query  1088  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1210
               K   P     YR +SW  YL +K + F KAL  I    D
Sbjct  315   VGKPASPAPCLAYRAVSWADYLGLKAELFDKALASIMVAED  355



>gb|ADK70955.1| gibberellin 3-beta-hydroxylase [Medicago arborea]
Length=298

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/296 (46%), Positives = 185/296 (63%), Gaps = 10/296 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      +VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    XEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGXGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             +GDL  I+SNG++ SVLHR +V++  HR SVAY +GP   VEI P  KL+ PT+ P
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRHRFSVAYLYGPPSKVEICPHEKLVGPTQPP  297



>gb|ADK70980.1| gibberellin 3-beta-hydroxylase [Medicago murex]
 gb|ADK70987.1| gibberellin 3-beta-hydroxylase [Medicago polymorpha]
Length=298

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/297 (46%), Positives = 186/297 (63%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      S+P+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSIPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>gb|ADK70986.1| gibberellin 3-beta-hydroxylase [Medicago polyceratia]
Length=291

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/291 (47%), Positives = 182/291 (63%), Gaps = 5/291 (2%)
 Frame = +2

Query  260   TWLDDHSPV-NSSSTHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEH  436
             T LDDH+P+   S+   SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL +I+ 
Sbjct  2     THLDDHTPIMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQW  61

Query  437   QARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQ  616
               +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R +WPQ
Sbjct  62    LGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRLLWPQ  121

Query  617   DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*  787
             DY+  C  V  Y   M+ LA  L  LM + +   +  I W        +   A +Q+N  
Sbjct  122   DYAKHCETVLQYDEAMKKLAGKLMWLMLESLGITMEDIKWAGSKAQFDEKANAAMQLNSY  181

Query  788   PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLM  967
             P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL 
Sbjct  182   PSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLF  240

Query  968   QIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
              I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  241   HILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADK71012.1| gibberellin 3-beta-hydroxylase [Trigonella coerulescens]
Length=289

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/290 (46%), Positives = 183/290 (63%), Gaps = 7/290 (2%)
 Frame = +2

Query  269   DDHSPVNSSST---HESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELLAQIEHQ  439
             DD++ +NS++      SVP+IDL DP A   I  AC+TWG+FQV NHG+P+ LL  I+  
Sbjct  1     DDNTLINSNNIIKESTSVPVIDLNDPNASKLIGHACKTWGVFQVVNHGIPISLLDDIQCL  60

Query  440   ARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHARQVWPQD  619
              +  F L  ++KL+A+R P  ++GYG  RIS FF   MWSEGFT+ GSPL+H +Q+WPQD
Sbjct  61    GQTLFSLPSQEKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQD  120

Query  620   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  790
             Y+ +C +V  Y   M+ LA  L  LM   +      I W       ++   A LQ+N  P
Sbjct  121   YAKYCDIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVEKACAALQLNSYP  180

Query  791   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  970
              CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  
Sbjct  181   SCPDPDRAMGLAAHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVGDLFH  239

Query  971   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1120
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   ILSNGLYTSVLHRVLVNRTRQRYSVAYLYGPPSNVEICPHAKLVGPTQPP  289



>gb|ADK71019.1| gibberellin 3-beta-hydroxylase [Trigonella kotschyi]
Length=297

 Score =   271 bits (693),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/296 (46%), Positives = 183/296 (62%), Gaps = 12/296 (4%)
 Frame = +2

Query  260   TWLDDHSPVNSS--------STHESVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVE  415
             T LDDH+ +NS+        +   SVP+IDL DP A   I  AC+TWG++QV NHG+P+ 
Sbjct  3     THLDDHTLINSNNIMMKESITNTSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPIS  62

Query  416   LLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEH  595
             LL  I+   +  F L   +KL+A+R P  ++GYG  RIS FF   MWSEGFT+ GSPL+H
Sbjct  63    LLDDIQWVGQTLFSLPSHEKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDH  122

Query  596   ARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQA  766
              RQ+WPQDY+ +C +V  Y   M+ LA  L  LM   +      I W        +   A
Sbjct  123   FRQLWPQDYAKYCDIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFDEKASA  182

Query  767   YLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIV  946
              +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV   +  W+ V P    +V
Sbjct  183   AMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQQEDFGWVTVPPLHGGLV  241

Query  947   VNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1114
             VN+GDL  I+SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  242   VNVGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQ  297



>gb|ADK70989.1| gibberellin 3-beta-hydroxylase [Medicago prostrata]
Length=298

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/297 (46%), Positives = 185/297 (62%), Gaps = 10/297 (3%)
 Frame = +2

Query  260   TWLDDHSPVNSSSTHE------SVPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             T LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  3     THLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  62

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+ GSPL+H R
Sbjct  63    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFR  122

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY   C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  123   QLWPQDYDKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  182

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  183   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVN  241

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1123
             +GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  242   VGDLFHILSNGLYTSVLHRVLVNRTRRRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>ref|XP_006301563.1| hypothetical protein CARUB_v10021997mg [Capsella rubella]
 gb|EOA34461.1| hypothetical protein CARUB_v10021997mg [Capsella rubella]
Length=354

