BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21708_g1_i1 len=1394 path=[1372:0-249 1622:250-363 1736:364-402
1775:403-447 1820:448-483 1856:484-600 1973:601-1393]

Length=1394
                                                                      Score     E

dbj|BAD06944.1|  gibberellin 3-oxidase-like protein                     583   0.0      Ipomoea nil [qian niu]
ref|XP_006476108.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    343   2e-110   
ref|XP_007013295.1|  Gibberellin 3-beta hydroxylase, putative           328   5e-105   
ref|XP_011045367.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    327   5e-104   
ref|XP_002299619.1|  gibberellin 3-beta-hydroxylase family protein      326   9e-104   Populus trichocarpa [western balsam poplar]
ref|XP_010254241.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    322   4e-102   
gb|AHC32022.1|  gibberellin 3-oxidase 1                                 318   1e-100   
ref|XP_006427125.1|  hypothetical protein CICLE_v10027153mg             317   1e-100   
gb|KDP32333.1|  hypothetical protein JCGZ_13258                         317   1e-100   
ref|XP_004288825.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    317   1e-100   
gb|AFS18537.1|  gibberellin 3-oxidase                                   317   4e-100   
ref|XP_009339604.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    316   4e-100   
gb|AGN95009.1|  gibberellin 3-beta-dioxygenase                          315   5e-100   
ref|XP_002303276.1|  gibberellin 3-beta-hydroxylase family protein      316   7e-100   Populus trichocarpa [western balsam poplar]
gb|AAR12160.1|  gibberellin 3-oxidase                                   316   8e-100   Populus tremula x Populus tremuloides
ref|XP_008228615.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        315   9e-100   
ref|XP_008377587.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        315   2e-99    
gb|AEK70423.1|  GA3ox1                                                  314   2e-99    
dbj|BAD91162.1|  gibberellin 3-beta hydroxylase                         314   3e-99    Prunus subhirtella [Higan cherry]
gb|AEW67998.1|  gibberellin 3 oxidase 1                                 314   3e-99    
ref|XP_009374076.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        315   3e-99    
gb|KHG10231.1|  Gibberellin 3-beta-dioxygenase 1 -like protein          313   4e-99    
ref|XP_010098950.1|  Gibberellin 3-beta-dioxygenase 3                   313   5e-99    
ref|XP_010249916.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    313   1e-98    
ref|XP_007215556.1|  hypothetical protein PRUPE_ppa007336mg             313   1e-98    
ref|XP_007203364.1|  hypothetical protein PRUPE_ppa020624mg             311   1e-98    
gb|KDP37169.1|  hypothetical protein JCGZ_06225                         311   5e-98    
dbj|BAA37129.1|  gibberelin 3beta-hydroxylase                           310   7e-98    Lactuca sativa [cultivated lettuce]
ref|XP_010110310.1|  Gibberellin 3-beta-dioxygenase 1                   311   7e-98    
ref|NP_001269085.1|  uncharacterized protein LOC100265167               310   1e-97    
ref|XP_009343425.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    310   1e-97    
gb|ACT99991.1|  gibberellin 3-oxidase                                   309   2e-97    
ref|XP_008365721.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    309   3e-97    
emb|CAN80137.1|  hypothetical protein VITISV_028510                     308   4e-97    Vitis vinifera
gb|AHC32023.1|  gibberellin 3-oxidase 2                                 308   1e-96    
ref|XP_007024019.1|  Gibberellin 3-oxidase 1, putative                  307   1e-96    
ref|XP_011039983.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    310   2e-96    
dbj|BAG48320.1|  gibberellin 3-oxidase1                                 306   2e-96    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_010914990.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    305   8e-96    
ref|XP_004486708.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    305   1e-95    
ref|XP_010061961.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    304   2e-95    
ref|XP_008242694.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    303   3e-95    
ref|XP_002515559.1|  gibberellin 3-beta hydroxylase, putative           303   4e-95    Ricinus communis
ref|XP_004486709.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    303   7e-95    
gb|AEK70424.1|  GA3ox2                                                  303   9e-95    
gb|ACF71491.1|  gibberellin 3-beta hydroxylase                          301   3e-94    Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004302950.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    301   3e-94    
ref|XP_011026517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    300   5e-94    
ref|XP_002324270.1|  gibberellin 3 beta-hydroxylase family protein      299   9e-94    Populus trichocarpa [western balsam poplar]
gb|ABP37820.1|  gibberellin 3-beta-hydroxylase                          299   2e-93    Medicago sativa subsp. caerulea
dbj|BAG48321.1|  gibberellin 3-oxidase2                                 298   2e-93    Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABB00360.1|  gibberellin 3-oxidase                                   298   3e-93    Fragaria x ananassa
ref|XP_009355033.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    298   4e-93    
ref|XP_003546239.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    298   4e-93    
ref|XP_010459098.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    296   2e-92    
ref|XP_010254240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    296   2e-92    
gb|ABP37819.1|  gibberellin 3-beta-hydroxylase                          296   3e-92    Medicago sativa subsp. caerulea
ref|XP_003597810.1|  Gibberellin 3-beta-hydroxylase                     296   4e-92    
ref|XP_002514367.1|  gibberellin 3-beta hydroxylase, putative           295   5e-92    Ricinus communis
gb|ABP37818.1|  gibberellin 3-beta-hydroxylase                          295   8e-92    Medicago falcata [sickle alfalfa]
ref|XP_010476647.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        295   8e-92    
gb|ACN89834.1|  gibberellin 3-oxidase                                   294   1e-91    Solanum tuberosum subsp. andigenum
dbj|BAD30035.1|  gibberellin 3beta-hydroxylase1                         294   1e-91    Daucus carota [carrots]
ref|XP_006341659.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    294   1e-91    
sp|O24648.1|G3OX_PEA  RecName: Full=Gibberellin 3-beta-dioxygenas...    294   2e-91    Pisum sativum [garden pea]
ref|XP_008804067.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    294   2e-91    
gb|ABG46320.1|  gibberellin 3-oxidase 1                                 293   2e-91    Rumex palustris
ref|NP_001275412.1|  gibberellin 3-beta-hydroxylase 2                   293   3e-91    
gb|AAC96017.1|  defective gibberellin 3B-hydroxylase                    293   4e-91    Pisum sativum [garden pea]
ref|XP_009377503.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    292   5e-91    
ref|XP_010249910.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    293   5e-91    
ref|XP_009788819.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    292   7e-91    
gb|ABO70984.1|  gibberellin 3-oxidase 2                                 292   8e-91    Nicotiana tabacum [American tobacco]
gb|AAC86820.1|  gibberellin 3 beta-hydroxylase                          292   8e-91    Pisum sativum [garden pea]
gb|AAC49794.1|  gibberellin 3 beta-hydroxylase                          292   9e-91    Pisum sativum [garden pea]
dbj|BAA37130.1|  gibberellin 3beta-hydroxylase                          292   1e-90    Lactuca sativa [cultivated lettuce]
gb|EYU21574.1|  hypothetical protein MIMGU_mgv1a017804mg                292   1e-90    
ref|XP_010497240.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    291   2e-90    
ref|XP_010691237.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    294   2e-90    
ref|XP_006416894.1|  hypothetical protein EUTSA_v10008008mg             291   2e-90    
ref|NP_001233855.1|  3b-hydroxylase                                     291   2e-90    
ref|XP_003543662.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    290   4e-90    
gb|AAM12872.1|AF494089_1  gibberellin 3-oxidase 1                       290   5e-90    Nicotiana sylvestris
gb|AAN87570.1|  gibberellin 3-oxidase                                   291   5e-90    Spinacia oleracea
ref|XP_011072274.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    290   5e-90    
dbj|BAJ65442.1|  gibberellin 3-oxidase                                  291   5e-90    
ref|XP_010925284.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    290   7e-90    
ref|XP_002892873.1|  hypothetical protein ARALYDRAFT_471756             289   8e-90    
dbj|BAQ02990.1|  gibberellin 3-oxidase                                  289   1e-89    
ref|XP_002284981.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        288   2e-89    Vitis vinifera
ref|XP_009596383.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    288   2e-89    
ref|XP_009588350.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    289   2e-89    
emb|CDX81720.1|  BnaC08g38810D                                          288   2e-89    
dbj|BAA89316.1|  gibberellin 3beta-hydroxylase                          288   3e-89    Nicotiana tabacum [American tobacco]
ref|XP_007013765.1|  Gibberellin 3-oxidase 3, putative                  287   3e-89    
ref|XP_008347459.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    288   3e-89    
ref|NP_173008.1|  gibberellin 3-beta-dioxygenase 1                      288   4e-89    Arabidopsis thaliana [mouse-ear cress]
emb|CDY36572.1|  BnaA06g10250D                                          288   4e-89    
gb|AGQ42612.1|  GA3ox3                                                  287   4e-89    
ref|XP_006382066.1|  gibberellin 3 beta-hydroxylase family protein      287   5e-89    
dbj|BAG32267.1|  gibberellin 3-oxidase                                  288   5e-89    Allium fistulosum [Japanese bunching onion]
ref|XP_009372969.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    287   6e-89    
ref|XP_008356836.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    287   7e-89    
ref|XP_008785607.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    287   8e-89    
ref|XP_009148952.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        287   8e-89    
ref|XP_011081703.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    287   1e-88    
ref|XP_009117822.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    286   2e-88    
emb|CDP18939.1|  unnamed protein product                                286   2e-88    
gb|KFK43811.1|  hypothetical protein AALP_AA1G176200                    286   2e-88    
emb|CAN73736.1|  hypothetical protein VITISV_025221                     286   7e-88    Vitis vinifera
gb|KDO58203.1|  hypothetical protein CISIN_1g043985mg                   284   8e-88    
dbj|BAM73280.1|  gibberellin 3 oxidase 1                                284   8e-88    
ref|XP_008346007.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    284   9e-88    
ref|XP_009355149.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    284   1e-87    
emb|CDY39663.1|  BnaC05g11920D                                          284   1e-87    
ref|XP_009771250.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    284   1e-87    
ref|XP_008352044.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    282   4e-87    
ref|XP_008387508.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    282   4e-87    
ref|XP_006427126.1|  hypothetical protein CICLE_v10027361mg             282   5e-87    
dbj|BAD06943.1|  gibberellin 3-oxidase-like protein                     282   1e-86    Ipomoea nil [qian niu]
ref|XP_006465424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    281   1e-86    
ref|XP_003533057.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    281   1e-86    
ref|XP_003527798.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    281   1e-86    
ref|XP_006356177.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    281   3e-86    
ref|XP_006305164.1|  hypothetical protein CARUB_v10009532mg             280   3e-86    
ref|XP_007150692.1|  hypothetical protein PHAVU_005G173500g             280   4e-86    
ref|XP_011019738.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    279   4e-86    
ref|XP_002515599.1|  gibberellin 3-beta hydroxylase, putative           278   9e-86    Ricinus communis
ref|NP_001233848.1|  3b-hydroxylase                                     279   9e-86    
ref|XP_009400517.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    279   1e-85    
gb|KHN47796.1|  Gibberellin 3-beta-dioxygenase 1                        279   1e-85    
ref|XP_009409327.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    278   2e-85    
ref|XP_002282411.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        278   3e-85    Vitis vinifera
gb|AGQ42610.1|  GA3ox2                                                  277   3e-85    
ref|NP_001275108.1|  gibberellin 3-beta-hydroxylase 1                   278   4e-85    
ref|XP_010537953.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        276   4e-85    
emb|CAC83089.1|  gibberellin 3-oxidase                                  278   5e-85    Cucurbita maxima [Boston marrow]
gb|KDP32294.1|  hypothetical protein JCGZ_13219                         276   9e-85    
dbj|BAD30036.1|  gibberellin 3beta-hydroxylase2                         276   1e-84    Daucus carota [carrots]
gb|ACN89835.1|  gibberellin 3-oxidase                                   275   3e-84    Solanum tuberosum subsp. andigenum
ref|XP_010051203.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    273   2e-83    
gb|ABI64150.1|  gibberellin 3-oxidase                                   272   2e-83    Pisum sativum [garden pea]
gb|KCW53766.1|  hypothetical protein EUGRSUZ_J03019                     272   3e-83    
ref|XP_006829636.1|  hypothetical protein AMTR_s00122p00090120          272   4e-83    
ref|XP_006285095.1|  hypothetical protein CARUB_v10006427mg             272   4e-83    
ref|XP_006366661.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    271   5e-83    
ref|XP_008219863.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    271   5e-83    
ref|XP_010915137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        271   5e-83    
ref|XP_003529820.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    272   6e-83    
ref|XP_006413746.1|  hypothetical protein EUTSA_v10026853mg             271   7e-83    
ref|XP_006355748.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    271   9e-83    
ref|XP_010049018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    271   1e-82    
ref|XP_010537951.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    271   2e-82    
ref|XP_007227245.1|  hypothetical protein PRUPE_ppa018007mg             270   2e-82    
ref|NP_001274405.1|  gibberellin 3-beta-dioxygenase 1-like              270   2e-82    
ref|XP_009108486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        270   3e-82    
ref|NP_193900.1|  gibberellin 3-beta-dioxygenase 3                      270   3e-82    Arabidopsis thaliana [mouse-ear cress]
gb|ABK28643.1|  unknown                                                 270   3e-82    Arabidopsis thaliana [mouse-ear cress]
gb|KGN62899.1|  hypothetical protein Csa_2G379300                       270   3e-82    
ref|XP_007135716.1|  hypothetical protein PHAVU_010G152200g             270   3e-82    
ref|NP_001267625.1|  gibberellin 3-beta-dioxygenase 1-like              270   3e-82    
ref|XP_010049027.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    270   3e-82    
ref|XP_008445137.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    270   5e-82    
ref|XP_002869872.1|  gibberellin 3-oxidase 3                            268   9e-82    
ref|XP_003522638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    268   9e-82    
emb|CDY31424.1|  BnaC03g64000D                                          268   1e-81    
ref|XP_007161254.1|  hypothetical protein PHAVU_001G055000g             268   1e-81    
emb|CDX76441.1|  BnaA08g09590D                                          268   1e-81    
ref|XP_004253252.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    268   1e-81    
ref|XP_004292966.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    268   1e-81    
emb|CDY37588.1|  BnaA02g19820D                                          267   3e-81    
gb|ADK71016.1|  gibberellin 3-beta-hydroxylase                          265   3e-81    
ref|XP_010049031.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    267   4e-81    
ref|XP_004135830.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    267   4e-81    
ref|XP_008461056.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    267   5e-81    
ref|XP_006301281.1|  hypothetical protein CARUB_v10021682mg             266   6e-81    
ref|XP_008219864.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    266   8e-81    
ref|XP_008811603.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1        266   8e-81    
ref|XP_010532144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    266   9e-81    
ref|XP_006361220.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    266   9e-81    
ref|XP_004158763.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    266   1e-80    
ref|XP_009385827.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    266   1e-80    
ref|XP_008461055.1|  PREDICTED: LOW QUALITY PROTEIN: gibberellin ...    266   1e-80    
ref|XP_009396646.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    266   2e-80    
ref|XP_010434144.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        265   2e-80    
gb|ADK71025.1|  gibberellin 3-beta-hydroxylase                          263   2e-80    
emb|CDY38661.1|  BnaC02g23180D                                          265   2e-80    
dbj|BAD30037.1|  gibberellin 3beta-hydroxylase3                         265   2e-80    Daucus carota [carrots]
ref|XP_004240225.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    265   2e-80    
ref|XP_010670743.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    265   2e-80    
ref|XP_009128435.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        265   3e-80    
gb|ADK71013.1|  gibberellin 3-beta-hydroxylase                          262   3e-80    
ref|XP_007226257.1|  hypothetical protein PRUPE_ppa018610mg             264   3e-80    
gb|AGH39958.1|  gibberellin 3-beta-hydroxylase                          262   3e-80    
ref|XP_009128433.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2        265   4e-80    
gb|AFK49394.1|  unknown                                                 264   4e-80    
emb|CDY37589.1|  BnaA02g19810D                                          264   5e-80    
ref|XP_004498636.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    264   6e-80    
emb|CBL59327.1|  Gibberellin 3-oxidase                                  263   7e-80    
gb|ADK71017.1|  gibberellin 3-beta-hydroxylase                          261   8e-80    
ref|XP_010439443.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    263   1e-79    
gb|AGH39956.1|  gibberellin 3-beta-hydroxylase                          260   3e-79    
gb|AGH39959.1|  gibberellin 3-beta-hydroxylase                          260   3e-79    
gb|ADK70985.1|  gibberellin 3-beta-hydroxylase                          259   3e-79    
ref|XP_006450547.1|  hypothetical protein CICLE_v10010629mg             261   3e-79    
gb|ADK70973.1|  gibberellin 3-beta-hydroxylase                          259   4e-79    
gb|ADK71024.1|  gibberellin 3-beta-hydroxylase                          259   5e-79    
ref|XP_006476223.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    261   5e-79    
gb|AGH39957.1|  gibberellin 3-beta-hydroxylase                          259   5e-79    
gb|ADK71011.1|  gibberellin 3-beta-hydroxylase                          259   6e-79    
ref|XP_010449018.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    261   6e-79    
gb|ADK70993.1|  gibberellin 3-beta-hydroxylase                          259   6e-79    
ref|XP_006389781.1|  hypothetical protein EUTSA_v10019663mg             261   7e-79    
ref|XP_004291424.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    260   8e-79    
gb|ADK70977.1|  gibberellin 3-beta-hydroxylase                          258   8e-79    
ref|XP_007221040.1|  hypothetical protein PRUPE_ppa015241mg             261   8e-79    
gb|ADK71023.1|  gibberellin 3-beta-hydroxylase                          258   8e-79    
gb|ADK71002.1|  gibberellin 3-beta-hydroxylase                          258   1e-78    
ref|XP_002887836.1|  gibberellin 3-oxidase 4                            260   1e-78    
gb|KFK42430.1|  hypothetical protein AALP_AA2G255300                    260   1e-78    
gb|ADK71010.1|  gibberellin 3-beta-hydroxylase                          258   1e-78    
ref|XP_006301563.1|  hypothetical protein CARUB_v10021997mg             260   1e-78    
ref|XP_003588693.1|  Gibberellin 3-beta-dioxygenase                     260   1e-78    
gb|ADK70986.1|  gibberellin 3-beta-hydroxylase                          258   2e-78    
ref|XP_008231797.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    259   2e-78    
ref|XP_004229097.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    259   2e-78    
gb|ADK70998.1|  gibberellin 3-beta-hydroxylase                          257   2e-78    
gb|ADK70964.1|  gibberellin 3-beta-hydroxylase                          257   3e-78    
gb|ADK70960.1|  gibberellin 3-beta-hydroxylase                          257   3e-78    
gb|ADK70999.1|  gibberellin 3-beta-hydroxylase                          257   3e-78    
gb|ADK70983.1|  gibberellin 3-beta-hydroxylase                          257   4e-78    
gb|ADK70984.1|  gibberellin 3-beta-hydroxylase                          257   4e-78    
ref|XP_004291422.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    259   4e-78    
gb|ADK70968.1|  gibberellin 3-beta-hydroxylase                          256   4e-78    
ref|XP_006389782.1|  hypothetical protein EUTSA_v10019816mg             259   4e-78    
gb|ADK70991.1|  gibberellin 3-beta-hydroxylase                          256   5e-78    
gb|ADM47338.1|  gibberellin 3-oxidase 2                                 259   6e-78    
gb|ADK70959.1|  gibberellin 3-beta-hydroxylase                          256   7e-78    
ref|XP_002887835.1|  predicted protein                                  258   7e-78    
emb|CDY38660.1|  BnaC02g23190D                                          258   7e-78    
ref|XP_006338004.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    258   9e-78    
ref|XP_010532143.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    258   1e-77    
gb|ADK71008.1|  gibberellin 3-beta-hydroxylase                          256   1e-77    
gb|ADK70970.1|  gibberellin 3-beta-hydroxylase                          256   1e-77    
gb|ADK70956.1|  gibberellin 3-beta-hydroxylase                          255   1e-77    
gb|ADK70955.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK70989.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK70971.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK71012.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK70980.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK70988.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK70995.1|  gibberellin 3-beta-hydroxylase                          255   2e-77    
gb|ADK71001.1|  gibberellin 3-beta-hydroxylase                          254   2e-77    
gb|ADK71019.1|  gibberellin 3-beta-hydroxylase                          255   3e-77    
gb|ADK70958.1|  gibberellin 3-beta-hydroxylase                          254   3e-77    
gb|ADK70962.1|  gibberellin 3-beta-hydroxylase                          254   4e-77    
gb|ADK70994.1|  gibberellin 3-beta-hydroxylase                          254   4e-77    
gb|ADK70966.1|  gibberellin 3-beta-hydroxylase                          254   6e-77    
gb|ADK71003.1|  gibberellin 3-beta-hydroxylase                          253   7e-77    
ref|XP_010112080.1|  Gibberellin 3-beta-dioxygenase 1                   257   8e-77    
gb|ADK70990.1|  gibberellin 3-beta-hydroxylase                          253   9e-77    
gb|ADK70992.1|  gibberellin 3-beta-hydroxylase                          253   9e-77    
gb|ADK71009.1|  gibberellin 3-beta-hydroxylase                          253   1e-76    
gb|ADK70978.1|  gibberellin 3-beta-hydroxylase                          253   1e-76    
gb|ADK71018.1|  gibberellin 3-beta-hydroxylase                          253   1e-76    
gb|ADK71027.1|  gibberellin 3-beta-hydroxylase                          252   1e-76    
ref|XP_008461419.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    255   2e-76    
gb|ADK71006.1|  gibberellin 3-beta-hydroxylase                          253   2e-76    
gb|ADK70972.1|  gibberellin 3-beta-hydroxylase                          252   3e-76    
gb|ADK70969.1|  gibberellin 3-beta-hydroxylase                          251   4e-76    
gb|ADK71015.1|  gibberellin 3-beta-hydroxylase                          251   4e-76    
gb|ADK70954.1|  gibberellin 3-beta-hydroxylase                          252   4e-76    
gb|ADK70997.1|  gibberellin 3-beta-hydroxylase                          251   6e-76    
gb|ADK71022.1|  gibberellin 3-beta-hydroxylase                          251   6e-76    
gb|ADM47339.1|  gibberellin 3-oxidase 3                                 253   6e-76    
gb|EYU21920.1|  hypothetical protein MIMGU_mgv1a009050mg                253   8e-76    
ref|XP_010520599.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3        253   2e-75    
ref|XP_003544624.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    252   2e-75    
gb|ADK70982.1|  gibberellin 3-beta-hydroxylase                          250   2e-75    
gb|ADK70979.1|  gibberellin 3-beta-hydroxylase                          249   2e-75    
gb|ADK71004.1|  gibberellin 3-beta-hydroxylase                          250   2e-75    
gb|ADK71005.1|  gibberellin 3-beta-hydroxylase                          249   3e-75    
gb|ADK71020.1|  gibberellin 3-beta-hydroxylase                          249   3e-75    
gb|ADK70981.1|  gibberellin 3-beta-hydroxylase                          249   4e-75    
emb|CDP04846.1|  unnamed protein product                                250   6e-75    
ref|XP_010429980.1|  PREDICTED: gibberellin 3-beta-dioxygenase 4        250   6e-75    
gb|ADK70965.1|  gibberellin 3-beta-hydroxylase                          248   1e-74    
emb|CAB92914.1|  gibberellin 3-beta-hydroxylase                         250   1e-74    
gb|ADK70976.1|  gibberellin 3-beta-hydroxylase                          248   1e-74    
ref|XP_007137069.1|  hypothetical protein PHAVU_009G097100g             249   1e-74    
gb|ADK70967.1|  gibberellin 3-beta-hydroxylase                          248   1e-74    
gb|ADK70974.1|  gibberellin 3-beta-hydroxylase                          247   1e-74    
gb|EPS71653.1|  gibberellin 3-oxidase                                   248   2e-74    
gb|ADK71007.1|  gibberellin 3-beta-hydroxylase                          247   2e-74    
ref|XP_007137070.1|  hypothetical protein PHAVU_009G097200g             249   2e-74    
gb|ADK70963.1|  gibberellin 3-beta-hydroxylase                          246   3e-74    
dbj|BAB12439.1|  gibberellin 3b-hydroxylase No3                         248   4e-74    
gb|ADK71014.1|  gibberellin 3-beta-hydroxylase                          246   8e-74    
ref|NP_001275523.1|  gibberellin 3-beta-dioxygenase 1-like              247   1e-73    
gb|ADK71000.1|  gibberellin 3-beta-hydroxylase                          244   2e-73    
gb|AAF80661.1|AF074710_1  putative gibberellin 3 beta hydroxylase       246   2e-73    
ref|XP_004291423.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    246   2e-73    
ref|XP_010417722.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    246   2e-73    
ref|XP_004136072.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    248   3e-73    
ref|XP_004158764.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    247   3e-73    
ref|NP_178149.1|  gibberellin 3-beta-dioxygenase 4                      246   3e-73    
ref|XP_003550162.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    245   6e-73    
gb|ADK70961.1|  gibberellin 3-beta-hydroxylase                          243   6e-73    
gb|AHW42464.1|  GA3ox2                                                  245   8e-73    
gb|AHW42463.1|  GA3ox1                                                  245   9e-73    
gb|ADK71021.1|  gibberellin 3-beta-hydroxylase                          242   2e-72    
gb|AAC83647.1|  gibberellin 3 beta-hydroxylase                          244   2e-72    
ref|NP_178150.1|  gibberellin 3-beta-dioxygenase 2                      243   3e-72    
emb|CAH69705.1|  gibberellin 3-oxidase                                  243   3e-72    
ref|XP_010429978.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    244   3e-72    
ref|XP_010941486.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    243   5e-72    
gb|ADK71026.1|  gibberellin 3-beta-hydroxylase                          240   6e-72    
emb|CDP19027.1|  unnamed protein product                                243   7e-72    
ref|XP_004290878.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    241   1e-71    
ref|XP_008445138.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    241   3e-71    
gb|ADK70975.1|  gibberellin 3-beta-hydroxylase                          238   5e-71    
ref|XP_010472948.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2        240   6e-71    
gb|AAB64347.1|  gibberellin 2beta,3beta-hydroxylase                     231   1e-67    
gb|ADM47337.1|  gibberellin 3-oxidase 1                                 230   3e-67    
ref|XP_004968405.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    231   4e-67    
sp|Q3I409.1|G3O23_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    229   1e-66    
emb|CDM81908.1|  unnamed protein product                                229   1e-66    
dbj|BAB17075.1|  GA 3beta-hydroxylase                                   229   2e-66    
dbj|BAB62072.1|  GA 3beta-hydroxylase                                   229   2e-66    
gb|KHN44143.1|  Gibberellin 3-beta-dioxygenase 1                        226   5e-66    
sp|Q3I410.1|G3O22_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    226   2e-65    
ref|NP_001042186.1|  Os01g0177400                                       225   4e-65    
ref|XP_004136071.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    224   5e-65    
ref|XP_008350339.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    220   2e-64    
ref|XP_008461418.1|  PREDICTED: gibberellin 3-beta-dioxygenase 1-...    222   4e-64    
emb|CAX46400.1|  putative GA3OX protein                                 216   3e-63    
sp|Q3I411.1|G3O21_WHEAT  RecName: Full=Gibberellin 3-beta-dioxyge...    218   2e-62    
ref|NP_001266453.1|  GA 3-oxidase 1                                     217   8e-62    
gb|ABV64512.1|  gibberellin 3-beta-hydroxylase                          215   3e-61    
gb|AAT49061.1|  GA 3-oxidase 2                                          215   3e-61    
ref|XP_002455082.1|  hypothetical protein SORBIDRAFT_03g004020          214   1e-60    
gb|ADK70957.1|  gibberellin 3-beta-hydroxylase                          209   3e-60    
ref|XP_003569638.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    213   4e-60    
ref|XP_008647746.1|  PREDICTED: GA 3-oxidase 2 isoform X1               211   1e-59    
ref|NP_001146525.1|  GA 3-oxidase 2                                     211   1e-59    
ref|XP_002987280.1|  hypothetical protein SELMODRAFT_450789             208   2e-58    
gb|ABX10776.1|  gibberellin 3-oxidase-like protein                      208   2e-58    
gb|AAT49060.1|  GA 3-oxidase 1                                          208   2e-58    
gb|ACG46320.1|  gibberellin 3-beta-dioxygenase 2-2                      207   4e-58    
gb|ABE97176.1|  putative gibberellin 3-beta-dioxygenase/gibberell...    205   4e-58    
dbj|BAK06541.1|  predicted protein                                      206   1e-57    
ref|XP_002989203.1|  hypothetical protein SELMODRAFT_450793             206   1e-57    
ref|XP_004963513.1|  PREDICTED: gibberellin 3-beta-dioxygenase 2-...    206   1e-57    
gb|ADE18861.1|  putative 2-oxoglutarate dependent dioxygenase           203   1e-56    
gb|ACL54258.1|  unknown                                                 200   2e-55    
gb|ABY49031.1|  GA3-oxidase                                             194   1e-54    
gb|ABY49023.1|  GA3-oxidase                                             191   4e-53    
gb|ABY49030.1|  GA3-oxidase                                             188   3e-52    
gb|ABY49028.1|  GA3-oxidase                                             187   7e-52    
dbj|BAQ20604.1|  gibberellin 3 oxidase 1                                191   1e-51    
gb|ABY49032.1|  GA3-oxidase                                             186   1e-51    
dbj|BAB62073.1|  GA 3beta-hydroxylase                                   190   2e-51    
gb|ABY49024.1|  GA3-oxidase                                             186   2e-51    
gb|EEC78618.1|  hypothetical protein OsI_18664                          189   3e-51    
ref|NP_001054798.1|  Os05g0178100                                       189   4e-51    
gb|KDO80406.1|  hypothetical protein CISIN_1g043986mg                   183   4e-51    
ref|XP_006451038.1|  hypothetical protein CICLE_v10010731mg             182   9e-51    
gb|ABY49026.1|  GA3-oxidase                                             181   1e-49    
gb|ABY49029.1|  GA3-oxidase                                             181   2e-49    
gb|ABY49025.1|  GA3-oxidase                                             179   7e-49    
gb|ABY49027.1|  GA3-oxidase                                             177   4e-48    
dbj|BAJ65443.1|  gibberellin 3-oxidase                                  171   9e-47    
ref|XP_002440702.1|  hypothetical protein SORBIDRAFT_09g005400          175   6e-46    
ref|XP_008337346.1|  PREDICTED: gibberellin 3-beta-dioxygenase 3-...    169   8e-46    
ref|XP_006451039.1|  hypothetical protein CICLE_v10010488mg             166   5e-45    
ref|XP_001768518.1|  predicted protein                                  171   2e-44    
gb|KDO80407.1|  hypothetical protein CISIN_1g036755mg                   163   4e-44    
ref|XP_006411026.1|  hypothetical protein EUTSA_v10016867mg             168   9e-44    
ref|XP_002268288.1|  PREDICTED: protein SRG1                            167   2e-43    
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                       166   8e-43    
ref|XP_011086643.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    164   2e-42    
gb|EAY77129.1|  hypothetical protein OsI_05094                          164   3e-42    
ref|NP_001045319.1|  Os01g0935400                                       164   3e-42    
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                       164   5e-42    
ref|XP_009396510.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    162   5e-42    
dbj|BAG68574.1|  GA20 oxidase-like protein                              163   9e-42    
ref|XP_009394604.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    162   9e-42    
ref|XP_002269890.1|  PREDICTED: protein SRG1                            162   1e-41    
ref|XP_006468196.1|  PREDICTED: protein SRG1-like                       162   1e-41    
ref|XP_001754794.1|  GA 2-oxidase                                       162   1e-41    
gb|KDO78008.1|  hypothetical protein CISIN_1g018099mg                   162   1e-41    
emb|CBI30780.3|  unnamed protein product                                160   2e-41    
ref|XP_004310153.1|  PREDICTED: flavonol synthase/flavanone 3-hyd...    161   2e-41    
ref|XP_003552185.2|  PREDICTED: protein SRG1-like isoform X1            162   2e-41    
gb|EMS54967.1|  Protein SRG1                                            162   2e-41    
gb|ACN30002.1|  gibberellin 2-beta-dioxygenase                          160   4e-41    
ref|XP_002459057.1|  hypothetical protein SORBIDRAFT_03g045170          161   5e-41    
ref|XP_004146011.1|  PREDICTED: protein SRG1-like                       160   5e-41    
ref|XP_008463796.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    160   5e-41    
ref|XP_001769181.1|  predicted protein                                  160   5e-41    
ref|XP_007044805.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    160   7e-41    
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                       160   9e-41    
ref|XP_002269432.1|  PREDICTED: protein SRG1                            159   1e-40    
gb|ACG44904.1|  flavonol synthase/flavanone 3-hydroxylase               161   1e-40    
ref|XP_003529241.1|  PREDICTED: codeine O-demethylase-like              160   1e-40    
gb|EMT24263.1|  Protein SRG1                                            160   1e-40    
ref|XP_001768771.1|  predicted protein                                  158   1e-40    
ref|XP_001774834.1|  predicted protein                                  158   1e-40    
emb|CBI16709.3|  unnamed protein product                                159   2e-40    
ref|XP_010665637.1|  PREDICTED: protein SRG1-like                       159   2e-40    
emb|CDP14583.1|  unnamed protein product                                158   2e-40    
emb|CBI16708.3|  unnamed protein product                                158   2e-40    
ref|XP_007149079.1|  hypothetical protein PHAVU_005G039300g             159   2e-40    
gb|KDP23860.1|  hypothetical protein JCGZ_27165                         159   3e-40    
ref|XP_010027975.1|  PREDICTED: protein SRG1-like                       159   3e-40    
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                       159   3e-40    
ref|XP_002270514.1|  PREDICTED: protein SRG1-like                       158   4e-40    
ref|XP_006477808.1|  PREDICTED: protein SRG1-like                       158   4e-40    
ref|XP_003531421.1|  PREDICTED: protein SRG1-like                       158   4e-40    
ref|XP_004976588.1|  PREDICTED: naringenin,2-oxoglutarate 3-dioxy...    157   5e-40    
sp|D4N501.1|DIOX2_PAPSO  RecName: Full=Probable 2-oxoglutarate/Fe...    158   5e-40    
gb|KFK34838.1|  hypothetical protein AALP_AA5G199600                    157   7e-40    
ref|XP_010925657.1|  PREDICTED: gibberellin 2-beta-dioxygenase 1-...    157   7e-40    
ref|XP_002528475.1|  Leucoanthocyanidin dioxygenase, putative           157   8e-40    
gb|AFS65097.1|  gibberellin 2-beta-dioxygenase                          156   9e-40    
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                       157   1e-39    
emb|CDM86075.1|  unnamed protein product                                157   1e-39    
gb|KCW79673.1|  hypothetical protein EUGRSUZ_C01027                     155   1e-39    
ref|XP_002270036.1|  PREDICTED: protein SRG1                            157   1e-39    
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                       157   1e-39    
gb|KEH22932.1|  2OG-Fe(II) oxygenase family oxidoreductase              157   1e-39    
ref|XP_007025225.1|  Senescence-related gene 1                          156   1e-39    
ref|XP_002270474.1|  PREDICTED: protein SRG1                            157   1e-39    
ref|XP_002270288.1|  PREDICTED: protein SRG1                            157   1e-39    
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg             157   1e-39    
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                       156   2e-39    
ref|XP_010517112.1|  PREDICTED: protein SRG1-like                       156   2e-39    
ref|XP_002517539.1|  gibberellin 3-beta hydroxylase, putative           153   2e-39    
ref|XP_006449602.1|  hypothetical protein CICLE_v10018344mg             157   2e-39    
gb|KDP21182.1|  hypothetical protein JCGZ_21653                         156   2e-39    
gb|AFK42896.1|  unknown                                                 157   2e-39    
gb|KFK36717.1|  hypothetical protein AALP_AA4G160400                    156   2e-39    
ref|XP_003604000.1|  S-norcoclaurine synthase                           156   2e-39    
ref|XP_006855491.1|  hypothetical protein AMTR_s00057p00196790          156   2e-39    
ref|XP_009116291.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    156   2e-39    
ref|XP_006442333.1|  hypothetical protein CICLE_v10020840mg             155   3e-39    
gb|AFK39951.1|  unknown                                                 155   3e-39    
emb|CBI30781.3|  unnamed protein product                                156   3e-39    
ref|XP_006442335.1|  hypothetical protein CICLE_v10020844mg             155   3e-39    
gb|AAO22518.1|  GA4                                                     150   3e-39    
emb|CBI30788.3|  unnamed protein product                                154   3e-39    
ref|XP_003565023.1|  PREDICTED: protein SRG1                            155   4e-39    
emb|CAN62525.1|  hypothetical protein VITISV_002347                     155   4e-39    
gb|KHG23078.1|  Codeine O-demethylase                                   155   4e-39    
emb|CBI30785.3|  unnamed protein product                                157   5e-39    
gb|AHW42455.1|  GA2ox5                                                  155   5e-39    
ref|XP_009139128.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    155   5e-39    
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                       155   5e-39    
emb|CBI30787.3|  unnamed protein product                                154   6e-39    
ref|XP_009133236.1|  PREDICTED: protein SRG1-like                       155   6e-39    
ref|XP_006442330.1|  hypothetical protein CICLE_v10020843mg             155   7e-39    
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...    155   7e-39    
ref|NP_001241442.1|  uncharacterized protein LOC100799195               154   7e-39    
ref|XP_006477806.1|  PREDICTED: protein SRG1-like                       154   7e-39    
emb|CDY07746.1|  BnaA03g17650D                                          154   7e-39    
ref|XP_002270078.1|  PREDICTED: protein SRG1                            155   8e-39    
emb|CDX72185.1|  BnaC08g26890D                                          157   8e-39    
ref|XP_003632980.1|  PREDICTED: protein SRG1-like                       154   8e-39    
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                     154   9e-39    
ref|XP_007135923.1|  hypothetical protein PHAVU_009G003400g             154   9e-39    
emb|CBI30782.3|  unnamed protein product                                155   9e-39    
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...    154   1e-38    
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                       154   1e-38    
ref|XP_001759112.1|  gibberellin 20-oxidase                             154   1e-38    
ref|XP_004971189.1|  PREDICTED: protein SRG1-like                       154   1e-38    
ref|XP_002269718.1|  PREDICTED: protein SRG1                            154   1e-38    
ref|XP_010274796.1|  PREDICTED: gibberellin 2-beta-dioxygenase-like     154   1e-38    
emb|CBI30786.3|  unnamed protein product                                152   1e-38    
ref|XP_010505441.1|  PREDICTED: protein SRG1-like                       154   1e-38    
emb|CAC83090.1|  gibberellin 2-oxidase                                  153   1e-38    
ref|XP_006435645.1|  hypothetical protein CICLE_v10033449mg             154   1e-38    
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2            154   1e-38    
ref|XP_006482819.1|  PREDICTED: protein SRG1-like                       154   2e-38    
gb|AAM63604.1|  putative anthocyanidin synthase                         154   2e-38    
ref|NP_181359.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...    154   2e-38    
emb|CAC85924.1|  Gibberellin 2-oxidase                                  153   2e-38    
ref|XP_003547191.1|  PREDICTED: protein SRG1-like                       154   2e-38    
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1            154   2e-38    
emb|CDY14476.1|  BnaC03g21190D                                          153   2e-38    
gb|KDO69142.1|  hypothetical protein CISIN_1g047368mg                   154   2e-38    
ref|XP_002271009.1|  PREDICTED: protein SRG1                            154   2e-38    
ref|XP_001760170.1|  predicted protein                                  152   2e-38    
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                       153   2e-38    
dbj|BAB62153.1|  GA 3beta-hydroxylase                                   151   2e-38    
ref|XP_004303202.1|  PREDICTED: protein SRG1-like                       153   2e-38    
dbj|BAJ98644.1|  predicted protein                                      154   3e-38    
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    153   3e-38    
emb|CBI30792.3|  unnamed protein product                                152   3e-38    
gb|ABX10772.1|  gibberellin 20-oxidase-like protein                     153   3e-38    
dbj|BAG68569.1|  GA20 oxidase-like protein                              152   3e-38    



>dbj|BAD06944.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=367

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/363 (79%), Positives = 316/363 (87%), Gaps = 9/363 (2%)
 Frame = +2

Query  191   MNQEIDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACE  370
             MNQEID+IIPMDFNKADQLP SH WLDDHSPVNSSST ESVP+IDLYDPQAV+KIK+ACE
Sbjct  1     MNQEIDNIIPMDFNKADQLPDSHTWLDDHSPVNSSSTHESVPLIDLYDPQAVDKIKMACE  60

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
             TWGIFQVTNHG+P +LL ++E Q RRFFELAPEQKLRA RSPGS+ GYG  RIS+FFDSQ
Sbjct  61    TWGIFQVTNHGVPWSLLAQIEHQARRFFELAPEQKLRAVRSPGSLAGYGTVRISKFFDSQ  120

Query  551   MWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP---  706
             MW+EGFTVAGSPLEHARQ    DYSDFCSV++DYQ +MR LA+ +AALMFK + + P   
Sbjct  121   MWSEGFTVAGSPLEHARQVWPQDYSDFCSVIDDYQEKMRGLAEKIAALMFKSLGLSPGED  180

Query  707   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  886
             + W     +    TQAYLQMNW P CPDPTRAMG AQHTDTSLVTLLYQTSNI GLQVYG
Sbjct  181   VEWFEPNGLSNS-TQAYLQMNWYPKCPDPTRAMGLAQHTDTSLVTLLYQTSNIRGLQVYG  239

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
             PNLNW+DV+P S+AIVVNLGDLMQIISNG FKSVLHRAIVS+AH+RISV YFFG SKNVE
Sbjct  240   PNLNWVDVKPISDAIVVNLGDLMQIISNGRFKSVLHRAIVSEAHNRISVGYFFGSSKNVE  299

Query  1067  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALASGSEAPVG  1246
             I+PSLKLIK +EFPMY+PISWN YLDIK KYF K+LEMIGFNSDVEKSNALASG EAP+G
Sbjct  300   ISPSLKLIKGSEFPMYKPISWNEYLDIKNKYFNKSLEMIGFNSDVEKSNALASGDEAPLG  359

Query  1247  SEV  1255
             SEV
Sbjct  360   SEV  362



>ref|XP_006476108.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Citrus sinensis]
Length=355

 Score =   343 bits (879),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 227/342 (66%), Gaps = 13/342 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW-LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETW  376
              +  IIP+DF  A +LP SH W L DH P+    T  +VPVIDL  PQA   I+ ACE W
Sbjct  14    HLKHIIPLDFKTALKLPDSHAWTLPDH-PMADPLTHAAVPVIDLGGPQAATLIRQACEKW  72

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G FQVTNHGIP+ LL ++E QTRR F L   QKL A RSP   TGYG+PRIS FF   MW
Sbjct  73    GAFQVTNHGIPIKLLNQVEFQTRRLFALPANQKLLAGRSPEDFTGYGLPRISTFFSKLMW  132

Query  557   TEGFTVAGSPLEHARQ------DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  709
             TEGFT+ GSPL+HARQ      D+ +FC V+ +YQ +++ LA+ +  LMF+ +      I
Sbjct  133   TEGFTILGSPLDHARQLWPHEYDHINFCQVMVEYQKELKGLAEKILGLMFRSLGLTQEDI  192

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
              W +    G +  Q  LQ+N  P+CPDP RAMG A HTD+SL+T LYQ  N +GLQVY  
Sbjct  193   AWFK-PKYGCKSPQGVLQLNSYPVCPDPNRAMGLAPHTDSSLLTSLYQ-GNTSGLQVYRD  250

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
             N+ W+ V P S A+VV +GDLMQI  NG FKS LHRA+V+   HRIS AYF+GP ++V+I
Sbjct  251   NVGWVPVHPVSGALVVIVGDLMQITCNGRFKSALHRALVNNTRHRISTAYFYGPPQDVKI  310

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1195
             +PS+KL       +YRP++W  YLD K  +F KA+E+I +++
Sbjct  311   SPSVKLTDHDHPILYRPVTWREYLDAKATHFNKAIELIRYDA  352



>ref|XP_007013295.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
 gb|EOY30914.1| Gibberellin 3-beta hydroxylase, putative [Theobroma cacao]
Length=355

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 217/335 (65%), Gaps = 11/335 (3%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             +  IP+DF    +LP SH W   H P++   TQE +P+IDL  P     ++ ACE WG F
Sbjct  21    EHTIPLDFTNVPKLPDSHAWTLPHQPIDPF-TQEPLPIIDLAKPDVSKLVRHACEEWGAF  79

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             Q+TNHGIP+ LL  +E QTRR F L  E KL A RSP   TGYG+ RIS FF   MW+EG
Sbjct  80    QITNHGIPICLLNEIEYQTRRLFSLPAESKLLAVRSPEGFTGYGLARISPFFSKLMWSEG  139

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*R  721
             F++ GSP+EHA Q    D++ FC V+E +Q +M+ L++ + A+M   +       + W  
Sbjct  140   FSIIGSPVEHASQLWPEDHAKFCEVMEQFQEEMKALSEKMVAIMLSSLGLTHEEDVKWFE  199

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LN  898
                 G   +   LQ+N  P+CPDP RAMG A HTD+S++TLLYQ  NI+GLQV   +   
Sbjct  200   PMKEGCDQSTCVLQLNSYPVCPDPGRAMGLAPHTDSSVLTLLYQ-GNISGLQVQRDDAAG  258

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ VEP   A+VVN+GDLM I+SNG FKSVLHRA+V+  HHR+S AYF+GP ++ +++P 
Sbjct  259   WMPVEPVEGALVVNVGDLMHIVSNGRFKSVLHRALVNNEHHRVSTAYFYGPPRDAKVSPL  318

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              KLI     P+YRP++W  YL+ K K+F KALE I
Sbjct  319   RKLIDRDHPPLYRPVTWKDYLEAKSKHFSKALESI  353



>ref|XP_011045367.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=372

 Score =   327 bits (837),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 217/332 (65%), Gaps = 14/332 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL---DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             +DF    ++P SH W    D+  P+      ESVPVIDL DP  +  I  AC+TWG+ QV
Sbjct  23    IDFTSLQEIPDSHKWTQIDDEQRPLVDPLITESVPVIDLSDPNVLQNIGHACKTWGVVQV  82

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP +LL  +E  +R  F L  +QKL+A RSP  V+GYG+PRIS FF   MW+EGFT
Sbjct  83    TNHGIPTSLLENIESASRSLFSLPIQQKLKAARSPDGVSGYGVPRISSFFSKLMWSEGFT  142

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPLEH R    QDY+ FC ++E+Y+ +M+ LA+ L  LM   +    + + W   G 
Sbjct  143   IVGSPLEHFRHLWSQDYTKFCDIIEEYKKEMQKLARRLTRLMLGSLGITKKDLKW--AGS  200

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N+ P CPDP +AMG A HTD++L+T+LYQ SN +GLQV    + W+ 
Sbjct  201   TGESKKGSAALQLNYYPACPDPDQAMGLAAHTDSTLLTILYQ-SNTSGLQVLKEGIGWVT  259

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+A+ +GP  +VEI+P  KL
Sbjct  260   VPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQKL  319

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P   P+YRP++WN YL  K  YF KAL  +
Sbjct  320   VGPNHPPLYRPVTWNEYLGTKATYFNKALSSV  351



>ref|XP_002299619.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE84424.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=372

 Score =   326 bits (835),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 217/332 (65%), Gaps = 14/332 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL---DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             +DF    ++P SH W    D+  P+      ESVPVIDL DP  +  I  AC+TWG+ QV
Sbjct  23    IDFTSLQEIPDSHKWTQIDDEQHPLVDPLNTESVPVIDLSDPNVLQNIGHACKTWGVLQV  82

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP +LL  +E  +R  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EGFT
Sbjct  83    TNHGIPTSLLENIESASRSLFSLPIQQKLKAARSPDGVSGYGVARISSFFSKLMWSEGFT  142

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPLEH R    QDY+ FC ++E+Y+ +M+ LA+ L  LM   +    + + W   G 
Sbjct  143   IVGSPLEHFRQLWSQDYTKFCDIIEEYKKEMQKLARRLTWLMLGSLGIAKKDLKW--AGS  200

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N+ P CPDP +AMG A HTD++L+T+LYQ SN +GLQV    + WI 
Sbjct  201   TGESKKGSAALQLNYYPACPDPDQAMGLAAHTDSTLLTILYQ-SNTSGLQVLKEGIGWIT  259

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+A+ +GP  +VEI+P  KL
Sbjct  260   VPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAFLYGPPSSVEISPLQKL  319

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P   P+YRP++WN YL  K KYF KAL  +
Sbjct  320   VGPNHPPLYRPVTWNEYLGTKAKYFNKALSSV  351



>ref|XP_010254241.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=370

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 165/346 (48%), Positives = 216/346 (62%), Gaps = 34/346 (10%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             +D     ++P SH W  LDD+  V+SS   ESVPVIDL DP AV  +  AC+TWG+FQVT
Sbjct  21    LDLESVREVPDSHAWPQLDDYPSVHSSFDVESVPVIDLSDPNAVKLVGHACKTWGVFQVT  80

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
             NHGIP+ LL  +E   RR F L P+QKL+A R P  ++GYG+ RIS FF   MW+EGFT+
Sbjct  81    NHGIPMRLLEDVESHGRRLFALPPQQKLKAARLPDGISGYGLARISSFFPKLMWSEGFTI  140

Query  575   AGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG--  736
              GSP+EHAR    QD++ FC V+E+Y   M+ LA+ L  LM             G +G  
Sbjct  141   VGSPIEHARQLWPQDHTRFCDVMEEYGKCMKQLARKLFWLML------------GSLGIN  188

Query  737   ---LQWTQ----------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQ  877
                + W            A LQ+N  P CPDPTRAMG A HTD++L+T+LYQ S  +GLQ
Sbjct  189   KDDINWASPQGGESGAMCAALQLNSYPACPDPTRAMGLAAHTDSTLLTVLYQNST-SGLQ  247

Query  878   VYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSK  1057
             V      W+ V P   A+VVN+GDL+ I+SNG+F SVLHRA+V++  HR+SVAY +GP  
Sbjct  248   VLRDGAGWVTVPPLPGALVVNVGDLLHILSNGIFPSVLHRAVVNRTRHRLSVAYLYGPPT  307

Query  1058  NVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1195
             N +I+P   L+ P   P+YRP++W  YL  K K+F KAL  +   S
Sbjct  308   NAQISPLSSLVDPNHPPLYRPVTWAEYLGTKAKHFNKALSSVRLCS  353



>gb|AHC32022.1| gibberellin 3-oxidase 1 [Camellia sinensis]
Length=361

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 223/335 (67%), Gaps = 17/335 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNS----SSTQESVPVIDLYDPQAVNKIKIACETWGI  382
             +DFN  ++LP SH W  L+ +S  +S    + T+ESVPVIDL DP A+  +  AC TWG+
Sbjct  21    LDFNSLEELPESHAWTSLEKYSSSDSVETITGTKESVPVIDLNDPNAMELVGHACRTWGV  80

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQVTNHGI  ++L R+E   +  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+E
Sbjct  81    FQVTNHGINTSVLNRVESAGKSLFSLPIQQKLKAARSPEGVSGYGVARISPFFPKLMWSE  140

Query  563   GFTVAGSPLEHA----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             GFT+ GSPLEHA     QDYS+FC V+E+Y+ +M+ LA+ L  LM   +      + W  
Sbjct  141   GFTIFGSPLEHACQLWPQDYSNFCDVIEEYEKEMKILARRLMWLMLGSLDISKEDVKW--  198

Query  722   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
              G  G  +   A +Q+N  P CP+P RAMG A HTD++L+T+LYQ +N +GL+V+     
Sbjct  199   AGPKGDFKGANAAVQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLEVHRDGYG  257

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P  + +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P 
Sbjct  258   WVTVPPIPDTLVVNIGDLLHILSNGLYPSVLHRAMVNRTRHRLSVAYLYGPPPNVQISPL  317

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              KL+  T  P+YRP++W  YL  K KYF KAL  +
Sbjct  318   SKLVDLTHPPLYRPVTWTEYLGTKAKYFDKALSSV  352



>ref|XP_006427125.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|ESR40365.1| hypothetical protein CICLE_v10027153mg [Citrus clementina]
 gb|KDO58202.1| hypothetical protein CISIN_1g036286mg [Citrus sinensis]
Length=352

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 214/330 (65%), Gaps = 12/330 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +DF    +LP S+ W   D  P+  S   ESVPVIDL DP A+  +  AC+TWG FQV N
Sbjct  21    LDFTSLQELPDSYAWTQRDEYPIGDSLISESVPVIDLNDPNALTLVGNACKTWGAFQVIN  80

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP  LL   E  +R  F L  +QKL+A RSP  V GYG+ RIS FF   MW+EGFTVA
Sbjct  81    HGIPTNLLDNTESTSRSLFSLPTQQKLKAARSPDGVAGYGLARISSFFSKLMWSEGFTVA  140

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  736
             GSPL+H R    QD+   C ++E+Y+ +M+ LA  L  L+   +    + + W   G  G
Sbjct  141   GSPLDHFRKLWPQDFCKHCDIIEEYEQEMKKLAGRLMWLVLGSLGITTQDVKW--AGPKG  198

Query  737   -LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  913
                   A LQ+N+ P CPDP RAMG A+HTD++L+T+LYQ +N +GLQV      W+ V 
Sbjct  199   HFTDASAALQLNYYPACPDPDRAMGLAEHTDSTLLTILYQ-NNTSGLQVLKEGTGWVMVP  257

Query  914   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1093
             P   A+VVN+GDL+ I+SNG + SVLHRA+V++A HR+S+AY +GP  +V+I+P  KL+ 
Sbjct  258   PIPGALVVNVGDLIHILSNGSYPSVLHRAVVNRAKHRLSIAYLYGPPSSVQISPLQKLVG  317

Query  1094  PTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P+  P+YRPI+W+ YLD K K+F KAL  +
Sbjct  318   PSHPPLYRPITWSEYLDTKAKHFNKALSSV  347



>gb|KDP32333.1| hypothetical protein JCGZ_13258 [Jatropha curcas]
Length=348

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/336 (47%), Positives = 219/336 (65%), Gaps = 9/336 (3%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW-LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETW  376
             +++ I P+DF    +LP SH W L   +P     TQESVP+IDL DP A + I+ A E W
Sbjct  2     QLNQITPLDFKNVAKLPDSHRWTLSSENPSQDPLTQESVPIIDLNDPHAPSLIREANENW  61

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G+FQ+TNHG+P+ L+  ++ QT+R F L  +QKL A RSP  +TGYG+ RIS F + Q+W
Sbjct  62    GMFQLTNHGVPITLMQEIQSQTQRLFALPADQKLLAARSPDGLTGYGMARISSFLNKQLW  121

Query  557   TEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
              EGFT+ GSP +HA Q    DY+ FC VVE+YQ +M+ L++ L  LMFK +      + W
Sbjct  122   FEGFTIIGSPAQHASQFWPNDYTTFCDVVEEYQKEMKGLSERLIGLMFKSLGLAQEDVKW  181

Query  716   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
                        Q+ LQ+N  PICP+  +AMG A HTD++L+TL++Q +N +GLQV+    
Sbjct  182   FTTKSETQHQPQSVLQLNSYPICPEAGQAMGLAPHTDSTLLTLVHQ-NNASGLQVFREGS  240

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              W+ V P   A+VVN+GDLMQI+SNG FKSVLHRA+V++ +HR SV +F+GP  + E++P
Sbjct  241   GWVPVHPVDGALVVNIGDLMQILSNGRFKSVLHRAVVNETYHRTSVVHFYGPPMDAEVSP  300

Query  1076  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              + LI      +YR +SW  YLD K  +F K L+ I
Sbjct  301   LMHLIDFDHPVLYRAVSWKEYLDAKKIHFDKTLDFI  336



>ref|XP_004288825.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Fragaria vesca 
subsp. vesca]
Length=355

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/354 (47%), Positives = 223/354 (63%), Gaps = 38/354 (11%)
 Frame = +2

Query  188   TMNQEIDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIAC  367
             T  + +  IIP+DFN  D LP SH W  D SP +   T E VP+IDL+DP A   I++A 
Sbjct  6     TSTRNLSHIIPLDFNSVDTLPDSHTW--DSSPDHHLFT-EFVPIIDLHDPNAATLIRLAS  62

Query  368   ETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDS  547
             E WG+FQVTNHG+P+ L+   E Q R  FEL  +QKLRA RSP S +GYG    +  F  
Sbjct  63    EQWGVFQVTNHGVPMNLVQEAEVQARGLFELPRDQKLRALRSPESFSGYGSAGNAANFSK  122

Query  548   QMWTEGFTVAGSPLEHARQDYSD-------FCSVVEDYQAQMRDLAQNLAALMFK*IIRP  706
              MW+EGFT+ GSP+EHA Q + D       FC V+E+YQ +M+ L+  L  LM       
Sbjct  123   LMWSEGFTIMGSPVEHAAQLWPDDQSVQTHFCDVMEEYQKKMKGLSGKLIRLML------  176

Query  707   ICW*RCGMVGL-----QWTQ----------AYLQMNW*PICPDPTRAMGFAQHTDTSLVT  841
                   G +GL     +W              LQ+N+ P+CPDPTRAMG A HTDTS+ T
Sbjct  177   ------GSLGLDKEDVKWLNRPKRSSTNFPQVLQLNYYPVCPDPTRAMGLAPHTDTSVFT  230

Query  842   LLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHH  1021
             +L Q  +I+GLQV+   + W+ V+P   A+VVN+GDLM I+SNG FK+ +HRA+V++ HH
Sbjct  231   VLNQC-DISGLQVFQEGIGWMSVQPIPGALVVNVGDLMHILSNGRFKTTIHRAVVNELHH  289

Query  1022  RISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             RIS+AYF+GP  +V+I+P +KLI     P+YRP++W  YL IK  +F +ALE+I
Sbjct  290   RISIAYFYGPPYDVKISPLMKLIGQDHPPLYRPVTWKEYLGIKGTHFNRALELI  343



>gb|AFS18537.1| gibberellin 3-oxidase [Pyrus communis]
Length=371

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 218/332 (66%), Gaps = 15/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSPVNSSS--TQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DFN   +LP S+ W   DDH P + SS    +SVPVIDL +P A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSSLSSFGVDDSVPVIDLSEPNALKLTGHACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP  LL  +E   +  F L  EQKL+A R P  ++GYG  RIS FF   MW+EGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVEQKLKAARPPDGISGYGFARISSFFRKLMWSEGFT  141

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RCGM  730
             + GSP++H RQ    DY  FC+++E+Y+ +M+ LA  L  LM   + I P  + W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYEKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISPEDVKW--AGS  199

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLRDGTGWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P + A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY FGP  +V+I+P  KL
Sbjct  259   VPPMAGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASVQISPLSKL  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P+  P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPITWNEYLGTKAKHFNKALSSV  350



>ref|XP_009339604.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 218/332 (66%), Gaps = 15/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSPVNSSS--TQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DFN   +LP S+ W   DDH P + SS    +SVPVIDL +P A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSSLSSFGVDDSVPVIDLSEPNALKLTGHACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP  LL  +E   +  F L  EQKL+A R P  ++GYG  RIS FF   MW+EGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVEQKLKAARPPDGISGYGFARISSFFRKLMWSEGFT  141

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RCGM  730
             + GSP++H RQ    DY  FC+++E+Y+ +M+ LA  L  LM   + I P  + W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYEKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISPEDVKW--AGS  199

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLRDGTGWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P + A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY FGP  +V+I+P  KL
Sbjct  259   VPPMAGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASVQISPLSKL  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P+  P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPITWNEYLGTKAKHFNKALSSV  350



>gb|AGN95009.1| gibberellin 3-beta-dioxygenase, partial [Prunus salicina]
Length=331

 Score =   315 bits (806),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 218/333 (65%), Gaps = 16/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDH---SPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF+   +LP S+ W   DD    SP +  + Q+SVPVIDL DP A+     AC TWG+FQ
Sbjct  1     DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  60

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHGIP  LL  +E   R  F L  +QKL+A RSP  ++GYG  RIS FF   MW+EGF
Sbjct  61    VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  120

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL+H R    QDY+ FC+++E+Y+ +M+ LA  L  LM   +      + W   G
Sbjct  121   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKEMKKLAGRLMWLMLGSLGISKEDVKW--AG  178

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  179   PKGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTRWV  237

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  238   TVPPLPGALVVNVGDLIHILSNGLYPSVLHRAVVNRSRHRLSIAYLYGPPDSVQISPLSK  297

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  298   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  330



>ref|XP_002303276.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEE78255.1| gibberellin 3-beta-hydroxylase family protein [Populus trichocarpa]
Length=373

 Score =   316 bits (809),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 218/334 (65%), Gaps = 16/334 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             +DF+   ++P SH W  LDD     P   S   ESVPVIDL DP  +  I  AC+TWG+ 
Sbjct  22    LDFSSLQEIPDSHKWTQLDDIEQQHPSVESFITESVPVIDLLDPNVLQNIGNACKTWGVL  81

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QVTNHGIP++LL  +E  +R  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EG
Sbjct  82    QVTNHGIPISLLESVEGVSRSLFSLPVQQKLKAARSPDGVSGYGVARISSFFSKLMWSEG  141

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPLEH R    QDY+ FC V+E+++ +M+ LA+ L  LM   +    + + W   
Sbjct  142   FTIVGSPLEHFRQLWPQDYTKFCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNW--A  199

Query  725   GMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
             G  G  +   A LQ+N  P CPDP  AMG A HTD++L+T+LYQ +N +GLQV    + W
Sbjct  200   GPKGESKEGGAALQLNSYPACPDPDLAMGLAAHTDSTLLTILYQ-NNTSGLQVLKEGIGW  258

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +V+I+P  
Sbjct  259   VTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAYLYGPPSSVQISPIQ  318

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             KL+ P   P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   KLVGPNHPPLYRPITWNEYLVAKAKHFNKALSSV  352



>gb|AAR12160.1| gibberellin 3-oxidase [Populus tremula x Populus tremuloides]
Length=373

 Score =   316 bits (809),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 218/334 (65%), Gaps = 16/334 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             +DF+   ++P SH W  LDD     P   S   ESVPVIDL DP  +  I  AC+TWG+ 
Sbjct  22    LDFSSLQEIPDSHKWTQLDDIEQQHPSVESFITESVPVIDLLDPNVLQNIGNACKTWGVL  81

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QVTNHGIP++LL  +E  +R  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EG
Sbjct  82    QVTNHGIPISLLESVEGVSRSLFSLPVQQKLKAARSPDGVSGYGVARISSFFSKLMWSEG  141

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPLEH R    QDY+ FC V+E+++ +M+ LA+ L  LM   +    + + W   
Sbjct  142   FTIVGSPLEHFRQLWPQDYTKFCDVIEEHEKEMQKLARRLTWLMLGSLGITKKDLNW--A  199

Query  725   GMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
             G  G  +   A LQ+N  P CPDP  AMG A HTD++L+T+LYQ +N +GLQV    + W
Sbjct  200   GPKGESKEGGAALQLNSYPACPDPDLAMGLAAHTDSTLLTILYQ-NNTSGLQVLKEGIGW  258

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +V+I+P  
Sbjct  259   VTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSIAYLYGPPSSVQISPIQ  318

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             KL+ P   P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   KLVGPNHPPLYRPITWNEYLVAKAKHFNKALSSV  352



>ref|XP_008228615.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Prunus mume]
Length=372

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 218/333 (65%), Gaps = 16/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDH---SPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF+   +LP S+ W   DD    SP +  + Q+SVPVIDL DP A+     AC TWG+FQ
Sbjct  22    DFSSLQELPDSYAWSQNDDQYASSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHGIP  LL  +E   R  F L   QKL+A RSP  ++GYG  RIS FF   MW+EGF
Sbjct  82    VTNHGIPSKLLDDIESAGRSLFSLPVHQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL+H R    QDY+ FC+++E+Y+ +M+ LA  L  LM   +   +  + W   G
Sbjct  142   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISMEDVKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  200   PRGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTGWV  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  259   TVPPLPGALVVNVGDLIHILSNGLYPSVLHRAVVNRSRHRLSIAYLYGPPDSVQISPLSK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  351



>ref|XP_008377587.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Malus domestica]
Length=371

 Score =   315 bits (807),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 215/332 (65%), Gaps = 15/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSPVNSSS--TQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DFN   +LP S+ W   DDH P + SS    +SVPVIDL +P A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSSLSSFGADDSVPVIDLSEPNAIKLTGHACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP  LL  +E   +  F L  EQKL+A R P  ++GYG  RIS FF   MW+EGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVEQKLKAARPPDGISGYGFARISSFFRKLMWSEGFT  141

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSP++H RQ    DY  FC+++E+Y+ +M+ LA  L  LM   +      + W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYEKFCNIIEEYEKEMKRLAGRLMWLMLGSLGISTEDVKW--AGS  199

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLRDGTGWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVVNVGDLIHILSNGVYPSVLHRAVVNRTQHRLSIAYLFGPPASIQISPLSKL  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P+  P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPITWNEYLGTKAKHFNKALSSV  350



>gb|AEK70423.1| GA3ox1 [Gossypium hirsutum]
Length=364

 Score =   314 bits (805),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 215/338 (64%), Gaps = 14/338 (4%)
 Frame = +2

Query  206   DSIIPM--DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
             D+II +  DF    +LP S+ W   DD    +  S+ ESVP+IDL DP A+  I  AC T
Sbjct  7     DAIIRLHPDFTSLQELPESYAWNQRDDIDYPSFDSSAESVPIIDLNDPNALQNIGHACRT  66

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG+FQV NHG+   LL  +E  +R  F L   QKL+A RSP  V+GYG  RIS FF   M
Sbjct  67    WGVFQVINHGVSTTLLDMVESTSRTLFSLPVNQKLKAARSPDGVSGYGFARISSFFSKLM  126

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPI  709
             W+EGFT+ GSP EH RQ    DY++ C V+++Y+ +M+ LA  L  LM   +     + I
Sbjct  127   WSEGFTIVGSPDEHFRQLWPHDYTNHCDVIKEYKQEMKKLAGRLMCLMLGSLGITAKQDI  186

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
              W        +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ S  +GLQV   
Sbjct  187   KW-AGPKSEFKEASAALQLNYYPACPDPDRAMGLAAHTDSTLLTILYQNST-SGLQVLKE  244

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
              + WI V P  + +V+N+GDLM I+SNG + SVLHRA+V++  HR+S+AY +GP  +V+I
Sbjct  245   GVGWIKVSPVPDGLVINVGDLMHILSNGSYPSVLHRAMVNRTRHRLSIAYLYGPPSSVKI  304

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +P  KL+ PT  P+YRPI+WN YLD K KYF KAL  +
Sbjct  305   SPHPKLVGPTHPPLYRPITWNEYLDTKAKYFNKALSWV  342



>dbj|BAD91162.1| gibberellin 3-beta hydroxylase [Prunus subhirtella]
Length=372

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 218/333 (65%), Gaps = 16/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDH---SPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF+   +LP S+ W   DD    SP +  + Q+SVPVIDL DP A+     AC TWG+FQ
Sbjct  22    DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHGIP  LL  +E   R  F L  +QKL+A RSP  ++GYG  RIS FF   MW+EGF
Sbjct  82    VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL+H R    QDY+ FC+++E+Y+  M+ LA  L  LM   +   +  + W   G
Sbjct  142   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKVMKRLAGRLMWLMLGSLGISMEDVKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  200   PKGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTGWV  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  259   TVPPLPGALVVNVGDLIHILSNGLYPSVLHRAVVNRSRHRLSIAYLYGPPASVQISPLSK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  351



>gb|AEW67998.1| gibberellin 3 oxidase 1 [Castanea mollissima]
Length=368

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 218/331 (66%), Gaps = 16/331 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             DFN   +LP S+ W   D  P   S + ESVP+IDL DP A+  +  AC+TWG+FQVTNH
Sbjct  22    DFNSLQELPDSYKWTQLDEYPSCESFSSESVPLIDLTDPNALTLVGHACKTWGVFQVTNH  81

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             GIP  LL  +E  +R  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ G
Sbjct  82    GIPTKLLDDIESVSRCLFSLPQQQKLKAARSPDGVSGYGLARISSFFPKLMWSEGFTIVG  141

Query  581   SPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPIC-----W*RCGMV  733
             SPLEH R    Q+YS FC ++E+Y+ +M+ LA  L  L+   +   IC     W   G  
Sbjct  142   SPLEHFRQLWPQEYSKFCDIIEEYEKEMKKLAGRLMWLILGSL--GICNEDIKW--AGPK  197

Query  734   G-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
             G  Q   A LQ+N  P CPDP +AMG A HTD++L+T+L+Q +N +GLQV      W+ V
Sbjct  198   GEFQGASAALQLNSYPACPDPDQAMGLAAHTDSTLLTILHQ-NNTSGLQVLREGTGWVTV  256

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
             +P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  +R+S+AY +GP  +V+I+P  KL+
Sbjct  257   DPVQGALVVNIGDLLHILSNGLYPSVLHRAMVNRTRYRLSMAYLYGPPDSVQISPLSKLL  316

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              P+  P+YRP++WN YL  K K+F KAL  +
Sbjct  317   GPSHPPLYRPVTWNEYLGTKAKHFNKALSCV  347



>ref|XP_009374076.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Pyrus x bretschneideri]
Length=385

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 226/369 (61%), Gaps = 54/369 (15%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWL-----------------DDHSPVNSSSTQESVPVIDLY  331
             +  IIP+DF     LP SHIW                   + +P N+ S    VPVIDL+
Sbjct  18    LSHIIPLDFESVHALPDSHIWTHTKEVEVPVSKSICNMKSNPTPYNTPSLV-CVPVIDLF  76

Query  332   DPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTG  511
             +  A + ++ ACE WG+FQVTNHGIP+ L+   E QTRR F L  +QKLRA RSP  VTG
Sbjct  77    NSNAASLVRRACEKWGVFQVTNHGIPMQLMKEAEFQTRRLFALPRDQKLRALRSPEGVTG  136

Query  512   YGIPRISRFFDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAA  679
             YG+ RIS+ F   MW+EGFT+ GSP EHARQ     +++FC  +E+YQ +M+ LA  L  
Sbjct  137   YGLARISKNFPMLMWSEGFTIMGSPAEHARQLWPRHHANFCGAMEEYQKEMKGLALKLIG  196

Query  680   LMFK*IIRPICW*RCGMVGLQWT-------------QAYLQMNW*PICPDPTRAMGFAQH  820
             LM             G +GL +              +A LQ+N  P+CPDPTRA+G A H
Sbjct  197   LML------------GSLGLNYEDVKWLKPKNRSGPRALLQLNSYPVCPDPTRAIGLAPH  244

Query  821   TDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRA  1000
             TD+SL+TLL Q+S I+GLQV    + W+ V P   A+VVN+GDLM I+SNG FKS +HRA
Sbjct  245   TDSSLLTLLNQSS-ISGLQVLLDGIRWVPVHPIPGALVVNVGDLMHILSNGQFKSAVHRA  303

Query  1001  IVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             +V++ HHRIS+AYF+GP  +V+I+P +        P+YRP++W  YL+ K  +F KALE+
Sbjct  304   VVNEVHHRISMAYFYGPPMDVKISPLID----HNHPLYRPVTWKEYLEYKATHFDKALEV  359

Query  1181  IGFNSDVEK  1207
             I   +D EK
Sbjct  360   I--RTDAEK  366



>gb|KHG10231.1| Gibberellin 3-beta-dioxygenase 1 -like protein [Gossypium arboreum]
Length=364

 Score =   313 bits (803),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 210/330 (64%), Gaps = 12/330 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             DF    +LP S+ W   DD    +  S+ ESVP+IDL DP A+  I  AC TWG+FQV N
Sbjct  15    DFTSLQELPESYAWNQRDDIDYPSFDSSAESVPIIDLNDPNALQSIGHACRTWGVFQVIN  74

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+   LL  +E  +R  F L   QKL+A RSP  V+GYG  RIS FF   MW+EGFT+ 
Sbjct  75    HGVSTTLLDMVESTSRTLFSLPVNQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIV  134

Query  578   GSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RCGMV  733
             GSP EH RQ    DY++ C V+++Y+ +M+ LA  L  LM   +     + I W      
Sbjct  135   GSPDEHFRQLWPHDYTNHCDVIKEYKQEMKKLAGRLMCLMLGSLGITAKQDIKW-AGPKS  193

Query  734   GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  913
               +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ S  +GLQV    + WI V 
Sbjct  194   DFKEASAALQLNYYPACPDPDRAMGLAAHTDSTLLTILYQNST-SGLQVLKEGVGWIKVP  252

Query  914   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1093
             P  + +V+N+GDLM I+SNG + SVLHRA+V++  HR+S+AY +GP  +V+I+P  KL+ 
Sbjct  253   PVPDGLVINVGDLMHILSNGSYPSVLHRAMVNRTRHRLSIAYLYGPPSSVKISPHPKLVG  312

Query  1094  PTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             PT  P+YRPI+WN YLD K KYF KAL  +
Sbjct  313   PTHPPLYRPITWNEYLDTKAKYFNKALSWV  342



>ref|XP_010098950.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
 gb|EXB76252.1| Gibberellin 3-beta-dioxygenase 3 [Morus notabilis]
Length=359

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 219/339 (65%), Gaps = 13/339 (4%)
 Frame = +2

Query  209   SIIPMDFNKADQLPHSHIWLDDHSPVNS-SSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             +I+P+DFN    LP SH W    S   S +    SVPVIDL+DP AV+ I+ ACE WG F
Sbjct  20    NIVPLDFNSVPTLPDSHTWTPCTSADPSFTGDDHSVPVIDLFDPNAVSLIRQACERWGAF  79

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QVTNHG+P   L  +E Q+RRFF L  E+KLR  RS  SVTGYG+  IS+FF   MW+EG
Sbjct  80    QVTNHGVPYDHLKEVESQSRRFFALPAERKLRVVRSAESVTGYGLVPISKFFPKMMWSEG  139

Query  566   FTVAGSPLEHARQ-----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             F++ GSP E+ARQ     D   FCSV+E YQ +M+ L++ L  L+ + +      I W  
Sbjct  140   FSMTGSPEEYARQLWPHEDCRQFCSVMEMYQKEMKGLSEKLLELILRSLGVNYEDIKW-A  198

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV-YGPNLN  898
                 GL   QA LQ+N  P+CPDPTRAMG A HTD+SL+T+LYQ+    GLQV    ++ 
Sbjct  199   NPKNGLSSYQALLQLNSYPVCPDPTRAMGLAPHTDSSLLTVLYQS--CMGLQVQRKEDIG  256

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V     A++VNLGDLM I+SNG FKS +HRA+V+K HHR+SVAYF GP K  +I+  
Sbjct  257   WVPVHTVDGALIVNLGDLMHIMSNGRFKSAMHRAVVNKTHHRVSVAYFCGPPKEEKISSL  316

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1195
             +++I      MYR ++W  YL+I+  +F KALE I  N+
Sbjct  317   IQMIDDDRPRMYRGVTWKEYLEIRAAHFDKALEFIKNNN  355



>ref|XP_010249916.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=378

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/337 (49%), Positives = 215/337 (64%), Gaps = 17/337 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPV----NSSSTQESVP-VIDLYDPQAVNKIKIACETWG  379
             +D     ++P SH W  LDD+       +S+   ESVP VIDL DP AV  +  AC+TWG
Sbjct  22    LDLESVREVPDSHAWPELDDYPSAVTVEDSNFDVESVPPVIDLTDPNAVKLVGHACKTWG  81

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             +FQVTNHG+P+ LL  +E Q RR F L P QKL+A R P  ++GYG+ RIS FF   MW+
Sbjct  82    VFQVTNHGLPMRLLDDVESQGRRLFSLPPHQKLKAARPPDGISGYGLARISSFFPKLMWS  141

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSP+EHARQ    DYS+FC V+E+Y+ +M+ LA  L  LM   +      I W 
Sbjct  142   EGFTIVGSPVEHARQLWPLDYSNFCDVMEEYEKEMKQLAGRLMWLMLGSLGISKDDIKWA  201

Query  719   RCGMVGLQ-WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-  892
                  G      A LQ+N  P CPDP+RAMG A HTD++L+T+LYQ S  +GLQV     
Sbjct  202   AAASKGESGGVCAALQLNSYPACPDPSRAMGLAAHTDSTLLTVLYQNST-SGLQVLRDGA  260

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P   A+VVN+GDL+ I+SNG + SVLHRAIV++ HHR+SVAY +GP  N +I+
Sbjct  261   AGWVTVPPLRGALVVNVGDLLHILSNGKYPSVLHRAIVNRTHHRLSVAYLYGPPTNAQIS  320

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P   L+ P   P+YRP++W  YL  K K+F KAL  +
Sbjct  321   PISSLVDPNHPPLYRPVTWAEYLGTKAKHFNKALSSV  357



>ref|XP_007215556.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
 gb|EMJ16755.1| hypothetical protein PRUPE_ppa007336mg [Prunus persica]
Length=372

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 218/333 (65%), Gaps = 16/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDH---SPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF+   +LP S+ W   DD    SP +  + Q+SVPVIDL DP A+     AC TWG+FQ
Sbjct  22    DFSSLQELPDSYAWSQNDDQYPSSPGSFGAEQDSVPVIDLSDPNALKLTGHACRTWGVFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHGIP  LL  +E   R  F L  +QKL+A RSP  ++GYG  RIS FF   MW+EGF
Sbjct  82    VTNHGIPSKLLDDIESAGRSLFSLPVQQKLKAARSPDGISGYGFARISSFFQKLMWSEGF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL+H R    QDY+ FC+++E+Y+ +M+ LA  L  LM   +      + W   G
Sbjct  142   TIVGSPLDHFRQLWPQDYNKFCNIIEEYEKEMKKLAGRLMWLMLGSLGISKEDVKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+
Sbjct  200   PKGDFRDASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTRWV  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL+ I+SNG++ SVLH+A+V+++ HR+S+AY +GP  +V+I+P  K
Sbjct  259   TVPPLPGALVVNVGDLIHILSNGLYPSVLHQAVVNRSRHRLSIAYLYGPPDSVQISPLSK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  319   LLGPSQPPLYRPITWNEYLGTKAKHFNKALSSV  351



>ref|XP_007203364.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
 gb|EMJ04563.1| hypothetical protein PRUPE_ppa020624mg [Prunus persica]
Length=341

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 165/341 (48%), Positives = 221/341 (65%), Gaps = 20/341 (6%)
 Frame = +2

Query  191   MNQEIDS---IIPMDFNKADQLPHSHIWL---DDHSPVNSSSTQESVPVIDLYDPQAVNK  352
             MN  + S   +IP+DF     LP+SH W     DH P       ESVPVIDL DP A   
Sbjct  1     MNIHLSSHHHLIPLDFKSLVTLPNSHTWAPSSSDHHPF-----PESVPVIDLSDPNATPL  55

Query  353   IKIACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRIS  532
             +++ACE WG+FQVTNHG+P+ L+ + + QT R F L  +QKLR  RSP   TGYG  RIS
Sbjct  56    VRLACEKWGVFQVTNHGVPMNLIKQTQLQTHRLFALPRDQKLRVLRSPDGFTGYGSARIS  115

Query  533   RFFDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*II  700
               F   MW+EGF++ GSPLEHARQ     +++FC+V+E+YQ +M+ LA  L  LM    +
Sbjct  116   DNFPKLMWSEGFSMMGSPLEHARQLWPLHHANFCNVMEEYQMEMKGLAAKLIELM----L  171

Query  701   RPICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  880
             R +      +  L+  ++ LQ+N  P+CPDPTRAMG A HTD+S +  L   +   GLQV
Sbjct  172   RSLGLNNEDVKWLRHPRSLLQLNSYPVCPDPTRAMGLAPHTDSS-LLTLLYQTTTGGLQV  230

Query  881   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1060
                 ++W  V P + A+VVN+GDLM I+SNG FKSV+HRAIV+K HHRIS+AYF+GP  +
Sbjct  231   LVDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPPWD  290

Query  1061  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             V+I+P +KLI     P+Y+P++W  YL  K  +F KALE+I
Sbjct  291   VKISPLMKLIDHNHPPLYQPVTWKEYLGYKATHFNKALELI  331



>gb|KDP37169.1| hypothetical protein JCGZ_06225 [Jatropha curcas]
Length=375

 Score =   311 bits (797),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 214/331 (65%), Gaps = 13/331 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDD--HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DF    +LP S+ W  LD+  HS    S  +ES+PVIDL D  A+  I  AC+TWG+FQV
Sbjct  22    DFTSLQELPDSYKWTQLDEETHSYSGDSFMKESIPVIDLLDSNALKNIGYACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHG+   LL  +E+ +R  F L  +QKL+A RSP  V+GYGI RIS FF   MW+EGFT
Sbjct  82    INHGVSTCLLDNIEKVSRDLFSLPMQQKLKAARSPDGVSGYGIARISSFFSKLMWSEGFT  141

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPL+H R    QDY+ FC  +E YQ +M+ LA  L  L+   +      I W     
Sbjct  142   IVGSPLDHFRQLWPQDYTKFCGTIEVYQVEMQKLAAKLMWLVLGSLDITKEDITW-AGPK  200

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
                +   A LQ+N+ P CPDP +AMG A HTD++L+T+LYQ +N +GLQV      W+ V
Sbjct  201   ADFREASAALQLNYYPACPDPDQAMGLAAHTDSTLLTILYQ-NNTSGLQVLREGTGWVTV  259

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
              P S  +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +++I+P  KL+
Sbjct  260   PPISGGLVVNVGDLLHILSNGLYPSVLHRAVVNRTKHRLSMAYLYGPPSSIQISPLSKLV  319

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              P++ P+YRPI+WN YL  K K+F KAL  +
Sbjct  320   GPSQPPLYRPITWNEYLGTKAKHFNKALSWV  350



>dbj|BAA37129.1| gibberelin 3beta-hydroxylase [Lactuca sativa]
Length=363

 Score =   310 bits (795),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 159/329 (48%), Positives = 212/329 (64%), Gaps = 14/329 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +D     +LP SH WL  D SP   SS+ E VPVI+L DP A+  +  AC+TWG+FQVTN
Sbjct  20    LDLKSMKELPESHAWLSQDGSPSYGSSSSEQVPVINLKDPNAMKLVGHACKTWGVFQVTN  79

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P  LL  ME   R+ F L  +QKL+A R+P  V+GYG+ RIS FF   MW+EGFT+ 
Sbjct  80    HGVPTNLLEEMEAAGRKLFALPIQQKLKAARAPDGVSGYGVARISSFFPKLMWSEGFTII  139

Query  578   GSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  736
             GSP EHAR+     YS FC V+E Y+ +M +LAQ L  LM   +      + W      G
Sbjct  140   GSPYEHARKLWPNRYSRFCDVIEGYKHEMNNLAQRLMWLMLGSLGVTTEDVKW-----DG  194

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
              Q +   LQ+N  P CPDP RAMG A HTD++L+T+LYQ +N +GLQ +     W+ V P
Sbjct  195   SQGSCPALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQ-NNTSGLQAHREGAGWVTVPP  253

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
                A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P  KL   
Sbjct  254   IPGALVVNVGDLLHILSNGLYPSVLHRAMVNRTQHRLSVAYLYGPPSNVQISPLSKLTDH  313

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                P+YRP++W+ YL  K K+F KAL  +
Sbjct  314   VHPPLYRPVTWSEYLGTKAKHFNKALSSV  342



>ref|XP_010110310.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
 gb|EXC25830.1| Gibberellin 3-beta-dioxygenase 1 [Morus notabilis]
Length=372

 Score =   311 bits (796),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 163/343 (48%), Positives = 217/343 (63%), Gaps = 16/343 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             DF+   +LP S+ W   DDH    S    +S+PV+DL DP A+  I  AC+TWG+FQVTN
Sbjct  25    DFSSLQELPDSYAWNQPDDHPSDRSIFASKSIPVVDLNDPNALKLIGHACKTWGVFQVTN  84

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGI   LL  +E   R  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ 
Sbjct  85    HGISTELLDDIESAGRSLFSLPLQQKLKAARSPDGVSGYGVARISSFFPKLMWSEGFTIV  144

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  736
             GSP++H R    QDYS FC V+E+Y+A+++ LA  L  LM   +      I W   G  G
Sbjct  145   GSPVDHFRQLWPQDYSKFCDVIEEYEAEVKRLAGRLMWLMLGSLGISRADIKW--AGPKG  202

Query  737   -LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  913
               +   A LQ+N  P CPDP RAMG A HTD++L+T+LYQ S  +GLQV      W+ V 
Sbjct  203   NFKGASAALQLNSYPACPDPDRAMGLAAHTDSTLLTILYQNST-SGLQVLREGTGWVTVP  261

Query  914   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1093
             P   A VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  +V+I+P  +L+ 
Sbjct  262   PIHGAFVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSIAYLYGPPSSVKISPLPRLVG  321

Query  1094  PTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALA  1222
             P + P+YRPI+W  YL  K K+F KAL  +   S V   N LA
Sbjct  322   PGQPPLYRPITWTEYLGTKAKHFNKALSSVRVFSPV---NGLA  361



>ref|NP_001269085.1| uncharacterized protein LOC100265167 [Vitis vinifera]
 emb|CBI36201.3| unnamed protein product [Vitis vinifera]
 gb|AGQ42611.1| GA3ox1 [Vitis vinifera]
Length=365

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 210/337 (62%), Gaps = 29/337 (9%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +D N   +LP  + W   D +P   S   ESVPVIDL DP A   +  AC++WG+FQVTN
Sbjct  21    LDLNSVQELPDLYAWAGVDENPSGDSLITESVPVIDLTDPNASELVGHACKSWGVFQVTN  80

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP +LL  +E   R  F L  +QKL+A RSP  V GYG+ RIS FF+  MW EGFT+ 
Sbjct  81    HGIPGSLLDDIESAGRSLFSLPAQQKLKAARSPDGVAGYGLARISSFFNKLMWYEGFTIF  140

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG---  736
             GSPLEHAR    QDY+ FC V E+++ +M  LA+ L  LM             G +G   
Sbjct  141   GSPLEHARQLWPQDYTKFCDVTEEFEKEMNQLAERLMWLML------------GSLGITK  188

Query  737   --LQWT------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  892
               L W       +A LQ+N  P CP+P RAMG A HTD+SL T+LYQ + ++GLQV    
Sbjct  189   EDLNWAGSKGDFKAALQLNSYPACPEPDRAMGLAAHTDSSLFTILYQNT-VSGLQVQREG  247

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               WI V P   A+V+N+GDL+ I+SNG+F SV+HRA+V++  HR+SVAY +GP   V I+
Sbjct  248   AGWITVPPLPGALVINVGDLLHILSNGVFPSVVHRALVNRTKHRLSVAYLYGPPAGVPIS  307

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P  KL+  T  P+YRP++W+ YL  K K+F KAL ++
Sbjct  308   PVPKLVDSTHPPLYRPVTWSEYLCTKAKHFDKALSLV  344



>ref|XP_009343425.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=371

 Score =   310 bits (795),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 213/332 (64%), Gaps = 15/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSP--VNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DFN   +LP S+ W   DD  P  + S    +SVPVIDL D  A+     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDLYPSFLTSFGADDSVPVIDLSDTNALKLTGHACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP  LL  +E   +  F L  +QKL+A RSP  ++GYG  RIS FF   MW+EGFT
Sbjct  82    TNHGIPQKLLDDIESAGKSLFSLPVQQKLKAARSPDGISGYGFARISSFFKKLMWSEGFT  141

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSP++H RQ    DY  FC+++E+Y+ +M+ LA  L  LM   +   +  I W   G 
Sbjct  142   IFGSPVDHFRQLWPQDYDKFCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKW--AGS  199

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ SN +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-SNTSGLQVLREGTGWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+V+N+GDL  I+SNG++ SVLHRA+V++  HR+S+AY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSIAYLFGPPASLQISPLSKL  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P+  P+YRPISWN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPISWNEYLGTKAKHFNKALSSV  350



>gb|ACT99991.1| gibberellin 3-oxidase [Malus domestica]
Length=369

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 212/332 (64%), Gaps = 15/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSP--VNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DFN   +LP S+ W   DDH P  + S    +SVPVI+L D   +     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSFLTSFGADDSVPVINLSDTNVLKLTGHACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGI   LL  +E   +  F L  +QKL+A RSP  ++GYG  RIS FF   MW+EGFT
Sbjct  82    TNHGIQQKLLDDIESAGKSLFSLPVQQKLKAARSPDGISGYGFARISSFFKKLMWSEGFT  141

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSP++H RQ    DY  FC+++E+Y+ +M+ LA  L  LM   +   +  I W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYDKFCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKW--AGS  199

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ SN +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-SNTSGLQVLREGTGWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+V+N+GDL  I+SNG++ SVLHRA+V++  HR+SVAY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSVAYLFGPPASIQISPLSKL  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P+  P+YRPISWN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPISWNEYLGTKAKHFNKALSSV  350



>ref|XP_008365721.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=371

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 212/332 (64%), Gaps = 15/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSP--VNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             DFN   +LP S+ W   DDH P  + S    +SVPVI+L D   +     AC+TWG+FQV
Sbjct  22    DFNSLHELPDSYAWTNNDDHYPSFLTSFGADDSVPVINLSDTNVLKLTGHACKTWGVFQV  81

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGI   LL  +E   +  F L  +QKL+A RSP  ++GYG  RIS FF   MW+EGFT
Sbjct  82    TNHGIQQKLLDDIESAGKSLFSLPVQQKLKAARSPDGISGYGFARISSFFKKLMWSEGFT  141

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSP++H RQ    DY  FC+++E+Y+ +M+ LA  L  LM   +   +  I W   G 
Sbjct  142   IVGSPVDHFRQLWPQDYDKFCNIIEEYEKEMKMLAGRLMWLMLGSLGISMEDIKW--AGS  199