 Score =   273 bits (697),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 208/342 (61%), Gaps = 13/342 (4%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPDSHTW----LDDHSPVNSSSTHESVPLIDLYDPQA--VDKIKMAC  367
             + I   +      +PDS TW     D   P +S+   ES+P+IDL DP A  +  I  AC
Sbjct  6     EEICTGNLGSLQTIPDSFTWNVTAEDSVLPPSSAGVEESIPVIDLSDPDATTIQLIGNAC  65

Query  368   ETWGIFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDS  547
             +TWG FQV NHG+  +LL  IE  ++  F++  E+KL A  S   ++GYG  RIS FF+ 
Sbjct  66    QTWGAFQVANHGISQKLLDDIESLSKTLFDMPSERKLEAASSDKGISGYGEPRISSFFEK  125

Query  548   QMWSEGFTVAGSPLE-HARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  715
             +MWSEGFT+A S    H   +WPQD++++C +VE+Y+ +M  LA  L   +   +   + 
Sbjct  126   KMWSEGFTIADSSYRNHFITLWPQDHTNYCRIVEEYKDEMEKLANRLLCCILGSLGVTVD  185

Query  716   PICW-*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  892
              I W  + G  G +  +  +++N  P+CP+P RAMG A HTD++++T+L+Q SN  GLQV
Sbjct  186   DIGWGQKAGNSGTKLERGAIRLNHYPVCPEPERAMGLAAHTDSTMLTILHQ-SNTGGLQV  244

Query  893   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSK  1069
                   W+ V+P    +VVN+GDL+ I+SNG  +SV+HRA V++   RIS+AY + GP+ 
Sbjct  245   LREESGWVKVDPRPGNLVVNMGDLIHILSNGKIQSVVHRAKVNQTRSRISIAYLWGGPAG  304

Query  1070  NVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             +VEI P  K+I P    +YR ++W  YL IK + F KAL+ I
Sbjct  305   DVEIKPISKIIGPLGTSLYRSVTWKEYLQIKCEVFDKALDAI  346



>gb|ADK70988.1| gibberellin 3-beta-hydroxylase [Medicago praecox]
Length=293

 Score =   270 bits (691),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 137/294 (47%), Positives = 184/294 (63%), Gaps = 10/294 (3%)
 Frame = +2

Query  260   TW--LDDHSPVNSSSTHES----VPLIDLYDPQAVDKIKMACETWGIFQVTNHGVPVELL  421
             TW  +DDH+ +NS++   +    VP+IDL DP A   I  AC+TWG++QV NHG+P+ LL
Sbjct  1     TWNHVDDHTLINSNNKESANSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  60

Query  422   AQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWSEGFTVAGSPLEHAR  601
              +I+   +  F L   QKL+A+RSP  ++GYG  RIS FF   MWSEGFT+AGSPL+H R
Sbjct  61    DEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIAGSPLDHFR  120

Query  602   QVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  772
             Q+WPQDY   C  V  Y   M+ LA  L  LM   +   +  I W        +   A +
Sbjct  121   QLWPQDYDKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAM  180

Query  773   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  952
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  181   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVN  239

Query  953   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1114
             +GDL  I+SNG++ SVLHR +V++ H R SVAY +GP  NVEI P  KL+ PT+
Sbjct  240   VGDLFHILSNGLYTSVLHRVLVNRTHQRFSVAYLYGPPSNVEICPHEKLVGPTQ  293



>ref|XP_002887836.1| gibberellin 3-oxidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64095.1| gibberellin 3-oxidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 202/338 (60%), Gaps = 15/338 (4%)
 Frame = +2

Query  224   DFNKADQLPDSHTW--------LDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACETWG  379
             +      LPDS TW        L   S V+S +  ES+P+IDL DP     I  AC+TWG
Sbjct  12    NLGSLQTLPDSFTWKLTAADSVLPPSSAVSSGTVEESIPVIDLSDPDVTTLIGNACKTWG  71

Query  380   IFQVTNHGVPVELLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQMWS  559
              FQ+ NHG+  +LL  IE  ++  F++  E+KL A  S   ++GYG  RIS FF+ +MWS
Sbjct  72    AFQIANHGISQKLLDDIESLSKTLFDMPSERKLEAASSDKGVSGYGEPRISPFFEKKMWS  131

Query  560   EGFTVA-GSPLEHARQVWPQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  727
             EGFT+A  S   H   +WP D++ +C ++E+Y  +M  LA  L + +   +   +  I W
Sbjct  132   EGFTIADASYRNHFISLWPHDHTKYCGIMEEYVDEMEKLASKLVSCILGSLGVTVEDIGW  191

Query  728   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  904
               +    G +  +  +++N  P+CP+P RAMG A HTD++++T+L+Q SN  GLQV+   
Sbjct  192   AHKLEKSGSKVGRGAIRLNHYPVCPEPERAMGLAAHTDSTILTILHQ-SNTGGLQVFREE  250

Query  905   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEI  1081
               WI VEP    +VVN+GDL  I+SNG   SV+HRA V+    RIS+AY + GP+  V+I
Sbjct  251   SGWITVEPVPGVLVVNMGDLFHILSNGKIPSVVHRAKVNHTRSRISIAYLWGGPAGEVQI  310

Query  1082  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1195
             AP  KLI P E  +YR I+W  YL IKY+ F KAL+ I
Sbjct  311   APISKLIGPVEPSLYRSITWKEYLQIKYEVFDKALDAI  348



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3832943026185