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   A LQ+N  P CP+P RAMG A HTD++L+T+LYQ SN +GLQV      W+ 
Sbjct  200   KGEFKGASAALQLNSYPACPEPDRAMGLAAHTDSTLLTILYQ-SNTSGLQVLREGTGWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+V+N+GDL  I+SNG++ SVLHRA+V++  HR+SVAY FGP  +++I+P  KL
Sbjct  259   VPPMPGALVINVGDLFHILSNGLYPSVLHRAVVNRTQHRLSVAYLFGPPASIQISPLSKL  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P+  P+YRPISWN YL  K K+F KAL  +
Sbjct  319   VGPSHPPLYRPISWNEYLGTKAKHFNKALSSV  350



>emb|CAN80137.1| hypothetical protein VITISV_028510 [Vitis vinifera]
Length=365

 Score =   308 bits (790),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 209/337 (62%), Gaps = 29/337 (9%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +D N   +LP  + W   D +P   S   ESVPVIDL DP A   +  AC++WG+FQVTN
Sbjct  21    LDLNSVQELPDLYAWAGVDENPSGDSLITESVPVIDLTDPNASELVGHACKSWGVFQVTN  80

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP +LL  +E   R  F L  +QKL+A RSP  V GYG+ RIS FF+  MW EGFT+ 
Sbjct  81    HGIPGSLLDDIESAGRSLFSLPAQQKLKAARSPDGVAGYGLARISSFFNKLMWYEGFTIF  140

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  739
             GSPLEHAR    QDY+ FC V E+++ +M  LA+ L  LM             G +G+  
Sbjct  141   GSPLEHARQLWPQDYTKFCDVTEEFEKEMNQLAERLMWLML------------GSLGITK  188

Query  740   ---QWT------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  892
                 W       +A LQ+N  P CP+P RAMG A HTD+SL T+LYQ + ++GLQV    
Sbjct  189   EDVNWAGSKGDFKAALQLNSYPACPEPDRAMGLAAHTDSSLFTILYQNT-VSGLQVQREG  247

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               WI V P   A+V+N+GDL+ I+SNG F SV+HRA+V++  HR+SVAY +GP   V I+
Sbjct  248   AGWITVPPLPGALVINVGDLLHILSNGXFPSVVHRALVNRTKHRLSVAYLYGPPAGVPIS  307

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P  KL+  T  P+YRP++W+ YL  K K+F KAL ++
Sbjct  308   PVPKLVDSTHPPLYRPVTWSEYLCTKAKHFDKALSLV  344



>gb|AHC32023.1| gibberellin 3-oxidase 2 [Camellia sinensis]
Length=373

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 209/331 (63%), Gaps = 12/331 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             +DFN   +LP SH W   L D+     S    SVP+IDL DP A   +  AC TWG+FQV
Sbjct  14    LDFNSVKELPESHAWTSLLGDYPSGPDSCGVGSVPIIDLDDPNAQKLVGHACSTWGVFQV  73

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHG+  +LL  +E   +  F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EGFT
Sbjct  74    TNHGVKNSLLNSIEAAGKSLFSLPIQQKLKAARSPDGVSGYGVARISSFFPKLMWSEGFT  133

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPLEHARQ    D++ FC V+E+Y+  M+ LA  L  LM   +      I W     
Sbjct  134   IFGSPLEHARQLWPQDHNQFCHVIEEYEKVMQQLAGRLMWLMLGSLGITKEDIKW-AGPK  192

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
                +   A +Q+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV      W+ V
Sbjct  193   ADFKGASAAIQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVLREGAGWVTV  251

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
              P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP  NV+I+P  KL+
Sbjct  252   PPQPGTLVVNIGDLLHILSNGLYPSVLHRAMVNRTQHRLSIAYLYGPPTNVQISPLSKLV  311

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              P+  P+YRP++W  YL  K K+F KAL  +
Sbjct  312   DPSHPPLYRPVTWTEYLGTKAKHFNKALSSV  342



>ref|XP_007024019.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
 gb|EOY26641.1| Gibberellin 3-oxidase 1, putative [Theobroma cacao]
Length=371

 Score =   307 bits (787),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 213/330 (65%), Gaps = 13/330 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIW-LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             DF    +LP  + W   D  P   +   ESVP+IDL DP A+  I  AC+TWG+FQV NH
Sbjct  23    DFTSLQELPDLYAWNQRDDYPCGDAFAAESVPIIDLDDPNALQGIGHACKTWGVFQVINH  82

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             GIP +LL  +E   R  F L   QKL+A RSP  V+GYG  RIS FF   MW+EGFT+ G
Sbjct  83    GIPPSLLDMVECTGRTLFSLPVHQKLKAARSPDGVSGYGFARISSFFSKLMWSEGFTIVG  142

Query  581   SPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP---ICW*RCGMVG  736
             SP EH R    QDYS++C V+++Y+ +M+ LA  L  L+   + IR    + W   G  G
Sbjct  143   SPDEHFRQLWPQDYSNYCDVIKEYKEEMKKLAGRLMWLVLGSLGIRAKQDMKW--AGPKG  200

Query  737   -LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  913
               +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ +N +GLQV      W+ V 
Sbjct  201   DFREASAALQLNFYPACPDPERAMGLAAHTDSTLLTILYQ-NNTSGLQVLKEGAEWVTVP  259

Query  914   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1093
             P    +V+N+GDLM I+SNG + SVLHRA+V+++ HR+S+AY +GP  +V+I+P  KL+ 
Sbjct  260   PVPGGLVINVGDLMHILSNGSYPSVLHRAMVNRSRHRLSIAYLYGPPSSVKISPHPKLVG  319

Query  1094  PTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P+  P+YRP++WN YLD K K+F KAL  +
Sbjct  320   PSHPPLYRPVTWNEYLDTKAKHFNKALSSV  349



>ref|XP_011039983.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=465

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 220/365 (60%), Gaps = 42/365 (12%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             +DF+   ++P SH W  LDD     P   S   ESVPVIDL DP  +  I  AC+TWG+ 
Sbjct  114   LDFSTLQEIPDSHKWTQLDDIEQQHPSVESFITESVPVIDLLDPNVLQNIGNACKTWGVL  173

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              VTNHGIP++LL  +E  + + F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EG
Sbjct  174   HVTNHGIPISLLENVESVSSKLFSLPIQQKLKAARSPDGVSGYGVARISSFFSKLMWSEG  233

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  733
             FT+ GSPLEH R    QDY+ FC V+E+++ +M+ LA+ L  LM             G +
Sbjct  234   FTIVGSPLEHFRQLWPQDYTKFCDVIEEHEKEMQKLARRLTWLML------------GSL  281

Query  734   G-----LQWT---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  871
             G     L W           A LQ+N  P CPDP  AMG A HTD++L+T+LYQ +N +G
Sbjct  282   GITKKDLNWAGPKGESKEGGAALQLNSYPACPDPDLAMGLAAHTDSTLLTILYQ-NNTSG  340

Query  872   LQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1051
             LQV    + W+ V P    +VVN+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP
Sbjct  341   LQVLKEGIGWVTVPPIPGGLVVNVGDLLHILSNGLYPSVLHRAVVNRNKHRLSIAYLYGP  400

Query  1052  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1213
                V I+P  KL+ P   P+YRP++WN YL  K K+F KAL  +   +      DV   N
Sbjct  401   PSTVLISPIQKLVGPNHPPLYRPVTWNEYLVAKAKHFNKALSSVRICAPLNGLVDVNDHN  460

Query  1214  ALASG  1228
             ++  G
Sbjct  461   SVKVG  465



>dbj|BAG48320.1| gibberellin 3-oxidase1 [Chrysanthemum x morifolium]
Length=356

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 212/329 (64%), Gaps = 14/329 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSSSTQ-ESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +D N    LP SH WL   S    SS   + VPVI L DP A+N +  AC+TWG+FQVTN
Sbjct  13    LDLNSMKVLPESHAWLSLESSPLYSSLSPDLVPVISLTDPNAMNLVGHACKTWGVFQVTN  72

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P+ LL +ME   R+ F L  +QKL+A R+P  V+GYG+ RIS FF   MW+EGFT+ 
Sbjct  73    HGVPINLLEKMEAAGRKLFALPIQQKLKAARAPDGVSGYGVARISSFFPKLMWSEGFTIM  132

Query  578   GSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  736
             GSP EHA +     Y+ FC V+E+Y+ +M  LAQ L +LM   +   +  + W      G
Sbjct  133   GSPYEHALKLWPNSYTRFCDVIEEYKEEMNKLAQTLMSLMLGSLGVTMEDVKW-----AG  187

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
              Q +   LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQ +     W+ V P
Sbjct  188   SQGSCPALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQAHRDGAGWVTVPP  246

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
                A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P  KL   
Sbjct  247   IPGALVINVGDLLHILSNGLYPSVLHRAMVNRTKHRLSVAYLYGPPSNVQISPLSKLTDQ  306

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                P+YRP++W+ YL  K K+F KAL  +
Sbjct  307   VHPPLYRPVTWSEYLGTKAKHFNKALSSV  335



>ref|XP_010914990.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=360

 Score =   305 bits (781),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 161/337 (48%), Positives = 215/337 (64%), Gaps = 14/337 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS-PVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
              +F    ++P SH W D H  P    S  +SVPV+DL  P AV ++  ACE WG+FQVT 
Sbjct  20    FEFESVREVPDSHAWPDLHDHPSVEPSGPDSVPVVDLASPDAVPRVGRACEEWGVFQVTG  79

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P  LL R+E QTRR F L   QKL+A RSPG+++GYG+  IS FF   MW+EGFT+A
Sbjct  80    HGVPSDLLDRLESQTRRLFSLPTHQKLKAARSPGNISGYGLAPISSFFSKLMWSEGFTIA  139

Query  578   GSPLEHAR-----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMV  733
             GSPLEHAR     +D  +FC V+E+Y+  M++LA  L  LM   +      I W   G V
Sbjct  140   GSPLEHARKLWRPEDSGEFCDVIEEYKEVMKELAGRLLHLMLLSLGLTEEDISW--AGPV  197

Query  734   GLQWT-QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWID  907
                    A LQ+N  P CP+P RA+G A HTD+SL+T+LYQ+S  +GLQV  P+   W+ 
Sbjct  198   RETGDLPAVLQLNSYPACPEPDRAIGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVT  256

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL  I+SNG F+SVLHRA+V++  HR+S AY  GP  +V+++P  KL
Sbjct  257   VPPLPGALVVNVGDLSHILSNGQFRSVLHRAVVNRTRHRLSAAYICGPPAHVKVSPVDKL  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1198
             + P+E P YR ++W  YL +K K F KAL  I  + +
Sbjct  317   VGPSEGPAYRAVTWPEYLGLKRKLFNKALASIKISKE  353



>ref|XP_004486708.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=371

 Score =   305 bits (781),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 158/354 (45%), Positives = 217/354 (61%), Gaps = 21/354 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSS----TQESVPVIDLYDPQAVNKIKIACETWGI  382
             +DFN   +LP S+ W  LDDH+ +NS++    +  SVPVIDL DP A   I  AC+TWG+
Sbjct  20    LDFNSLQELPESYTWTHLDDHTIINSNNIMKESNSSVPVIDLNDPNASKLIGHACKTWGV  79

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             +Q+ NHGIP++LL  ++   +  F L P QKL+A RSP  V+GYG+ RIS FF   MW+E
Sbjct  80    YQIVNHGIPISLLDDIQWVGQTLFSLPPHQKLKALRSPDGVSGYGLARISSFFPKLMWSE  139

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             GFT+ GSP EH R    QDY+ +C +V  Y+  M+ LA  L  LM   +      I W  
Sbjct  140   GFTIVGSPFEHFRQLWPQDYAKYCDIVLQYEETMKKLAGKLMWLMLDSLGITKEDIKW-A  198

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
                   +   A +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    + W
Sbjct  199   GSKAQFEKACAAMQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGIGW  257

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P    +VVN+GDL  I+SNG++ SVLHR +V++   R S+AY +GP  NVEI P  
Sbjct  258   VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSIAYLYGPPSNVEICPHT  317

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSNALAS  1225
             KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV KSN +  
Sbjct  318   KLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSYVRICATINGLFDVNKSNKVVG  371



>ref|XP_010061961.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW69008.1| hypothetical protein EUGRSUZ_F02568 [Eucalyptus grandis]
Length=370

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 216/341 (63%), Gaps = 15/341 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL---DDHSPVNSSSTQE-SVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +DF+   +LP S+ W    +D+   NS S QE +VPVIDL+ P A+  I  AC+TWG FQ
Sbjct  21    LDFSSVKELPDSYTWTTQPEDYPCPNSPSGQEVTVPVIDLHHPNALELIGHACKTWGAFQ  80

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHGIP  LL  ++   +  F L   QK +A RSP  V GYG+ RIS FF   MW+EGF
Sbjct  81    VTNHGIPKRLLDSIQSAGKNLFSLPVHQKHKAARSPNGVPGYGVARISSFFPKLMWSEGF  140

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  736
             T+ GSPLEHARQ    D+++FC V+E+YQ +MR LA  L  LM   +   IC       G
Sbjct  141   TIIGSPLEHARQLWPNDHAEFCDVIEEYQKEMRKLAGRLMWLMLGSL--GICKGDIKWAG  198

Query  737   LQWTQA----YLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
              +   A     LQ+N  P CPDP RAMG A HTD++L+T+L+Q S  +GLQV      W+
Sbjct  199   PKGDFAGACNALQLNSYPACPDPDRAMGLAPHTDSTLLTILFQNST-SGLQVLKEGSGWV  257

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              + P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP  NV+I+P  +
Sbjct  258   TIPPIPGALVINVGDLLHILSNGLYPSVLHRAVVNRTWHRLSVAYLYGPPSNVQISPLSQ  317

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEK  1207
             LI  +  P+YRP++W+ YL  K K+F KAL  +     + K
Sbjct  318   LINSSNPPLYRPVTWSEYLGTKAKHFNKALSSVRLCGPMNK  358



>ref|XP_008242694.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=338

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 163/340 (48%), Positives = 218/340 (64%), Gaps = 21/340 (6%)
 Frame = +2

Query  191   MNQEIDS--IIPMDFNKADQLPHSHIWL---DDHSPVNSSSTQESVPVIDLYDPQAVNKI  355
             MN  + S  +IP+DF     LP+SH W     DH P       +SVPVIDL DP A   +
Sbjct  1     MNIHLSSHHLIPLDFKSLVSLPNSHTWAPSSSDHHPF-----PDSVPVIDLSDPNATPLV  55

Query  356   KIACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISR  535
             + ACE WG+FQVTNHG+P+ L+ + + QT R F L  +QKLR  RSP   +GYG  RIS 
Sbjct  56    RRACEKWGVFQVTNHGVPMNLIKQTQLQTHRLFALPRDQKLRVLRSPDGFSGYGSARISD  115

Query  536   FFDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIR  703
              F   MW+EGF++ GSPLEHARQ     +++FC+V+E+YQ +M+ LA  L  LM    +R
Sbjct  116   NFPKLMWSEGFSMMGSPLEHARQLWPRHHANFCNVMEEYQKEMKGLAAKLIELM----LR  171

Query  704   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
              +      +  L   Q+ LQ+N  P+CPDPTRAMG A HTD+S +  L   +   GLQV 
Sbjct  172   SLGLNNEDVKWLTHPQSLLQLNSYPVCPDPTRAMGLAPHTDSS-LLTLLYQTTTGGLQVL  230

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                ++W  V P + A+VVN+GDLM I+SNG FKSV+HRAIV+K HHRIS+AYF+GP  +V
Sbjct  231   VDGVSWAPVYPTAGALVVNVGDLMHILSNGCFKSVVHRAIVNKVHHRISIAYFYGPPWDV  290

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +I+P +KL      P+Y+P++W  YL  K  +F KALE+I
Sbjct  291   KISPLMKLTD--HPPLYQPVTWKEYLGYKATHFNKALELI  328



>ref|XP_002515559.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47008.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=354

 Score =   303 bits (775),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 161/335 (48%), Positives = 212/335 (63%), Gaps = 12/335 (4%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESV-PVIDLYDPQAVNKIKIACETWGI  382
             ++I P+DF     LP SH W    S    +S  +S+ PVIDL  P A+  IK A E WG+
Sbjct  15    NNIFPLDFTSILTLPDSHAWTTPPSLDPLTSQDDSIIPVIDLNSPNALILIKEASENWGM  74

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQVTNH IP+ L   +E QTR  F L   QKL A RSPG +TGYG  RIS FF  +MW E
Sbjct  75    FQVTNHDIPIHLFHHIEGQTRCLFGLPSSQKLLAARSPGGLTGYGRARISDFFKREMWYE  134

Query  563   GFTVAGSPLEHARQDY----SDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  730
             GFT+ GSP EHA Q +    + FC  V+ YQ +M+ L++ +  LMFK +   +       
Sbjct  135   GFTIMGSPAEHASQLWPNQDTSFCDAVKAYQKEMKGLSERIIGLMFKSL--GLIEEDVKF  192

Query  731   VGL----QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
             +GL    Q+ Q  LQ+N  P CPDP RAMG A HTD+SL+T+L+Q   ++GLQV+   + 
Sbjct  193   LGLKDESQYPQGALQLNSYPKCPDPDRAMGLAPHTDSSLITVLHQ-DGVSGLQVFKDGIG  251

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P   A+VVN+GDLM IISNG FK   H+A+V+K HHRISVAYF+GP  +V+I+P 
Sbjct  252   WMPVCPVDGALVVNIGDLMHIISNGRFKCAQHQAVVNKTHHRISVAYFYGPPGDVKISPL  311

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             ++L+      +YRP++W  YLD K  YF KAL+ I
Sbjct  312   MQLVDFDHPVLYRPVTWKEYLDAKTIYFDKALDFI  346



>ref|XP_004486709.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=375

 Score =   303 bits (776),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 154/334 (46%), Positives = 210/334 (63%), Gaps = 15/334 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSS----TQESVPVIDLYDPQAVNKIKIACETWGI  382
             +DFN   +LP S+ W  LDDH+ +NS++    +  SVPVIDL DP A   I  AC+TWG+
Sbjct  20    LDFNSLQELPESYTWTHLDDHTVINSNNIMKESNSSVPVIDLNDPNASKLIGHACKTWGV  79

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             +Q+ NHGIP++LL  ++   +  F L P QKL+A RSP  V+GYG+ RIS FF   MW+E
Sbjct  80    YQIVNHGIPISLLDDIQWVGQTLFSLPPHQKLKALRSPDGVSGYGLARISSFFPKLMWSE  139

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             GFT+ GSP EH R    QDY+ +C +V  Y+  M+ LA  L  LM   +      I W  
Sbjct  140   GFTIVGSPFEHFRQLWPQDYAKYCDIVLQYEETMKKLAGKLMWLMLDSLGITKEDIKW-A  198

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
                   +   A +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    + W
Sbjct  199   GSKAQFEKGCAAIQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGIGW  257

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  
Sbjct  258   VTVPPLHGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHT  317

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             KL+ PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  318   KLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSYV  351



>gb|AEK70424.1| GA3ox2 [Gossypium hirsutum]
Length=368

 Score =   303 bits (775),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/350 (45%), Positives = 211/350 (60%), Gaps = 17/350 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHG  403
             DF    +LP S+ W     P   +   ESVP++DL D  A+  I  AC+TWGIFQVTNHG
Sbjct  21    DFTSLHELPDSYAWNQRDDPSPETFATESVPLVDLNDSNALQVIGHACKTWGIFQVTNHG  80

Query  404   IPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGS  583
             I  +LL  +E   R  F L   QKL+A RSP  V+GYG  RIS FF   MW++GFT+ G 
Sbjct  81    ISTSLLDMVEHTCRSLFSLPVHQKLKAARSPDGVSGYGFARISSFFSKLMWSQGFTIVGP  140

Query  584   PLEHA----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RCGMVGL  739
             P EH      QD+S  C V+++Y+ +M+ LA  L  LM   +       I W        
Sbjct  141   PDEHFCQLWPQDFSYHCDVIKEYKEEMKKLAGRLMWLMLGSLGIIAKEDIKW-AGPKADF  199

Query  740   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  919
             +   A LQ+N+ P CPDP RAMG A HTD++L+T+LYQ S  +GLQV+     W+ V P 
Sbjct  200   KGASAALQLNYYPACPDPDRAMGLAPHTDSTLLTILYQNST-SGLQVFKEGAGWVAVPPV  258

Query  920   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1099
                +V+N+GDLM I+SNG ++SVLHRA+V+++HHR+S AY +GP   VEI+P  KL+ PT
Sbjct  259   PGGLVINVGDLMHILSNGSYQSVLHRAMVNRSHHRLSSAYLYGPPSTVEISPHPKLVGPT  318

Query  1100  EFPMYRPISWNAYLDIKYKYFGKALEMI-------GFNSDVEKSNALASG  1228
               P+YRP++WN YL  K K+F KAL  +       G     E++N++  G
Sbjct  319   HPPLYRPVTWNEYLHTKAKHFNKALSSVRVCVPLNGLGDVNEQNNSVTVG  368



>gb|ACF71491.1| gibberellin 3-beta hydroxylase [Chrysanthemum x morifolium]
Length=358

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/346 (45%), Positives = 216/346 (62%), Gaps = 35/346 (10%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             D +   +LP S+ W  +DD   ++ SS  E VPVI+L DP  +  +  AC+TWG+F VTN
Sbjct  13    DLSSMKELPDSYAWSSVDDDCLLSCSS--EPVPVINLEDPNVMKHVGHACKTWGVFHVTN  70

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP+A+L  ME   R+ F L  +QKL+A R+P  V+GYG  RIS FF   MW+EGFT+ 
Sbjct  71    HGIPMAVLDDMEASVRKLFYLPIQQKLKAARAPDGVSGYGAVRISSFFHKHMWSEGFTII  130

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  739
             GSP EHA+    QDY +FC VV++Y  +M+ L   L  L+             G +G+  
Sbjct  131   GSPYEHAKKLWPQDYKNFCVVVDEYNKEMKKLTNRLMWLVL------------GSLGITE  178

Query  740   ---QWTQAY---------LQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
                +W +           LQ+N  P CPDP RAMG A HTD+SL+T+L+Q +N +GLQV 
Sbjct  179   GDVKWARQTRDTKEACPALQLNSYPACPDPDRAMGLAAHTDSSLLTILHQ-NNTSGLQVQ  237

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                + W+ V P   A+VV++GDL+ I+SNG++ SVLHRAIV++A HR+S+AY +GP  NV
Sbjct  238   REGMGWVTVPPIKGALVVHVGDLLHILSNGLYSSVLHRAIVNRAQHRLSIAYIYGPPSNV  297

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDV  1201
              I+P  KL      P+Y+P++W+ YL IK KYF K L ++  ++ V
Sbjct  298   RISPLSKLTSIVRPPLYQPVTWSEYLAIKAKYFNKTLSIVRLSAPV  343



>ref|XP_004302950.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=358

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/336 (46%), Positives = 216/336 (64%), Gaps = 13/336 (4%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIW---LDDHSPVNSS-STQESVPVIDLYDPQAVNKIKIACETWGIF  385
             P DFN   +LP S+ W   LD+   ++S   +   VPVIDL D   +  I  AC+TWG+F
Sbjct  18    PADFNSLHELPDSYAWTNQLDEFPSLDSPFGSDLCVPVIDLNDQNVIKLIGHACKTWGVF  77

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QVTNHG+P  L+  +E   R  F L  +QKL+A R    ++GYGI RIS FF   MW+EG
Sbjct  78    QVTNHGVPQKLVHDIESTCRSLFSLPVQQKLKAARPADGISGYGIHRISSFFQKLMWSEG  137

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPLEH RQ    DY+ FC +VE+Y+ +M+ LA  L  L+F  +      + W   
Sbjct  138   FTLVGSPLEHFRQLWPQDYNKFCCMVEEYETEMKKLAGRLMWLIFGSLGISKEDVSW-AG  196

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                G +     LQ+N  P CPDP+RAMG A+HTD++L+T+++Q SNI+GLQV      W+
Sbjct  197   PKGGFEDASNALQLNSYPACPDPSRAMGLAEHTDSTLLTIIHQ-SNISGLQVLREGAGWL  255

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P + A+V+N+GDL+ I+SNG +++VLHRAIV+++  R+SVAY +GP  NV+I+P  K
Sbjct  256   TVPPVAGALVINIGDLIHILSNGEYQNVLHRAIVNRSQQRLSVAYLYGPPINVQISPHSK  315

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFN  1192
             L+ P+   +YRP++W  YL IK K + KAL  I F+
Sbjct  316   LVTPSHPSLYRPVTWKEYLGIKGKLYNKALSSIKFH  351



>ref|XP_011026517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=341

 Score =   300 bits (767),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 206/338 (61%), Gaps = 30/338 (9%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             IIP+DF+    +P SH+W   H+    S  Q S+P +DL DP AV  +  ACETWG+FQV
Sbjct  18    IIPLDFDSVRTVPDSHVWPTSHA--FESDDQLSIPTVDLMDPDAVKLVGHACETWGVFQV  75

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP+ ++  +E + RR F L    KL+A RSPG  TGYG+ RIS FF  +MW EGFT
Sbjct  76    INHGIPLDVIDEVESEARRLFSLPTGHKLKALRSPGGATGYGLARISPFFSKKMWHEGFT  135

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK----------*IIRPI  709
             V GSP++HAR+    DY  FC V+EDYQ +M++LA  L  L+ K           ++ P 
Sbjct  136   VMGSPVDHARELWPTDYQRFCDVMEDYQKKMKELAITLMHLILKSLDLSEEEISKVVSPG  195

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
             C               LQ+N  P CPDP+R MG A HTDTSL+T+L+Q S I GL+++  
Sbjct  196   C-----------ASTALQLNSYPFCPDPSRVMGLAPHTDTSLLTILHQ-STINGLEIFKD  243

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
              + W+ V P + ++VVN+GDL+ I+SN  F S+LHR ++ +   R+S+AYF+ P  +  +
Sbjct  244   GVGWVLVSPTNGSLVVNVGDLLHILSNAQFPSILHRVVLKEKQQRLSLAYFYSPPTDFHV  303

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +P    + P E P+YR +S   Y+ IK K   KAL ++
Sbjct  304   SP--LALNPAEIPLYRSVSVREYIHIKAKNLEKALSLV  339



>ref|XP_002324270.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|EEF02835.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=341

 Score =   299 bits (765),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 207/331 (63%), Gaps = 16/331 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             IIP+DF+    +P SH+W   H+    S  Q S+P +DL DP AV  +  ACETWG+FQV
Sbjct  18    IIPLDFDSVRTVPDSHVWPTSHA--FESDDQLSIPTVDLMDPDAVKLVGHACETWGVFQV  75

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP+ ++  +E + RR F L    KL+A RSPG  TGYG+ RIS FF  +MW EGFT
Sbjct  76    INHGIPLDIIDEVESEARRLFSLPTGHKLKALRSPGGATGYGLARISPFFSKKMWHEGFT  135

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  730
             V GSP++HAR+    DY  FC V+EDYQ +M++LA  L  L+ K +      I      +
Sbjct  136   VMGSPVDHARELWPNDYQRFCDVMEDYQKKMKELAITLMHLILKSLDLSEEEI----SKV  191

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
             V        LQ+N  P CPDP+R MG A HTDTSL+T+LYQ S I GL+++   + W+ V
Sbjct  192   VSPGGASTALQLNSYPFCPDPSRVMGLAPHTDTSLLTILYQ-STINGLEIFKDGVGWVLV  250

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
              P + ++VVN+GDL+ I+SN  F SVLHR ++ +   R+S+AYF+ P  + +++P    +
Sbjct  251   SPTNGSLVVNVGDLLHILSNAQFPSVLHRVVLKEKQQRLSLAYFYSPPTDFDVSP--LAL  308

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              P + P+YR +S   Y+ IK K   KAL +I
Sbjct  309   NPAQIPLYRSVSVREYIHIKAKNVEKALSLI  339



>gb|ABP37820.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 212/351 (60%), Gaps = 22/351 (6%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWG  379
             DFN   +LP S+ W  LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG
Sbjct  21    DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWG  80

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             ++QV NHGIP++LL  ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+
Sbjct  81    VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWS  140

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSPL+H R    QDY+  C  V  Y   M+ LA  L  LM   +   +  I W 
Sbjct  141   EGFTIVGSPLDHFRQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWA  200

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                    +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV G    
Sbjct  201   GSKAQFDEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSG  259

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P 
Sbjct  260   WVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPH  319

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1213
              KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV  SN
Sbjct  320   EKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSVSLCAPINGLFDVNDSN  370



>dbj|BAG48321.1| gibberellin 3-oxidase2 [Chrysanthemum x morifolium]
Length=358

 Score =   298 bits (764),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 216/338 (64%), Gaps = 15/338 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             MD +   +LP S+ W  +DD   ++ SS  E VPVI+L DP  +  +  AC+TWG+F VT
Sbjct  12    MDLSSMKELPDSYAWASVDDGCLLSCSS--EPVPVINLDDPNVMKHVGHACKTWGVFYVT  69

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
             NHGIP+A++  ME   R+ F L  +QKL+A R+P  V+GYG  RIS FF   MW+EGFT+
Sbjct  70    NHGIPMAVVDDMEASVRKLFYLPIQQKLKAARAPDGVSGYGAVRISSFFHKHMWSEGFTI  129

Query  575   AGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMV  733
              GSP EHA++    DY +FC VV++Y  +M+ L   L  L+   +      + W   G  
Sbjct  130   IGSPYEHAKKLWPHDYKNFCEVVDEYNKEMKKLTNRLMWLVLGSLGITEGDVKW--AGPA  187

Query  734   G-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
             G L+     LQ+N  P CPDP RAMG A HTD+SL+T+L+Q +N +GLQV    + W+ V
Sbjct  188   GDLKEACPALQLNSYPACPDPDRAMGLAAHTDSSLLTILHQ-NNTSGLQVQREGMGWVTV  246

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
              P   A+VV++GDL+ I+SNG++ SVLHRAIV++  HR S+AY +GP  NV I+P  KL 
Sbjct  247   PPIKGALVVHVGDLLHILSNGLYSSVLHRAIVNRTQHRFSIAYLYGPPSNVRISPLSKLT  306

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1204
                  P+Y+P++W+ YL IK KYF K L ++  ++ V+
Sbjct  307   SIVRPPLYQPVTWSEYLAIKAKYFNKTLSVVRLSAPVD  344



>gb|ABB00360.1| gibberellin 3-oxidase [Fragaria x ananassa]
Length=358

 Score =   298 bits (763),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 154/337 (46%), Positives = 217/337 (64%), Gaps = 15/337 (4%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIW---LDDHSPVNSS-STQESVPVIDLYDPQAVNKIKIACETWGIF  385
             P DFN   +LP S+ W   LD+   ++SS  +   VPVIDL D   +  I  AC+TWG+F
Sbjct  18    PADFNSLHELPDSYAWTNQLDECPSLDSSFGSDLCVPVIDLNDQNVIKLIGHACKTWGVF  77

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QVTNHG+P  L+  +E   R  F L  +QKL+A R    ++GYGI RIS FF   MW+EG
Sbjct  78    QVTNHGVPQKLVHDIESTCRSLFSLPVQQKLKAARPADGISGYGIHRISSFFQKLMWSEG  137

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPLEH RQ    DY+ FC +VE+Y+ +M+ LA  L  L+F  +      + W   
Sbjct  138   FTLVGSPLEHFRQLWPQDYNKFCCMVEEYETEMKKLAGRLMWLIFGSLGISKEDVSW--A  195

Query  725   GMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
             G  G  +     LQ+N  P CPDP+RAMG A+HTD++L+T+++Q SNI+GLQV      W
Sbjct  196   GPKGDFEDASNALQLNSYPACPDPSRAMGLAEHTDSTLLTIIHQ-SNISGLQVLREGAGW  254

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P + A+V+N+GDL+ I+SNG +++V HRAIV+++  R+SVAY +GP  NV+I+P  
Sbjct  255   LTVPPVAGALVINIGDLIHILSNGEYQNVFHRAIVNRSQQRLSVAYLYGPPINVQISPHS  314

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFN  1192
             KL+ P+   +YRP++W  YL I+ K + KAL  I F+
Sbjct  315   KLVTPSHPSLYRPVTWKEYLGIEGKLYNKALSSIKFH  351



>ref|XP_009355033.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=362

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/336 (45%), Positives = 211/336 (63%), Gaps = 16/336 (5%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             P DF+   +LP ++ W   L+++    S S  ESVPVIDL DP  V  +  AC+TWGIFQ
Sbjct  22    PDDFSSLQELPEAYAWTSQLNEYPSFESLSCSESVPVIDLTDPNVVELVGNACKTWGIFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
              TNHG+P  L+  ME   R  F L P+QKL+A R P   +GYG  RIS F +   W+E F
Sbjct  82    ATNHGVPQKLVDDMESTVRSLFSLPPQQKLKATRLPDGFSGYGFHRISAFCEKLTWSESF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T  GSPLEH R    QDY+ FC + E+Y+ +M+ LA  L  LM   +      I W   G
Sbjct  142   TTVGSPLEHFRQLWPQDYTKFCCIAEEYEREMKRLAARLMWLMLGSLGISKEDIKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY---GPNL  895
               G  +   A LQ N  P CPDP R MG AQHTD++L+++++Q+SN +GLQV+       
Sbjct  200   PRGEFEDASAVLQFNSYPACPDPDRTMGLAQHTDSTLISIVHQSSNASGLQVFRQGEQGR  259

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              W+ V P   A V+N+GD + ++SNG++++VLHRA+V+++ HR+SVAY +GPS+NV+++P
Sbjct  260   GWLMVPPVPGAFVINVGDFIHMLSNGLYQNVLHRAVVNRSQHRVSVAYLYGPSENVQVSP  319

Query  1076  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               KL+ P+  P+Y P++WN YL  K K   KALE +
Sbjct  320   LSKLLGPSCPPLYPPLTWNEYLGTKAKLHNKALESL  355



>ref|XP_003546239.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHM98787.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=353

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 156/332 (47%), Positives = 204/332 (61%), Gaps = 17/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL----DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             D N   +LP S+ W     DDH+  NS ++ ESVPVIDL DP A   I  AC TWG +QV
Sbjct  21    DLNSLQELPESYTWTHHGHDDHT--NSPASNESVPVIDLNDPNASKLIHHACTTWGAYQV  78

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP++LL  ++      F L   QK +A RSP  V GYG+ RIS FF   MW+EGFT
Sbjct  79    LNHGIPMSLLQDIQWVGETLFSLPSHQKHKAARSPDGVDGYGLARISSFFPKLMWSEGFT  138

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPLEH R    QDY  +C  V  Y   M+ L   L  LM   +      + W   G 
Sbjct  139   IVGSPLEHFRQLWPQDYDKYCDFVMQYDEAMKKLVGKLMLLMLDSLGITKEDLKW--AGS  196

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  + T A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +NI+GLQV+   + W+ 
Sbjct  197   KGQFEKTCAALQLNSYPTCPDPDRAMGLAAHTDSTLLTILYQ-NNISGLQVHRKGVGWVT  255

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P S  +V+N+GDL+ I+SNG++ SVLHR +V++   R+SVAY  GP  NVEI P  KL
Sbjct  256   VPPLSGGLVINVGDLLHILSNGLYPSVLHRVLVNRIQRRLSVAYLCGPPPNVEICPHAKL  315

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P + P+Y+ ++WN YL  K K+F KAL  +
Sbjct  316   VGPNKPPLYKAVTWNEYLGTKAKHFNKALSTV  347



>ref|XP_010459098.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 211/333 (63%), Gaps = 13/333 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P++LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ QMW+EGF
Sbjct  83    IANHGVPLSLLQDVEFLTGSLFGLPVQRKLKAARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE+Y+ +M+ LA  L  L    +      + W    
Sbjct  143   TITGSPLNDFRKLWPQHHLNYCDIVEEYEERMKKLASKLMWLALNSLGVSEEDVEWASLN  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI 
Sbjct  203   SADLSWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWIT  261

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  262   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVSKL  321

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIG  1186
             + P E P+YR ++W  YL  K  +F KAL MIG
Sbjct  322   VSPLESPLYRSVTWREYLQTKATHFNKALSMIG  354



>ref|XP_010254240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=352

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 152/338 (45%), Positives = 216/338 (64%), Gaps = 15/338 (4%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETW  376
             +D I P+DF    ++P S IW  L D+   NS+   E VP IDL DP+A   ++ ACE  
Sbjct  16    LDHITPIDFESIKEVPESFIWPLLSDYPSCNSADI-EPVPSIDLCDPKATKLMRRACERS  74

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G+FQ+TNHGIP  LL ++E Q  R F L   QKL+  RSP   TGYG+   S F+   +W
Sbjct  75    GVFQITNHGIPTRLLHKLESQVWRLFSLPTGQKLKTLRSPDGFTGYGLANHSSFYPKLLW  134

Query  557   TEGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
             +EGFT+ GSP+EHAR    QDY++FC V+E+YQ +M  L+  L  L+   +      + W
Sbjct  135   SEGFTIFGSPVEHARQLWPQDYTNFCDVIEEYQKEMSKLSGRLTVLLLNSLGLTTDDLEW  194

Query  716   *RCGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  892
                G  G +   ++ L++N  P CP+PTRAMG A HTD+SL T++YQ +  TGLQV    
Sbjct  195   --VGATGEINGARSALRLNSYPPCPEPTRAMGLAPHTDSSLFTVIYQ-NGTTGLQVSVEG  251

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
             + W+ V P + A+VVN+GD++ IISNG F S +HRA+V +A HR+S+A+F+GP  N +++
Sbjct  252   VGWVTVRPVTGALVVNVGDILHIISNGRFVSSVHRAVVDRAQHRLSIAHFYGPPVNAQLS  311

Query  1073  PSLKLIKPTEFP-MYRPISWNAYLDIKYKYFGKALEMI  1183
             P+ KL+ P + P +YR ++   YL IK K+F KAL +I
Sbjct  312   PAKKLVDPPDHPILYRTVTSQEYLAIKAKHFDKALALI  349



>gb|ABP37819.1| gibberellin 3-beta-hydroxylase [Medicago sativa subsp. caerulea]
Length=377

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 158/351 (45%), Positives = 211/351 (60%), Gaps = 22/351 (6%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWG  379
             DFN   +LP S+ W  LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG
Sbjct  21    DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWG  80

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             ++QV NHGIP++LL  ++   +  F L   QKL+A RSP  V+GY + RIS FF   MW+
Sbjct  81    VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYDLARISSFFPKLMWS  140

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSPL+H R    QDY+  C  V  Y   M+ LA  L  LM   +   +  I W 
Sbjct  141   EGFTIVGSPLDHFRQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWA  200

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                    +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV G    
Sbjct  201   GSKAQFDEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSG  259

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P 
Sbjct  260   WVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPH  319

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1213
              KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV  SN
Sbjct  320   EKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSVSLCAPINGLFDVNDSN  370



>ref|XP_003597810.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 ref|XP_003597814.1| Gibberellin 3-beta-hydroxylase [Medicago truncatula]
 gb|AES68061.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=371

 Score =   296 bits (757),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/345 (45%), Positives = 206/345 (60%), Gaps = 16/345 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             DFN   +LP S+ W  LDDH+ +   +T   VPVIDL DP A   I  AC+TWG++QV N
Sbjct  21    DFNSLQELPESYTWNHLDDHTLIKEGTTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVN  80

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP++LL  ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ 
Sbjct  81    HGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIV  140

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  736
             GSPL+H +    QDY+  C  V  Y   M+ LA  L  LM   +   +  I W       
Sbjct  141   GSPLDHFQQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQF  200

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
              +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P
Sbjct  201   DEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPP  259

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
                 +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ P
Sbjct  260   LHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGP  319

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1213
             T+ P+YR ++WN YL  K KYF KAL  +   +      DV  SN
Sbjct  320   TQPPLYRSVTWNEYLGTKAKYFNKALSSVSLCAPINGLFDVNDSN  364



>ref|XP_002514367.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF48321.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=356

 Score =   295 bits (755),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/335 (47%), Positives = 212/335 (63%), Gaps = 12/335 (4%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESV-PVIDLYDPQAVNKIKIACETWGI  382
             ++I+P+DF     LP SH W    S    +S  +S+ PVIDL  P  +  IK A E WG+
Sbjct  15    NNIVPLDFTSILTLPDSHAWTTPPSLDPLTSQDDSIIPVIDLNGPNVLILIKEASENWGM  74

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQVTNH IP+ L   +E QTR  F L   QKL A RSPG +TGYG  RIS FF  +MW E
Sbjct  75    FQVTNHDIPIHLFHHIEGQTRCLFGLPSTQKLLAARSPGGLTGYGRARISDFFTREMWYE  134

Query  563   GFTVAGSPLEHARQDY----SDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  730
             GFT+ GSP EHA Q +    + FC+V+E  Q +M+ L++ +  +MFK +   +       
Sbjct  135   GFTIMGSPAEHASQLWPNQDTSFCNVMEACQKEMKGLSERIIGIMFKSL--GLNEEDVKF  192

Query  731   VGL----QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
             +GL    Q+ Q  LQ+N  P CPDP RAMG A HTD+SL+T+L+Q   ++GLQV+   + 
Sbjct  193   LGLKDGSQYPQGALQLNSYPKCPDPDRAMGLAPHTDSSLITVLHQ-GGVSGLQVFKEGIG  251

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P  +A+VVN+GDLM IISNG FK   H+A+V+K  HRISVAYF+GP  +V+I+P 
Sbjct  252   WVPVSPVDDALVVNIGDLMHIISNGRFKCAQHQAVVNKTRHRISVAYFYGPPGDVKISPL  311

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             ++L+      +Y P++W  YLD K  YF KAL+ I
Sbjct  312   MQLVDFDHPVLYCPVTWKEYLDAKAIYFDKALDFI  346



>gb|ABP37818.1| gibberellin 3-beta-hydroxylase [Medicago falcata]
Length=377

 Score =   295 bits (755),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 211/351 (60%), Gaps = 22/351 (6%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWG  379
             DFN   +LP S+ W  LDDH+ +NS++T +      SVP+IDL DP A   I  AC+TWG
Sbjct  21    DFNSLQELPESYTWTHLDDHTLINSNNTMKESANSSSVPIIDLNDPNASKLIGHACKTWG  80

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             ++QV NHGIP++LL  ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+
Sbjct  81    VYQVVNHGIPISLLDEIQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWS  140

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSPL+H R    QDY+  C  V  Y   M+ LA  L  LM   +   +  I W 
Sbjct  141   EGFTIVGSPLDHFRQLWPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWA  200

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                    +   A +Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      
Sbjct  201   GSKAQFDEKACAAMQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSG  259

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P 
Sbjct  260   WVTVPPLHGGLVVNVGDLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPH  319

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS------DVEKSN  1213
              KL+ PT+ P+YR ++WN YL  K K+F KAL  +   +      DV  SN
Sbjct  320   EKLVGPTQPPLYRSVTWNEYLGTKAKHFNKALSSVSLCAPINGLFDVNDSN  370



>ref|XP_010476647.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Camelina sativa]
 gb|ADE80896.1| GA3ox1-like protein [Camelina sativa]
Length=358

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 212/332 (64%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P++LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ QMW+EGF
Sbjct  83    IANHGVPLSLLQDVEFLTESLFGLPVKRKLKAARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    QD+ ++C +VE+Y+ +M+ LA  L  L    +      + W R  
Sbjct  143   TITGSPLNDFRKLWPQDHLNYCDIVEEYEERMKKLASKLMWLALNSLGVTEEDVEWARL-  201

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI 
Sbjct  202   TSDLSWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWIT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPLESPLYRSVTWREYLQTKATHFNKALSMI  352



>gb|ACN89834.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=356

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 211/338 (62%), Gaps = 18/338 (5%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQ-AVNKIKIACE  370
             I S   +D     +LP SH W   LDD    N +   ES+PVIDL D + A+++I  AC+
Sbjct  5     ISSEKQLDLYSIKELPESHAWRSSLDDDGSRNINV--ESIPVIDLNDDKFAIDRIGHACK  62

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
             TWG FQ+ NH I   LL  ME    R F L  +QKL+A RS   + GYG+ RIS FF   
Sbjct  63    TWGAFQIINHNISQRLLNDMETCGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFSKL  122

Query  551   MWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  709
             MW+EGFT+ GSPLEHARQ    +Y+ FC V+E+Y+ +M  LA  L  LM   +      +
Sbjct  123   MWSEGFTIFGSPLEHARQLWPHNYNKFCDVIEEYENEMEKLAGTLMGLMLGSLGITKEDV  182

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
              W     VG +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+  
Sbjct  183   KW----AVGPRSGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFRE  237

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
                W+ V P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I
Sbjct  238   GNGWVTVPPLRGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKI  297

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +P  KL+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  298   SPLSKLVDQRNPPMYRPVTWSEYLGTKAKHFDKALSSV  335



>dbj|BAD30035.1| gibberellin 3beta-hydroxylase1 [Daucus carota]
Length=344

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 208/331 (63%), Gaps = 18/331 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             +D N   +LP SH W  L D      S+  ES+P+IDL DP  +  ++ ACETWG+ QV 
Sbjct  12    LDLNSIKELPESHTWTSLQDDCTDCLSNESESLPIIDLNDPDVLALVRHACETWGVLQVK  71

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAK-RSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             NHG+ + LL  ME  T + F L  EQKL+    S   ++GY +P+IS FF   MW EGFT
Sbjct  72    NHGVSLRLLEDMEAATTKLFSLPIEQKLKVSLSSSNDISGYRLPKISPFFPKFMWREGFT  131

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSP+EHA     QDY  FC +VE+Y  +M++LA+ L  LM K +      I W   G 
Sbjct  132   IFGSPVEHAVKLWPQDYKPFCDLVEEYGKEMKNLAERLMWLMLKSLGITEEDINWSSLG-  190

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
                    A +Q+N  P+CPDP RAMG A+HTD+SL+T+LYQ +N TGLQ++     W+ V
Sbjct  191   ------GAAIQLNSYPVCPDPDRAMGLAEHTDSSLLTILYQ-NNTTGLQIFREGTGWLTV  243

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
             +P++  +VVN+GDLM I+SNG++ SVLHRA+V++   RISVAY + P  NV I+P  KL+
Sbjct  244   QPHTGVLVVNIGDLMHILSNGLYPSVLHRALVNRKQQRISVAYIYRPPANVLISPLPKLV  303

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                   ++RPI+W  YL++K K+F   L +I
Sbjct  304   DHYHLCLFRPITWTEYLELKSKHFTNTLSLI  334



>ref|XP_006341659.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=356

 Score =   294 bits (753),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 211/338 (62%), Gaps = 18/338 (5%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQ-AVNKIKIACE  370
             I S   +D     +LP SH W   LDD    N +   ES+PVIDL D + A+++I  AC+
Sbjct  5     ISSEKQLDLYSIKELPESHAWRSSLDDDGSRNINV--ESIPVIDLNDDKFAIDRIGHACK  62

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
             TWG FQ+ NH I   LL  ME    R F L  +QKL+A RS   + GYG+ RIS FF   
Sbjct  63    TWGAFQIINHNISQRLLNDMETCGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFSKL  122

Query  551   MWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  709
             MW+EGFT+ GSPLEHARQ    +Y+ FC V+E+Y+ +M  LA  L  LM   +      +
Sbjct  123   MWSEGFTIFGSPLEHARQLWPHNYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGITKEDV  182

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
              W     VG +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+  
Sbjct  183   KW----AVGPRSGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFRE  237

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
                W+ V P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I
Sbjct  238   GNGWVTVPPLCGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKI  297

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +P  KL+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  298   SPLSKLVDQRNPPMYRPVTWSEYLGTKAKHFDKALSSV  335



>sp|O24648.1|G3OX_PEA RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; AltName: Full=Gibberellin 3 beta-hydroxylase 
1 [Pisum sativum]
 gb|AAB65829.1| 2-oxoglutarate-dependent dioxygenase [Pisum sativum]
 gb|AAC49792.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 205/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSS----TQESVPVIDLYDPQAVNKIKIACETWGIF  385
             DFN   +LP S+ W  LDDH+ ++S++    +  +VPVIDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QV NHGIP++LL  ++   +  F L   QK +A RSP  V+GYGI RIS FF   MW EG
Sbjct  81    QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPL+H R    QDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                  +   A LQ+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>ref|XP_008804067.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=359

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 208/336 (62%), Gaps = 15/336 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +F    ++P SH W  L DH  V  S   +SVPV+DL  P AV  +  ACE WG FQVT 
Sbjct  21    EFESVREVPDSHAWPGLHDHPSVEPSGP-DSVPVVDLASPDAVLLVGRACEEWGAFQVTG  79

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGI   LL R+E Q RR F L   QKL+A RSPG+++GYG+  IS FF   MW+EGFT+A
Sbjct  80    HGISSDLLDRLEYQIRRLFSLPTHQKLKAARSPGNISGYGLAPISSFFSKFMWSEGFTIA  139

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMVG  736
             GSPLEHAR    +D   FC V+E+Y+  M++LA  L  LM   +      I W   G V 
Sbjct  140   GSPLEHARKLWPKDSGGFCDVMEEYKEVMKELAGRLMHLMLLSLGLTEEDISW--AGPVR  197

Query  737   LQWT-QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWIDV  910
                   A LQ+N  P CP+P RAMG A HTD+SL+T+LYQ+S  +GLQV  P+   W+ V
Sbjct  198   DSGELSAVLQLNSYPACPEPDRAMGLAAHTDSSLLTVLYQSST-SGLQVLRPDPARWVTV  256

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
              P   A+VVN+GDL  I+SNG F++VLHRA+V++  HR+S AY  GP  +V ++P  KL+
Sbjct  257   PPLPGALVVNVGDLSHILSNGQFRTVLHRAVVNRTRHRLSAAYICGPPAHVGVSPVDKLV  316

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1198
              P + P YR ++W  YL +K K F  AL  I  + +
Sbjct  317   GPGQGPAYRTVTWPEYLSLKRKLFNNALASIKLSKE  352



>gb|ABG46320.1| gibberellin 3-oxidase 1 [Rumex palustris]
Length=368

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/340 (44%), Positives = 204/340 (60%), Gaps = 32/340 (9%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             +DF   ++LP ++ W    S        + VP++DL  P A   I  AC++WG FQV NH
Sbjct  23    LDFQSVEELPDAYEWGPLESHGGPVGADQGVPIVDLKGPNARELIGSACKSWGAFQVINH  82

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             G+P   L  +E   RR F L   QKL+A R+P  VTGYG  RIS FF   +W+EGFT+ G
Sbjct  83    GVPQRFLEEVESAGRRLFSLPLHQKLKAARAPDGVTGYGPARISSFFPKLLWSEGFTIFG  142

Query  581   SPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL---  739
             SP +HARQ    DY +FC ++E+Y   M+ LA  L  L+             G +G+   
Sbjct  143   SPEDHARQLWPQDYQNFCEIIEEYDRDMKRLAGRLMWLVL------------GSLGIAKD  190

Query  740   --QWT----------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
               +W            A LQ+N  P CP+P RAMG A HTD++L+T+LYQ +N TGLQV+
Sbjct  191   DVEWAGPTGDFNDTCSAALQLNSYPKCPNPGRAMGLAAHTDSTLLTILYQ-NNTTGLQVH  249

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                L W+ V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++ HHR+SVAY FGP ++V
Sbjct  250   RDGLGWVMVPPVPGALVVNIGDLLHILSNGLYPSVLHRAVVNRTHHRLSVAYLFGPPQSV  309

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              I+P  +L+ P    +YRPISW  YL  K K+F KAL  +
Sbjct  310   RISPLERLVDPDHPALYRPISWTEYLSTKAKHFNKALSSV  349



>ref|NP_001275412.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
 gb|AAK91506.1| gibberellin 3-beta-hydroxylase 2 [Solanum tuberosum]
Length=355

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 209/333 (63%), Gaps = 19/333 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDL-YDPQAV-NKIKIACETWGIF  385
             +D     +LP SH W   LDD    N ++  ES+PVIDL +D + V + I  AC+TWG F
Sbjct  9     LDLYSIKELPESHAWKSSLDDDGSRNINA--ESIPVIDLNHDHKFVMDTIGHACKTWGAF  66

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             Q+ NH I   LL  ME    R F L  +QKL+A RS   + GYG+ RIS FFD  MW+EG
Sbjct  67    QIVNHNISHRLLNHMETHGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFDKLMWSEG  126

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPLEHARQ    DY+ FC V+E+Y+ +M  LA  L  LM   +      + W   
Sbjct  127   FTIFGSPLEHARQLWPYDYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKW---  183

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               VG +   + LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV+     W+
Sbjct  184   -AVGPRSGSSALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVFKEGNGWV  241

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+V+N+GDL+ I+SNG++ SVLHRAIV++  HR+SVAY +GP   V+I+P  K
Sbjct  242   TVLPLRGALVLNVGDLVHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSK  301

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+      MYRP++W+ YL  K K+F KAL  +
Sbjct  302   LVDQRNPQMYRPVTWSEYLGTKAKHFDKALSSV  334



>gb|AAC96017.1| defective gibberellin 3B-hydroxylase [Pisum sativum]
 gb|AAC96015.1| gibberellin 3B-hydroxylase [Pisum sativum]
Length=374

 Score =   293 bits (751),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 205/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSS----TQESVPVIDLYDPQAVNKIKIACETWGIF  385
             DFN   +LP S+ W  LDDH+ ++S++    +  +VPVIDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QV NHGIP++LL  ++   +  F L   QK +A RSP  V+GYGI RIS FF   MW EG
Sbjct  81    QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPL+H R    QDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                  +   A LQ+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>ref|XP_009377503.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score =   292 bits (747),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 155/338 (46%), Positives = 211/338 (62%), Gaps = 15/338 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIWLD-DHSPVNS--SSTQESVPVIDLYDPQAVNKIKIACE  370
              +  IIP+DFN   +LP SH+W D  H  +    S+    VPVIDL D +A + +  ACE
Sbjct  11    HLHHIIPIDFNSVQKLPESHVWHDISHESLFGVPSADPLPVPVIDLMDSEASSLMIQACE  70

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
             TWGIFQV  HG+   L+  +E +  + F L  +QKL+A RSPG  TGYG P IS FFD  
Sbjct  71    TWGIFQVIGHGL-TKLMEDVEFEAEKLFGLPVDQKLKALRSPGGATGYGRPHISPFFDRH  129

Query  551   MWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  709
             MW EGFT+ GSP++HA+Q    DY  FC  ++DYQ QM+ LA+ L  + FK +    + +
Sbjct  130   MWQEGFTIMGSPIDHAKQLWPQDYQGFCDTIDDYQNQMKALAEKLIRIFFKSLNINFKEL  189

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
              W      GL      LQ+N  P CPDPTRAMG A HTDTSLVT++ Q S  +GLQV+  
Sbjct  190   NW--LNDSGLSSPGTALQLNSYPPCPDPTRAMGMAAHTDTSLVTIV-QQSKTSGLQVFKD  246

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
              + W+ V+P   A+ VNLGD + I+SNGM+ SVLHRA+V++   R S+AYF+ P ++  +
Sbjct  247   GVGWVLVQPVPGALTVNLGDYLHILSNGMYTSVLHRAVVNQQIQRFSMAYFYAPPRDFTV  306

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +P L  +   + P YR ++   Y+DIK K+F KAL +I
Sbjct  307   SPVLSRVM-GQMPKYRSLTVKEYVDIKGKHFEKALSLI  343



>ref|XP_010249910.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nelumbo nucifera]
Length=376

 Score =   293 bits (750),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 152/344 (44%), Positives = 207/344 (60%), Gaps = 17/344 (5%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW-----LDDHSPVNSSST---QESVPVIDLYDPQAVNKI  355
              +  IIP+DF+   +LP SH W     LDD       S       +PVIDL D   V  +
Sbjct  17    HLQHIIPLDFSSVRELPDSHAWTSSLLLDDKPHGRRGSVIGVGGPIPVIDLADANVVKLV  76

Query  356   KIACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISR  535
               ACETWG+FQ+TNHG P++LL  +E ++ R F L  EQKL+A RSP   TGYG  RI+ 
Sbjct  77    GRACETWGVFQITNHGQPISLLEAVESESLRLFSLPAEQKLKALRSPDGATGYGRARITP  136

Query  536   FFDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLA--QNLAALMFK*I  697
             FF   MW EGFT+ GSP EHA Q    +Y+ FC V+++YQ +M+ L+       L    +
Sbjct  137   FFSKLMWHEGFTIMGSPAEHAHQLWPHNYTRFCGVMDEYQKEMKQLSVRLLRLILSSLGL  196

Query  698   IRPICW*RCGMVG--LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  871
              R       G  G   Q     LQ+N  P CPDP R MG A HTDTS+ T+LYQ SN +G
Sbjct  197   AREDLTKWVGPAGEFTQGATTALQLNSYPACPDPNRTMGLAAHTDTSMFTILYQ-SNTSG  255

Query  872   LQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1051
             LQ++     W+ V P + A++VN+GDL+QI+SN  F +VLHRA+V++ + R+S+AYF+GP
Sbjct  256   LQIFRDGFGWVSVPPLAGALIVNVGDLLQILSNARFPAVLHRAVVNRTNQRLSIAYFYGP  315

Query  1052  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             S    I P  KLI P + P+YR ++W  Y+ IK K+  +AL ++
Sbjct  316   STETRIMPLSKLIGPGDPPLYRSLTWKEYIGIKAKHLYRALSLV  359



>ref|XP_009788819.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
Length=360

 Score =   292 bits (748),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 205/326 (63%), Gaps = 11/326 (3%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQ-AVNKIKIACETWGIFQ  388
             +D     +LP SH W   LD     N S   ES+PVIDL D + A+  I  AC+TWG FQ
Sbjct  14    LDLYTIKELPESHAWRSSLDHDYQCNDS--LESIPVIDLNDEKFAIENIGHACKTWGAFQ  71

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NH I   LL  MEE  +R F L  +QKL+A RS   + GYG+ RIS FF   MW+EGF
Sbjct  72    IINHNISQRLLDNMEEAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGF  131

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  736
             T+ GSP +HARQ    DY  FC V+E+Y+ +M  LA  L  LM   +       +  +VG
Sbjct  132   TIVGSPFDHARQLWPHDYKKFCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWAVVG  191

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
              +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+ V P
Sbjct  192   PRGGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWVTVPP  250

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
              S A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I+P  KL+  
Sbjct  251   LSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKLVDQ  310

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKAL  1174
                P+YR ++W+ YL  K K+F KAL
Sbjct  311   GHPPLYRSVTWSEYLGTKAKHFDKAL  336



>gb|ABO70984.1| gibberellin 3-oxidase 2 [Nicotiana tabacum]
Length=360

 Score =   292 bits (747),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 152/329 (46%), Positives = 205/329 (62%), Gaps = 17/329 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQ-AVNKIKIACETWGIFQ  388
             +D     +LP SH W   LD     N S   ES+PVIDL D + A+  I  AC+TWG FQ
Sbjct  14    LDLYTIKELPESHAWRSSLDHDYQCNDS--LESIPVIDLNDEKFAIENIGHACKTWGAFQ  71

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NH I   LL  MEE  +R F L  +QKL+A RS   + GYG+ RIS FF   MW+EGF
Sbjct  72    IINHNISQRLLDNMEEAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGF  131

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSP +HARQ    DY  FC V+E+Y+ +M  LA  L  LM   +      + W  CG
Sbjct  132   TIVGSPFDHARQLWPHDYKKFCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCG  191

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
               G     + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+ 
Sbjct  192   PRG---ECSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWVT  247

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P S A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I+P  KL
Sbjct  248   VPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKL  307

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKAL  1174
             +     P+YR ++W+ YL  K K+F KAL
Sbjct  308   VDQGHPPLYRSVTWSEYLGTKAKHFDKAL  336



>gb|AAC86820.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
 gb|AAC49793.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   292 bits (748),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 204/333 (61%), Gaps = 15/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSS----TQESVPVIDLYDPQAVNKIKIACETWGIF  385
             DFN   +LP S+ W  LDDH+ ++S++    +  +VPVIDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QV NHGIP++LL  ++   +  F L   QK +A RSP  V+GYGI RIS FF   MW EG
Sbjct  81    QVMNHGIPLSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPL+H R    QDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                  +   A LQ+N  P CPDP  AMG   HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLTPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>gb|AAC49794.1| gibberellin 3 beta-hydroxylase [Pisum sativum]
Length=374

 Score =   292 bits (748),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 204/333 (61%), Gaps = 15/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSS----TQESVPVIDLYDPQAVNKIKIACETWGIF  385
             DFN   +LP S+ W  LDDH+ ++S++    +  +VPVIDL DP A   I +AC+TWG++
Sbjct  21    DFNSLQELPESYNWTHLDDHTLIDSNNIMKESTTTVPVIDLNDPNASKLIGLACKTWGVY  80

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QV NHGIP +LL  ++   +  F L   QK +A RSP  V+GYGI RIS FF   MW EG
Sbjct  81    QVMNHGIPFSLLEDIQWLGQTLFSLPSHQKHKATRSPDGVSGYGIARISSFFPKLMWYEG  140

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPL+H R    QDY+ FC +V  Y   M+ LA  L  LM   +      I W   
Sbjct  141   FTIVGSPLDHFRELWPQDYTRFCDIVVQYDETMKKLAGTLMCLMLDSLGITKEDIKW-AG  199

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                  +   A LQ+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      WI
Sbjct  200   SKAQFEKACAALQLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVNREGSGWI  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P    +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  K
Sbjct  259   TVPPLQGGLVVNVGDLFYILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             LI PT+ P+YR ++WN YL  K K+F KAL  +
Sbjct  319   LIGPTKPPLYRSVTWNEYLGTKAKHFNKALSSV  351



>dbj|BAA37130.1| gibberellin 3beta-hydroxylase [Lactuca sativa]
Length=362

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 210/340 (62%), Gaps = 35/340 (10%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +D N   +LP S+ W  +D+ P  SSS  E VPVI+L D  A+  +  AC+TWG+FQVTN
Sbjct  14    LDLNSIKELPESYAWSSEDNCP--SSSNSEPVPVINLKDSNAMKHVGYACKTWGVFQVTN  71

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             H IP+ LL  ME   R+ F L  +QKL+A RS   V+GYG+ RIS FF   MW+EGFT+ 
Sbjct  72    HDIPITLLNNMEASGRKLFSLPFQQKLKAARSLDGVSGYGVARISSFFPKLMWSEGFTLI  131

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG---  736
              SP +HA+    Q   +FC V+E+Y  +M  L+              + W   G +G   
Sbjct  132   DSPHQHAQKLWPQGSGNFCDVIEEYNKEMNKLSNR------------VMWLILGSLGIKK  179

Query  737   --LQWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
               ++W           A LQ+N  P CPDP RAMG A HTD++L+T+L+Q SN +GLQV 
Sbjct  180   GDIKWANQEGEIKEACAALQLNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-SNTSGLQVQ  238

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                + W+ V+P + A+VVN+GDL+QI+SNG++ SVLHRA+V++  HR+SVAY +GP  NV
Sbjct  239   -RGVGWVTVKPIAGALVVNIGDLIQILSNGLYSSVLHRAMVNRTQHRLSVAYLYGPPSNV  297

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              IAP  KL      P+YRP++W+ YL  K K+F KAL  +
Sbjct  298   RIAPLSKLTDNVHPPLYRPVTWSEYLGTKAKHFNKALLFV  337



>gb|EYU21574.1| hypothetical protein MIMGU_mgv1a017804mg [Erythranthe guttata]
Length=380

 Score =   292 bits (748),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 154/351 (44%), Positives = 211/351 (60%), Gaps = 43/351 (12%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS--PVN----SSSTQESVPVIDLYDPQAVNKIKIACETWGI  382
             +D +   +LP SH W   ++  P +    +  + E+VP++DL    A   I  AC+TWG+
Sbjct  22    LDLSSVKELPESHAWTSQNNDYPFSGGGAADGSSETVPIVDLNSGNATELIGHACKTWGV  81

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQV NHGIP  LL  +E      F L   QKLRA R+   V+GYG+ RIS FF  +MW+E
Sbjct  82    FQVVNHGIPNNLLEEIEAAGSSLFSLPMHQKLRAARAADGVSGYGVARISSFFSKRMWSE  141

Query  563   GFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  730
             GFT+ GSPLE+AR+    DY+ FC  +EDY+ +M+ LA  L  LM             G 
Sbjct  142   GFTIVGSPLENARKIWPDDYNKFCQTIEDYEKEMKKLAGRLMWLML------------GS  189

Query  731   VGL-------QWTQ------------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQ  853
             +G+       +W              A LQMN  P CPDP RAMG A HTD++++T+L+Q
Sbjct  190   LGITKEEEEVKWADPKEESESGSGCAAALQMNSYPACPDPDRAMGLAAHTDSTILTVLHQ  249

Query  854   TSNITGLQVYGPNLN-WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRIS  1030
              SNI+GLQV     N W+ VEP+  A+VV++GDLM I+SNG + SVLHRA+V++  HR+S
Sbjct  250   -SNISGLQVLREGGNRWVTVEPHPGALVVHVGDLMHILSNGSYPSVLHRAVVNRTRHRLS  308

Query  1031  VAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             VAY +GP   V+I+P  KL+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  309   VAYLYGPPPGVKISPLSKLVDQYNPPMYRPVTWSEYLGTKAKHFDKALTSV  359



>ref|XP_010497240.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Camelina sativa]
Length=359

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 209/332 (63%), Gaps = 13/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYSWTPKDDILFAAAPSPPTAVETIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P++LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ QMW+EGF
Sbjct  83    IANHGVPLSLLQDVEFLTGSLFGLPVQRKLKAARSDTGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE+Y+ +M+ LA  L  L    +      + W    
Sbjct  143   TITGSPLNDFRKLWPQHHLNYCDIVEEYEERMKKLASKLMWLALNSLGVSEEDVEWASLN  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI 
Sbjct  203   SADLSWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWIT  261

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SV + +GP  +++I+P  KL
Sbjct  262   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVDFLWGPQSDIKISPVPKL  321

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  322   VSPLESPLYRSVTWKKYLQTKATHFNKALSMI  353



>ref|XP_010691237.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 208/325 (64%), Gaps = 12/325 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSSST---QESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             +DF  + +LP S  W     P +  S     E VPVI+L DP+A   I +AC++WG FQ+
Sbjct  85    LDFQSSKELPDSFAWAPHGDPCSLESNAFGHEHVPVINLEDPRAQQLIGVACKSWGAFQI  144

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNHGIP +LL  +E   +  F L   QKL+A RSP  +TGYG  RIS FF  +MW+EGFT
Sbjct  145   TNHGIPKSLLDDIEFAGKNLFALPVHQKLKAARSPHGITGYGPARISSFFPKRMWSEGFT  204

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCGMVG  736
             + GSPL+HARQ    DY+ FC ++E+YQ +M  LA+ L  L+   + I      +   + 
Sbjct  205   ILGSPLDHARQLWPNDYNKFCDIIEEYQKEMNHLAKRLMQLILGSLGISNQDIMKWADLL  264

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
             L+     +Q+N  P+CPDP RAMG A HTD++L+T+L+Q+S  TGLQV+   + WI V P
Sbjct  265   LKGANGAIQLNSYPVCPDPNRAMGLAAHTDSTLLTILHQSST-TGLQVFKEQVGWITVPP  323

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
              S  +V+N+GDL+ I+SNG + SV HRA+V++  HR+SVAY +GP+  V I P   L   
Sbjct  324   LSGGLVINIGDLLHILSNGQYPSVYHRAMVNRVQHRLSVAYLYGPAPGVRIQP---LPNT  380

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKA  1171
             T  P+YRP++W+ YL IK ++F KA
Sbjct  381   THPPIYRPVTWSEYLGIKGEHFNKA  405



>ref|XP_006416894.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
 gb|ESQ35247.1| hypothetical protein EUTSA_v10008008mg [Eutrema salsugineum]
Length=361

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 151/340 (44%), Positives = 211/340 (62%), Gaps = 14/340 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +T E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYTWTLKDDLLFAAAPSPPATGENIPLIDLNHPDAANQIGCACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F L  ++KL+A RS   V+GYG+ RIS FF+ QMW+EGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFRLPVQRKLKAARSETGVSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHAR-----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             T+AGSPL   R     Q + ++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TIAGSPLNDFRKLWPKQLHLNYCDIVEEYEEQMQKLASKLMWLALNSLGVTEDDIKWASV  202

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                 L W Q+ LQ+N  P+CP P RAMG A HTD++L+T+LYQ +N  GLQV+  +L WI
Sbjct  203   DDSDLNWAQSALQLNHYPVCPQPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWI  261

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   ++VVN+GDL  I++NG+FKSVLHRA V++   R+SVA+ +GP  + +I+P  K
Sbjct  262   TVPPIPGSLVVNVGDLFHILTNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDTKISPVPK  321

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1204
             L+ P   P+YR ++W  YL  K  +F KAL MI  + + E
Sbjct  322   LVSPVGSPLYRSVTWTEYLRTKAVHFNKALSMIRNHKEEE  361



>ref|NP_001233855.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34125.1| 3b-hydroxylase [Solanum lycopersicum]
Length=355

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 208/333 (62%), Gaps = 19/333 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDL-YDPQAV-NKIKIACETWGIF  385
             +D     +LP SH W   LDD    N ++  ES+PVIDL +D + V + I  AC+TWG F
Sbjct  9     LDLYSIKELPESHAWKSSLDDDGSRNINA--ESIPVIDLNHDHKFVMDTIGHACKTWGAF  66

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             Q+ NH I   LL  ME    R F L  +QKL+A RS   + GYG+ RIS FFD  MW+EG
Sbjct  67    QIVNHNISHRLLNHMETHGTRLFSLPMQQKLKAARSSDGIAGYGVARISSFFDKLMWSEG  126

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSPLEHARQ    DY+ FC V+E+Y+ +M  LA  L  LM   +      + W   
Sbjct  127   FTIFGSPLEHARQLWPYDYNKFCDVIEEYENEMEKLAGRLMGLMLGSLGIAKEDVKW---  183

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               VG +   + LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV+     W+
Sbjct  184   -AVGPRSGSSALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVFKEGNGWV  241

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V     A+V+N+GDL+ I+SNG++ SVLHRAIV++  HR+SVAY +GP   V+I+P  K
Sbjct  242   TVPLLRGALVINVGDLLHILSNGLYPSVLHRAIVNRTRHRLSVAYLYGPPSGVKISPLSK  301

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+      MYRP++W+ YL  K K+F KAL  +
Sbjct  302   LVDQRNPQMYRPVTWSEYLGTKAKHFDKALSSV  334



>ref|XP_003543662.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=352

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 202/332 (61%), Gaps = 18/332 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL----DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             D N   +LP S+ W     DDH+P   +++ ESVPVIDL DP A   I  AC TWG +QV
Sbjct  21    DLNSLQELPESYTWTHHSHDDHTP---AASNESVPVIDLNDPNASKLIHHACITWGAYQV  77

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NH IP++LL  ++      F L   QK +A RSP    GYG+ RIS FF   MW+EGFT
Sbjct  78    VNHAIPMSLLQDIQWVGETLFSLPCHQKQKAARSPDGADGYGLARISSFFPKLMWSEGFT  137

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPLEH RQ    DY  +C +V+ Y   M+ L   L  LM   +      + W   G 
Sbjct  138   IVGSPLEHFRQLWPQDYHKYCDIVKRYDEAMKKLVGKLMWLMLDSLGITKEDLKW--AGS  195

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  + T A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +NI+GLQV+     W+ 
Sbjct  196   KGQFKKTCAALQLNSYPTCPDPDRAMGLAAHTDSTLLTILYQ-NNISGLQVHRKGGGWVT  254

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P    +V+N+GDL+ I+SNG++ SVLHR +V++   R+SVAY  GP  NVEI P  KL
Sbjct  255   VAPVPEGLVINVGDLLHILSNGLYPSVLHRVLVNRIQQRLSVAYLCGPPPNVEICPHAKL  314

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P + P+Y+ ++WN YL  K K+F KAL  +
Sbjct  315   VGPNKPPLYKAVTWNEYLGTKAKHFNKALSTV  346



>gb|AAM12872.1|AF494089_1 gibberellin 3-oxidase 1 [Nicotiana sylvestris]
Length=360

 Score =   290 bits (742),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 205/329 (62%), Gaps = 17/329 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQ-AVNKIKIACETWGIFQ  388
             +D     +LP SH W   LD     N S   ES+PVIDL D + A+  I  AC+TWG FQ
Sbjct  14    LDLYTIKELPESHAWRSSLDHDYQCNDS--LESIPVIDLNDEKFAIENIGHACKTWGAFQ  71

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NH I   LL  MEE  +R F L  +QKL+A RS   + GYG+ RIS FF   MW+EGF
Sbjct  72    IINHNISQRLLDNMEEAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGF  131

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSP +HARQ    DY  FC V+E+Y+ +M  LA  L  LM   +      + W  CG
Sbjct  132   TIVGSPFDHARQLWPHDYKKFCDVIEEYEKEMEKLAGRLMWLMLGSLGISKDDMKWACCG  191

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                 +   + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+ 
Sbjct  192   P---RXECSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWVT  247

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P S A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+I+P  KL
Sbjct  248   VPPLSGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLSKL  307

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKAL  1174
             +     P+YR ++W+ YL  K K+F KAL
Sbjct  308   VDQGHPPLYRSVTWSEYLGTKAKHFDKAL  336



>gb|AAN87570.1| gibberellin 3-oxidase [Spinacia oleracea]
Length=382

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 153/360 (43%), Positives = 212/360 (59%), Gaps = 33/360 (9%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVN----SSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +D    ++LP S  W     P +    S    +SVPVI+L DPQA   + +AC +WG+FQ
Sbjct  20    LDLESLNELPDSFAWGSFEDPCSIDNPSGYGPDSVPVINLQDPQAQQLVGLACRSWGVFQ  79

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHGI  +LL  +E   +  F L   QKL+A RS   VTGYG   IS FF  +MW+EGF
Sbjct  80    VTNHGIQKSLLDDIEAAGKSLFALPVNQKLKAARSSCGVTGYGPAGISSFFPKRMWSEGF  139

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  736
             T+ GSPL+HARQ    +Y+ FC ++E YQ +M  LA+ L  L+             G +G
Sbjct  140   TILGSPLDHARQLWPNNYNKFCDIIEKYQKEMNQLAKKLMQLV------------VGSLG  187

Query  737   ------------LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  880
                         L+     +Q+N  PI PDP RAMG A HTD++L+T+L+Q SN TGLQV
Sbjct  188   ISNQDIMNWADLLEGANGAMQLNSYPIRPDPNRAMGLAAHTDSTLLTILHQ-SNTTGLQV  246

Query  881   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1060
             +     W+ V P S  +V+N+GDL+ I+SNG + SV HRA+V++  HR+SVAY +GP+  
Sbjct  247   FRERSGWVTVPPISGGLVINIGDLLHILSNGRYPSVYHRAMVNRVQHRLSVAYLYGPASG  306

Query  1061  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALASGSEAP  1240
             V + P  KLI  T  P+YRP++W+ YL IK ++  KAL +I  N +   S     G++ P
Sbjct  307   VRVQPLPKLIDATHPPLYRPVTWSEYLGIKSEHLTKALSLIRINHNTNPSLTGLIGNDEP  366



>ref|XP_011072274.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Sesamum indicum]
Length=378

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/349 (45%), Positives = 211/349 (60%), Gaps = 41/349 (12%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDH---SPVNSSST--QESVPVIDLYDPQAVNKIKIACETW  376
             +D N   +LP +H W   LD +   SP     T   E VP+IDL +  A   I  AC++W
Sbjct  22    LDLNSVKELPDTHAWTSQLDGYPLSSPGGCGGTCHSEMVPIIDLNNENATELIGHACKSW  81

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G+FQV NH IP+ LL  +E    + F L   QKLRA R P  ++GYG+ RIS FF   MW
Sbjct  82    GVFQVINHNIPMNLLDEVELAGNKLFSLPMHQKLRAARPPDGISGYGVARISSFFSKLMW  141

Query  557   TEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RC  724
             +EGFTV GSPLEHARQ    DY +FC  +EDYQ  M+ LA  L  LM             
Sbjct  142   SEGFTVVGSPLEHARQLWPHDYHEFCDTIEDYQKSMKKLAGRLMWLML------------  189

Query  725   GMVG------LQWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTS  859
             G +G      ++W           A +Q+N  P CPDP RAMG A HTD++L+T+L+Q S
Sbjct  190   GSLGITNEDDIKWASPAGEAGGGNAAIQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-S  248

Query  860   NITGLQVYGP-NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVA  1036
             N +GLQV+   +  WI V P+  A+V+++GDLM I+SNG++ SVLHRA+V++  HR+S+A
Sbjct  249   NTSGLQVFQEGSKRWITVPPHPGALVIHVGDLMHILSNGLYPSVLHRAVVNRTRHRLSIA  308

Query  1037  YFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             Y +GP  +V+I+P  KL+     P+YRPI+W+ YL  K K+F KAL  +
Sbjct  309   YLYGPPSSVKISPLPKLVDHFHPPLYRPITWSEYLGTKAKHFDKALTSV  357



>dbj|BAJ65442.1| gibberellin 3-oxidase [Torenia fournieri]
 dbj|BAJ76663.1| gibberellin 3-oxidase [Torenia fournieri]
Length=382

 Score =   291 bits (744),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 154/356 (43%), Positives = 213/356 (60%), Gaps = 15/356 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             +D +   +LP +H W         +   E+VP+IDL D  A+  I  AC TWG+FQV NH
Sbjct  28    LDLSSVKELPETHAWTSSKLDDEETCDAENVPIIDLNDENAIELIGRACRTWGVFQVINH  87

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
              IP +LL  +E + ++ F L  +QKLRA RSP  V+GYG+ RIS FF   MW+EGFT+ G
Sbjct  88    NIPKSLLDEIEFEGKKLFSLPMQQKLRAARSPDGVSGYGVARISSFFSKLMWSEGFTILG  147

Query  581   SPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RCGMVG  736
             S  EHAR     DY+ FC  +E+YQ  M+ LA  L  LM   +       + W       
Sbjct  148   SVSEHARLLWPNDYNKFCDTIEEYQKAMKRLAGRLMWLMLGSLGITEDDDLKWAAQKEPD  207

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWIDVE  913
              Q   A LQ+N  P CPDP RAMG A HTD++++T+L+Q SN +GLQV       W+ V 
Sbjct  208   DQGGSAALQLNSYPSCPDPDRAMGLAAHTDSTILTILHQ-SNTSGLQVAREGRAGWVTVP  266

Query  914   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIK  1093
             P + A+VV++GDL+ I+SNG++ SV+HRA+V++  HR+SVAY +GP  +V+I+P  KL+ 
Sbjct  267   PLAGALVVHVGDLLHILSNGLYPSVVHRAVVNRTRHRLSVAYLYGPPSSVKISPLRKLVD  326

Query  1094  PTEFPMYRPISWNAYLDIKYKYFGKALEMIGF-----NSDVEKSNALASGSEAPVG  1246
                 P+YRPI+W+ YL  K K+F KAL  +       N  V+ SN   S +   VG
Sbjct  327   KYHPPLYRPITWSEYLGTKAKHFDKALTSVRLLCAPRNGFVDTSNDHTSSTVQLVG  382



>ref|XP_010925284.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Elaeis guineensis]
Length=362

 Score =   290 bits (741),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 150/337 (45%), Positives = 208/337 (62%), Gaps = 28/337 (8%)
 Frame = +2

Query  227   FNKADQLPHSHIWLDDHS-PVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHG  403
             F    ++P SH W D H  P    S  +SVPV+DL  P A+  +  AC+ +G+FQ+T+HG
Sbjct  24    FESIRKVPDSHAWPDLHDHPSVEPSGPDSVPVVDLASPDALLLVGRACQDFGVFQITSHG  83

Query  404   IPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGS  583
             IP  LL R+E Q RR F L   QKL+A RSPGS++GYG+  IS FF   MW+EGFT+AGS
Sbjct  84    IPTDLLDRLESQIRRLFSLPTHQKLKAARSPGSISGYGLVPISSFFPKLMWSEGFTIAGS  143

Query  584   PLEHAR-----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV--GLQ  742
             PLEHAR     + Y++FC+V+E+Y   M+ LA  L  LM             G+    + 
Sbjct  144   PLEHARKLWPNESYAEFCNVIEEYSKVMKKLAGRLMHLMLL---------SLGLTEEDIS  194

Query  743   WT---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-  892
             W             +Q+N  P CP+P RA+G A HTD+SL+T+LYQ S  +GLQV  P+ 
Sbjct  195   WAGPTKDSGDLSTVMQLNSYPACPEPDRAVGLAAHTDSSLLTVLYQ-SRTSGLQVLRPDP  253

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P    ++V++GDL  I+SNG F+SVLHRA+V++ HHR+S AY  GP  +V+++
Sbjct  254   PRWVTVPPLPGVLIVHVGDLSHILSNGRFRSVLHRAVVNRTHHRLSAAYICGPPAHVKVS  313

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P  KL+ P++ P YR ++W  YL +K K F +AL  I
Sbjct  314   PVKKLLGPSQGPAYRAVTWPEYLALKGKLFNEALASI  350



>ref|XP_002892873.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69132.1| hypothetical protein ARALYDRAFT_471756 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 210/332 (63%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +T E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYKWTPKDDLLFAAAPSPPTTGENIPLIDLDHPDAANQIGHACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ +MW+EGF
Sbjct  83    IANHGVPLGLLQDIEFLTGSLFRLPVQRKLKAARSETGVSGYGVARIASFFNKKMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE+Y+ QM+ LA  L  L  K +      + W    
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEEYEEQMKKLASKLMWLALKSLGVSEEDVEWASLN  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+L Q +N  GLQV+  +L W+ 
Sbjct  203   S-DLNWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILCQ-NNTAGLQVFRDDLGWVT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPVELPLYRSVTWTEYLRTKATHFNKALSMI  352



>dbj|BAQ02990.1| gibberellin 3-oxidase [Rorippa aquatica]
Length=356

 Score =   289 bits (739),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 148/332 (45%), Positives = 210/332 (63%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTALRELPDSYTWTPKDDILFPAAPSPPAASETIPLIDLNQPDAANQIGRACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ QMW+EGF
Sbjct  83    IANHGVPLGLLEDIEFLTSSLFRLPVQRKLKAARSDTGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE+Y+ QMR LA  L  L+   +      + W R  
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEEYEEQMRKLASKLLWLVLNSLGVSEEDVKWARLN  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                  W QA LQ+N  P+CP P +AMG A HTD++L+T+LYQ +N  GLQV+  +L W+ 
Sbjct  203   SDS-NWAQAALQLNHYPVCPQPDQAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWVT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL+ I+SNG+FKSVLHRA V++   R SVA+ +GP  +++I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLLHILSNGLFKSVLHRARVNQTRSRFSVAFLWGPQSDIQISPIPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+Y+ ++W  YL IK  +F KAL MI
Sbjct  321   VGPFESPLYQSVTWTHYLQIKATHFNKALSMI  352



>ref|XP_002284981.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI36204.3| unnamed protein product [Vitis vinifera]
Length=359

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 208/332 (63%), Gaps = 15/332 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             +D N   +LP SH W  L +H P   S   ESVPVIDL DP A+  +  AC++WG+FQV 
Sbjct  21    LDLNSIQELPDSHAWASLGEH-PCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVI  79

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
             NHGIP++LL  +E+ +R  F L  EQKL+A R P   +G+G PRI+ FF  QMW EGFTV
Sbjct  80    NHGIPISLLEAIEDASRNLFALPAEQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTV  139

Query  575   AGSPLEHAR----QDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  730
              GSPLE       ++Y + FC V E+Y  QM+ LA  L  L+   +      + W   G 
Sbjct  140   LGSPLELVSKLWPEEYCTKFCEVTEEYDKQMKQLANKLLWLLLGSLGINKEDVEW--AGP  197

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G L+   A LQ+N  P CP P +AMG A+HTD+SL+T+LYQ S  +GLQV      WI 
Sbjct  198   EGQLEGAHAALQLNSYPACPQPDKAMGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWIT  256

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL+ I+SN  F SVLHRA+V+ +  RISVAYF+GP   + +AP  KL
Sbjct  257   VPPLPGALVVNIGDLLHILSNAAFPSVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKL  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +  +  P+YR ++W+ +L  K K+F KAL ++
Sbjct  317   VDSSHPPVYRSVTWSEFLATKAKHFNKALSLV  348



>ref|XP_009596383.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=363

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 150/333 (45%), Positives = 210/333 (63%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD--DHSPVNSSSTQESVPVIDLYDPQ-AVNKIKIACETWGIFQV  391
             +D     +LP SH W    DH    S+ + ES+PVIDL D + A+ KI  AC+TWG FQ+
Sbjct  13    LDLYTIKELPESHAWRSSLDHD-YQSNDSLESIPVIDLNDNKFAMEKIGHACKTWGAFQI  71

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NH I  +LL  ME   +R F L  +QKL+A RS   + GYG+ RIS FF   MW+EGFT
Sbjct  72    INHNISQSLLDNMEGAGKRLFSLPMQQKLKAARSADGIAGYGVARISSFFSKLMWSEGFT  131

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPL+HARQ    DY  FC ++E+Y+ +M  LA  L  LM   +      + W   G 
Sbjct  132   IVGSPLDHARQLWPHDYKKFCEIIEEYEKEMEKLAGRLMWLMLGSLGINKDDVKW-AVGP  190

Query  731   VGLQWTQ--AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
              G++     + LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W+
Sbjct  191   RGVESKGGCSALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGNGWV  249

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+V+N+GDL+ I+SNG++ SVLHRA+V++  HR+S+AY +GP   V+I+P  K
Sbjct  250   AVPPLPGALVINVGDLLHILSNGLYPSVLHRAVVNRTRHRLSMAYLYGPPSWVKISPLSK  309

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+     PMYRP++W+ YL  K K+F KAL  +
Sbjct  310   LVDQGHPPMYRPVTWSEYLGTKAKHFDKALSSV  342



>ref|XP_009588350.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana tomentosiformis]
Length=371

 Score =   289 bits (739),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 202/335 (60%), Gaps = 15/335 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS-PVNSSSTQESVPVIDL------YDPQAVNKIKIACETWG  379
             +D N   +LP SH W   +  P  +S   ES+PVIDL       +   +  I  AC+ WG
Sbjct  17    LDLNSIKELPESHAWTSSNDYPSENSCNFESIPVIDLDNYINNNNINVLEHIGQACKKWG  76

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
              FQ+ NH I   LL  +E   +  F L   QKL+A RSP  VTGYG+ RIS FF   MW+
Sbjct  77    AFQIINHNISERLLQDIELAGKSLFSLPMHQKLKAARSPEGVTGYGVARISSFFSKLMWS  136

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSPLEHARQ    DY  FC V+E+Y+ +M  LA  L  LM   +      + W 
Sbjct  137   EGFTIVGSPLEHARQIWPHDYQKFCDVIEEYEREMEKLAGRLMWLMLGSLGITKEEVKWA  196

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
              C     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     
Sbjct  197   VCPKGESKGGSAALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGSG  255

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+++P 
Sbjct  256   WVTVPPFPGALVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPL  315

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              KL+     P+YR ++W+ YL  K K+F KAL  +
Sbjct  316   AKLVDQRHPPLYRAVTWSEYLGTKAKHFDKALSSV  350



>emb|CDX81720.1| BnaC08g38810D [Brassica napus]
Length=358

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/332 (44%), Positives = 204/332 (61%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPVNSS-----STQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W     P+ ++        ES+P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTSKDDPLFTAPPSPPGAGESIPLIDLNHPDAANQIGRACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F+L  + KL A RS    +GYG+ RIS FF+ +MW+EGF
Sbjct  83    IANHGVPLELLQDIEFLTGSLFQLPVQHKLEAARSDAGFSGYGVARISSFFNKKMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE Y+ QM+ LA  L  L    +      I W R  
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEQYEEQMQKLASKLMWLSLNSLGVSEEDIKWARVS  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L W+ 
Sbjct  203   S-DLNWAQSALQLNHYPVCPEPDRAMGLAPHTDSTLLTILYQ-NNTAGLQVFRDDLGWVT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSV+HR  V++   R+SVA+ +GP  + +I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVIHRVRVNQTRPRLSVAFLWGPRSDTKISPVPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPDESPLYRSVTWTEYLRTKATHFNKALSMI  352



>dbj|BAA89316.1| gibberellin 3beta-hydroxylase [Nicotiana tabacum]
Length=371

 Score =   288 bits (738),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/335 (44%), Positives = 203/335 (61%), Gaps = 15/335 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS-PVNSSSTQESVPVIDL------YDPQAVNKIKIACETWG  379
             +D N   +LP SH W   +  P  +S   ES+PVIDL       +   +  I  AC+ WG
Sbjct  17    LDLNSIKELPESHAWTSSNDYPSENSCNFESIPVIDLDNYINNNNINVLEHIGQACKKWG  76

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
              FQ+ NH I   LL  +E   +  F L  +QKL+A RSP  VTGYG+ RIS FF   MW+
Sbjct  77    AFQIINHNISERLLQDIELAGKSLFSLPMQQKLKAARSPEGVTGYGVARISSFFSKLMWS  136

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSPLEHARQ    DY  FC V+E+Y+ +M  LA  L  LM   +      + W 
Sbjct  137   EGFTIVGSPLEHARQIWPHDYQKFCDVIEEYEREMEKLAGRLMWLMLGSLGITKEEVKWA  196

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
              C     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     
Sbjct  197   VCPKGESKGGSAALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGSG  255

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR+SVAY +GP   V+++P 
Sbjct  256   WVTVPPFPGALVVNVGDLLHILSNGLYPSVLHRAVVNRTRHRLSVAYLYGPPSRVKVSPL  315

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              KL+     P+YR ++W+ YL  K ++F KAL  +
Sbjct  316   AKLVDQRHPPLYRAVTWSEYLGTKARHFDKALSSV  350



>ref|XP_007013765.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
 gb|EOY31384.1| Gibberellin 3-oxidase 3, putative [Theobroma cacao]
Length=342

 Score =   287 bits (735),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 151/335 (45%), Positives = 205/335 (61%), Gaps = 23/335 (7%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             I+P+DF+    +P SH+W   DD S    S  Q S+P+IDL DP AV     ACETWG F
Sbjct  18    IVPLDFHSVRTVPDSHVWPKSDDFS----SDDQLSIPIIDLKDPLAVKLAGHACETWGAF  73

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QV NHGIP  L+  +E + RR F L  +QK++A R P   TGYG+ RIS FF   MW EG
Sbjct  74    QVINHGIPSNLVEEVESEARRLFSLPAQQKMKALREPAGATGYGLARISPFFPKYMWHEG  133

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  733
             FTV GSP++HAR     D + FC V+E YQ +M+ LA+ L  L+ + +          + 
Sbjct  134   FTVMGSPVDHARALWPNDNARFCDVIERYQKKMKVLAEQLTHLILESL-------DVSLE  186

Query  734   GLQWT----QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
              L W        LQ+N  P CPDP R MG A HTDTS +TLL+Q+S I+GLQ++   + W
Sbjct  187   DLSWDVGSPSTALQLNSYPSCPDPNRTMGLAPHTDTSFLTLLHQSS-ISGLQIFKEGVGW  245

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSK-AHHRISVAYFFGPSKNVEIAPS  1078
             + V P + A+VVN+GDL+ I+SN  F SVLHRA+V++   HR+SVAYF+G   +  ++P 
Sbjct  246   LSVRPIAGALVVNVGDLLHILSNARFPSVLHRAVVNRDGCHRLSVAYFYGIPTDCNVSPL  305

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              KL+     P YR ++   Y+ +K K F +AL +I
Sbjct  306   AKLLNSGHTPRYRSVTVKEYVILKAKNFEEALSLI  340



>ref|XP_008347459.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score =   288 bits (737),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/337 (44%), Positives = 206/337 (61%), Gaps = 17/337 (5%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             P DF+   +LP S+ W   L+++    S S  ESVPVIDL DP  V  +  AC+TWG+FQ
Sbjct  22    PDDFSSLXELPKSYAWTSQLNEYPSFESLSCSESVPVIDLTDPNVVELVGHACKTWGMFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
               NHG+P  L+  ME   R  F L P+QKL+A R P   +GYG  RIS F +  MW+E F
Sbjct  82    AXNHGVPQKLVDDMESTVRSLFSLPPQQKLKAARLPDGFSGYGFHRISAFCEKLMWSESF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T  GSPLEH R    QDY+ FC + E+Y+ +M  LA  L  LM   +      I W   G
Sbjct  142   TTVGSPLEHFRQLWPQDYTKFCCIAEEYEREMIRLAAXLMWLMLGSLGISKEDIKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY----GPN  892
               G  +   A LQ N  P CPDP R +G AQHTD+SL+++++Q+SN +GLQV+       
Sbjct  200   PRGEFEDASAVLQFNSYPACPDPDRTIGLAQHTDSSLISIVHQSSNASGLQVFRQGEEEG  259

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P   A V+N+GD M ++SNG++++V HRA+V+++ HR+SVA  +GP +N +++
Sbjct  260   RGWLMVPPVPGAFVINVGDFMHMLSNGLYQNVFHRAVVNRSQHRVSVACLYGPPENAQVS  319

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P  KL+ P+  P+Y P++WN YL  K K   KALE +
Sbjct  320   PLSKLLGPSCPPLYPPLTWNEYLGTKAKLHNKALESL  356



>ref|NP_173008.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
 sp|Q39103.2|G3OX1_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 1; AltName: Full=GA 
3-oxidase 1; Short=AtGA3ox1; AltName: Full=Gibberellin 3 
beta-hydroxylase 1 [Arabidopsis thaliana]
 gb|AAF71980.1|AC013453_5 GA4 protein [Arabidopsis thaliana]
 gb|AAC37506.1| GA4 [Arabidopsis thaliana]
 gb|AAO64762.1| At1g15550 [Arabidopsis thaliana]
 dbj|BAE99582.1| Gibberillin 3 beta-hydroxylase [Arabidopsis thaliana]
 gb|AEE29335.1| gibberellin 3-beta-dioxygenase 1 [Arabidopsis thaliana]
Length=358

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 210/332 (63%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +T E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYKWTPKDDLLFSAAPSPPATGENIPLIDLDHPDATNQIGHACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             ++NHG+P+ LL  +E  T   F L  ++KL++ RS   V+GYG+ RI+ FF+ QMW+EGF
Sbjct  83    ISNHGVPLGLLQDIEFLTGSLFGLPVQRKLKSARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE+Y+  M+ LA  L  L    +      I W    
Sbjct  143   TITGSPLNDFRKLWPQHHLNYCDIVEEYEEHMKKLASKLMWLALNSLGVSEEDIEWASLS  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W QA LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +L W+ 
Sbjct  203   S-DLNWAQAALQLNHYPVCPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLGWVT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  KL
Sbjct  261   VPPFPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPVPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+Y+ ++W  YL  K  +F KAL MI
Sbjct  321   VSPVESPLYQSVTWKEYLRTKATHFNKALSMI  352



>emb|CDY36572.1| BnaA06g10250D [Brassica napus]
Length=359

 Score =   288 bits (736),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 211/338 (62%), Gaps = 15/338 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPV-----NSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W     P+     +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F+L  ++KL+A RS    +GYG+ RIS FF+ QMW+EGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSETGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQDY-----SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             T+ GSPL   R+ +     +++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLNNYCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKW-AS  201

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                 L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANPDLNWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P  +++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPDSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1198
             L+ P   P+YR ++W  YL  K  +F +AL MI  + D
Sbjct  321   LVSPVGSPLYRSVTWTEYLRTKATHFNEALSMIKNDID  358



>gb|AGQ42612.1| GA3ox3 [Vitis vinifera]
Length=359

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 154/332 (46%), Positives = 208/332 (63%), Gaps = 15/332 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             +D N   +LP SH W  L +H P   S   ESVPVIDL DP A+  +  AC++WG+FQV 
Sbjct  21    LDLNSIQELPDSHAWASLGEH-PCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVI  79

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
             NHGIP+++L  +E+ +R  F L  EQKL+A R P   +G+G PRI+ FF  QMW EGFTV
Sbjct  80    NHGIPISILEAIEDASRNLFALPAEQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTV  139

Query  575   AGSPLEHAR----QDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  730
              GSPLE       ++Y + FC V E+Y  QM+ LA  L  L+   +      + W   G 
Sbjct  140   LGSPLELVSKLWPEEYCTKFCEVTEEYDKQMKQLANKLLWLLLGSLGINKEDVEW--AGP  197

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G L+   A LQ+N  P CP P +AMG A+HTD+SL+T+LYQ S  +GLQV      WI 
Sbjct  198   EGQLEGAHAALQLNSYPACPQPDKAMGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWIT  256

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL+ I+SN  F SVLHRA+V+ +  RISVAYF+GP   + +AP  KL
Sbjct  257   VPPLPGALVVNIGDLLHILSNAAFPSVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKL  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +  +  P+YR ++W+ +L  K K+F KAL ++
Sbjct  317   VDSSHPPVYRSVTWSEFLATKAKHFNKALSLV  348



>ref|XP_006382066.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
 gb|ERP59863.1| gibberellin 3 beta-hydroxylase family protein [Populus trichocarpa]
Length=342

 Score =   287 bits (734),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 204/332 (61%), Gaps = 17/332 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQE---SVPVIDLYDPQAVNKIKIACETWGI  382
             IIP+DF+    LP SH+W     P + +S  E   S+P +DL DP A   I  ACE WG 
Sbjct  18    IIPLDFDSVRTLPDSHVW----QPTSHASESEDRLSIPTVDLKDPDAGKLIGHACEAWGA  73

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQVTNH IP+ L   +E + RR F L   QKL+A RSPG  TGYG+ RIS FF+  MW E
Sbjct  74    FQVTNHDIPLDLFHEVESEARRLFSLPTGQKLKALRSPGGATGYGLARISPFFNKYMWHE  133

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCG  727
             GFT+ GS ++HAR     DY  FC V+EDYQ +M++LA  L  L+ K + I      R  
Sbjct  134   GFTIMGSSIDHARDLWPNDYQRFCDVMEDYQKKMKELAVTLMHLVLKSLDISEEEISRVV  193

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
               G   T   LQ+N  P+CPDP RAMG A HTDTSL+T+L+Q S + GLQ++   + W+ 
Sbjct  194   SAGGDSTA--LQLNSYPLCPDPNRAMGLAPHTDTSLLTILHQ-STVNGLQIFKEGVGWVL  250

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P + ++VVN+GDL+ I+SN  F+SVLHR ++ +   R+S+AYF+    +  I+P    
Sbjct  251   VSPTNGSLVVNVGDLLHILSNAQFRSVLHRVVMKENQQRLSLAYFYCLPSDFHISP--LA  308

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +  T+ P+YR +S   Y+ IK K   KAL +I
Sbjct  309   LNSTQMPLYRSVSVRDYIGIKAKNLEKALSLI  340



>dbj|BAG32267.1| gibberellin 3-oxidase [Allium fistulosum]
Length=365

 Score =   288 bits (736),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/343 (45%), Positives = 210/343 (61%), Gaps = 19/343 (6%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHG  403
             D   A ++P SH W     P   +   ES+PVIDL  P  ++ I  ACE+WG+FQV +HG
Sbjct  23    DLGSAHEVPDSHTW-PTIQPNPPNGPNESIPVIDLSSPDVISLIGHACESWGVFQVISHG  81

Query  404   IPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGS  583
             + + LL  +E Q RR F L  +QKL+A RSP S++GYG+  IS  F   MW+EGFT++GS
Sbjct  82    VDLNLLHNLESQARRLFSLPTQQKLKAGRSPNSISGYGLAPISSLFSKLMWSEGFTISGS  141

Query  584   PLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQ  742
             PL+HAR     DY +FC V+E+Y  +M+ +A+ L  LM   +      I W    M  LQ
Sbjct  142   PLDHARSLWPDDYFNFCEVIEEYNKEMKRVAERLMQLMLLSLGLTEETIKW-AGPMNELQ  200

Query  743   WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-----LNWID  907
                + LQ+N  P CP+P RA+G A HTD+SL+T+LYQ SN +GLQV  PN       W+ 
Sbjct  201   DISSVLQLNSYPACPNPDRAIGLAAHTDSSLLTILYQ-SNTSGLQVLRPNKESSPTQWVT  259

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL  I+SNG F SV+HRA+V++  HR S AY  GP  +V+++P   +
Sbjct  260   VPPIPGALVVNVGDLCHILSNGRFHSVVHRAVVNRTEHRYSAAYICGPPAHVKVSP---I  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNA  1216
             +KP   P YRPI+W  YL IK + F KAL  +  + +    N+
Sbjct  317   VKPVG-PAYRPITWREYLGIKARLFDKALASVIISEEDHNDNS  358



>ref|XP_009372969.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=345

 Score =   287 bits (734),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 154/335 (46%), Positives = 204/335 (61%), Gaps = 17/335 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQES----VPVIDLYDPQAVNKIKIACETWG  379
             IIP+DFN    LP SH+W  DHS  +SS    +    VPVIDL DP+A + +  ACE WG
Sbjct  15    IIPIDFNTIQTLPESHVW-HDHSDESSSRVPSADPLFVPVIDLMDPEAPSLMIQACEEWG  73

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             IFQV  HG+   L+  +E +  + F L  +QKL+A RSPG  TGYG P IS FFD  MW 
Sbjct  74    IFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKALRSPGGATGYGCPHISPFFDKHMWQ  132

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSP++HA+    QDY  FC  ++DYQ QM+ LAQ L  + FK +        W 
Sbjct  133   EGFTIMGSPVDHAKQLWPQDYQGFCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDW-  191

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                  GL      LQ+N  P CPDPTRA+G A HTDTSLVT++ Q S  +GLQV+     
Sbjct  192   -LNDSGLSSPSTALQLNSYPPCPDPTRALGMATHTDTSLVTIV-QQSKTSGLQVFKDGAG  249

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V+P   A+ VNLGD + I+SNGMF SV HR +V++   R S+AYF+ P ++  ++P 
Sbjct  250   WVLVQPIPGALTVNLGDYLHILSNGMFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPV  309

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L  +   + P YR ++   Y+DIK K+  KA  +I
Sbjct  310   LSRVL-EKVPKYRSLTVKEYVDIKGKHLEKAFSLI  343



>ref|XP_008356836.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=363

 Score =   287 bits (735),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 211/341 (62%), Gaps = 17/341 (5%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             P DF+   +LP S+ W   L+++    S S  ESVPVIDL DP  V  +  AC+TWG+FQ
Sbjct  22    PDDFSSLQELPESYAWTSQLNEYPSFESLSCSESVPVIDLADPNVVELVGHACKTWGMFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
              TNHG+P  L+  ME   R  F L P+QKL+A R P  ++GYG  RIS F +  MW+E F
Sbjct  82    ATNHGVPQKLVDDMESTVRSLFSLPPQQKLKAARLPDGISGYGFHRISAFCEKLMWSESF  141

Query  569   TVAGSPLEHA----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCG  727
             T+ GS L+H      QD++ FC V E+Y+ +M+ LA  L  LM   +      I W   G
Sbjct  142   TIVGSXLQHFCQLWPQDHTKFCCVTEEYEKEMKRLAARLMWLMLGSLXISKEDIKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN--  898
               G  +   A LQ+N  P CPDP R MG AQHTD++L+++++Q++  +GLQV+    +  
Sbjct  200   PRGEFEDASAALQLNSYPACPDPDRTMGLAQHTDSNLLSIIHQSAKASGLQVFQEGKDEG  259

Query  899   --WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P   A V+N+GD + I+SNG++++ LHRA+V+++ HR+SVAY +GP +N +++
Sbjct  260   RGWLMVPPVPGAFVINVGDFIHILSNGLYQTPLHRAVVNRSQHRVSVAYLYGPPENAQVS  319

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1195
             P  KL+ P   P+Y P++WN YL  K K   KAL+ +  N+
Sbjct  320   PLSKLLGPXCPPLYAPVTWNEYLGTKAKLNNKALQSLRLNA  360



>ref|XP_008785607.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Phoenix dactylifera]
Length=362

 Score =   287 bits (734),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 152/337 (45%), Positives = 207/337 (61%), Gaps = 14/337 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS-PVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
              DF    ++P SH W D H  P    S  +SVPV+DL  P AV  +  AC+ WG+FQVT 
Sbjct  22    FDFESIREVPDSHAWPDLHDHPSVEPSGPDSVPVVDLDSPDAVLLVGRACQEWGVFQVTG  81

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP  LL R+E Q RR F L   QKL+A RSPG + GYG+  IS FF   MW+EGFT+A
Sbjct  82    HGIPTDLLDRLESQIRRLFSLPTHQKLKAARSPGDIAGYGLAPISSFFPKLMWSEGFTIA  141

Query  578   GSPLEHAR----QDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMV  733
             GSP EHAR    ++Y ++FC+V+E+Y    ++LA  L  LM   +      I W   G +
Sbjct  142   GSPFEHARKLLPKEYCAEFCNVIEEYNKVAKELAGRLMHLMLLSLGLTEEDISW--AGPI  199

Query  734   GLQWT-QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-LNWID  907
                    A +Q+N  P CP+P RA+G A HTD+SL+T+LYQ S  +GLQV  P+   W+ 
Sbjct  200   RDSGDLSAVIQLNSYPACPEPDRALGLAAHTDSSLLTVLYQ-SGTSGLQVLRPDPARWVT  258

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P    ++V++GDL  I+SNG F+SVLHRA+V++ HHR+S AY  GP  +V+++P    
Sbjct  259   VPPLPGVLIVHVGDLSHILSNGHFRSVLHRAVVNRRHHRLSAAYICGPPAHVKVSPIDIF  318

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1198
             + P++ P YR ++W  YL +K K F KAL  I    +
Sbjct  319   LGPSQGPAYRAVTWPEYLALKGKLFNKALASIKLRRE  355



>ref|XP_009148952.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Brassica rapa]
Length=359

 Score =   287 bits (734),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 144/338 (43%), Positives = 210/338 (62%), Gaps = 15/338 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPV-----NSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W     P+     +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F+L  ++KL+A RS    +GYG+ RIS FF+ QMW+EGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSETGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQDY-----SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             T+ GSPL   R+ +     +++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLNNYCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKW-AS  201

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                 L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANPDLNWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1198
             L+ P   P+YR ++W  YL  K  +F +AL MI  + D
Sbjct  321   LVSPVGSPLYRSVTWTEYLRTKATHFNEALSMIKNDID  358



>ref|XP_011081703.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like, partial [Sesamum 
indicum]
Length=369

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/359 (41%), Positives = 221/359 (62%), Gaps = 42/359 (12%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSS-----STQESVPVIDLYDPQAVNKIKIACETWGIF  385
             +D +  + LP SH W  + +  +SS     S  ES+P+I+L D  A+  I++AC TWG+F
Sbjct  22    VDLSSVEILPDSHAWTSEANKYSSSCGGDISRLESIPIINLKDENAMELIRLACTTWGVF  81

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             Q+ NH +P  L+  +E    + F L  ++KL A+R+P  V+GYG+ RIS FF   MW+EG
Sbjct  82    QIVNHNVPKNLVDEVELAGEKLFSLPMDRKLMAERTPNGVSGYGMARISSFFSKSMWSEG  141

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  733
             FT+ GSPLEHA +    DY +FC+ +E+YQ +M++LA  L  L+             G +
Sbjct  142   FTIVGSPLEHAAKLWPHDYHNFCNTIEEYQKEMKNLASRLMGLIL------------GSL  189

Query  734   GL-----QWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  871
             G+     +W +         A LQ+N  P CPDP +AMG A HTD++++ +L+Q SN +G
Sbjct  190   GVTEDDVKWVEPKGELKERGAALQLNSYPPCPDPDKAMGMAAHTDSTILNILHQ-SNTSG  248

Query  872   LQVY-GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFG  1048
             LQV+ G  + W+ ++P+  A++V +GDLM I+SNG + + LHRA+V++  HR+SV Y  G
Sbjct  249   LQVFRGDGIGWVTLQPHPGALIVVIGDLMHILSNGSYLNALHRAVVNQTQHRLSVVYLHG  308

Query  1049  PSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI----GF-NSDVEKS  1210
             P  +V++ P  +L+     P+YRPI+WN YL IK +YF KAL  I    GF N+D + S
Sbjct  309   PPSSVKMGPLPQLVDSNHPPLYRPITWNEYLGIKAQYFDKALTTISLANGFMNADDDDS  367



>ref|XP_009117822.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Brassica rapa]
 emb|CDY68965.1| BnaA09g57140D [Brassica napus]
Length=358

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 205/332 (62%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPVNSS-----STQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W     P+ ++        ES+P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTSKDDPLFTAPPSPPDAGESIPLIDLNHPDAANQIGRACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F+L  ++KL+A RS    +GYG+ RIS FF+ +MW+EGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSDTGFSGYGVARISSFFNKKMWSEGF  142

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL   R    Q + ++C +VE Y+ QM+ LA  L  L    +      I W    
Sbjct  143   TITGSPLNDFRKLWPQLHLNYCDIVEQYEEQMQKLASKLMWLSLNSLGVTEEDIKWATVS  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+LYQ +N  GLQV+  +  W+ 
Sbjct  203   S-DLNWAQSALQLNHYPVCPEPDRAMGLAPHTDSTLLTILYQ-NNTAGLQVFRDDFGWVT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSV+HRA V++   R+SVA+ +GP  + +I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVIHRARVNQTRPRLSVAFLWGPRSDTKISPVPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPDESPLYRSVTWTEYLRTKATHFNKALSMI  352



>emb|CDP18939.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   286 bits (732),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/333 (44%), Positives = 203/333 (61%), Gaps = 14/333 (4%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL----DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +D ++  +LP SH W      D  P       E+VPV+DL D  A + +  AC TWG+FQ
Sbjct  21    LDLSRVKKLPDSHAWTTAPPKDDYPRGELLNVETVPVVDLADKNAQDLLGHACRTWGVFQ  80

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             V NHGI   LL  +E   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGF
Sbjct  81    VKNHGISKNLLDEIESAGKGLFSLPMHQKLKAARSPEGVSGYGVARISSFFPKLMWSEGF  140

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCG  727
             T+ GSPLEHARQ    DY  FC+V+++Y+ +M+ LA  L  L+   +      + W    
Sbjct  141   TIVGSPLEHARQLWPHDYHKFCNVMKEYEKEMKKLAGKLMWLILGSLGVTEEEVKW-ASP  199

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY-GPNLNWI  904
                 +   A +Q+N  P CP+P RAMG A HTD++++T+L+Q +N +GLQV       W+
Sbjct  200   KGAFEGGNAAIQLNSYPACPEPDRAMGLAAHTDSTILTILHQ-NNTSGLQVLRDGGAGWV  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL+ I+SNG++ SVLHRA+V++  HR SVAY +GP   V I+P  K
Sbjct  259   TVPPLPGALVVNIGDLLHILSNGLYPSVLHRAVVNRTRHRFSVAYLYGPPSGVTISPLQK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+     P+YRP++W  YL  K K+F KAL ++
Sbjct  319   LVDQGRPPLYRPVTWTEYLGTKAKHFDKALSLV  351



>gb|KFK43811.1| hypothetical protein AALP_AA1G176200 [Arabis alpina]
Length=358

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/332 (44%), Positives = 209/332 (63%), Gaps = 14/332 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD---HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W   DD    +  +  +T E++P+IDL +P A ++I  AC TWG FQ
Sbjct  23    DFTSLRELPDSYTWTPKDDLLFAAAPSPRATGENIPLIDLNNPDAASQIGHACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ QMW+EGF
Sbjct  83    IANHGVPLELLEGIEFLTGSLFRLPVQRKLKAARSETGVSGYGVARIASFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQDYS----DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T++GSPL   R+ +     ++C +VE+Y+  M+ LA  L  L    +      I W R  
Sbjct  143   TISGSPLNDFRKLWPKLHLNYCDIVEEYEEHMQKLASKLMWLALNSLGVSEEDIKWARLN  202

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                  W QA LQ+N  P+CP P RAMG A HTD+SL+T+LYQ +N  GLQ++  ++ W+ 
Sbjct  203   -SDYNWAQAALQLNHYPVCPQPDRAMGLAAHTDSSLLTILYQ-NNTAGLQLFRDDIGWVT  260

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  + +I+P  KL
Sbjct  261   VPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDTKISPVPKL  320

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P E P+YR ++W  YL  K  +F KAL MI
Sbjct  321   VSPFESPLYRSVTWTEYLRTKATHFNKALSMI  352



>emb|CAN73736.1| hypothetical protein VITISV_025221 [Vitis vinifera]
Length=416

 Score =   286 bits (733),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 154/332 (46%), Positives = 208/332 (63%), Gaps = 15/332 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             +D N   +LP SH W  L +H P   S   ESVPVIDL DP A+  +  AC++WG+FQV 
Sbjct  78    LDLNSIQELPDSHAWASLGEH-PCVDSLIAESVPVIDLSDPNALTLVGDACKSWGVFQVI  136

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
             NHGIP+++L  +E+ +R  F L  EQKL+A R P   +G+G PRI+ FF  QMW EGFTV
Sbjct  137   NHGIPISILEAIEDASRNLFALPAEQKLKATRPPDGFSGFGQPRIAPFFAKQMWYEGFTV  196

Query  575   AGSPLEHAR----QDY-SDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGM  730
              GSPLE       ++Y + FC V E+Y  QM+ LA  L  L+   +      + W   G 
Sbjct  197   LGSPLELVSKLWPEEYCTKFCEVTEEYDKQMKQLANKLLWLLLGSLGINKEDVEW--AGP  254

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G L+   A LQ+N  P CP P +AMG A+HTD+SL+T+LYQ S  +GLQV      WI 
Sbjct  255   EGQLEGAHAALQLNSYPACPQPDKAMGLAEHTDSSLLTILYQGST-SGLQVVLEGSGWIT  313

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL+ I+SN  F SVLHRA+V+ +  RISVAYF+GP   + +AP  KL
Sbjct  314   VPPLPGALVVNIGDLLHILSNAAFPSVLHRAMVNNSKQRISVAYFYGPPATIPVAPIPKL  373

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +  +  P+YR ++W+ +L  K K+F KAL ++
Sbjct  374   VDSSHPPVYRSVTWSEFLATKAKHFNKALSLV  405



>gb|KDO58203.1| hypothetical protein CISIN_1g043985mg [Citrus sinensis]
Length=350

 Score =   284 bits (726),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 153/332 (46%), Positives = 209/332 (63%), Gaps = 15/332 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNK--IKIACETWGIFQV  391
             +DF    +LP  + W + D  P   S   ESVPVIDL  P AVN   I  AC+TWG+FQV
Sbjct  21    LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGPTAVNVNLIGHACKTWGVFQV  80

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP ALL      +R  F L  EQKL+  RSP +  GYG  RIS FF   MW EGFT
Sbjct  81    INHGIPTALLHNAMCTSRSLFTLPNEQKLKVARSPDAFEGYGFARISSFFSKLMWYEGFT  140

Query  572   VAGSPLEHA----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
               GSPL+H      QDY+  C+VVE+Y+ +M+ LA+ L  L+ + +      I W   G+
Sbjct  141   NVGSPLDHFCQLWPQDYNMHCNVVEEYKKEMKKLAERLMCLILRSLGTTREDIKW--PGL  198

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   + L  N+ P CPDP RAMG A HTD+SL T+LYQ S ++GLQV      W+ 
Sbjct  199   NGDFKDHPSPLNFNYYPACPDPDRAMGLAAHTDSSLFTILYQNS-VSGLQVLREGTGWVT  257

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P S+A+VVN+GD++ I+SNG++ SVLHRA+ ++  +R+S+AYF+G   +++I+P   L
Sbjct  258   VPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATRK-NRLSIAYFYGLPSDLQISPLENL  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P++ P+YR ISW+ YL +K K+F KAL  +
Sbjct  317   VGPSQPPLYRSISWSEYLRMKAKHFNKALSFV  348



>dbj|BAM73280.1| gibberellin 3 oxidase 1 [Raphanus sativus]
Length=359

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 206/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPV-----NSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W     P+     +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F+L  ++KL+A RS    +GYG+ RIS FF+ QMW+EGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVQRKLKAARSDTGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQDY-----SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             T+ GSPL   R+ +      ++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLKNYCDIVEEYEEQMQTLASKLMWLSLTSLGVSEEDIKW-AT  201

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                 L W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANPDLNWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRFSVAFLWGPQSDIKISPVPK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+   E P+YR ++W  YL  K  +F +AL MI
Sbjct  321   LVSLVESPLYRSVTWTEYLRTKATHFNEALSMI  353



>ref|XP_008346007.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=360

 Score =   284 bits (727),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 206/331 (62%), Gaps = 18/331 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +P DFN   +LP S+ W  L++H  ++S    +SVPV+DL DP A+  +  AC+TWG+FQ
Sbjct  26    VPDDFNSLHELPDSYAWTTLNEHPSLDS----DSVPVVDLNDPNALQLLGHACKTWGVFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             +TNHGIP  L+  ME   R  F L  +QKL+  RSPG ++GYG   I+ F+D Q W+E F
Sbjct  82    LTNHGIPQTLVHDMESAARSLFSLPAQQKLKVARSPGQISGYGFHLIAAFWDKQQWSECF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPLEH      QDY+ FC + E+++ +++ LA  L  LM   +      + W   G
Sbjct  142   TIVGSPLEHYEQLWPQDYTKFCCITEEFEKEIKKLASRLMWLMLASLGISKDDVEW--DG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  Q   A  Q N  P CPDP R +G   HTD+SLV++++Q SNI GLQV+     W 
Sbjct  200   PKGDDQNASAVFQFNSYPSCPDPDRTLGLVPHTDSSLVSIVHQ-SNIDGLQVFREGTGWF  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              ++P   A+VVN+GDLM I+SNG++ SVLHR +V +A HRIS+ Y +GP   V+IAP  K
Sbjct  259   TIQPVPGALVVNVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPPAAVKIAPLEK  318

Query  1085  LIKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1174
             L  P+  P+Y P++ WN Y+  K K  GKAL
Sbjct  319   LFGPSHPPLYPPVTNWNEYISTKAKLKGKAL  349



>ref|XP_009355149.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Pyrus x bretschneideri]
Length=360

 Score =   284 bits (727),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 207/331 (63%), Gaps = 18/331 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +P DFN   +LP S+ W  L++H  + S    +SVPV+DL DP ++  +  AC+TWG+FQ
Sbjct  26    VPDDFNSLHELPDSYAWTTLNEHPSLES----DSVPVVDLNDPNSLQLLGHACKTWGVFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             +TNHGIP +L+  ME   R  F L  +QKL+  RSPG ++GYG   I+ F+D Q W+E F
Sbjct  82    LTNHGIPQSLVHAMESAARSLFSLPAQQKLKVARSPGQISGYGFHLIAAFWDKQQWSECF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPLEH      QDY+ FC + E+++ +++ LA  L  LM   +      + W   G
Sbjct  142   TIVGSPLEHYAQLWPQDYTKFCCITEEFEREIKRLASRLVWLMLASLGISKDDVEW--DG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  Q   A  Q N  P CPDP R +G   HTD+SLV++++Q SNI GLQV+     W 
Sbjct  200   PKGDDQNASAVFQFNSYPSCPDPDRTLGLVPHTDSSLVSIVHQ-SNIDGLQVFREGTGWF  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              ++P   A+V+N+GDLM I+SNG++ SVLHR +V +A HRIS+ Y +GP   V+IAP  K
Sbjct  259   TIQPVPGALVINVGDLMSILSNGLYSSVLHRVLVKRAQHRISLVYHYGPPAAVKIAPLAK  318

Query  1085  LIKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1174
             L+ P+  P+Y P++ WN Y+  K K  GKAL
Sbjct  319   LVGPSNSPLYPPVTNWNEYISTKAKLKGKAL  349



>emb|CDY39663.1| BnaC05g11920D [Brassica napus]
Length=359

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 142/333 (43%), Positives = 206/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPV-----NSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DF    +LP S+ W     P+     +  +  E++P+IDL  P A N+I  AC TWG FQ
Sbjct  23    DFTSLSELPDSYTWTPKDDPLLDAAPSPPAASENIPLIDLNHPDAANQIGSACRTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P+ LL  +E  T   F+L   +KL+A RS    +GYG+ RIS FF+ QMW+EGF
Sbjct  83    IANHGVPLELLQGIEFLTGSLFQLPVHRKLKAARSETGFSGYGVARISSFFNKQMWSEGF  142

Query  569   TVAGSPLEHARQDY-----SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             T+ GSPL   R+ +     +++C +VE+Y+ QM+ LA  L  L    +      I W   
Sbjct  143   TITGSPLNDFRKLWPQHHLNNYCDIVEEYEEQMQKLASKLMWLSLTSLGVSEEDIKW-AS  201

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                   W Q+ LQ+N  P+CP+P RAMG A HTD++L+T+L+Q +N  GLQV+  +L W+
Sbjct  202   ANSDSDWAQSALQLNHYPVCPEPDRAMGLAAHTDSTLLTILHQ-NNTAGLQVFRDDLGWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P  K
Sbjct  261   TVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRSRLSVAFLWGPQSDIKISPVPK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ P   P+YR ++W  YL  K  +F +AL MI
Sbjct  321   LVSPVGSPLYRSVTWTEYLRTKATHFNEALSMI  353



>ref|XP_009771250.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Nicotiana sylvestris]
 gb|AAM12873.1|AF494090_1 gibberellin 3-oxidase 2 [Nicotiana sylvestris]
Length=370

 Score =   284 bits (726),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/356 (43%), Positives = 208/356 (58%), Gaps = 22/356 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS-PVNSSSTQESVPVIDLYDPQ-----AVNKIKIACETWGI  382
             +D N   +LP SH W   +  P  +S   ES+PVIDL +        +  I  AC+ WG 
Sbjct  17    LDLNSIKELPESHAWTSSNDYPSENSCNFESIPVIDLNNNNHNNINVLEHIGQACKKWGA  76

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQ+ NH I   LL  +E   +  F L  +QKL+A RSP  VTGYG+ RIS FF   MW+E
Sbjct  77    FQIINHNISERLLQDIELAGKNLFSLPMQQKLKAARSPDGVTGYGVARISSFFSKLMWSE  136

Query  563   GFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             GFT+ GSPLEHARQ    DY  FC  +E+Y+ +M  LA  L  LM   +      + W  
Sbjct  137   GFTIVGSPLEHARQIWPQDYKKFCDAIEEYEREMEKLAGRLMWLMLGSLGITKEDVNWAV  196

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
                   +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQV+     W
Sbjct  197   GPKGESKGGSAALQLNSYPACPDPDRAMGLAAHTDSTILTILHQ-NNTSGLQVFKEGSGW  255

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  HR+SVAY +GP   V+I+P  
Sbjct  256   VTVPPFLGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPSGVKISPLA  315

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALE-------MIGFNSDVEKSNALASG  1228
             KL+     P+YR I+W+ YL  K K+F KAL        + GF +D +  N +  G
Sbjct  316   KLVDQRHPPLYRAITWSEYLGTKAKHFDKALSSVRLCAPLTGF-ADAKDHNGVQVG  370



>ref|XP_008352044.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 149/338 (44%), Positives = 206/338 (61%), Gaps = 15/338 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIWLD-DHSPVNS--SSTQESVPVIDLYDPQAVNKIKIACE  370
              +  IIP+DFN   +LP SH+W D  H  +    S+    VPVIDL D +A + +  ACE
Sbjct  11    HLHHIIPIDFNSVQKLPESHVWHDKSHESLFGVPSADPLPVPVIDLMDSEASSLMIQACE  70

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
             TWGIFQV  HG+       +E +  + F L  +QKL+A RSPG  TGYG P IS FFD  
Sbjct  71    TWGIFQVIGHGL-TKFXEDVESEAEKLFGLPVDQKLKALRSPGGATGYGRPHISPFFDRH  129

Query  551   MWTEGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  709
             MW EGFT+ GSP++HA+    QDY  FC  ++DYQ QM+ LA+ +  + FK +      +
Sbjct  130   MWQEGFTIMGSPIDHAKQLWPQDYQGFCDTIDDYQNQMKALAEKIIRIFFKSLNINFEEL  189

Query  710   CW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
              W      GL      LQ+N  P CPDPTRAMG A HTDTSLVT++ Q S  +GLQV+  
Sbjct  190   NW--LNDSGLSSPGTALQLNSYPPCPDPTRAMGMAAHTDTSLVTIV-QQSKTSGLQVFKD  246

Query  890   NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEI  1069
              + W+ V+P   A+ V LGD + I+SNGM+ +VLHRA+V++   R S+AYF+ P ++  +
Sbjct  247   GVGWVLVQPVPGALTVXLGDYLHILSNGMYTNVLHRAVVNQQIQRFSMAYFYAPPRDFTV  306

Query  1070  APSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +P L  +   + P YR ++   Y+D+K K+  KAL +I
Sbjct  307   SPVLSRVT-GQMPKYRSLTVKEYVDLKGKHLEKALSLI  343



>ref|XP_008387508.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Malus domestica]
Length=345

 Score =   282 bits (721),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 153/335 (46%), Positives = 202/335 (60%), Gaps = 17/335 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQE----SVPVIDLYDPQAVNKIKIACETWG  379
             IIP+DFN    LP SH+W  DHS  +SS        SVPVIDL DP+A + +  ACE WG
Sbjct  15    IIPIDFNSIQTLPESHVW-HDHSDESSSGVPSADPLSVPVIDLMDPEAPSLMIQACEEWG  73

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             IFQV  HG+   L+  +E +  + F L  +QKL+A RSPG  TGYG P IS FFD  MW 
Sbjct  74    IFQVIGHGL-TKLMDDVESEAEKLFGLPVDQKLKALRSPGGATGYGRPHISPFFDKHMWQ  132

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSP++HA+    QDY  FC  ++DYQ QM+ LAQ L  + FK +        W 
Sbjct  133   EGFTIMGSPVDHAKQLWPQDYQGFCDTMDDYQNQMKALAQKLIHIFFKSLDINFEEFDW-  191

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                  G       LQ+N  P CPDPTRA+G A HTDTSLVT++ Q S  +GLQV+     
Sbjct  192   -LNDSGSSNPSTALQLNSYPPCPDPTRALGMATHTDTSLVTIV-QQSKTSGLQVFKDGAG  249

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V+P   A+ VNLGD + I SNG+F SV HR +V++   R S+AYF+ P ++  ++P 
Sbjct  250   WVLVQPIPGALTVNLGDYLHIXSNGVFTSVRHRVVVNQQIQRFSMAYFYSPPRDFTVSPV  309

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L  +   + P YR ++   Y+DIK K+  KA  +I
Sbjct  310   LSRVL-EKVPKYRSLTVKEYVDIKGKHLEKAFSLI  343



>ref|XP_006427126.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
 gb|ESR40366.1| hypothetical protein CICLE_v10027361mg [Citrus clementina]
Length=350

 Score =   282 bits (721),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 208/332 (63%), Gaps = 15/332 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNK--IKIACETWGIFQV  391
             +DF    +LP  + W + D  P   S   ESVPVIDL  P AVN   I  AC+TWG+FQV
Sbjct  21    LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGPTAVNVNLIGHACKTWGVFQV  80

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP ALL      +R  F L  EQKL+  RSP +  GYG  RIS FF   MW EGFT
Sbjct  81    INHGIPTALLHNAMCTSRSLFTLPNEQKLKVARSPDAFEGYGFARISSFFSKLMWYEGFT  140

Query  572   VAGSPLEHA----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
               GSPL+H      QDY+  C+VVE+Y+ +M+ LA+ L  L+ + +      I W   G+
Sbjct  141   NVGSPLDHFCQLWPQDYNMHCNVVEEYKKEMKKLAERLMCLILRSLGTTREDIKW--AGL  198

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   + L  N+ P CPDP RAMG A HTD+SL T+L Q S ++GLQV      W+ 
Sbjct  199   NGDFKDHPSPLNFNYYPACPDPDRAMGLAAHTDSSLFTILCQNS-VSGLQVLREGTGWVT  257

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P S+A+VVN+GD++ I+SNG++ SVLHRA+ ++  +R+S+AYF+G   +++I+P   L
Sbjct  258   VPPVSDALVVNVGDMLHILSNGLYPSVLHRAVATRK-NRLSIAYFYGLPSDLQISPLENL  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P++ P+YR ISW+ YL +K K+F KAL  +
Sbjct  317   VGPSQPPLYRSISWSEYLRMKAKHFNKALSFV  348



>dbj|BAD06943.1| gibberellin 3-oxidase-like protein [Ipomoea nil]
Length=372

 Score =   282 bits (721),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 212/334 (63%), Gaps = 16/334 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKI------ACETWG  379
             +D     +LP SH W  DDH+  NS +  ES+PVIDL +    N   I      AC+ WG
Sbjct  20    LDLYSIKELPESHAWSSDDHTGSNSINF-ESIPVIDLDNYNHDNNFNILDTIGHACKKWG  78

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
              FQ+ NH I   LL  +E   RR F L  +QKL+A RSP  V+GYG+ RIS FFD  MW+
Sbjct  79    AFQLINHNISEKLLEDIEIAGRRLFSLPMQQKLKAARSPDGVSGYGLARISSFFDKLMWS  138

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  727
             EGFT+ GSPLEH+R    QD++ FC VVE+Y+ +M+ LA  +  L+ + +       + G
Sbjct  139   EGFTIVGSPLEHSRLLWPQDFNSFCEVVEEYEKEMKKLAGRMMKLILESLGVAEEDAKWG  198

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY--GPNLNW  901
             +       A LQ+N  P CPDP RAMG A+HTD++++T+L+Q +N +GLQV+  G    W
Sbjct  199   VESKGRCSA-LQLNSYPACPDPGRAMGLAEHTDSTVLTILHQ-NNTSGLQVFREGAAGGW  256

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P   A+V+N GDL+ I+SNG++ SVLHRA+V+++ HR+SVAY +GP   ++I+P  
Sbjct  257   VTVPPIPGALVINAGDLLHILSNGLYHSVLHRAVVNRSSHRLSVAYLYGPPPGIKISPLP  316

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             KL+   + P++R I+W+ YL  K K+F KAL  +
Sbjct  317   KLVAEGQPPLFRAITWSEYLRTKAKHFDKALSSV  350



>ref|XP_006465424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
Length=350

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/332 (46%), Positives = 210/332 (63%), Gaps = 15/332 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNK--IKIACETWGIFQV  391
             +DF    +LP  + W + D  P   S   ESVPVIDL    AVN   I  AC+TWG+FQV
Sbjct  21    LDFTSLKELPDLYTWTEPDEYPAGQSLASESVPVIDLDGLTAVNVNLIGHACKTWGVFQV  80

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP ALL  +   +R FF L  EQKL+  RSP +  G G  RIS FF   MW EGFT
Sbjct  81    INHGIPTALLHNVMCTSRSFFTLPTEQKLKVARSPDAFEGNGFARISSFFSKLMWYEGFT  140

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
               GSPL+H R    QDY+  C+VVE+Y+ +M+ LA+ L  L+ + +      I W   G+
Sbjct  141   NVGSPLDHFRQFWPQDYNMHCNVVEEYKKEMKKLAERLMCLILRSLGTTREDIKW--PGL  198

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  +   + L +N+ P CPDP RAMG A HTD+SL T+LYQ S ++GLQV      W+ 
Sbjct  199   NGDFKDHPSPLNLNYYPACPDPDRAMGLAAHTDSSLFTILYQNS-VSGLQVLREGTGWVT  257

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P  +A+VVN+GD++ I+SNG++ SVLHRA+ ++  +R+S+AYF+G   +++I+P   L
Sbjct  258   VPPVWDALVVNVGDMLHILSNGLYPSVLHRAVATRK-NRLSIAYFYGLPSDLQISPLENL  316

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P++ P+YR ISW+ YL +K K+F KAL  +
Sbjct  317   VGPSQPPLYRSISWSEYLRMKAKHFNKALSFV  348



>ref|XP_003533057.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
Length=375

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 203/341 (60%), Gaps = 18/341 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL----DDHSPVNSSS---TQESVPVIDLYDPQAVNKIKIACETWGI  382
             DFN   +LP S+ W     DDH   N  S   T+  VP+IDL DP A N I  AC+TWG+
Sbjct  21    DFNSLQELPDSYAWTQPDDDDHRLTNYPSNNKTKTVVPIIDLNDPNAPNLIGHACKTWGV  80

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQV NHGIP +L + ++  +   F L   QKL+A RSP  V+GYG  RIS FF   MW+E
Sbjct  81    FQVVNHGIPTSLFSDIQRASLALFSLPLHQKLKAARSPDGVSGYGRARISSFFPKLMWSE  140

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP---ICW*R  721
              FT+  SPL+       QDY+ +C +V +Y+A M+ LA  L  LM   +  P   I W  
Sbjct  141   CFTILDSPLDLFLKLWPQDYAKYCDIVVEYEAAMKKLAAKLMCLMLASLGIPKEDIKW--  198

Query  722   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
              G  G      A L  N  P CPDP RAMG A HTD++L+T+L+Q +N+ GLQV      
Sbjct  199   AGPKGEFNGACAALHWNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVNGLQVLKEGEG  257

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P    +V+N+GDL+ I+SNG++ SVLHR  V++   R SVAY +GP  NV+I+P 
Sbjct  258   WVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVNRTRQRFSVAYLYGPPTNVQISPQ  317

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDV  1201
             +KL+ PT   +YR ++WN YL  K K F KAL  +  +S +
Sbjct  318   VKLVGPTRPVLYRSVTWNEYLGTKAKLFNKALSAVRLSSSI  358



>ref|XP_003527798.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN16493.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=347

 Score =   281 bits (718),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/335 (44%), Positives = 203/335 (61%), Gaps = 19/335 (6%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWL------DDHSPVNSSSTQES-VPVIDLYDPQAVNKIKIACE  370
             IIP+DF+ A  LP SH W       DD+   N  ++  S +P+IDL DP A+ +I  ACE
Sbjct  19    IIPLDFSSAHSLPDSHAWSHSQPNDDDYVSFNDDASSSSFIPIIDLMDPNAMEQIGHACE  78

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
              WG FQ+ NHGIP  ++  +EE+ +R F L  EQKL+A RSPG  TGYG  RIS FF   
Sbjct  79    KWGAFQLKNHGIPFCVIEDVEEEAKRLFALPTEQKLKALRSPGGATGYGRARISPFFPKF  138

Query  551   MWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*  718
             MW EGFT+ GSP   A++    D++ FC ++E+Y+ QM+ LA+ L  +MF   +  I   
Sbjct  139   MWHEGFTIIGSPSHDAKKIWPNDHAGFCDLMENYEKQMKVLAERLTQMMFS--LMDISEE  196

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
             +   VG       +Q+N+ P CP+P RAMG A HTDTSL T+L+Q S ITGLQ++     
Sbjct  197   KTKWVGASNISGAVQLNFYPSCPEPNRAMGLAPHTDTSLFTILHQ-SRITGLQIFKEGKE  255

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P+ N +VV+ GDL+ IISN  F+S LHR  V+    R SVAYF+ P  +  ++P 
Sbjct  256   WVPVHPHPNTLVVHTGDLLHIISNARFRSALHRVTVNSTRERYSVAYFYSPPLDYVVSPL  315

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +  +       +R ++   Y+ IK K FG+AL +I
Sbjct  316   VDSVA-----RFRDVTVKEYIGIKAKNFGEALSLI  345



>ref|XP_006356177.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Solanum tuberosum]
Length=372

 Score =   281 bits (718),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/357 (43%), Positives = 209/357 (59%), Gaps = 23/357 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDL-----YDPQAVNKIKIACETWG  379
              D N   +LP SH W   +DH    +S   ES+PVIDL      +   ++ I  AC+ WG
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNILDHIGHACKKWG  77

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
              FQ+ NH I   LL  ++   +  F L  +QKL+A RSP  VTGYG+ RIS FF   MW+
Sbjct  78    AFQIINHSISERLLQDIDVAGKTLFSLPMQQKLKAARSPDGVTGYGVARISSFFSKLMWS  137

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSP+EHARQ    DY  FC V+E+Y+ +M  LA  L  L+   +      + W 
Sbjct  138   EGFTIVGSPIEHARQLWPKDYKKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKWA  197

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                    +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY     
Sbjct  198   VGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGNG  256

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  HR+SVAY +GP   V ++P 
Sbjct  257   WVTVPPIPGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPL  316

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI-------GFNSDVEKSNALASG  1228
              KL+     P+YR ++W+ YL  K KYF KAL  +       GF +D +  N +  G
Sbjct  317   SKLLDHRHPPLYRAVTWSEYLGTKAKYFDKALSSVRLCVPLSGF-ADAKDHNGVQVG  372



>ref|XP_006305164.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
 gb|EOA38062.1| hypothetical protein CARUB_v10009532mg [Capsella rubella]
Length=362

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/335 (44%), Positives = 207/335 (62%), Gaps = 17/335 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DD------HSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWG  379
             DF    +LP S+ W   DD       +P   ++  E++P IDL  P A N+I  AC TWG
Sbjct  24    DFTSLRELPDSYSWTPKDDILFAAAAAPSPPTAVDETIPFIDLDHPDAANQIGHACRTWG  83

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
              FQ+ NHG+P+ LL  +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ QMW+
Sbjct  84    AFQIANHGVPLRLLQDIEFLTGSLFGLPVQRKLKAARSETGVSGYGVARIASFFNKQMWS  143

Query  560   EGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSPL   R    Q + ++C +VE+Y+ +M+ LA  L  L    +      + W 
Sbjct  144   EGFTITGSPLNDFRKLWPQLHLNYCDIVEEYEERMKKLASKLMWLALSSLGVSEEDVQWA  203

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                     W QA LQ+N  P+CP P RAMG A HTD++L+T+LYQ +N  GLQV+  +L 
Sbjct  204   SLNSDS-NWAQAALQLNHYPVCPQPDRAMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDLG  261

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P   ++VVN+GDL  I+SNG+FKSVLHRA V++   R+SVA+ +GP  +++I+P 
Sbjct  262   WVTVPPVPGSLVVNVGDLFHILSNGLFKSVLHRARVNQTRARLSVAFLWGPQSDIKISPV  321

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              KL+ P + P+YR ++W  YL  K  +F KAL MI
Sbjct  322   PKLVSPVDTPLYRSVTWTEYLQTKATHFNKALSMI  356



>ref|XP_007150692.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
 gb|ESW22686.1| hypothetical protein PHAVU_005G173500g [Phaseolus vulgaris]
Length=365

 Score =   280 bits (716),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 149/340 (44%), Positives = 203/340 (60%), Gaps = 15/340 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSST--QESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             D N   +LP S+ W  ++D +  + S+    E VPVIDL DP A   I  AC +WG++QV
Sbjct  21    DLNSLQELPESYTWTQMEDQANNHPSNCGLNEGVPVIDLNDPNAPKLIGHACISWGVYQV  80

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGIP  LL  ++      F L    K RA RSP  V GYG+ RIS FF   MW+EGFT
Sbjct  81    VNHGIPFTLLDEIQCLGETLFSLPSHHKHRAARSPDGVDGYGLARISSFFPKLMWSEGFT  140

Query  572   VAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGM  730
             + GSPLE  RQ    DY+ +C  V  Y   M+ LA+ L  LM + +      + W   G 
Sbjct  141   IVGSPLERFRQLWPQDYNKYCDTVMQYDETMKKLAEKLMWLMLESLGITKEDLKW--AGA  198

Query  731   VG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
              G  + T A LQ+N  P CPDP RAMG A HTD++L+T+LYQ +NI+GLQV+     W+ 
Sbjct  199   KGQFKNTCAALQLNSYPTCPDPDRAMGLAAHTDSTLLTILYQ-NNISGLQVHRKGTGWVT  257

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P    +V+N+GDL+ I+SNG++ SVLHR +V++   R+SVAY  GP  NV I P  KL
Sbjct  258   VPPVPGGLVINVGDLLHILSNGLYPSVLHRVLVNRVQQRLSVAYLCGPPPNVSICPHEKL  317

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEK  1207
             + P +  +Y+ ++WN YL  K K+F KAL  +  +S + +
Sbjct  318   VGPNQPRLYKSVTWNEYLGTKAKHFNKALSTVLVSSAISE  357



>ref|XP_011019738.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Populus euphratica]
Length=342

 Score =   279 bits (714),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/329 (45%), Positives = 201/329 (61%), Gaps = 11/329 (3%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             I+P+DF+    LP SH+W    S    S  + S+P +DL DP A   I  AC+ WG FQV
Sbjct  18    IVPLDFDSVRTLPDSHVW-PPTSHAFESEDRLSIPSVDLKDPDAGELIGHACKAWGAFQV  76

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             TNH IP+ L   +E + RR F L   QKL+A RSPG  TGYG+ RIS FF+  MW EGFT
Sbjct  77    TNHDIPLDLFHEVESEARRLFSLPTGQKLKALRSPGGATGYGLARISPFFNKYMWHEGFT  136

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCGMVG  736
             + GS ++HAR     DY  FC V+EDYQ +M++LA  L  L+ K + I      R    G
Sbjct  137   IMGSSIDHARDLWPNDYQRFCDVMEDYQKKMKELAITLMHLVLKSLDISEEEISRVVSAG  196

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
                T   LQ+N  P+CPDP RAMG A HTDTSL+T+L+Q S + GLQ++   + W+ V P
Sbjct  197   GDSTA--LQLNSYPLCPDPNRAMGLAPHTDTSLLTILHQ-STVNGLQIFKEGVGWVLVSP  253

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
              + ++VVN+GDL+ I+SN  F SVLHR ++ +   R+S+AYF+    +  I+P    +  
Sbjct  254   TNGSLVVNVGDLLHILSNAQFPSVLHRVVMKENQQRLSLAYFYCLPSDFHISP--LALNS  311

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             T+ P+YR +S   Y+ IK K   KAL +I
Sbjct  312   TQMPLYRSVSVRDYIGIKAKNLEKALSLI  340



>ref|XP_002515599.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
 gb|EEF47048.1| gibberellin 3-beta hydroxylase, putative [Ricinus communis]
Length=345

 Score =   278 bits (712),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 150/334 (45%), Positives = 200/334 (60%), Gaps = 10/334 (3%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWG  379
              +  IIP+DF+    LP SH+W  +      +  Q S+P IDL DP A N I  ACETWG
Sbjct  14    HLHQIIPLDFDSIRTLPESHVW-PESGEFEFNDGQLSIPTIDLNDPDAGNLIGHACETWG  72

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             +FQV +H IP+ LL  +E +TRR F L   QKL+A RS G   GYG  RIS FF+  MW 
Sbjct  73    VFQVIHHNIPLNLLHEVESETRRLFSLPARQKLKALRSAGGAVGYGRARISHFFNKHMWH  132

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  727
             EGFT+ GSP++HARQ    DY  FC V+E Y+ +M++LA  L  ++FK +   I   +  
Sbjct  133   EGFTIMGSPVDHARQLWPHDYQRFCDVMEGYEKKMKELATTLMRVIFKYL--GISEEQTK  190

Query  728   MVGL-QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
              VG    + A LQ+N  P CPDP RAMG A HTDTS +T+L+Q+S   GLQ++   + W+
Sbjct  191   WVGSPGCSSAALQLNSYPYCPDPNRAMGLAPHTDTSFLTILHQSST-KGLQIFKEGVGWV  249

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKA-HHRISVAYFFGPSKNVEIAPSL  1081
              V P S A+VVN+GD + I+SN  F +VLHR I+ +    R SVA+F  PS +  + P  
Sbjct  250   LVYPTSGALVVNVGDFLHILSNARFPNVLHRVIMKECKQQRFSVAFFHCPSTDFSLFPLG  309

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                   EFP+YR +S   Y+ IK K     L +I
Sbjct  310   LSSSCGEFPLYRSVSAAEYIGIKAKNIDNPLALI  343



>ref|NP_001233848.1| 3b-hydroxylase [Solanum lycopersicum]
 dbj|BAA34124.1| 3b-hydroxylase [Solanum lycopersicum]
Length=373

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 201/336 (60%), Gaps = 16/336 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDL------YDPQAVNKIKIACETW  376
              D N   +LP SH W   +DH    +S   ES+PVIDL       +   ++ I  AC+ W
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNNILDHIGHACKKW  77

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G FQ+ NH I   LL  +E   +  F L  +QKL+A RSP  VTGYG  RIS FF   MW
Sbjct  78    GAFQIINHSISEKLLQDIEVAGKTLFSLPMQQKLKAARSPDGVTGYGAARISSFFSKLMW  137

Query  557   TEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
             +EGFT+ GSP+EHARQ    DY+ FC V+E+Y+ +M  LA  L  L+   +      + W
Sbjct  138   SEGFTIVGSPIEHARQLWPKDYNKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKW  197

Query  716   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
                     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY    
Sbjct  198   AVGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGN  256

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  +R+SVAY +GP   V ++P
Sbjct  257   GWITVPPIPGALVVNIGDLLHILSNGSYPSVLHRAVVNRTRYRLSVAYLYGPPSGVRVSP  316

Query  1076  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               KL+     P+YR ++W+ YL  K KYF KAL  +
Sbjct  317   LSKLVDHRHPPLYRAVTWSEYLGTKAKYFDKALSSV  352



>ref|XP_009400517.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=370

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 147/344 (43%), Positives = 202/344 (59%), Gaps = 22/344 (6%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDL--YDPQAVNKIKIACETWGIFQV  391
             P+DF    ++P SH W D H    +S+    VPVIDL       + ++  ACE+WG FQV
Sbjct  17    PLDFESVREVPDSHAWPDLHDHPTASAQGAVVPVIDLSATATNVLEQLARACESWGAFQV  76

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             T HG+P  LL R+E   R  F L   +KL A R    V+GYG  RIS FF   MW+EGFT
Sbjct  77    TGHGVPPGLLRRVEAAARGVFALPTNRKLEAARPADGVSGYGRARISCFFPKLMWSEGFT  136

Query  572   VAGSPLEHARQDYSD-----FCSVVEDYQAQMRDLAQNLAALMFK*I----IRPICW*RC  724
             +AGSP++HAR  + D     FC V+E+Y+ +M+ LA+ L  +M   +             
Sbjct  137   IAGSPVDHARTLWPDDDALAFCDVIEEYKEEMKQLARKLMRMMLMSLGLTEAEAEAETET  196

Query  725   GMVG----LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQ--TSNITGLQVYG  886
             G +G         A LQ+N  P+CPDP RAMG A HTD++L+TLL+Q  TS +  LQV G
Sbjct  197   GWIGPGDEAGGMSAVLQLNSYPVCPDPDRAMGMAAHTDSTLLTLLFQSNTSGLQVLQVVG  256

Query  887   PN-----LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1051
                      W+ V P   A++VN+GDL QI+SNG ++SV+HRA+V++  HR+SVAY  GP
Sbjct  257   DTGRDRAARWVTVPPMPGALIVNVGDLFQILSNGRYRSVIHRAVVNRTSHRVSVAYMCGP  316

Query  1052  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                 ++ P +KL+ P   P+YRP++W  YL +K K F KAL  +
Sbjct  317   PAASKVEPIVKLVGPGSGPVYRPVTWPEYLSVKGKLFDKALASV  360



>gb|KHN47796.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=375

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 203/341 (60%), Gaps = 18/341 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL----DDHSPVNSSS---TQESVPVIDLYDPQAVNKIKIACETWGI  382
             DFN   +LP S+ W     DDH   N  S   T+  VP+IDL DP A N I  AC+TWG+
Sbjct  21    DFNSLQELPDSYAWTQPDDDDHRLTNYPSNNKTKTVVPIIDLNDPNAPNLIGHACKTWGV  80

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQV NH IP++L + ++  +   F L   QKL+A RSP  V+GYG  RIS FF   MW+E
Sbjct  81    FQVVNHDIPMSLFSDIQRASLALFSLPLHQKLKAARSPDGVSGYGRARISSFFPKLMWSE  140

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP---ICW*R  721
              FT+  SPL+       QDY+ +C +V +Y+A M+ LA  L  LM   +  P   I W  
Sbjct  141   CFTILDSPLDLFLKLWPQDYAKYCDIVVEYEAAMKKLAAKLMCLMLASLGIPKEDIKW--  198

Query  722   CGMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
              G  G      A L  N  P CPDP RAMG A HTD++L+T+L+Q +N+ GLQV      
Sbjct  199   AGPKGEFNGACAALHWNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVNGLQVLKEGEG  257

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P    +V+N+GDL+ I+SNG++ SVLHR  V++   R SVAY +GP  NV+I+P 
Sbjct  258   WVAVPPLPGGLVINVGDLLHILSNGLYPSVLHRVRVNRTRQRFSVAYLYGPPTNVQISPQ  317

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDV  1201
             +KL+ PT   +YR ++WN YL  K K F KAL  +  +S +
Sbjct  318   VKLVGPTRPVLYRSVTWNEYLGTKAKLFNKALSAVRLSSSI  358



>ref|XP_009409327.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Musa acuminata 
subsp. malaccensis]
Length=376

 Score =   278 bits (712),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 153/358 (43%), Positives = 204/358 (57%), Gaps = 45/358 (13%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
              +F    ++P SH W  ++DH         ++VPVIDL  P A   I  ACE WG FQ+T
Sbjct  16    FEFKTLTEVPDSHAWPVVNDHP-----HGDDAVPVIDLACPDAARLIGQACEEWGAFQIT  70

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
              HG+PV LL R+E QTRR F L   QKL+A RSPG VTGYGI  IS FF    W+EGFT+
Sbjct  71    GHGVPVDLLDRLEAQTRRLFSLPTGQKLKAARSPGGVTGYGIANISAFFSKLFWSEGFTI  130

Query  575   AGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGLQ  742
              GSP + AR+    D ++FC  +E+Y + M+ L   L  LM               +GL 
Sbjct  131   VGSPHDEARKLWPDDSAEFCGAIEEYTSWMKPLGCRLMLLML------------ASLGLS  178

Query  743   -----WT-----------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGL  874
                  W               +Q+N  P CPDP RAMG A+HTD+SL T+LYQ S + GL
Sbjct  179   EGEIDWAVPSNDTTHEAPAPVIQLNSYPACPDPDRAMGLAEHTDSSLFTVLYQGS-VRGL  237

Query  875   QVYGPN-----LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAY  1039
             Q+   N       W+ V P   A+VVN+GDL  I+SNG F+SV HRAIV++   RISVAY
Sbjct  238   QLLHGNHPTRRARWVTVPPLPGALVVNVGDLSHILSNGRFQSVTHRAIVNRTQTRISVAY  297

Query  1040  FFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSN  1213
             F+GP  + +IAP  KL+ P + P YR ++W  YL +K + + +AL  I   ++ E+ +
Sbjct  298   FYGPPAHFKIAPIEKLMGPQQGPAYRAVTWPEYLTLKRRLYNQALASIRLPTEGEEES  355



>ref|XP_002282411.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Vitis vinifera]
 emb|CBI20992.3| unnamed protein product [Vitis vinifera]
Length=355

 Score =   278 bits (710),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 208/339 (61%), Gaps = 13/339 (4%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQE--SVPVIDLYDPQAVNKIKIACET  373
             ++ IIP+DF     LP SH+W   D  P  ++   E  S+P+IDL DP A   +  ACE 
Sbjct  16    LNHIIPLDFTSVHSLPESHVWPAFDGFPFGTTYPGEKFSIPIIDLMDPNAAQLVGHACEK  75

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG FQ+T+HG+P  L   +E QTRR F L   +K++A R P   TGYG  RIS F+   M
Sbjct  76    WGAFQLTSHGLPSILTDDVESQTRRLFALPAHEKMKALRLPSGGTGYGQARISPFYPKFM  135

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+ GS ++HAR+    DY  FC V+EDYQ +M++LA++L  +  + +       R
Sbjct  136   WHEGFTIMGSAVDHARKLWPDDYKGFCDVMEDYQKKMKELAESLLHIFLESLDISKEEYR  195

Query  722   CGMV--GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
                +  G +     LQ+N  P CPDP RAMG A HTD+ L T+++Q S+ +GLQ+    +
Sbjct  196   STTIQRGREACNTALQLNSYPPCPDPNRAMGLAPHTDSLLFTIVHQ-SHTSGLQILRDGV  254

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++A HRIS+AYF+GP  +  I+P
Sbjct  255   GWITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPPADSLISP  314

Query  1076  SLKLIKPTE---FPMYRPISWNAYLDIKYKYFGKALEMI  1183
                L+   +    P YR +S   Y+D+K K+  KAL ++
Sbjct  315   LCNLVSSGQQVVAPRYRSVSVKEYVDLKEKHKEKALSLL  353



>gb|AGQ42610.1| GA3ox2 [Vitis vinifera]
Length=355

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 208/339 (61%), Gaps = 13/339 (4%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQE--SVPVIDLYDPQAVNKIKIACET  373
             ++ IIP+DF     LP SH+W   D  P  ++   E  S+P+IDL DP A   +  ACE 
Sbjct  16    LNHIIPLDFTSVHSLPESHVWPAFDGFPFGTTYPGEKFSIPIIDLMDPNAAQLVGHACEK  75

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG FQ+T+HG+P  L   +E QTRR F L   +K++A R P   TGYG  RIS F+   M
Sbjct  76    WGAFQLTSHGLPSILTDDVESQTRRLFALPAHEKMKALRLPSGGTGYGQARISPFYPKFM  135

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+ GS ++HAR+    DY  FC V+EDYQ +M++LA++L  +  + +       R
Sbjct  136   WHEGFTIMGSAVDHARKLWPDDYKGFCDVMEDYQKKMKELAESLLHIFLESLDISKEEYR  195

Query  722   CGMV--GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
                +  G +     LQ+N  P CPDP RAMG A HTD+ L T+++Q S+ +GLQ+    +
Sbjct  196   STTIQRGHKACNTALQLNSYPPCPDPNRAMGLAPHTDSLLFTIVHQ-SHTSGLQILRDGV  254

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++A HRIS+AYF+GP  +  I+P
Sbjct  255   GWITVFPLEGALVVNVGDLLHILSNGRYPSVLHRAVVNQAEHRISLAYFYGPPADSLISP  314

Query  1076  SLKLIKPTE---FPMYRPISWNAYLDIKYKYFGKALEMI  1183
                L+   +    P YR +S   Y+D+K K+  KAL ++
Sbjct  315   LCNLVSSGQQVVAPRYRSVSVKEYVDLKEKHKEKALSLL  353



>ref|NP_001275108.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
 gb|AAK91507.1| gibberellin 3-beta-hydroxylase 1 [Solanum tuberosum]
Length=373

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 200/336 (60%), Gaps = 16/336 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDL------YDPQAVNKIKIACETW  376
              D N   +LP SH W   +DH    +S   ES+PVIDL       +   ++ I  AC+ W
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNNILDHIGHACKKW  77

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G FQ+ NH I   LL  +E   +  F L  +QKL+A RSP  VTGYG  RIS FF   MW
Sbjct  78    GAFQIINHSISEKLLQDIEVAGKTLFSLPMQQKLKAARSPDGVTGYGAARISSFFSKLMW  137

Query  557   TEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
              EGFT+ GSP+EHARQ    DY+ FC V+E+Y+ +M  LA  L  L+   +      + W
Sbjct  138   FEGFTIVGSPIEHARQLWLKDYNKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDDVKW  197

Query  716   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
                     +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY    
Sbjct  198   AVGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGN  256

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              WI V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  +R+SVAY +GP   V ++P
Sbjct  257   GWITVPPIPGALVVNIGDLLHILSNGSYPSVLHRAVVNRTRYRLSVAYLYGPPSGVRVSP  316

Query  1076  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               KL+     P+YR ++W+ YL  K KYF KAL  +
Sbjct  317   LSKLVDHRHPPLYRAVTWSEYLGTKAKYFDKALSSV  352



>ref|XP_010537953.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Tarenaya hassleriana]
Length=335

 Score =   276 bits (707),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 141/328 (43%), Positives = 199/328 (61%), Gaps = 13/328 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHG  403
             D      LP S+ W     P  SS+ +ES+PVIDL D   V +I  ACETWG FQ+ NHG
Sbjct  6     DLRNLKTLPESYKW----KPTTSSNDRESIPVIDLADSDVVTRIGNACETWGAFQIANHG  61

Query  404   IPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT-VAG  580
             IP  LL  +E  +   F L  EQKL        + GYG  RI+ FFDS+MW+EGFT VAG
Sbjct  62    IPSKLLDDVESLSSSLFGLPTEQKLETATQKNGIGGYGEARIAPFFDSKMWSEGFTIVAG  121

Query  581   SPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMVGL  739
             S  +H       DY  +C ++E+Y+ +M+ LA  L  L+   I      I W      GL
Sbjct  122   SYRQHFPTLWPHDYDKYCGIIEEYEEEMQKLAGKLMGLILGSIGVTEEDIKWTGPNNSGL  181

Query  740   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  919
                   +++N  P+CP+P +AMG A HTD+++VT+L+Q +N  GLQ++     W+ V+P 
Sbjct  182   GSGSGAIRLNHYPVCPEPDQAMGLAAHTDSTMVTILHQ-NNAAGLQMFKEGTGWVLVKPV  240

Query  920   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1099
                +VVN+GDL+ I+SNG  +S LH+A+V+K   R S+AY +GPS +++I+P  KL+ P 
Sbjct  241   PGLLVVNVGDLLHILSNGKLRSSLHQALVNKNKSRFSIAYLWGPSGDIDISPISKLVSPI  300

Query  1100  EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             E  MYRP++W  YL++K ++F KAL MI
Sbjct  301   EPAMYRPVTWKEYLEMKARHFDKALSMI  328



>emb|CAC83089.1| gibberellin 3-oxidase [Cucurbita maxima]
Length=377

 Score =   278 bits (710),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 145/348 (42%), Positives = 202/348 (58%), Gaps = 40/348 (11%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-------DHSPVNS--SSTQESVPVIDLYDPQAVNKIKIACET  373
             +DF+   +LP S+ W+         H   NS   S  +SVP+IDL  P A   I  A  +
Sbjct  22    LDFDSLHELPDSYAWIQPDSFPSPTHKHHNSILDSDSDSVPLIDLSLPNAAALIGNAFRS  81

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG FQV NHG+P++LL  +E      F L P  KL+A R+P  ++GYG+ RIS FF  +M
Sbjct  82    WGAFQVINHGVPISLLQSIESSADTLFSLPPSHKLKAARTPDGISGYGLVRISSFFPKRM  141

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W+EGFT+ GSPL+H RQ    DY   C +VE+Y  +MR L   L             W  
Sbjct  142   WSEGFTIVGSPLDHFRQLWPHDYHKHCEIVEEYDREMRSLCGRL------------MWLG  189

Query  722   CGMVG-----LQW---------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTS  859
              G +G     ++W         + A  Q N  P+CPDP RAMG   HTDTSL+T++YQ S
Sbjct  190   LGELGITRDDMKWAGPDGDFKTSPAATQFNSYPVCPDPDRAMGLGPHTDTSLLTIVYQ-S  248

Query  860   NITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAY  1039
             N  GLQV      W+ VEP +  +VV +GDL+ I++NG++ S LH+A+V++   R+SVAY
Sbjct  249   NTRGLQVLREGKRWVTVEPVAGGLVVQVGDLLHILTNGLYPSALHQAVVNRTRKRLSVAY  308

Query  1040  FFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              FGP ++ EI+P  KL+ PT+ P+YRP++W  YL  K ++F  AL  +
Sbjct  309   VFGPPESAEISPLKKLLGPTQPPLYRPVTWTEYLGKKAEHFNNALSTV  356



>gb|KDP32294.1| hypothetical protein JCGZ_13219 [Jatropha curcas]
Length=350

 Score =   276 bits (706),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 152/341 (45%), Positives = 201/341 (59%), Gaps = 19/341 (6%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWG  379
              +  IIP+DF+    +P SH+W +     ++     S+P IDL DP     I  ACETWG
Sbjct  14    HLHQIIPLDFDSVRAVPDSHVWPESGELESNDHHWLSIPTIDLNDPDRAKLIGHACETWG  73

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             +FQ+TNH IP+ LL  +E + +R F L   QKL+A RSPG   GYGI RIS FF+  MW 
Sbjct  74    VFQLTNHNIPLNLLNEVEFEIKRLFSLPARQKLKALRSPGGAIGYGIARISPFFNKYMWH  133

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*  718
             EGFT+ GSP++HA Q     Y  FC V+EDYQ +M +LA  L  L+ + I        W 
Sbjct  134   EGFTIMGSPVDHAMQLWPNGYQRFCDVMEDYQKKMEELATTLIHLILQNISMSEEETKW-  192

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
               G  G   +   LQ+N  P CPDP RAMG A HTDTSL+T+L+Q S I+GLQ++     
Sbjct  193   -LGSPG--GSSTALQLNSYPNCPDPHRAMGLAPHTDTSLLTILHQ-STISGLQIFKEGFG  248

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P + A+VVN+GDL+ I+SNG F SVLHR I+ +   R SVA+F+ P  +  + P 
Sbjct  249   WVLVYPTNGALVVNIGDLLHILSNGRFISVLHRVIMKEPKQRFSVAFFYCPRTDFHVFP-  307

Query  1079  LKLIKPTE------FPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L L    E       P+YR +S   Y+ IK K   KAL +I
Sbjct  308   LGLSSGDEDDDHGQVPLYRSVSVAEYVGIKSKNLDKALSLI  348



>dbj|BAD30036.1| gibberellin 3beta-hydroxylase2 [Daucus carota]
Length=353

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 204/330 (62%), Gaps = 16/330 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDP-QAVNKIKIACETWGIFQ  388
             +D N  ++LP SH W   LD  S       + ++PVIDL D       +  AC+TWG FQ
Sbjct  23    LDLNSLEELPDSHAWSSELDKLSSSPDDHGESNLPVIDLSDSINGPKHLVHACKTWGAFQ  82

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHGI   L+  ME  TR+ F L  EQKL+A+R  G   GYG  RIS FF  +MW+EGF
Sbjct  83    LINHGISNQLIDSMEAATRKLFSLPIEQKLKAERQEGGC-GYGPFRISSFFPKRMWSEGF  141

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPL+HAR    +DYS FC V E+YQ +M+ LA  +  +M + +      I W   G
Sbjct  142   TIVGSPLQHARLLWPEDYSVFCDVTEEYQKEMKKLAGKIMWIMLEALGITKEDIIW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  + + A LQ+N  P+CPDP RAMG A HTD++L+++L+Q SN +GLQV+   + W+
Sbjct  200   PNGEFEASGAALQLNSYPVCPDPDRAMGLADHTDSTLLSILHQ-SNQSGLQVFQEEMGWV  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL+ I++NG + SVLHR  V++  HR S+AY +GP  + EI+P  K
Sbjct  259   TVPPVEGALVVNIGDLLHILTNGSYPSVLHRVTVNRERHRYSMAYLYGPPHSAEISPLSK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKAL  1174
             L+     P+YRP++W+ YL +K   F  AL
Sbjct  319   LVDHQHPPLYRPVTWSEYLGMKAILFYNAL  348



>gb|ACN89835.1| gibberellin 3-oxidase [Solanum tuberosum subsp. andigenum]
Length=372

 Score =   275 bits (704),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 150/357 (42%), Positives = 207/357 (58%), Gaps = 23/357 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDL-----YDPQAVNKIKIACETWG  379
              D N   +LP SH W   +DH    +S   ES+PVIDL      +   ++ I  AC+ WG
Sbjct  18    FDLNSIKELPESHAWTSSNDHYTQENSCNFESIPVIDLDNNNNNNNNILDHIGHACKKWG  77

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
              FQ+ NH I   LL  ++   +  F L  +QKL+A RSP  VTGYG  +IS  F   MW+
Sbjct  78    AFQIINHSISERLLQDIDVAGKTLFSLPMQQKLKAARSPDGVTGYGAAQISSLFSKLMWS  137

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*  718
             EGFT+ GSP+EHARQ    DY  FC V+E+Y+ +M  LA  L  L+   +      + W 
Sbjct  138   EGFTIVGSPIEHARQLWPKDYKKFCEVIEEYEKEMEKLAGRLMWLILGSLGITKDEVKWA  197

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                    +   A LQ+N  P CPDP RAMG A HTD++++T+L+Q +N +GLQVY     
Sbjct  198   VGPKGETKEGCAALQLNSYPACPDPGRAMGLAAHTDSTILTILHQ-NNTSGLQVYQEGNG  256

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             W+ V P   A+VVN+GDL+ I+SNG + SVLHRA+V++  HR+SVAY +GP   V ++P 
Sbjct  257   WVTVPPIPGALVVNVGDLLHILSNGSYPSVLHRAVVNRTRHRLSVAYLYGPPTGVRVSPL  316

Query  1079  LKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI-------GFNSDVEKSNALASG  1228
              KL+     P+YR ++W+ YL  K KYF KAL  +       GF +D +  N +  G
Sbjct  317   SKLLDHRHPPLYRAVTWSEYLGTKAKYFDKALSSVRLCVPLSGF-ADAKDHNGVQVG  372



>ref|XP_010051203.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81486.1| hypothetical protein EUGRSUZ_C02844 [Eucalyptus grandis]
Length=355

 Score =   273 bits (698),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 203/343 (59%), Gaps = 19/343 (6%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW--LDDHSP---VNSSSTQESVPVIDLYDPQAVNKIKIA  364
              +  IIP+DF+   ++P SH W   DD SP    N      S+P IDL  P A+     A
Sbjct  14    HLQHIIPIDFDSVKEVPQSHSWPQSDDESPRRMFNFDGDHFSIPAIDLDSPDAIEMAGHA  73

Query  365   CETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFD  544
             C+  GIFQVTNHGIP +LL  +E Q  RFF L    K++A RSP   TGYG+ RI+ FF+
Sbjct  74    CKIMGIFQVTNHGIPSSLLREVESQAWRFFTLPARAKVKALRSPSGATGYGVARIAPFFN  133

Query  545   SQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  703
               MW EGFT+ GSPLEHAR+     Y  FC V+EDYQ +M+ L++ L A++ K +     
Sbjct  134   KFMWHEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGMSEH  193

Query  704   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
              + W R            LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+
Sbjct  194   DVDWPRLRSNAC----TALQLNSYPRCPDPRQAMGLAPHTDTFLLTILHQNHSAHGLQVH  249

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  W+ V P + A+VVN+GD++ I+SN MF SV+HRAI S+  HR++V YF+GP  + 
Sbjct  250   REGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRAIPSENTHRLTVGYFYGPPTDF  309

Query  1064  EIAPSLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              + P  +L + +   +   +R ++   Y+ +K K   KAL MI
Sbjct  310   HVGPIHRLTQASGREDAAQFRSVTVKDYIQMKAKNLDKALSMI  352



>gb|ABI64150.1| gibberellin 3-oxidase [Pisum sativum]
Length=349

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 203/331 (61%), Gaps = 15/331 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIW---LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGI  382
             IIP+DF+    LP SH W    DD+  + S+ +   +P+IDL DP A+ +I +ACE WG 
Sbjct  19    IIPLDFSSFRTLPDSHAWPQSKDDNDHLTSNGS--CIPIIDLNDPNAMEQIGLACEKWGA  76

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQ+ NHG+P+ L+  +EE+ ++ F L  ++K++A RS G  TGYG  RIS FF   MW E
Sbjct  77    FQLKNHGVPLNLIEEVEEEAKKLFSLPSKEKIKALRSAGGATGYGRARISPFFPKYMWHE  136

Query  563   GFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  730
             GFT+ GSP    ++    DY  FC ++EDYQ QM+ LA+ +  ++F   I  I   +   
Sbjct  137   GFTIMGSPSNDVKKIWPNDYEYFCDIMEDYQKQMKTLAEKITNIIFN--ILGISKEQNKW  194

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
             VG       LQ+N+ P CPDP +AMG A HTDTSL T+L+Q S  +GLQ++   + ++ V
Sbjct  195   VGSNNHCEALQLNFYPCCPDPKKAMGLAPHTDTSLFTILHQ-SQTSGLQIFKEGVGYVTV  253

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
             +P+ N +VVN GD++ I+SN  F+  LHRA+V+    R SVAYF+GP  +  ++P   L+
Sbjct  254   DPHPNTLVVNTGDILHILSNSRFRCSLHRAVVNDVKDRYSVAYFYGPPVDYLVSP---LV  310

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                  P +R +S   Y+ IK K  G AL +I
Sbjct  311   VDGSLPRFRSLSVKDYIGIKAKNLGGALSLI  341



>gb|KCW53766.1| hypothetical protein EUGRSUZ_J03019 [Eucalyptus grandis]
Length=349

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/340 (42%), Positives = 205/340 (60%), Gaps = 50/340 (15%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +DF+ A++LP S+ W +    P +   ++ES+P+IDL DP A+  I  AC++WG++QVTN
Sbjct  21    LDFSSAEELPDSYAWTELGEYPSSHCPSKESLPIIDLNDPNALKLIGHACKSWGVYQVTN  80

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP  LL  +E   +  F L  +QKL+A RSP  ++GYG+ +IS FF  QMW+EGFT+ 
Sbjct  81    HGIPEELLHDVERAAKNLFSLPVQQKLKASRSPEGISGYGVAKISAFFPKQMWSEGFTIM  140

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  739
             GSP+EHAR    QDYS FC V+E YQ +M+ LA+ L  LM             G +GL  
Sbjct  141   GSPMEHARRLWPQDYSLFCDVIEKYQKEMKQLAERLMWLML------------GSLGLTK  188

Query  740   ---QWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
                +W+          A LQ+N  P CPDP RAMG A HTD++L+T+L+Q +N +GLQV 
Sbjct  189   EDIKWSSPKGEFTGAVAALQLNSYPACPDPDRAMGLAAHTDSTLLTILHQ-NNTSGLQVL  247

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  WI V P    + V+               VLHRA+V++  HR+SVAY +GP   V
Sbjct  248   KEGSGWITVPP----LPVHF--------------VLHRAMVNRTEHRLSVAYLYGPPSWV  289

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +++P  +LI     P+Y+P++W+ YL  K K+F KAL ++
Sbjct  290   QVSPLPELIDSNHPPLYKPVTWSEYLGTKAKHFNKALSLV  329



>ref|XP_006829636.1| hypothetical protein AMTR_s00122p00090120 [Amborella trichopoda]
 gb|ERM97052.1| hypothetical protein AMTR_s00122p00090120 [Amborella trichopoda]
Length=369

 Score =   272 bits (696),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 196/329 (60%), Gaps = 21/329 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDP--QAVNKIKIACETWGIFQVT  394
             +DF     +P SH W +       SS  + +PVIDL  P      +I  AC +WG FQV 
Sbjct  17    VDFGSVKTVPESHAWQEPEGFSLESSDLDGIPVIDLSTPWWGVAREIGRACASWGAFQVV  76

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTV  574
             NHG+P  +L R+EEQ  R F L P+QKL+A+R P  + G+G PRI+ FF  +MWTEGFTV
Sbjct  77    NHGVPDNVLKRVEEQGWRLFSLPPDQKLKAERGPDEIAGFGAPRITHFFPKRMWTEGFTV  136

Query  575   AGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGLQ  742
              GSPLE AR+    D+  FC V+E+YQ++M+ L   L  L+ +       W   G   L 
Sbjct  137   FGSPLEQARRLWPHDHMQFCEVIEEYQSEMKSLTVKLLELILE-------WVGAGKEDLN  189

Query  743   W----TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY-GPNLNWID  907
             W    +    Q+N  P CP+P+RAMG A HTD+SL+T+++Q SN +GLQ+       W+ 
Sbjct  190   WEVGDSSGVTQLNSYPSCPEPSRAMGLAPHTDSSLLTVIHQ-SNTSGLQLLDASGQKWVT  248

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDL+ I+SNG  +S +HRA+V++ HHR+S AYF  PS    + P +  
Sbjct  249   VPPVHGALVVNIGDLLHILSNGRCRSSMHRAVVNRVHHRLSFAYFCFPSPGATVEPLIGP  308

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKAL  1174
              +PT   +YR ++W  YL IK   F  AL
Sbjct  309   DEPTA--LYRSVTWTEYLRIKGTLFNNAL  335



>ref|XP_006285095.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
 gb|EOA17993.1| hypothetical protein CARUB_v10006427mg [Capsella rubella]
Length=353

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 199/338 (59%), Gaps = 16/338 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W               +PVI+L DP     ++ ACE WG+F
Sbjct  16    DRIIPLDFTSTKTLPDSHVWSKTEPETKPKPVNLPIPVINLSDPDQHVLLRQACEEWGVF  75

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+P  LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  76    HITDHGVPGYLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  135

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             F+V GS L  HA      D++DFC+V+E+YQ  M DL+  L  ++   +      + W  
Sbjct  136   FSVLGSSLRRHATLLWPDDHADFCNVMEEYQKAMDDLSLRLITMLMGSLGITHEDLGWLV  195

Query  722   CGMVGLQWT--QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
                 G +    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P  
Sbjct  196   PDKTGSETNSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIQSPQE  254

Query  896   N---WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 WI VEP   ++V+ +GDL  IISNG+F++ +HRA+V+K HHR+S AYF GP KN++
Sbjct  255   EGPRWIGVEPIEGSLVIIMGDLSHIISNGLFRTTMHRAVVNKTHHRVSAAYFAGPPKNLQ  314

Query  1067  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             I P +        P+YR + W  YL  K  +F K L +
Sbjct  315   IGPLIG--DKNHPPIYRRLVWEEYLAAKATHFNKTLTL  350



>ref|XP_006366661.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 143/341 (42%), Positives = 203/341 (60%), Gaps = 17/341 (5%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
             Q +  I+P+DF+   ++P+SH+W D ++SP++      +VP+IDL  P  V  I  AC+T
Sbjct  16    QSLQHILPIDFHSIQEVPNSHLWPDINNSPISHDEKNPNVPMIDLLAPNVVELIGHACKT  75

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WGIFQV NHG+ + L   +E Q RR F L  EQK++  RS    TGYG  RI+ FF   M
Sbjct  76    WGIFQVVNHGVSLELFDEVESQARRLFALPAEQKVKVVRSTSGATGYGTARITPFFSKFM  135

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+  SPL+HA++    DY   C V+E+YQ +M+ L+  L  L+    ++P     
Sbjct  136   WHEGFTIMDSPLDHAKKLWPHDYQKICEVMENYQKKMKALSFQLWLLILN-YLQPSQ--E  192

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
               +   + T A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   N  W
Sbjct  193   HSIKSFESTGA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKNQVW  251

Query  902   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  252   TSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMIVP-  310

Query  1079  LKLIKPTE----FPMYRPISWNAYLDIKYKYFGKALEMIGF  1189
               L+   +     P YR +    YLD+K K+  K   MI F
Sbjct  311   --LVSSEDNVGAIPKYRNVKVKEYLDLKAKHLEKVFSMIRF  349



>ref|XP_008219863.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=344

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/334 (44%), Positives = 199/334 (60%), Gaps = 18/334 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLD--DHSPVNSSSTQE-SVPVIDLYDPQAVNKIKIACETWGI  382
             +IP+D+     LP SHIWLD  D SP  + ST   S PVI+L DP A   I  ACETWG+
Sbjct  17    LIPLDYGSVRTLPESHIWLDQSDESPYVAHSTGPISPPVINLMDPDAPRLIIQACETWGV  76

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             FQ+T HGIP  L+  +E +  + F L  +QKL+A RSPG   GYG+P IS FF+  MW E
Sbjct  77    FQLTGHGIPTKLMEDVESEAEKLFGLPVDQKLKALRSPGGGAGYGLPHISPFFNKHMWHE  136

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             GFT+ GSP+ H R    Q Y  FC  + DYQ Q++ L + L  ++FK +      + W  
Sbjct  137   GFTIMGSPIYHTRQLWPQAYQGFCETMVDYQNQLKALTEQLIRIIFKSLNINSEEVDW--  194

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
               +   Q +   LQ+N  P CPDPTRAMG A HTDTSL+T+L   S  +GLQV+     W
Sbjct  195   --LKDSQGSSTALQLNSYPACPDPTRAMGLAPHTDTSLITIL--QSKTSGLQVFKEGAGW  250

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
               V+    A++VN+GD + I+SNG+F +V HR +V+    R S A+F+ P  +V ++P +
Sbjct  251   TLVQSIPGAVIVNVGDFLHILSNGVFTTVRHRVVVTHI-QRFSAAHFYAPPGDVIVSPVM  309

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                   E P YR +S   Y++ K K+F KAL +I
Sbjct  310   SK-DFGEVPRYRSVSVKGYVETKGKHFEKALSLI  342



>ref|XP_010915137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Elaeis guineensis]
Length=350

 Score =   271 bits (694),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/337 (45%), Positives = 198/337 (59%), Gaps = 26/337 (8%)
 Frame = +2

Query  224   DFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +F    +LP SH W  L DH  V+     E VPVIDL DP+A   +  AC +WG FQVT 
Sbjct  17    EFESVRELPESHAWPTLHDHPCVS-----EPVPVIDLADPKAAEFMARACVSWGAFQVTG  71

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+   LL  ++ + RR F L  +QKL+A R P  ++GYG+  IS FF   MW+EGFT+A
Sbjct  72    HGVAPRLLEAIDSEMRRLFALPIQQKLKAARPPDGISGYGLVPISSFFAKLMWSEGFTIA  131

Query  578   GSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*II---RPICW*RCGMVG  736
             GSPL+HAR+    D   FC V+E Y   M+ LA  L  LM   +      + W   G  G
Sbjct  132   GSPLDHARKLWPHDPDQFCDVIERYDQVMKALAGRLITLMLLSLGLRHEELEW--AGQTG  189

Query  737   --LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY------GPN  892
               L      L++N  P CPDP RAMG A H D+SL+T+LYQ+S  +GLQ+       GP 
Sbjct  190   KLLPDLAGVLRLNSYPACPDPDRAMGMAAHADSSLLTILYQSST-SGLQLLRAEDQNGPA  248

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P   A+VV +GDL  I+SNG FKSV+HR +V+++  R+SVAYF GP   V ++
Sbjct  249   -RWVTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSVAYFSGPPAGVRVS  307

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P  KL+ P   P YR ++W  YL +K K F KAL  I
Sbjct  308   PIGKLVGPGRAPAYRAVTWAEYLGLKRKLFDKALATI  344



>ref|XP_003529820.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN01362.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=378

 Score =   272 bits (696),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 146/340 (43%), Positives = 202/340 (59%), Gaps = 16/340 (5%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL---DDHSP--VNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DFN   +LP S+ W    D H P   +++ T+  VPVIDL  P A N I  AC+TWG+FQ
Sbjct  21    DFNSLQELPDSYSWTQPHDHHLPNYPSNNKTKIFVPVIDLNHPNAPNLIGHACKTWGVFQ  80

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             V NH IP++L + ++  +   F L   QKL+A RSP  V+GYG  RIS FF   MW+E F
Sbjct  81    VVNHDIPMSLFSDIQRASLALFSLPLHQKLKAARSPDGVSGYGRARISSFFPKLMWSECF  140

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+  SPL+       QDY+ +C +V +Y+A M+ LA  L  LM   +        W   G
Sbjct  141   TILDSPLDLFLKLWPQDYAKYCDIVVEYEAAMKKLAAKLMCLMLASLGITKEDTKW--AG  198

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G      A L +N  P CPDP RAMG A HTD++L+T+L+Q +N+ GLQV      W+
Sbjct  199   PKGEFNGACAALHLNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVNGLQVLKEGEGWV  257

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P    +V+N+GDL+ I+SNG++ SVLHR  V++   R SVAY +GP  NV+I+P +K
Sbjct  258   AVPPLHGGLVINVGDLLHILSNGLYPSVLHRVRVNRTQQRFSVAYLYGPPANVQISPHVK  317

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVE  1204
             L+ PT   +YRP++WN YL  K   F KAL  +  ++ + 
Sbjct  318   LVGPTRPALYRPVTWNEYLGTKANLFNKALSAVRLSASIN  357



>ref|XP_006413746.1| hypothetical protein EUTSA_v10026853mg [Eutrema salsugineum]
 gb|ESQ55199.1| hypothetical protein EUTSA_v10026853mg [Eutrema salsugineum]
Length=354

 Score =   271 bits (693),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 145/341 (43%), Positives = 209/341 (61%), Gaps = 21/341 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W +    +    T   +P+I L +P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVWSEPEPVLEPEPTIRPIPIISLSNPEQV-LLRHACEEWGVF  74

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HGIP +LL  +  Q ++ F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  75    HITDHGIPHSLLQNVGCQMKKLFSLPMHRKILAIRSPDESTGYGVARISMFYDKLMWSEG  134

Query  566   FTVAGSPLE-HAR------QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
             F+V GS L+ HA+       D++DFC+V+E+YQ +M DL+  L +++   I      + W
Sbjct  135   FSVMGSSLQRHAKILWPDPDDHTDFCNVMEEYQKEMGDLSHRLVSMVMGTIGLTHEELRW  194

Query  716   *RCGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP  889
                 + G +    Q++LQ+N  P+C DP  AMG A HTD+SL+T+LYQ  NI+GL++  P
Sbjct  195   LEPDIAGTRTDSIQSFLQLNSYPVCSDPHLAMGLAPHTDSSLLTILYQ-GNISGLEIQNP  253

Query  890   ---NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1060
                   WI V+P  + +VV +GDL  IISNG FKS +HR +V+K HHR++ AYF GP KN
Sbjct  254   QEEESRWIGVDPIEDGLVVIMGDLSHIISNGRFKSTMHRVVVNKTHHRVTAAYFSGPPKN  313

Query  1061  VEIAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1180
             ++I P   LI   +  P+YR + W  YL  K  +F KAL +
Sbjct  314   LQIGP---LINDKDHPPIYRRLIWEEYLAAKATHFNKALTL  351



>ref|XP_006355748.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   271 bits (692),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 202/339 (60%), Gaps = 12/339 (4%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
             Q +  I+P+DF+   ++P+SH+W + ++SP+N      +VP+IDL  P  V  I  AC T
Sbjct  15    QSLQHILPIDFHLIQEVPNSHLWPNINNSPINHDEKNPNVPIIDLLAPNVVELIGHACRT  74

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
              GIFQV NHG+P+      E Q RR F L  EQK++  RS    TGYG  RI+ FF   M
Sbjct  75    LGIFQVVNHGVPLEFFDEAESQARRLFALPAEQKVKVVRSTSGATGYGTARITPFFSKFM  134

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+  SPL+HA++    DY +FC V+E+YQ +M+ L+  L  L+    ++P     
Sbjct  135   WHEGFTIMDSPLDHAKELWPHDYQEFCDVMENYQKKMKALSFQLWLLILN-YLQPSQ--E  191

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
               +   ++TQA LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W
Sbjct  192   HLINSFEFTQA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGW  250

Query  902   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  251   TSIAPISNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSTIVPL  310

Query  1079  LKLIKPTE--FPMYRPISWNAYLDIKYKYFGKALEMIGF  1189
             +   K      P YR +    YL +K K+  K   +I +
Sbjct  311   VSFEKNVGVVVPKYRKVKVKEYLSLKAKHLEKVFSLIRY  349



>ref|XP_010049018.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81481.1| hypothetical protein EUGRSUZ_C02840 [Eucalyptus grandis]
Length=355

 Score =   271 bits (692),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 202/343 (59%), Gaps = 19/343 (6%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW--LDDHSP---VNSSSTQESVPVIDLYDPQAVNKIKIA  364
              +  IIP+DF+  +++P SH W   DD SP    N      S+P IDL  P A+     A
Sbjct  14    HLQHIIPIDFDSVEEVPQSHSWPQSDDESPRRMFNLDGDHFSIPAIDLDSPDAIEMAGHA  73

Query  365   CETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFD  544
             C+  GIFQVTNHGIP +LL  +E Q  RFF L    K++A RSP   TGYG+ RI+ FF+
Sbjct  74    CKIMGIFQVTNHGIPSSLLREIESQAWRFFTLPARAKVKALRSPSGATGYGVARIAPFFN  133

Query  545   SQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  703
               MW EGFT+ GSPLEHAR+     Y  FC V+EDYQ +M+ L++ L A++ K +     
Sbjct  134   KFMWHEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGISEH  193

Query  704   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
              + W R            LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+
Sbjct  194   DVDWPRLRSNAC----TALQLNSYPRCPDPGQAMGLAPHTDTLLLTILHQNHSAHGLQVH  249

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  W+ V P + A+VVN+GD++ I+SN MF SV+HR I S+  HR++V YF+GP  + 
Sbjct  250   REGRGWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPPTDF  309

Query  1064  EIAPSLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              + P   L + +   +   +R I+   Y+ +K K   KAL MI
Sbjct  310   HVGPIHGLTQTSGQEDAARFRSITVKDYVQMKAKNLDKALSMI  352



>ref|XP_010537951.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like [Tarenaya hassleriana]
Length=367

 Score =   271 bits (692),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 144/357 (40%), Positives = 210/357 (59%), Gaps = 37/357 (10%)
 Frame = +2

Query  218   PMDFNKADQLPHSHIWLDDHSPVNSSST---QESVPVIDLYD-PQAVNKIKIACETWGIF  385
             P DF    +LP S  W      + S++T    +S+PV+DL D   A + +  AC TWG F
Sbjct  22    PHDFTSLCELPDSFTWTHKDDLLFSAATPDYADSLPVVDLSDHDSAASAVGHACMTWGAF  81

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QVTNHG+P+ LL  +E  +R  F+L P +K +A R    ++GYG+ RI+ FF  QMW+EG
Sbjct  82    QVTNHGVPLPLLDDIEFLSRSLFQLPPHRKFKAARPENGISGYGVARIASFFHKQMWSEG  141

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  733
             FT+AGSPL+H R+     +  +C+++++Y+ QM+ LA+ L             W   G +
Sbjct  142   FTLAGSPLDHFRKLWPRHHLRYCNIIKEYEEQMQKLARRL------------TWLVLGSL  189

Query  734   G-----LQWT---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITG  871
             G     ++W          QA +Q+N  P+CP+P RAMG A HTD++L+T+LYQ SN  G
Sbjct  190   GVTEGDIKWAGPNSDFNGAQAAIQLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQ-SNTAG  248

Query  872   LQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1051
             LQV+     W+ V P   ++VVN+GDL+ I+SNG   S LHR  V++   R SVAY +GP
Sbjct  249   LQVFKDGFGWLTVPPIPGSLVVNIGDLLHILSNGRLSSALHRVRVNQDRPRFSVAYLWGP  308

Query  1052  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDVEKSNALA  1222
               +V+I+P  KL+ P + P+YRP++W  YL  K  +F  AL  I    D  K+N + 
Sbjct  309   QADVQISPLPKLVSPVKPPLYRPVTWKEYLGTKATHFNNALSAI--RVDDNKNNVVG  363



>ref|XP_007227245.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
 gb|EMJ28444.1| hypothetical protein PRUPE_ppa018007mg [Prunus persica]
Length=344

 Score =   270 bits (690),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/336 (44%), Positives = 199/336 (59%), Gaps = 24/336 (7%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIWLD--DHSPVNSSSTQE-SVPVIDLYDPQAVNKIKIACETWGIF  385
             IP+D+     LP SHIWLD  D SP  + ST   S PVIDL DP A   I  ACETWG+F
Sbjct  18    IPLDYGSVRTLPESHIWLDQSDESPYVAHSTGPISPPVIDLMDPDAPRLIIQACETWGVF  77

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             Q+  HGIP  L+  +E +  + F L  +QKL+A RSPG   GYG+P IS FF+  MW EG
Sbjct  78    QLIGHGIPTKLMEDVESEAEKLFGLPVDQKLKALRSPGGGAGYGLPHISPFFNKHMWHEG  137

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FT+ GSP+ H R    Q Y  FC  + DYQ Q++ L + L  ++FK +      + W   
Sbjct  138   FTIMGSPIYHTRQLWPQAYQGFCETMVDYQNQLKALTEQLIRIIFKSLNINSEEVDW---  194

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
              +   Q +   LQ+N  P CPDPTRAMG A HTDTSL+T+L   S  +GLQV+     WI
Sbjct  195   -LKDSQGSSTALQLNSYPACPDPTRAMGLAPHTDTSLITIL--QSKTSGLQVFKEGAGWI  251

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V+P   A++VN+GD + I+SNG+F +V HR +V+    R S A+F+ P  +V ++P + 
Sbjct  252   LVQPIPGALIVNVGDFLHILSNGVFTTVRHRVVVTHI-QRFSAAHFYAPPGDVIVSPVMS  310

Query  1085  LIKPTEF---PMYRPISWNAYLDIKYKYFGKALEMI  1183
                  +F   P Y  +S   Y++ K K+F KAL +I
Sbjct  311   ----KDFGGVPRYHSVSVKGYVESKGKHFEKALSLI  342



>ref|NP_001274405.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28483.1| GA 3-oxidase [Cucumis sativus]
Length=353

 Score =   270 bits (691),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 198/337 (59%), Gaps = 17/337 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPV------NSSSTQESVPVIDLYDPQAVNKIKIACET  373
             I+P+DF+    +P SH W +           + ++   S+P+IDL DP A++ I  ACET
Sbjct  19    IVPLDFDSLRTIPDSHDWFNSSLETPSSSSHHHTNVNVSIPLIDLTDPNAISLIGNACET  78

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG+FQ+ NH +PV+L+ R E +TRR F+L   +KL+A R+PG VTGYG+PRI+ FF   M
Sbjct  79    WGVFQLINHDVPVSLIERAEGETRRLFDLPMTRKLKALRAPGDVTGYGLPRITPFFSKYM  138

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK--*IIRPICW  715
             W EGFT+ G  + HA Q    +Y  FC V+E+YQ +M+ LA+ +   +F    I     W
Sbjct  139   WHEGFTIMGPSIGHASQLWPSNYQPFCDVMEEYQRKMKSLAEQITRSIFNYLKISDGANW  198

Query  716   *R-CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  892
                 G          LQ+N  P CPDPTR MG A HTDT L+T+L+QT    GLQV+   
Sbjct  199   LHSAGSTEAAACSTALQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQTRT-CGLQVFRDG  257

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P   A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYF+GP  +  ++
Sbjct  258   FGWVPVAPVPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFYGPPPDFCVS  317

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P   L  P E P YR +    Y+ +K K    AL MI
Sbjct  318   P---LYDPPESPCYRSVMVKDYVRLKAKNLENALSMI  351



>ref|XP_009108486.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Brassica rapa]
Length=350

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 207/339 (61%), Gaps = 21/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W      +        +PVI +  P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW--SKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVF  72

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+P++LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  73    HITDHGVPLSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  132

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             F+V  S L  HA      D+++FC+V+E+YQ +M +L+  L +++   +    + + W  
Sbjct  133   FSVMDSSLRRHATLIWPDDHAEFCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKELRWLV  192

Query  722   CGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV---YG  886
               + G +   +Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++     
Sbjct  193   PNITGSRTDSSQSFLQLNSYPVCPDPDLAMGLAPHTDSSLLTILYQ-GNIPGLEIQNLQA  251

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 WI VEP    +VV +GDL  IISNG FKS +HRA+V+K HHR+S AYF GP KN++
Sbjct  252   EKSRWIGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQ  311

Query  1067  IAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1180
             I P   L   T+  P+YR ++W  YL  K  +F KAL +
Sbjct  312   IGP---LTADTDHPPLYRRLTWEEYLAAKATHFNKALSL  347



>ref|NP_193900.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
 sp|Q9SVS8.1|G3OX3_ARATH RecName: Full=Gibberellin 3-beta-dioxygenase 3; AltName: Full=GA 
3-oxidase 3; Short=AtGA3ox3; Short=AtGA3ox4; AltName: Full=Gibberellin 
3 beta-hydroxylase 3 [Arabidopsis thaliana]
 emb|CAB36813.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 emb|CAB81276.1| gibberellin 3 beta-hydroxylase-like protein [Arabidopsis thaliana]
 gb|ABE66082.1| gibberellin 3 beta-hydroxylase family protein [Arabidopsis thaliana]
 gb|AEE84490.1| gibberellin 3-beta-dioxygenase 3 [Arabidopsis thaliana]
Length=349

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/339 (43%), Positives = 203/339 (60%), Gaps = 22/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W    S     +T   +PVI L +P+    ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW----SKPEPETTSGPIPVISLSNPEEHGLLRQACEEWGVF  71

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+  +LL  ++ Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  72    HITDHGVSHSLLHNVDCQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  131

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  715
             F+V GS L  HA      D+++FC+V+E+YQ  M DL+  L +++   +      + W  
Sbjct  132   FSVMGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLV  191

Query  716   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  889
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  192   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIESPQ  249

Query  890   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  WI VEP   ++VV +GDL  IISNG F+S +HRA+V+K HHR+S AYF GP KN+
Sbjct  250   EEGSRWIGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNL  309

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  310   QIGPLTS--DKNHPPIYRRLIWEEYLAAKATHFNKALTL  346



>gb|ABK28643.1| unknown [Arabidopsis thaliana]
Length=350

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/339 (43%), Positives = 203/339 (60%), Gaps = 22/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W    S     +T   +PVI L +P+    ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW----SKPEPETTSGPIPVISLSNPEEHGLLRQACEEWGVF  71

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+  +LL  ++ Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  72    HITDHGVSHSLLHNVDCQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  131

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  715
             F+V GS L  HA      D+++FC+V+E+YQ  M DL+  L +++   +      + W  
Sbjct  132   FSVMGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLGLTHEDLGWLV  191

Query  716   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  889
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  192   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIESPQ  249

Query  890   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  WI VEP   ++VV +GDL  IISNG F+S +HRA+V+K HHR+S AYF GP KN+
Sbjct  250   EEGSRWIGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNL  309

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  310   QIGPLTS--DKNHPPIYRRLIWEEYLAAKATHFNKALTL  346



>gb|KGN62899.1| hypothetical protein Csa_2G379300 [Cucumis sativus]
Length=372

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/337 (42%), Positives = 198/337 (59%), Gaps = 17/337 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPV------NSSSTQESVPVIDLYDPQAVNKIKIACET  373
             I+P+DF+    +P SH W +           + ++   S+P+IDL DP A++ I  ACET
Sbjct  38    IVPLDFDSLRTIPDSHDWFNSSLETPSSSSHHHTNVNVSIPLIDLTDPNAISLIGNACET  97

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG+FQ+ NH +PV+L+ R E +TRR F+L   +KL+A R+PG VTGYG+PRI+ FF   M
Sbjct  98    WGVFQLINHDVPVSLIERAEGETRRLFDLPMTRKLKALRAPGDVTGYGLPRITPFFSKYM  157

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK--*IIRPICW  715
             W EGFT+ G  + HA Q    +Y  FC V+E+YQ +M+ LA+ +   +F    I     W
Sbjct  158   WHEGFTIMGPSIGHASQLWPSNYQPFCDVMEEYQRKMKSLAEQITRSIFNYLKISDGANW  217

Query  716   *R-CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  892
                 G          LQ+N  P CPDPTR MG A HTDT L+T+L+QT    GLQV+   
Sbjct  218   LHSAGSTEAAACSTALQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQTRT-CGLQVFRDG  276

Query  893   LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIA  1072
               W+ V P   A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYF+GP  +  ++
Sbjct  277   FGWVPVAPVPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFYGPPPDFCVS  336

Query  1073  PSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             P   L  P E P YR +    Y+ +K K    AL MI
Sbjct  337   P---LYDPPESPCYRSVMVKDYVRLKAKNLENALSMI  370



>ref|XP_007135716.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
 gb|ESW07710.1| hypothetical protein PHAVU_010G152200g [Phaseolus vulgaris]
Length=374

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 203/339 (60%), Gaps = 16/339 (5%)
 Frame = +2

Query  224   DFNK-ADQLPHSHIWL----DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             DFN    Q P S+ W     D H   + ++T  +VPVID  DP A N I  AC+TWG+FQ
Sbjct  22    DFNSLQQQFPESYAWTQPDSDHHHHYSDNTTTNTVPVIDFKDPNASNLIGHACKTWGVFQ  81

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHGIP+ L T ++      F L   QKL+A RSP  V GYG  RIS FF   MW+E F
Sbjct  82    LVNHGIPIKLFTDIQTACLALFSLPLHQKLKAARSPDGVAGYGRARISSFFPKLMWSECF  141

Query  569   TVAGSPL----EHARQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+  SPL    +   Q+Y+ +C +V++Y+A M+ LA  L  L+   +      I W   G
Sbjct  142   TILDSPLHLFLQLWPQEYAKYCEIVKEYEAAMKKLAAKLMCLVLASLGISKEDIKW--AG  199

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G      A L +N  P CPDP RAMG A HTD++L+T+L+Q +N++GLQV      W+
Sbjct  200   PRGEFNGACAALHLNSYPSCPDPDRAMGLAAHTDSTLLTILHQ-NNVSGLQVLKDGEGWV  258

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              + P +  +V+N+GDL+ I+SNG++ SVLHR  V+++  R SVAY +GP  NVEI+P+ K
Sbjct  259   ALPPLAGGLVINIGDLLHILSNGLYPSVLHRVRVNRSRQRFSVAYLYGPPTNVEISPNEK  318

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSDV  1201
             L+ P    +++ ++WN YL  K K+F KAL  +  +S +
Sbjct  319   LVGPGRPSLFQSVTWNEYLGKKAKHFNKALSAVRVSSSI  357



>ref|NP_001267625.1| gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CCD28484.1| GA 3-oxidase [Cucumis sativus]
 gb|KGN45325.1| hypothetical protein Csa_7G435500 [Cucumis sativus]
Length=374

 Score =   270 bits (691),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 142/347 (41%), Positives = 207/347 (60%), Gaps = 35/347 (10%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPV---NSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             ++ +   QLP ++ W+  D  P     + S  +SVP+IDL  P A + I  A +TWG+FQ
Sbjct  25    LNLDSLQQLPDTYDWIQPDAFPSFRDPNISLSDSVPLIDLSLPNAPHLIGNALKTWGVFQ  84

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             V NHG+P++LL  ME  T   F+L    KL+A R+P  VTGYG+PRIS FF  +MW+EGF
Sbjct  85    VINHGVPISLLNSMESFTNTLFDLPSPHKLKAARTPDGVTGYGLPRISTFFPKRMWSEGF  144

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  736
             T+ GSPLEH ++    +YS +C + E+Y  +M+ L               + W   G +G
Sbjct  145   TIVGSPLEHFQKLWPNEYSKYCDITEEYSREMKSLCGR------------VIWLALGELG  192

Query  737   L-----QWTQ---------AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGL  874
             +      W +         A +Q+N  P+CPDP RAMG   HTDTSL+T+LYQ +N  GL
Sbjct  193   ITREDVNWAEANGDFKTSNAVIQLNSYPVCPDPDRAMGLGAHTDTSLLTILYQ-NNTRGL  251

Query  875   QVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPS  1054
             QV      W+ VEP + A+VV +GDL+ I++NG++ S  H+A+V++   RIS+AYFFGPS
Sbjct  252   QVLREGNRWVMVEPVTGALVVQVGDLLHILTNGLYPSSAHQAVVNQNRKRISIAYFFGPS  311

Query  1055  KNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNS  1195
             ++ EI+P  KL+ PT+  +Y  ++W  YL  K + F   L  I  ++
Sbjct  312   ESAEISPLNKLVTPTQPLLYPTVTWTEYLRKKAQLFNNTLSSIRLSA  358



>ref|XP_010049027.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81490.1| hypothetical protein EUGRSUZ_C02851 [Eucalyptus grandis]
Length=355

 Score =   270 bits (689),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/339 (43%), Positives = 202/339 (60%), Gaps = 19/339 (6%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIW--LDDHSP---VNSSSTQESVPVIDLYDPQAVNKIKIACETW  376
             IIP+DF+  +++P SH W   DD SP    N      S+P IDL  P A+     AC+  
Sbjct  18    IIPIDFDSVEEVPQSHSWPQSDDESPRRMFNLDGDHFSIPAIDLDSPDAIEMAGHACKIM  77

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             GIFQVTNHGIP +LL  +E Q  RFF L    K++A RSP   TGYGI RI+ FF+  MW
Sbjct  78    GIFQVTNHGIPSSLLREVESQAWRFFTLPARAKVKALRSPSGATGYGIARIAPFFNKFMW  137

Query  557   TEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
              EGFT+ GSPLEHAR+     Y  FC V+EDYQ +M+ L++ L A++ K +      + W
Sbjct  138   HEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGISEHDVDW  197

Query  716   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNL  895
              R            LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+    
Sbjct  198   PRLRSNAC----TALQLNSYPRCPDPRQAMGLAPHTDTFLLTILHQNHSAHGLQVHMEGR  253

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              W+ V P + A+VVN+GD++ I+SN MF SV+HR I S+  HR++V YF+GP  +  + P
Sbjct  254   GWVPVFPMNGALVVNVGDMLHIMSNAMFPSVVHRVIPSENTHRLTVGYFYGPPTDFHVGP  313

Query  1076  SLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +L + +   +   +R I+   Y+ +K +   KAL MI
Sbjct  314   IHELTQASGREDAARFRSITVKDYVQMKAENLEKALSMI  352



>ref|XP_008445137.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=369

 Score =   270 bits (689),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 201/339 (59%), Gaps = 20/339 (6%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNS---------SSTQESVPVIDLYDPQAVNKIKIA  364
             I+P+DF+    +P SH WL       S         ++   S+P+IDL D  A+  I  A
Sbjct  34    IVPLDFDSLRTIPDSHDWLHSSPETPSSSSSSSCYHTNVDVSIPLIDLTDHDAIALIGNA  93

Query  365   CETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFD  544
             CETWG+FQ+ NH +P++L+ + E +TRR F+L   +KL+A R+P  VTGYG+PRI+ FF 
Sbjct  94    CETWGVFQLINHDVPMSLIEKAEGETRRLFDLPMTRKLKALRTPRDVTGYGLPRITPFFS  153

Query  545   SQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPIC  712
               MW EGFT+ G P++HA Q    +Y  FC V+E+YQ +M+ LA+ +  L+F  +    C
Sbjct  154   KYMWHEGFTIMGPPIDHASQLWPSNYQPFCDVMEEYQRKMKALAEQITNLIFNYLKISDC  213

Query  713   --W*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  886
               W          + A LQ+N  P CPDPTR MG A HTDT L+T+L+QT    GLQ++ 
Sbjct  214   ANWLHSTGAAAACSTA-LQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQTRT-CGLQIFR  271

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 W+ V P   A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYF+GP  +  
Sbjct  272   DGSGWVPVAPLPGALVLNVGDLFHILSNGRFPNVLHRVVVDPTQRRLSMAYFYGPPPDFC  331

Query  1067  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             ++P   L  P E P YRP+    Y+ +K K    AL MI
Sbjct  332   VSP---LNDPPETPCYRPVVVKDYVRLKAKNLENALSMI  367



>ref|XP_002869872.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46131.1| gibberellin 3-oxidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 146/339 (43%), Positives = 203/339 (60%), Gaps = 23/339 (7%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W    S     +T   +PVI L +P+    ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW----SKPEPETTTRPIPVISLSNPEH-GLLRQACEEWGVF  70

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+  +LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  71    HITDHGVSHSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  130

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALM---FK*IIRPICW--  715
             F+V GS L  HA      D+++FC+V+E+YQ  M DL+  L +++    +     + W  
Sbjct  131   FSVMGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSHRLISMLMGSLRLTREDLGWLV  190

Query  716   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  889
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  191   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIESPQ  248

Query  890   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  WI VEP   ++VV +GDL  IISNG F+S +HRA+V+K HHR+S AYF GP KN+
Sbjct  249   EEGSRWIGVEPIEGSLVVIMGDLSHIISNGQFRSTMHRAVVNKTHHRVSAAYFAGPPKNL  308

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  309   QIGPLTS--DKNHPPIYRRLIWEEYLAAKATHFNKALNL  345



>ref|XP_003522638.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Glycine max]
 gb|KHN08099.1| Gibberellin 3-beta-dioxygenase 1 [Glycine soja]
Length=341

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 202/334 (60%), Gaps = 14/334 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
              +  IIP+DF+ A  LP SH W     +   +SSS+  S+P+IDL DP A++ I  ACE 
Sbjct  14    HLSHIIPLDFSSALSLPDSHAWPHCQPNDDASSSSSSSSIPIIDLMDPNAMDLIGHACEK  73

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WG FQ+ NHGIP  ++  +EE+ +R F L  EQKL+A RSPG  TGYG  RIS FF   M
Sbjct  74    WGAFQLKNHGIPFGVIEDVEEEAKRLFALPTEQKLKALRSPGGATGYGRARISPFFPKFM  133

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+ GSP   A++    DY+ FC ++E+Y+ QM+ LA  L  ++F   +  I   +
Sbjct  134   WHEGFTIIGSPSHDAKKIWPNDYARFCDLMENYEKQMKVLADRLTEMIFN--LMDISEEK  191

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
                VG       +Q+N+ P CP+P RAMG A HTDTSL T+L+Q S ITGLQ++     W
Sbjct  192   RKWVGASNISEAVQLNFYPSCPEPNRAMGLAPHTDTSLFTILHQ-SQITGLQIFKEGKGW  250

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P+ N +VV+ GDL+ IISN  F+  LHR  V++   R SVAYF+ P  +  ++P +
Sbjct  251   VPVHPHPNTLVVHTGDLLHIISNARFRCALHRVTVNRTWERYSVAYFYSPPMDYVVSPLV  310

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +       +R ++   Y+ IK K FG+AL  I
Sbjct  311   HSVA-----RFRDVTVKEYIGIKAKNFGEALSFI  339



>emb|CDY31424.1| BnaC03g64000D [Brassica napus]
Length=350

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/339 (42%), Positives = 205/339 (60%), Gaps = 21/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W      +        +PVI +  P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW--SKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVF  72

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+P++LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  73    HITDHGVPLSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  132

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             F+V  S L  HA      D+++FC+V+E+YQ +M +L+  L +++   +    +   W  
Sbjct  133   FSVMDSSLRRHATLLWPDDHAEFCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKEFRWLV  192

Query  722   CGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV---YG  886
               + G +   +Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++     
Sbjct  193   PNITGSRTNSSQSFLQLNSYPVCPDPDLAMGLAPHTDSSLLTILYQ-GNIPGLEIQNLQA  251

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 WI VEP    +VV +GDL  IISNG FKS +HRA+V+K HHR+S AYF GP KN+ 
Sbjct  252   EKSRWIGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLH  311

Query  1067  IAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1180
             I P   L   T+  P+YR ++W  YL  K  +F KAL +
Sbjct  312   IGP---LTADTDHPPLYRRLTWEEYLAAKATHFNKALSL  347



>ref|XP_007161254.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
 gb|ESW33248.1| hypothetical protein PHAVU_001G055000g [Phaseolus vulgaris]
Length=351

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/339 (40%), Positives = 201/339 (59%), Gaps = 18/339 (5%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW-------LDDHSPVNSSSTQESVPVIDLYDPQAVNKIK  358
              +  IIP+DF+    LP SH W         D    +       +P+IDL DP A+  I 
Sbjct  15    HLHHIIPLDFSSLRTLPDSHAWPQTEDGHHHDDHDDDDHGGGSCIPIIDLMDPNAMELIG  74

Query  359   IACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRF  538
             +ACE WG FQ+ NHGIP+ ++  +E++ ++ F L  ++KL+A RS    TGYG  RIS F
Sbjct  75    LACENWGAFQLKNHGIPLNVVEEVEKEAKKLFALPADRKLKALRSAAGATGYGRARISSF  134

Query  539   FDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  706
             F   MW EGFT+ GSP + A++    D++ FC+++E+YQ QM+ LA+ L  +M +  +  
Sbjct  135   FPKHMWHEGFTIMGSPCDDAKKIWPNDHTRFCNIMENYQKQMKMLAEKLTQMMLR--LLG  192

Query  707   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  886
             IC    G VG +     +Q+N+ P CP+P RAMG A HTDTSL+T+L+Q S   GLQ++ 
Sbjct  193   ICEDEKGWVGSRNLCEAVQLNFYPCCPEPNRAMGLAPHTDTSLLTILHQ-SQTNGLQIFK  251

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 W+ V P+ N +VV+ GD++ I+SN  F   LHR +V+    R SVAYF+GP  +  
Sbjct  252   EGAGWVPVHPHPNTLVVHTGDILHILSNSRFPCALHRVMVNSERQRYSVAYFYGPPLDYV  311

Query  1067  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             ++P L     + FP +R +S   Y+ IK K  G+AL +I
Sbjct  312   LSPLLL----SSFPRFRSLSVKEYIAIKAKNLGQALSLI  346



>emb|CDX76441.1| BnaA08g09590D [Brassica napus]
Length=350

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 207/339 (61%), Gaps = 21/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP SH+W      +        +PVI +  P+ V  ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPDSHVW--SKPELEPEPMTRPIPVISISSPEKV-LLRHACEEWGVF  72

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+P++LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  73    HITDHGVPLSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  132

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*R  721
             F+V  S L  HA      D+++FC+V+E+YQ +M +L+  L +++   +    + + W  
Sbjct  133   FSVMDSSLRRHATLIWPDDHAEFCNVIEEYQKEMANLSHRLVSMVMGSLGLTHKELRWLV  192

Query  722   CGMVGLQW--TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV---YG  886
               + G +   +Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++     
Sbjct  193   PNITGSRTDSSQSFLQLNSYPVCPDPDLAMGLAPHTDSSLLTILYQ-GNIPGLEIQNLQA  251

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 WI VEP    +VV +GDL  IISNG FKS +HRA+V+K HHR+S AYF GP KN++
Sbjct  252   EKSRWIGVEPVEGGLVVIMGDLSHIISNGRFKSTMHRAVVNKTHHRVSAAYFSGPPKNLQ  311

Query  1067  IAPSLKLIKPTEF-PMYRPISWNAYLDIKYKYFGKALEM  1180
             I P   L   T+  P+YR ++W  YL  K  +F +AL +
Sbjct  312   IGP---LTADTDHPPLYRRLTWEEYLAAKATHFNEALSL  347



>ref|XP_004253252.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score =   268 bits (685),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 139/339 (41%), Positives = 204/339 (60%), Gaps = 17/339 (5%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWG  379
             +  I+P+DF+   ++P+SH+W + ++SP++    + ++P+IDL  P  V  I  AC+TWG
Sbjct  18    LQHILPIDFHSIQEVPNSHLWPNINNSPISHDEKKPTIPIIDLLAPNVVELIGHACKTWG  77

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             IFQV NHGI + L   +E Q RR F L  ++K++  RS    TGYG  RI+ FF   MW 
Sbjct  78    IFQVVNHGISLELFDEVESQARRLFALPAKEKVKVVRSTTGATGYGTARITPFFSKFMWH  137

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  727
             EGFT+  SPL+HA++    DY  FC V+ DYQ +M+ L+  L  L+    ++P       
Sbjct  138   EGFTIMDSPLDHAKELWPHDYKKFCDVMGDYQKKMKALSFQLWMLILN-YLQPSQ--EHS  194

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
             +   + T A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +L W  
Sbjct  195   IKSFESTGA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDLGWTS  253

Query  908   VEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
             + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P   
Sbjct  254   ITPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSVIVP---  310

Query  1085  LIKPTE----FPMYRPISWNAYLDIKYKYFGKALEMIGF  1189
             L+   +     P YR +    Y+D+K K+  K   MI F
Sbjct  311   LVSSKDNVGVVPKYRNVKVKEYIDLKAKHMEKVFSMIRF  349



>ref|XP_004292966.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=341

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 195/341 (57%), Gaps = 25/341 (7%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGI  382
             I  ++P+DF  A  +P S +W      V+S     ++PVIDL DP A   I  AC+TWGI
Sbjct  10    IKRLVPLDFGSAKSVPDSFVWPQASDEVHSGDGL-TIPVIDLTDPNAPQLITEACKTWGI  68

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
              QV  HGIP  LL  ME +  R F L  +QK++A RSPG +TGYGI  I   F + MW E
Sbjct  69    LQVKGHGIPTKLLEDMESECERLFSLPTDQKMKAVRSPGRITGYGIAHIQSLFSTTMWHE  128

Query  563   GFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  730
             GFT+ GS ++HAR     DY  FC  ++DYQ QM+ LA+ L  ++FK +          +
Sbjct  129   GFTIVGSAIDHARLLWPNDYQGFCDTIDDYQKQMKALAEQLMRILFKAL-------SISV  181

Query  731   VGLQW---------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
               L W             LQ+N  P CP+P+R +G A HTDTS+VT+L   +  +GLQV+
Sbjct  182   EELNWLDDPTNSSGCSLSLQLNSYPPCPEPSRTLGLAPHTDTSIVTIL--QAKTSGLQVF  239

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                + WI VE   +A+ VNLGD  +I+SNG F SVLHR +V K   R S+AYFF P  + 
Sbjct  240   KDGVGWILVELEPDALFVNLGDFSRILSNGQFISVLHRVVV-KPIQRYSMAYFFRPPTDF  298

Query  1064  EIAPSL-KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +P L K + P E P YR ++   YLD+K K+   AL  I
Sbjct  299   VASPLLSKDLGPGEVPRYRSVTVKEYLDLKGKHLENALSFI  339



>emb|CDY37588.1| BnaA02g19820D [Brassica napus]
Length=351

 Score =   267 bits (682),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 204/328 (62%), Gaps = 15/328 (5%)
 Frame = +2

Query  245   LPHSHIW----LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPV  412
             LP S  W     D   P +S++ +ES+PVIDL DP   N +  AC+TWG FQ+ NHG+  
Sbjct  19    LPDSFTWKLTAADSILPPSSAAVKESIPVIDLSDPDVTNLLGNACKTWGAFQIANHGVSQ  78

Query  413   ALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLE  592
             +LL  +E  ++ FF++  E+KL A  S   V+GYG PRIS FF+ +MW+EG T+A     
Sbjct  79    SLLDDVESLSKTFFDMPSERKLEAASSNKGVSGYGEPRISLFFEKKMWSEGLTIADGSYR  138

Query  593   HA-----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RCGMVGLQW  745
             +       +DY+ +C ++E+Y+ +M  LA  L + +   +   +  I W  +      + 
Sbjct  139   NQFLTIWPRDYTKYCGIIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKSESKM  198

Query  746   TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSN  925
              Q+ +++N  P+CP+P RAMG A HTD+ L+T+L+Q SN+ GLQV+     W+ VEP   
Sbjct  199   GQSVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQ-SNMGGLQVFKEESGWVTVEPIPG  257

Query  926   AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSLKLIKPTE  1102
              +VVN+GDL  I+SNG F SV+HRA V++   RIS+AY + GP+  VEI+P  K++ P  
Sbjct  258   VLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWGGPAGEVEISPISKIVGPVG  317

Query  1103  FPMYRPISWNAYLDIKYKYFGKALEMIG  1186
               +YRP++W+ YL IK++ F KAL+ IG
Sbjct  318   PCLYRPVTWSEYLRIKFEVFDKALDAIG  345



>gb|ADK71016.1| gibberellin 3-beta-hydroxylase [Trigonella foenum-graecum]
Length=292

 Score =   265 bits (677),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/289 (47%), Positives = 182/289 (63%), Gaps = 8/289 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+  NS+++   VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  +    +
Sbjct  5     LDDHTLNNSNTSSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIHWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFSLPSHQKLKAIRSPDGVSGYGLARISTFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
              +C +V  Y   M+ LA  L  LM   +      I W       ++   A LQ+N  P C
Sbjct  125   KYCDIVLQYDETMKILAGKLMFLMLDSLGITKEDIKWASSKAQFVENASAALQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A+HTD++ +T+L Q ++I+GLQV   +  W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLARHTDSTFLTILSQ-NDISGLQVQREDFGWVTVPPLQGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   SNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQPPL  292



>ref|XP_010049031.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Eucalyptus 
grandis]
 gb|KCW81493.1| hypothetical protein EUGRSUZ_C02855 [Eucalyptus grandis]
Length=355

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 200/343 (58%), Gaps = 19/343 (6%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW--LDDHSP---VNSSSTQESVPVIDLYDPQAVNKIKIA  364
              +  IIP+DF+   ++P SH W   DD S     N      S+P IDL  P A+     A
Sbjct  14    HLQHIIPIDFDSVKEVPQSHSWPQSDDESTRRMFNLDGDHFSIPAIDLDSPDAIETAGHA  73

Query  365   CETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFD  544
             C+  GIFQVTNHGI  +LL  +E Q  RFF L    K++A RSP   TGYG+ RI+ FF+
Sbjct  74    CKIMGIFQVTNHGILSSLLREVESQAWRFFTLPARAKVKALRSPSGATGYGVARIAPFFN  133

Query  545   SQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  703
               MW EGFT+ GSPLEHAR+     Y  FC V+EDYQ +M+ L++ L A++ K +     
Sbjct  134   KFMWHEGFTMMGSPLEHAREVWPHGYRKFCEVMEDYQDKMKALSERLLAMILKYLGISEH  193

Query  704   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
              I W R          A LQ+N  P CPDP +AMG A HTDT L+T+L+Q  +  GLQV+
Sbjct  194   DIDWPRLRSNAC----AALQLNSYPRCPDPRQAMGLAPHTDTFLLTILHQNHSAHGLQVH  249

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  W+ V P + A+VVNLGD++ I+SN MF SV+HR I S+  HR++V YF+GP  + 
Sbjct  250   MEGRGWVPVFPMNGALVVNLGDMLHIMSNAMFPSVVHRVIPSEKRHRLTVGYFYGPPTDF  309

Query  1064  EIAPSLKLIKPT---EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              + P   L + +   +   +R ++   Y+ +K K   KAL MI
Sbjct  310   HVGPIHGLTQSSGREDAARFRSVTVKDYVQMKAKNLDKALSMI  352



>ref|XP_004135830.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis sativus]
 emb|CBX88045.1| gibberellin 3-oxidase, partial [Cucumis sativus]
 gb|KGN45321.1| hypothetical protein Csa_7G434970 [Cucumis sativus]
Length=374

 Score =   267 bits (683),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 205/333 (62%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS----PVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +DF+   +LP S+ W+   S     ++++   +S+P+IDL  P A   I  A  TWG FQ
Sbjct  24    LDFDSLHELPDSYDWIQPDSFPSSSLSNNHLSDSIPLIDLSLPNAPQLIGNAFRTWGAFQ  83

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             V NHG+P++LL  +E      F L P  KL+A R    ++GYG+ RIS FF  +MW+EGF
Sbjct  84    VINHGVPISLLHSIESSANSLFSLPPPHKLKAARPSDGISGYGLVRISSFFPKRMWSEGF  143

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNL--AALMFK*IIRP-ICW*RCG  727
             T+ GSPLEH R+    DY+ +C +VE+Y  +M+ L   L   AL    I R  + W   G
Sbjct  144   TIVGSPLEHFRKLWPHDYTRYCDIVEEYDREMKSLCGRLMWVALGELGITREDVNW--AG  201

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  + + A  Q+N  P+CPDP RAMG   HTDTSL+T++YQ +N  GLQV      W+
Sbjct  202   PNGDFKTSNAATQLNSYPVCPDPDRAMGLGAHTDTSLLTIVYQ-NNTRGLQVLREGNRWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              VEP   A+VV +GDL+ I++NG++ S +H+A+V++   R+SVAY FGP ++ EI+P  K
Sbjct  261   TVEPVPGALVVQVGDLLHILTNGLYPSPVHQAVVNRTRKRLSVAYVFGPPESAEISPLKK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ PT+ P+YR ++W  YL  K ++F  AL  +
Sbjct  321   LLGPTQPPLYRTVTWTEYLRKKAEHFNNALSSV  353



>ref|XP_008461056.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cucumis melo]
Length=374

 Score =   267 bits (682),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/333 (43%), Positives = 202/333 (61%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNSSSTQ----ESVPVIDLYDPQAVNKIKIACETWGIFQ  388
              DF+   +LP S+ W+   S  NSS +     +S+P+IDL  P A + I  A  TWG FQ
Sbjct  24    FDFDSLQELPDSYDWIQPDSFPNSSLSNNHLSDSIPLIDLSLPNAPHLIGNAFRTWGAFQ  83

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             V NHG+P++LL  +E      F L    KL+A R    ++GYG+ RIS FF  +MW+EGF
Sbjct  84    VINHGVPISLLHSIESSANSLFSLPAPHKLKAARPSDGISGYGLVRISSFFPKRMWSEGF  143

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNL--AALMFK*IIRP-ICW*RCG  727
             T+ GSPLEH R+    DY+ +C +VE+Y  +M+ L   L   AL    I R  + W   G
Sbjct  144   TIVGSPLEHFRKLWPHDYTRYCDIVEEYDQEMKSLCGRLMWVALGELGITREDVNW--AG  201

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G    + A  Q N  P+CPDP RAMG   HTDTSL+T++YQ +N  GLQV      W+
Sbjct  202   PNGDFMTSNAATQFNSYPVCPDPERAMGLGAHTDTSLLTIVYQ-NNTRGLQVLREGNRWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              VEP   A+VV +GDL+ I++NG++ S +H+A+V++   R+SVAY FGP ++ EI+P  K
Sbjct  261   TVEPVPGALVVQVGDLLHILTNGLYPSPVHQAVVNRTRKRLSVAYVFGPPESAEISPLKK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ PT+ P+YR ++W  YL  K ++F  AL  +
Sbjct  321   LLGPTQPPLYRTVTWTEYLRKKAEHFNNALSSV  353



>ref|XP_006301281.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
 gb|EOA34179.1| hypothetical protein CARUB_v10021682mg [Capsella rubella]
Length=355

 Score =   266 bits (680),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/332 (42%), Positives = 200/332 (60%), Gaps = 32/332 (10%)
 Frame = +2

Query  245   LPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALL  421
             LP S+ W   D    ++S++ ES+P+IDL DP A   +  AC TWG FQ+TNHG+P  LL
Sbjct  27    LPDSYTWSPKDDLLFSASASDESLPLIDLSDPHATTLVGNACTTWGAFQITNHGVPSRLL  86

Query  422   TRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR  601
               +E  T   F L+  QKL+A R    V+GYG+ RI+ FF+ +MW+EGFTV GSPL   R
Sbjct  87    DDIELLTGDLFRLSVHQKLKAARLENGVSGYGVARIASFFNKKMWSEGFTVVGSPLHDFR  146

Query  602   Q----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL----------  739
             +     + ++C ++E Y+  M+ LA  L             W   G +G+          
Sbjct  147   KLWPSHHLEYCEIIEAYKEHMQKLAAKL------------MWLALGSLGVEENDIKWAGP  194

Query  740   ----QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
                 Q TQA +Q+N  PICP+P R+MG A HTD++L+T+LYQ +N  GLQV+  ++ W+ 
Sbjct  195   NSDFQGTQAAIQLNHYPICPEPERSMGLAAHTDSTLLTILYQ-NNTAGLQVFRDDVGWVT  253

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GPS +V I+P  KL
Sbjct  254   VPPIPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPSSDVMISPLPKL  313

Query  1088  IKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             + P + P+Y  ++W  YL  K  +F  +L +I
Sbjct  314   VDPLQSPLYPSLTWKQYLATKATHFNHSLSII  345



>ref|XP_008219864.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=343

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 142/331 (43%), Positives = 200/331 (60%), Gaps = 15/331 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVT  394
             IP+D+     LP SH+WLD+     S       PVIDL DP A   I  ACETWG+FQ+ 
Sbjct  18    IPLDYGSVHTLPDSHVWLDESDESPSGVHTTGPPVIDLADPDAARLIIQACETWGVFQLI  77

Query  395   NHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSP-GSVTGYGIPRISRFFDSQMWTEGFT  571
              HGIP  L+  ++ +  + F+L  +QK++A RSP GS +GYG+P IS FF+  MW EG+ 
Sbjct  78    GHGIPTKLMEDVQSEAEKLFDLPVDQKMKALRSPGGSQSGYGLPPISPFFEKLMWHEGYH  137

Query  572   VAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RCGM  730
             + GSP+EHA+     DY  FC  +  Y++Q++ L + L  ++FK + I P  + W    +
Sbjct  138   IMGSPIEHAKLLWPNDYQGFCGTMVHYRSQLKALTEQLIRIIFKSLNINPEEVAW----L  193

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
                +     LQ+N  P CPDPTRAMG A HTDTSL+T+L Q S ++GLQV+     W+ V
Sbjct  194   KDTEGLSIGLQLNCYPPCPDPTRAMGIAPHTDTSLITIL-QQSKVSGLQVFKEGAGWVLV  252

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
             +P   AI VNLGD+  I+SNG+F +V HR +V+    R+S AYF+ P  +  ++P L   
Sbjct  253   QPVPGAITVNLGDIFHILSNGVFTTVRHR-VVATPIRRLSFAYFYAPPGDFIVSPVLSK-  310

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                E P Y+ +S   Y+ IK K+F KAL +I
Sbjct  311   DFGEVPRYQTLSVKEYVGIKGKHFEKALSVI  341



>ref|XP_008811603.1| PREDICTED: gibberellin 3-beta-dioxygenase 1 [Phoenix dactylifera]
Length=349

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/341 (43%), Positives = 195/341 (57%), Gaps = 20/341 (6%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETW  376
             +D    ++F    +LP SH W  L DH  V+     E VPVID+ DP+A   +  AC +W
Sbjct  9     LDQAHHLEFESVHELPESHAWPTLHDHPCVS-----EPVPVIDMADPKAAEFMARACVSW  63

Query  377   GIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMW  556
             G FQVT HG+   LL  ++ + RR F L  +QKL+A R    V+GYG+  IS FF   MW
Sbjct  64    GAFQVTGHGVAPRLLESIDSEMRRLFALPTQQKLKAARPADGVSGYGLVPISSFFAKLMW  123

Query  557   TEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW  715
             +EGFT+AGSPL+HAR+    D   FC  +E Y  +M+ LA  L  LM   +      + W
Sbjct  124   SEGFTIAGSPLDHARKLWPHDPDQFCDAIERYDREMKALAGRLIRLMLLSLGLSDEEVEW  183

Query  716   *RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-  892
                G          L++N  P CPDP RAMG A H D+SLVT+LYQ+S  +GLQV     
Sbjct  184   AGQGGELPPDLAGVLRLNSYPACPDPDRAMGMAAHADSSLVTILYQSST-SGLQVLRAED  242

Query  893   ----LNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1060
                   W+ V P   A+VV +GDL  I+SNG FKSV+HR +V+++  R+S AYF GP   
Sbjct  243   QNSPARWVTVPPLPGALVVIVGDLFHILSNGRFKSVVHRVVVNRSQQRVSAAYFCGPPAG  302

Query  1061  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             V ++P  KL+ P   P YR ++W  YL +K + F KAL  I
Sbjct  303   VTVSPIEKLVGPGRAPAYRAVTWAEYLGLKRELFDKALATI  343



>ref|XP_010532144.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like isoform X2 [Tarenaya 
hassleriana]
Length=354

 Score =   266 bits (679),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 143/336 (43%), Positives = 198/336 (59%), Gaps = 25/336 (7%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             D     QLP S  W   DD     +S+ Q ++PVIDL D  A   I  AC +WG FQVTN
Sbjct  22    DLTSLRQLPDSFTWTHEDDLLFSAASNDQNTLPVIDLSDHAAAAAIGRACMSWGAFQVTN  81

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P++LL  +E  T   F L   +K+RA R    V+GYG+ RI+ FF  QMW+EGFTV 
Sbjct  82    HGVPLSLLDDIESLTVSLFRLPAHRKMRAARPVDGVSGYGVARIASFFHKQMWSEGFTVT  141

Query  578   GSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGLQW  745
             GS  +H R+     +  +C V+++Y+  M+ LA  L  L+   +             ++W
Sbjct  142   GSARDHFRKLWPLHHLKYCDVIKEYEEHMQKLATKLMWLVLSSL-------GVTEADIKW  194

Query  746   T---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNIT-GLQVYGPNL  895
                       QA +Q+N  P+CP+P RAMG A HTD++L+T+LYQ  NIT GLQV+   +
Sbjct  195   AGPNSDFNGAQAAIQLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQ--NITAGLQVFKDGV  252

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              W+ V P   ++VVN+GDL+ I+SNG   SVLHR  V+K   R SVAY +GP  +V+I+P
Sbjct  253   GWLTVSPIPGSLVVNIGDLLHILSNGRLPSVLHRVRVNKNRSRFSVAYLWGPQSDVQISP  312

Query  1076  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               KL+ P E P+YRP++W  YL  K  +F  AL +I
Sbjct  313   IWKLVSPVEPPLYRPVTWKEYLRTKATHFNNALSVI  348



>ref|XP_006361220.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   266 bits (679),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 203/341 (60%), Gaps = 17/341 (5%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
             Q +  I+P+DF+   ++P+SH+W + ++SP++      +VP+IDL  P  V  I  AC+T
Sbjct  16    QSLQHILPIDFHSIQEVPNSHLWHNINNSPISHDEKNPNVPIIDLLAPNVVELIGHACKT  75

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WGIFQV NHG+ + L   +E Q RR F L  EQK++  RS    TGYG  RI  FF   M
Sbjct  76    WGIFQVVNHGVSLELFDEVEFQARRLFALQVEQKVKVMRSTTGATGYGTARIMPFFSKFM  135

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+  SPL+HA++    DY  FC V+E+YQ +++ L+  L  L+    ++P     
Sbjct  136   WHEGFTIMDSPLDHAKELWPHDYQIFCDVMENYQKKIKALSFQLWLLILN-YLQPSQ--E  192

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
               +   +  +A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W
Sbjct  193   HSIKSFESRRA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGW  251

Query  902   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  252   TSIAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMIVP-  310

Query  1079  LKLIKPTE----FPMYRPISWNAYLDIKYKYFGKALEMIGF  1189
               L+   +     P YR +    YLD+K K+  K   MI F
Sbjct  311   --LVSSKDNVGVVPKYRNVKVKEYLDLKAKHLEKVFSMIRF  349



>ref|XP_004158763.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
1-like [Cucumis sativus]
Length=374

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/333 (42%), Positives = 204/333 (61%), Gaps = 15/333 (5%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHS----PVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +DF+   +LP S+ W+   S     ++++   +S+P+IDL  P A   I  A  TWG FQ
Sbjct  24    LDFDSLHELPDSYDWIQPDSFPSSSLSNNHLSDSIPLIDLSLPNAPQLIGNAFRTWGAFQ  83

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             V NHG+P++LL  +E      F L P  KL+A R    ++GYG+ RIS FF  +MW+EGF
Sbjct  84    VINHGVPISLLHSIESSANSLFSLPPPHKLKAARPSDGISGYGLVRISSFFPKRMWSEGF  143

Query  569   TVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNL--AALMFK*IIRP-ICW*RCG  727
             T+ GSPLEH R+    DY+ +C +VE+Y  +M+ L   L   AL    I R  + W   G
Sbjct  144   TIVGSPLEHFRKLWPHDYTRYCDIVEEYDREMKSLCGRLMWVALGELGITREDVNW--AG  201

Query  728   MVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
               G  + + A  Q+N  P+CPDP RAMG   HTDTSL+T++YQ +N  GLQV      W+
Sbjct  202   PNGDFKTSNAATQLNSYPVCPDPDRAMGLGAHTDTSLLTIVYQ-NNTRGLQVLREGNRWV  260

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              VEP   A+VV +GDL+ I++NG++ S +H+A+V++   R+SVAY FGP ++ EI+P  K
Sbjct  261   TVEPVPGALVVQVGDLLHILTNGLYPSPVHQAVVNRTRKRLSVAYVFGPPESAEISPLKK  320

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ PT+ P YR ++W  YL  K ++F  AL  +
Sbjct  321   LLGPTQPPXYRTVTWTEYLRKKAEHFNNALSSV  353



>ref|XP_009385827.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   266 bits (679),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/333 (42%), Positives = 199/333 (60%), Gaps = 19/333 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLDDHSPVNS-SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             ++ N    +P ++ W    S +N      + VPV+DL  P AV  I  ACE WG FQ+T 
Sbjct  12    LELNTLSHVPDAYAW----SALNDLPYGDDVVPVVDLASPDAVGLIGRACEEWGAFQITG  67

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HGIP+ LL R+E QTR  F L   QKL+A R PGS++GYG+   S F+ +  W+EGFT+ 
Sbjct  68    HGIPLHLLDRVEAQTRLLFSLPTAQKLKAARGPGSLSGYGLANTSSFYSNIFWSEGFTII  127

Query  578   GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQN-LAALMFK*IIRPICW*RCGMVGLQ  742
             GSP + AR    +DY ++C V+E+Y   ++ L+   L ++M    +        G+  L 
Sbjct  128   GSPYDDARKLWPEDYEEYCCVMEEYNRLIKALSGRLLRSMMLSLGLHEEDMDWAGL--LS  185

Query  743   WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY------GPNLNWI  904
                  LQ+N+ P CP+P RA+G A HTD+S +T+LYQ+S  +GLQ+       GP   W+
Sbjct  186   KADPVLQLNYYPACPEPDRAIGIAHHTDSSFITILYQSSGESGLQLVHREDAAGPA-RWV  244

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V P   A+VVN+GDL +I+ NG  +SV+HRAIV++   R+SVAYF GP +   +AP  K
Sbjct  245   TVPPRRGALVVNVGDLCEIVFNGRIRSVMHRAIVNRTQTRVSVAYFCGPPRQFNVAPIGK  304

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L+ P E P YR +SW  +L +K K + K LE +
Sbjct  305   LVGPNERPAYRAMSWPEFLSLKRKLYNKTLEYL  337



>ref|XP_008461055.1| PREDICTED: LOW QUALITY PROTEIN: gibberellin 3-beta-dioxygenase 
2-like [Cucumis melo]
Length=375

 Score =   266 bits (680),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 203/345 (59%), Gaps = 38/345 (11%)
 Frame = +2

Query  224   DFNKADQLPHSHIWLDDHSPVNS-----SSTQESVPVIDLYD-PQAVNKIKIACETWGIF  385
             + +  ++LP ++ W+   S  +S      S  +SVP+IDL D P A + I  A +TWG F
Sbjct  23    NLDSFEKLPDTYDWIQPDSFPSSLTDPNVSLSDSVPLIDLSDLPNAPHLIGNALKTWGXF  82

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             QV NHG+P++LL  ME  T   F+L    KL+A R+P  V GYG+PRIS FF  +MW+EG
Sbjct  83    QVINHGVPISLLNSMESFTNALFDLPSPHKLKAARTPDGVAGYGLPRISTFFPKRMWSEG  142

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMV  733
             FT+ GSPLEH ++    +YS +C + E+Y  +M  L   L             W   G +
Sbjct  143   FTIVGSPLEHFQKLWPDEYSKYCDLTEEYSREMGSLCGRL------------IWLALGEL  190

Query  734   GL-----QW----------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNIT  868
             G+      W          T A +Q+N  PICPDP RAMG   HTD+SL+T+LYQ +N  
Sbjct  191   GITQEDVNWAGSNGDFKTSTNAVIQLNSYPICPDPDRAMGLGAHTDSSLLTILYQ-NNSR  249

Query  869   GLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFG  1048
             GLQV      W+ VEP + A+VV +GDL+ I++NG++ S +H+A+V++   RIS+AYFFG
Sbjct  250   GLQVLREGNRWVMVEPVNGALVVQVGDLLHILTNGLYLSSVHQAVVNQTQKRISIAYFFG  309

Query  1049  PSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             PS+ VEI+P  KL+ PT   +Y  I+W  YL  K K F   L  I
Sbjct  310   PSEGVEISPINKLVTPTRPLLYPTITWTEYLRKKAKLFNNTLSSI  354



>ref|XP_009396646.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Musa acuminata 
subsp. malaccensis]
Length=364

 Score =   266 bits (679),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 148/341 (43%), Positives = 200/341 (59%), Gaps = 21/341 (6%)
 Frame = +2

Query  221   MDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQA-VNKIKIACETWGIFQV  391
             ++     ++P SH W  LDDH  V      E VPV+DL  P A V  +   CE+WG FQV
Sbjct  21    LELESVREVPDSHAWPALDDHPTV-----YEPVPVVDLAGPDASVAHLARVCESWGAFQV  75

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
             T HGI   LL R+E +TRR F L  +QKL+A R    ++GYG+ RIS FF   MW+EGFT
Sbjct  76    TGHGIRSDLLERLESETRRLFALPMDQKLKAARPSNGISGYGLARISCFFSKLMWSEGFT  135

Query  572   VAGSPLEHARQ-----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  736
             ++GSPL+HA +     D S FC V+++Y  +M+ +A  +  LM   +       +    G
Sbjct  136   ISGSPLDHALKLWPDADPSRFCDVMQEYSDEMKQVAGRVVRLMLLSMGLTPEEMKRAEEG  195

Query  737   LQWTQ--AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN-----L  895
              +  Q  A LQ+N  P CPDP RAMG A HTD+SLVTLL+Q S  +GLQ+  P       
Sbjct  196   TRVDQLSAVLQLNSYPPCPDPNRAMGLAAHTDSSLVTLLFQ-SGTSGLQLLRPQDQHGPA  254

Query  896   NWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAP  1075
              W+ V P   A++V  GDL+QI++NG +KSV HRA+V++ HHR+SVAY  GP  + +++P
Sbjct  255   RWVTVPPRPGALIVLAGDLLQILTNGRYKSVAHRAVVNRNHHRVSVAYICGPPPHHKLSP  314

Query  1076  SLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMIGFNSD  1198
               K   P     YR +SW  YL +K + F KAL  I    D
Sbjct  315   VGKPASPAPCLAYRAVSWADYLGLKAELFDKALASIMVAED  355



>ref|XP_010434144.1| PREDICTED: gibberellin 3-beta-dioxygenase 3 [Camelina sativa]
Length=351

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/339 (43%), Positives = 204/339 (60%), Gaps = 20/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP+SH+W        + S    +PVI L +P     ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPNSHVWSKTEPEPKTMSL--PIPVISLSNPDQHLLLRQACEEWGVF  73

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+P +LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  74    HITDHGVPRSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  133

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  715
             F+V GS L  HA      D+++FC+V+E+YQ  M DL+  L  ++   +      + W  
Sbjct  134   FSVLGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSLRLITMLMASLGLTHEDLGWLV  193

Query  716   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGP-  889
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  194   PDKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIQSPQ  251

Query  890   --NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  WI VEP   ++V+ +GDL  IISNG F++ +HRA+V+K HHR+S AYF GP KN+
Sbjct  252   EEGSRWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRVSAAYFAGPPKNL  311

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             +I P L   K    P+YR + W  YL  K  +F +AL +
Sbjct  312   QIGP-LACDK-NHPPIYRRLLWEEYLAAKATHFNRALTL  348



>gb|ADK71025.1| gibberellin 3-beta-hydroxylase [Trifolium microdon]
Length=300

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/302 (46%), Positives = 184/302 (61%), Gaps = 16/302 (5%)
 Frame = +2

Query  245   LPHSHIW--LDDHSP-----VNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHG  403
             LP S+ W  LDDH+      +   S+  SVP+IDL D  A   I  AC+TWG++QV NHG
Sbjct  1     LPQSYTWTNLDDHTTNSNNIMKDPSSNTSVPIIDLSDTNASKLIGHACKTWGVYQVVNHG  60

Query  404   IPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGS  583
             IP++LL  ++   +  F L   QKL+A RSP  VTGYG+ RIS FF   MW+EGFT+ GS
Sbjct  61    IPLSLLDDIQWVGQSLFSLPSHQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGS  120

Query  584   PLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQ  742
             PL+H +Q    DY+ +C +V  Y   M+ LA+ L  LM   +      I W        +
Sbjct  121   PLDHFQQLWPKDYAKYCDIVLQYDEAMKKLAEKLMLLMLDSLGITKEDIIW-ASSKAQFE  179

Query  743   WTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNS  922
                A +Q+N  PICPDP RAMG A HTD++ +T+L Q S+I+GLQV      W+ V P  
Sbjct  180   KACAAMQLNSYPICPDPDRAMGLAPHTDSTFLTILSQ-SDISGLQVQREGFGWVTVPPLH  238

Query  923   NAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1102
               +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  239   GGLVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKLVGPTQ  298

Query  1103  FP  1108
              P
Sbjct  299   LP  300



>emb|CDY38661.1| BnaC02g23180D [Brassica napus]
Length=358

 Score =   265 bits (678),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 198/328 (60%), Gaps = 10/328 (3%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             DF     LP S+ W   D    ++SS+ ES+P IDL DP    ++  AC TWG FQ+TNH
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             G+P  LL  +E  T   F L   +KL+A R    ++GYG+ RI+ FF+ QMW+EGFTV G
Sbjct  83    GVPSRLLDDIEFLTGSLFRLPVHRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIG  142

Query  581   SPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGL  739
             SPL+       + +  +C ++++Y+  M+ LA  L  L    +    + I W    +   
Sbjct  143   SPLDDFHKLWPKQHLKYCKIIQEYEEHMQKLAAKLMWLALGSLGVEEKDIEW-AGPISDF  201

Query  740   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  919
             Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQV+  ++ WI V P 
Sbjct  202   QGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLMTILYQ-NNTAGLQVFRDDVGWITVPPV  260

Query  920   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1099
               ++VVNLGDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  KL+ P 
Sbjct  261   PGSLVVNLGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPL  320

Query  1100  EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               P+Y  ++W  YL  K  +F ++L  I
Sbjct  321   HSPLYPSLTWKQYLATKATHFNQSLSFI  348



>dbj|BAD30037.1| gibberellin 3beta-hydroxylase3 [Daucus carota]
Length=344

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 201/331 (61%), Gaps = 13/331 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQE-SVPVIDLYDPQAVNKIKIACETWGIFQ  388
             IIP+DF+  D +P SH W   HS V      E S+P++DL DP A   I  A E WGIFQ
Sbjct  18    IIPLDFHAVDSVPESHEW--PHSDVLRPVIDEISIPLVDLKDPNAQKLIGHASEDWGIFQ  75

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             VTNHG+P+ +L  +E + RR F L  ++KL+  RSP   TGYG  RIS FF   MW EGF
Sbjct  76    VTNHGVPLGVLMDVEFEARRLFSLPVKEKLKVLRSPEGATGYGAARISPFFSKFMWHEGF  135

Query  569   TVAG-SPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRPICW*RCGM  730
             T+ G S ++HA+Q    DY  F  V++ YQ +M++LA  +  L+ K + I          
Sbjct  136   TIIGSSSVDHAKQLWPHDYESFTDVIDVYQKKMKELAHQILLLLLKSLEISEEDITSWAA  195

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
                      LQ+N  P CP+P+RA+G A HTD+ L+T+L QT + + LQ++   + WI V
Sbjct  196   STHDSNNGALQLNSYPCCPNPSRAIGLAPHTDSLLLTILSQTHDSSALQIFRDGVGWIAV  255

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
              P  +A+VVN+GDL+ I+SNG F SV H+ IVS+  HRISVAYF+GP  + ++AP  ++ 
Sbjct  256   APVRDALVVNVGDLLHILSNGRFPSVYHQVIVSEKEHRISVAYFYGPRTDAQVAPLSRI-  314

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                E P+YR +S   ++ IK K+  KAL  +
Sbjct  315   ---EVPIYRSLSVKEFIGIKAKHLDKALSFV  342



>ref|XP_004240225.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=349

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 138/337 (41%), Positives = 200/337 (59%), Gaps = 12/337 (4%)
 Frame = +2

Query  197   QEIDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
             Q    I+P+DF+   ++P+SH+W + ++ P+N      +VP+IDL  P  V  I  AC+T
Sbjct  15    QSPQHILPIDFHLIQEVPNSHLWPNINNFPINHDEKNPNVPIIDLLAPNVVQLIGHACKT  74

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQM  553
             WGIFQV NHGI +     +E Q RR F L  E+K++  RS    TGYG  RI+ FF   M
Sbjct  75    WGIFQVINHGISLDFFDEVESQARRLFALPVEEKVKVMRSTSGATGYGTARITPFFSKFM  134

Query  554   WTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             W EGFT+  SPL+HA++    DY +FC V+E+YQ +M+ L+  L   +    ++P     
Sbjct  135   WHEGFTIMDSPLDHAKKLWPHDYQEFCDVMENYQKKMKALSFQLWLFILN-YLQPSQ--E  191

Query  722   CGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
               +   ++TQA LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W
Sbjct  192   HLINSFEFTQA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQEW  250

Query  902   IDVEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
               + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I P 
Sbjct  251   TSITPISNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSTIVPL  310

Query  1079  LKLIKPTE--FPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +   K      P YR +    YL +K K+  K   +I
Sbjct  311   VSFDKNVGVVVPKYRKVKVKEYLSLKAKHLEKVFSLI  347



>ref|XP_010670743.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   265 bits (677),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/339 (41%), Positives = 204/339 (60%), Gaps = 15/339 (4%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKI  361
             E + I P+DF+    +P SH W+  +    + +  +      SVP+I+L D   +  I  
Sbjct  14    EHNLIAPLDFSLIKDVPESHAWIQSNDLKENPNINKKELGLISVPIINLEDANVLELIFN  73

Query  362   ACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFF  541
             ACETWG+FQVTNHGI   LL ++E + ++ F L  E+K++  RSP + TGYG PRI+ FF
Sbjct  74    ACETWGMFQVTNHGISKQLLEQVEFEAKKLFNLPFEEKMKTLRSPEAATGYGYPRITPFF  133

Query  542   DSQMWTEGFTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  706
                MW EGFT+ G+ L +HA+     D+  FC V+E+YQ +M+DL+  L  L+ K +  P
Sbjct  134   SKLMWNEGFTIMGNSLIDHAKILWPNDFQGFCDVMEEYQTRMKDLSDKLMGLLLKSLNIP  193

Query  707   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  886
               + +     L      LQ+N  P CP+PTR MG AQHTDT L T+L+Q++N +GLQV+ 
Sbjct  194   GPYMKEMDNDLC---TALQLNSYPTCPNPTRTMGLAQHTDTFLFTILHQSANASGLQVFI  250

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
                 W+ V+P+  A+VVN+GDL+ IISN  F S +HRA+V+ A  R+S AYF+GP  + +
Sbjct  251   DGPGWVSVDPHPGALVVNVGDLLHIISNARFPSAIHRAVVNNATQRLSFAYFYGPPLDFQ  310

Query  1067  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +AP L      E P ++ +    Y+ IK KY   AL  +
Sbjct  311   VAPFLD-YPGCEGPTFKSLKVKEYVGIKSKYLDMALSFV  348



>ref|XP_009128435.1| PREDICTED: gibberellin 3-beta-dioxygenase 4 [Brassica rapa]
Length=351

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/327 (41%), Positives = 203/327 (62%), Gaps = 15/327 (5%)
 Frame = +2

Query  245   LPHSHIW----LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPV  412
             LP S  W     D   P +S++ +ES+PVIDL DP   N +  AC+TWG FQ+ NHG+  
Sbjct  19    LPDSFTWKLTAADSILPPSSAAVKESIPVIDLSDPDVTNLLGNACKTWGAFQIANHGVSQ  78

Query  413   ALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLE  592
             +LL  +E  ++ FF++  E+KL A  S   V+GYG PRIS FF+ +MW+EG T+A     
Sbjct  79    SLLDDVESLSKTFFDMPSERKLEAASSNKGVSGYGEPRISLFFEKKMWSEGLTIADGSYR  138

Query  593   HA-----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RCGMVGLQW  745
             +       +DY+ +C ++E+Y+ +M  LA  L + +   +   +  I W  +      + 
Sbjct  139   NQFLTIWPRDYTKYCGIIEEYKGEMEKLASRLLSCILGSLGVTVDDIEWAKKTEKSESKM  198

Query  746   TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSN  925
              Q+ +++N  P+CP+P RAMG A HTD+ L+T+L+Q SN+ GLQV+     W+ VEP   
Sbjct  199   GQSVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQ-SNMGGLQVFKEESGWVTVEPIPG  257

Query  926   AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSLKLIKPTE  1102
              +VVN+GDL  I+SNG F SV+HRA V++   RIS+AY + GP+  VEI+P  K++ P  
Sbjct  258   VLVVNIGDLFHILSNGKFPSVVHRARVNRTKSRISIAYLWGGPAGEVEISPISKIVGPVG  317

Query  1103  FPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +YRP++W+ YL IK++ F KAL+ I
Sbjct  318   PCLYRPVTWSEYLRIKFEVFDKALDAI  344



>gb|ADK71013.1| gibberellin 3-beta-hydroxylase [Trigonella corniculata]
Length=297

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/296 (47%), Positives = 183/296 (62%), Gaps = 16/296 (5%)
 Frame = +2

Query  266   LDDHSPVNS------SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS      S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  4     LDDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDD  63

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             +    +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H +  
Sbjct  64    IHSVGQTLFSLPSNQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQL  123

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGL-QWTQAYLQ  763
               QDY  +C +V  Y   M+ LA  L  LM   +      I W  C      +   A LQ
Sbjct  124   WPQDYXKYCDIVLQYDETMKKLAGKLMWLMLDSLGITKEDIKW-ACSKAQFDEQACAALQ  182

Query  764   MNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNL  943
             +N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    L W+ V P    +VVN+
Sbjct  183   LNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQQEGLGWVTVPPLHGGLVVNV  241

Query  944   GDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P+ KL+ PT+ P+
Sbjct  242   GDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPNAKLVGPTQPPL  297



>ref|XP_007226257.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
 gb|EMJ27456.1| hypothetical protein PRUPE_ppa018610mg [Prunus persica]
Length=343

 Score =   264 bits (675),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/333 (43%), Positives = 202/333 (61%), Gaps = 19/333 (6%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIWLD--DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             IP+D+     LP SH+WLD  D SP    ST    PVIDL DP +   I  ACETWG+FQ
Sbjct  18    IPLDYGSVHTLPDSHVWLDESDESPSGVHST--GPPVIDLADPDSARLIIQACETWGVFQ  75

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSP-GSVTGYGIPRISRFFDSQMWTEG  565
             +  HGIP  L+  ++ +  + F+L  +QK++A RSP GS +GYG+P IS FF+  MW EG
Sbjct  76    LIGHGIPTKLMEDVQSEAEKLFDLPVDQKMKALRSPGGSQSGYGLPPISPFFEKLMWHEG  135

Query  566   FTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I-IRP--ICW*RC  724
             + + GSP++HA+     DY  FC  +  Y++Q++ L + L  ++FK + I P  + W   
Sbjct  136   YHIMGSPIDHAKLLWPNDYQGFCDTMVHYRSQLKALTEQLIRIIFKSLNINPDEVAW---  192

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
              +   Q     LQ+N  P CPDPTRAMG A HTDTSL+T+L Q S ++GLQV+     W+
Sbjct  193   -LKESQGLSIGLQLNCYPPCPDPTRAMGIAPHTDTSLITVL-QQSKVSGLQVFKEGAGWV  250

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
              V+P   AI VNLGD   I+SNG+F +V HR + ++   R+S AYF+ P  +  ++P L 
Sbjct  251   LVQPVPGAITVNLGDFFHILSNGVFTTVRHRVVATRI-RRLSFAYFYAPPGDFIVSPVLS  309

Query  1085  LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
                  E P Y+ +S   Y+ IK K+F KAL +I
Sbjct  310   K-DFGEVPRYQTLSVKEYVGIKGKHFEKALSVI  341



>gb|AGH39958.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=293

 Score =   262 bits (670),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 179/289 (62%), Gaps = 8/289 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +  S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  6     LDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  65

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H +    QDY+
Sbjct  66    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQDYA  125

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
              +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  126   KYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  185

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q +NI+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  186   PDPDHAMGLAPHTDSTFLTILSQ-NNISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHIL  244

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  245   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  293



>ref|XP_009128433.1| PREDICTED: gibberellin 3-beta-dioxygenase 2 [Brassica rapa]
Length=358

 Score =   265 bits (676),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 199/328 (61%), Gaps = 10/328 (3%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             DF     LP S+ W   D    ++SS+ ES+P IDL DP    ++  AC TWG FQ+TNH
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             G+P  LL  +E  T   F+L   +KL+A R    ++GYG+ RI+ FF+ QMW+EGFTV G
Sbjct  83    GVPSRLLDDIEFLTGSLFQLPVHRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIG  142

Query  581   SPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGL  739
             SPL+   +     +  +C ++++Y+  M+ LA  L  L    +    + I W    +   
Sbjct  143   SPLDDFHKLWPRQHLKYCKIIQEYEEHMQKLAAKLMWLALGALGVEEKDIEW-AGPISDF  201

Query  740   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  919
             Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQ++  ++ WI V P 
Sbjct  202   QGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQIFRDDVGWITVPPV  260

Query  920   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1099
               ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  KL+ P 
Sbjct  261   PGSLVVNVGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPL  320

Query  1100  EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               P+Y  ++W  YL  K  +F ++L  I
Sbjct  321   HSPLYPSLTWKQYLATKATHFNQSLSFI  348



>gb|AFK49394.1| unknown [Lotus japonicus]
Length=362

 Score =   264 bits (675),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 145/344 (42%), Positives = 197/344 (57%), Gaps = 23/344 (7%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIW---LDDHSP--VNSSSTQESVPVIDLYDPQAVNKIKIAC  367
             +  IIP+DF+ A  LP SH W    DDH    +++S+   S+P+IDL DP A+  I  AC
Sbjct  21    LHHIIPLDFSSAPNLPESHAWSLSKDDHDDDYLSNSNGSPSIPIIDLMDPNAMELIGHAC  80

Query  368   ETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDS  547
             E WG FQ+ NHGIP++++  +E + +R F L  + KL+A RS G  TGYG  RIS FF  
Sbjct  81    ENWGAFQLKNHGIPLSIIQEVENEAKRLFALPADHKLKALRSSGGATGYGSARISPFFPK  140

Query  548   QMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW  715
              MW EGFT+ GSP E  ++    DY+ FC ++E+YQ QM+ LA+ L  +M   +      
Sbjct  141   FMWHEGFTIMGSPSEDVKKIWPNDYARFCDLMENYQKQMKVLAEQLTRMMLNFLDI----  196

Query  716   *RCGMVGLQW-------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGL  874
                G    QW           +Q N+ P CPDPTRAMG A HTDTSL T+L+QT   TGL
Sbjct  197   -SNGENKSQWDIGSSSNMCGVVQPNFYPPCPDPTRAMGLAPHTDTSLFTILHQTQTATGL  255

Query  875   QVYGPNLN-WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1051
             QV+      W+ V P+ N +VVN GDL  I+SN  F+  LHR   +K   R SVAYF  P
Sbjct  256   QVFNEGTKAWVPVHPHRNLLVVNTGDLFHIMSNARFRCALHRVTTNKTVQRYSVAYFHCP  315

Query  1052  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +  + P +  +       +R ++   Y+ IK K FG+AL +I
Sbjct  316   PSDYVVFPLVGGVN-NSVARFRGVTVKEYVGIKSKNFGEALSLI  358



>emb|CDY37589.1| BnaA02g19810D [Brassica napus]
Length=358

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/328 (41%), Positives = 199/328 (61%), Gaps = 10/328 (3%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             DF     LP S+ W   D    ++SS+ ES+P IDL DP    ++  AC TWG FQ+TNH
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSASSSDESLPFIDLSDPHVATRVGHACTTWGAFQITNH  82

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             G+P  LL  +E  T   F+L   +KL+A R    ++GYG+ RI+ FF+ QMW+EGFTV G
Sbjct  83    GVPSRLLDDIEFLTGSLFQLPVNRKLKAARREDGISGYGVARIASFFNKQMWSEGFTVIG  142

Query  581   SPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGL  739
             SPL+   +     +  +C ++++Y+  M+ LA  L  L    +    + I W    +   
Sbjct  143   SPLDDFHKLWPRQHLKYCKIIQEYEEHMQKLAAKLMWLALGALGVEEKDIEW-AGPISDF  201

Query  740   QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPN  919
             Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQ++  ++ WI V P 
Sbjct  202   QGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLLTILYQ-NNTAGLQIFRDDVGWITVPPV  260

Query  920   SNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1099
               ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  KL+ P 
Sbjct  261   PGSLVVNVGDLLHILTNGIFPSVLHRARVNHLRSRFSMAYLWGPPSDLMISPLPKLVDPL  320

Query  1100  EFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               P+Y  ++W  YL  K  +F ++L  I
Sbjct  321   HSPLYPSLTWKQYLATKATHFNQSLSFI  348



>ref|XP_004498636.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Cicer arietinum]
Length=361

 Score =   264 bits (674),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/340 (40%), Positives = 201/340 (59%), Gaps = 18/340 (5%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIW------LDDH--SPVNSSSTQESVPVIDLYDPQAVNKI  355
              +  IIP+DF+    LP SH W       +DH  S +N    +  +P+IDL DP A+ +I
Sbjct  15    HLHHIIPLDFSSFRTLPDSHAWPQSNDDCNDHLTSNINGCFDESCIPIIDLNDPNAMEQI  74

Query  356   KIACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISR  535
              +ACE WG FQ+ NHGIP+ L+  +EE+ +RFF L  ++K++A RS G  TGYG  RIS 
Sbjct  75    GLACEKWGAFQLRNHGIPLNLIEEVEEEAKRFFSLPSKEKVKALRSSGGATGYGRARISP  134

Query  536   FFDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIR  703
             FF   MW EGFT+ GSP   A++    DY  FC  +E+Y+ QM+ L++ +  ++F   I 
Sbjct  135   FFPKYMWHEGFTIMGSPSNDAKKIWPNDYKRFCDKMENYENQMKMLSEKVTKMIFN--IL  192

Query  704   PICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
              I       VG       +Q+N+ P CPDP +AMG A HTDTSL+T+L+Q S  +GLQ++
Sbjct  193   GISQQENKWVGSNNHCGAIQLNFYPSCPDPNKAMGLAPHTDTSLLTILHQ-SQTSGLQIF  251

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                + ++ V P+ N ++V+ GD++ I+SN  F+  LHR +V+   +R SVAYF+ P  + 
Sbjct  252   KEGVGYVPVHPHPNTLIVHTGDILHILSNSRFRCALHRVVVNNVKNRYSVAYFYVPPIDY  311

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              + P    +     P +R +S   Y+ IK K  G AL +I
Sbjct  312   LVQP---FVPTNSLPRFRSLSVKEYIGIKAKNLGGALSLI  348



>emb|CBL59327.1| Gibberellin 3-oxidase [Cucurbita maxima]
Length=350

 Score =   263 bits (673),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 140/341 (41%), Positives = 197/341 (58%), Gaps = 20/341 (6%)
 Frame = +2

Query  200   EIDSIIPMDFNKADQLPHSHIWLDDHSPVNS----SSTQESVPVIDLYDPQAVNKIKIAC  367
              +  I+P+DF+    +P SH W   HS  ++    ++   S+P+ID+ DP     I   C
Sbjct  15    HLHHIVPLDFDSLRTVPDSHDW--PHSSYDTLKLHTNGDVSIPLIDMSDPNVAMLIGNVC  72

Query  368   ETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDS  547
             +TWG+FQ+TNHG+P +L+ R E +  R F+L   +KL+A R+PG  TGYG+PRI+ FF  
Sbjct  73    KTWGVFQLTNHGVPTSLVERAEAEAGRLFDLPMTRKLKALRAPGDATGYGLPRITPFFSK  132

Query  548   QMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP---  706
              MW EGFT+ GS  EHA Q    +Y  FC V+E+YQ  M+ LA+ +  L+   +  P   
Sbjct  133   YMWHEGFTIMGSSAEHASQLWSSNYQPFCDVMEEYQKNMKSLAEKITHLILNFLKIPDDA  192

Query  707   --ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  880
                 W          + A LQ+N  P CPDPTR MG A HTDT L+T+L+Q+S   GLQ+
Sbjct  193   EISNWLHSAGAAAACSTA-LQLNCYPRCPDPTRVMGLAPHTDTFLLTILHQSST-CGLQI  250

Query  881   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1060
             +     WI V P + A+V+N+GDL  I+SNG F +VLHR +V     R+S+AYFFGP  +
Sbjct  251   FRDGFGWIPVTPVAGALVLNVGDLFHILSNGRFPNVLHRVVVDPTRRRLSMAYFFGPPPD  310

Query  1061  VEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               + P      P E P +R +    Y+ +K K    AL MI
Sbjct  311   FCVTP---FNNPPESPRFRSVVVKEYVGLKAKNLECALSMI  348



>gb|ADK71017.1| gibberellin 3-beta-hydroxylase [Trigonella gladiata]
Length=301

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 140/301 (47%), Positives = 187/301 (62%), Gaps = 12/301 (4%)
 Frame = +2

Query  254   SHIW--LDDHSPVNSSSTQES--VPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALL  421
             S+ W  LDDH+  NS++   S  VPVIDL DP A   I  AC+TWG++QV NHGIP++LL
Sbjct  2     SYTWTHLDDHTLNNSNTNTSSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLL  61

Query  422   TRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR  601
               +    +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R
Sbjct  62    DDIHCLGQTLFSLPSHQKLKAIRSPDGVSGYGLARISTFFPKLMWSEGFTIVGSPLDHFR  121

Query  602   ----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  760
                 QDY+ +C +V  Y   M+ LA  L +LM   +      I W       ++   A L
Sbjct  122   QLWPQDYAKYCDIVLQYDETMKKLAGKLMSLMLDSLGITKEDIKWASSKAQFVENASAAL  181

Query  761   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  940
             Q+N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN
Sbjct  182   QLNSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLQGGLVVN  240

Query  941   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRP  1120
             +GDL  I+SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+ P+YR 
Sbjct  241   VGDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQPPLYRS  300

Query  1121  I  1123
             +
Sbjct  301   V  301



>ref|XP_010439443.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=353

 Score =   263 bits (671),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/353 (42%), Positives = 205/353 (58%), Gaps = 46/353 (13%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIW-LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGI  382
             D IIP+DF     LP+SH+W + +  P   S     +PVI L +P     ++ ACE WG+
Sbjct  16    DRIIPLDFTNTKTLPNSHVWSITEPEPKTMSL---PIPVISLSNPDQHVLLRQACEEWGV  72

Query  383   FQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTE  562
             F +T+HG+P +LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+E
Sbjct  73    FHITDHGVPRSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSE  132

Query  563   GFTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  727
             GF+V GS L  HA      D+++FC+V+E+YQ  M DL+  L  ++             G
Sbjct  133   GFSVLGSSLRRHATLLWPDDHAEFCNVMEEYQKAMDDLSLRLITMLM------------G  180

Query  728   MVGLQ-----W--------------TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLY  850
              +GL      W               Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LY
Sbjct  181   SLGLTHEDLGWLVPDKTGSGTDSNSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILY  240

Query  851   QTSNITGLQVYGP---NLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHH  1021
             Q  NI GL++  P      WI VEP   ++V+ +GDL  IISNG F++ +HRA+V+K HH
Sbjct  241   Q-GNIPGLEIQSPQEEGSRWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHH  299

Query  1022  RISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             R+S AYF GP KN++I P L   K    P+YR + W  YL  K  +F +AL +
Sbjct  300   RVSAAYFAGPPKNLQIGP-LACDK-NHPPIYRRLLWEEYLAAKATHFNRALTL  350



>gb|AGH39956.1| gibberellin 3-beta-hydroxylase [Medicago archiducis-nicolai]
Length=299

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 183/295 (62%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSS------STQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS+      +T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  6     LDDHTLINSNNIMKENTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDD  65

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  66    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  125

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  126   WPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQL  185

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  186   NSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVG  244

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   ++SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  245   DLFHILSNGLYPSVLHRGLVNRTRQKVSVAYLYGPPSNVEICPHEKLVGPTQPPL  299



>gb|AGH39959.1| gibberellin 3-beta-hydroxylase [Medicago ruthenica]
Length=299

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 182/295 (62%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVN------SSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +N       S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  6     LDDHTLINPNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDD  65

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  66    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  125

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  126   WPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQL  185

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  186   NSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVG  244

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI+P  KL+ PT+ P+
Sbjct  245   DLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKLVGPTQPPL  299



>gb|ADK70985.1| gibberellin 3-beta-hydroxylase [Medicago platycarpos]
Length=295

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/292 (47%), Positives = 181/292 (62%), Gaps = 14/292 (5%)
 Frame = +2

Query  266   LDDHSPVNS------SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS      S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNIMKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDD  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1102
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI+P  KL+ PT+
Sbjct  244   DLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEISPHEKLVGPTQ  295



>ref|XP_006450547.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
 gb|ESR63787.1| hypothetical protein CICLE_v10010629mg [Citrus clementina]
Length=342

 Score =   261 bits (668),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 139/329 (42%), Positives = 198/329 (60%), Gaps = 14/329 (4%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             IIP+DFN    LP SH W       ++   + SVPVIDL DP+    I  ACE WG+FQ+
Sbjct  21    IIPIDFNSVCSLPESHKWPKSDDLYDN---KISVPVIDLRDPRVAQLIGRACEKWGVFQL  77

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
               HGIP+ LL   E + RR F L   QKL+A R+P   TGYGI RI+ FFD  MW EGFT
Sbjct  78    IYHGIPLNLLKDAESEARRLFSLPSRQKLKALRAPAGATGYGIARITPFFDKYMWHEGFT  137

Query  572   VAGSPL-EHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVG  736
             + G+ + +HA+Q    +++ FC V+E YQ +M  LA  L  L+FK +   I   +   + 
Sbjct  138   IMGTSIHDHAKQLWPHNHAKFCDVMETYQKKMNILADQLTQLIFKSL--DISEEQAEEMN  195

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
                + + LQ+N  P CP+P RA+G A HTDTSL+T+L++ S I GLQ++   + W+ V+P
Sbjct  196   WVGSSSALQLNSYPSCPEPNRAVGLAPHTDTSLITILHENS-IAGLQIFKQEVGWVSVKP  254

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
                A+VVN+GDL  I+SN  F +VLHR  V++   R+S+AYF+ P  +  + P   ++K 
Sbjct  255   VDGALVVNVGDLFHILSNARFPNVLHRVSVNQKRQRLSLAYFYNPPTDSTVVP---IVKS  311

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              +   YRP++   ++ +K K   KAL  I
Sbjct  312   GQVARYRPVTVKEFISLKAKSPEKALSCI  340



>gb|ADK70973.1| gibberellin 3-beta-hydroxylase [Medicago lupulina]
Length=292

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/289 (46%), Positives = 178/289 (62%), Gaps = 8/289 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +  S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  5     LDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF    W+EGFT+ GSPL+H +    QDY+
Sbjct  65    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLKWSEGFTIVGSPLDHFQQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
              +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q +NI+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NNISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  292



>gb|ADK71024.1| gibberellin 3-beta-hydroxylase [Trifolium incarnatum]
Length=299

 Score =   259 bits (663),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 138/300 (46%), Positives = 185/300 (62%), Gaps = 18/300 (6%)
 Frame = +2

Query  254   SHIW--LDDHSPVNSSSTQES------VPVIDLYDPQAVNKIKIACETWGIFQVTNHGIP  409
             S+ W  LDDH+ +NS++  +       VP+IDL DP A   I  AC+TWG++QV NHGIP
Sbjct  3     SYTWTNLDDHT-INSNNIMKDSSSXSSVPIIDLSDPNASKLIGHACKTWGVYQVVNHGIP  61

Query  410   VALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPL  589
             ++LL  ++   +  F L   QKL+A RSP  VTGYG+ RIS FF   MW+EGFT+ GSPL
Sbjct  62    LSLLDDIQWVGQTLFSLPSHQKLKAIRSPDGVTGYGLARISSFFSKLMWSEGFTIVGSPL  121

Query  590   EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWT  748
             +H R    QDY+ +C +V  Y   M+ LA+ L  LM   +      I W        +  
Sbjct  122   DHFRQLWPQDYAKYCDIVLQYDETMKKLAEKLMLLMLDSLGITKEDIKW-ASSKAQFEKA  180

Query  749   QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNA  928
              A +Q+N  PICPDP RAMG A HTD++ +T+L Q S+I+GLQV      W+ V P    
Sbjct  181   CAAMQLNSYPICPDPDRAMGLAPHTDSTFLTILSQ-SDISGLQVQREGFGWVTVPPLPGG  239

Query  929   IVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   LVVNVGDLFHILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKLVGPTQPP  299



>ref|XP_006476223.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Citrus sinensis]
 gb|KDO79608.1| hypothetical protein CISIN_1g043251mg [Citrus sinensis]
Length=342

 Score =   261 bits (666),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 198/331 (60%), Gaps = 18/331 (5%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             IIP+DFN    LP SH W   DD         + SVPVIDL DP+    I  ACE WG+F
Sbjct  21    IIPIDFNSVCSLPESHKWPKFDD-----LYDNKISVPVIDLRDPRVAQLIGRACEKWGVF  75

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             Q+  HGIP+ +L   E + RR F L   QKL+A R+P   TGYGI RI+ FFD  MW EG
Sbjct  76    QLIYHGIPLNVLKDAESEARRLFSLPSRQKLKALRAPAGATGYGIARITPFFDKYMWHEG  135

Query  566   FTVAGSPL-EHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGM  730
             FT+ G+ + +HA+Q    +++ FC V+E YQ +M  LA  L  L+FK +   I   +   
Sbjct  136   FTIMGTSIHDHAKQLWPHNHAKFCDVMETYQKKMNILADQLTQLIFKSL--DISEEQAEE  193

Query  731   VGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDV  910
             +    + + LQ+N  P CP+P RA+G A HTDTSL+T+L++ S I GLQ++   + W+ V
Sbjct  194   MNWVGSSSALQLNSYPSCPEPNRAVGLAPHTDTSLITILHENS-IAGLQIFKQEVGWVSV  252

Query  911   EPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLI  1090
             +P   A+VVN+GDL  I+SN  F +VLHR  V++   R+S+AYF+ P  +  + P   ++
Sbjct  253   KPVDGALVVNVGDLFHILSNARFPNVLHRVSVNQKRQRLSLAYFYNPPTDSTVVP---IV  309

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             K  +   YRP++   ++ +K K   KAL  I
Sbjct  310   KSGQVARYRPVTVKEFISLKAKSPEKALSCI  340



>gb|AGH39957.1| gibberellin 3-beta-hydroxylase [Medicago edgeworthii]
Length=293

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 178/289 (62%), Gaps = 8/289 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ V  S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  6     LDDHTLVKESTTSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDDIQWLGQ  65

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H +    QDY+
Sbjct  66    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQDYA  125

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  126   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  185

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  186   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHIL  244

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  245   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  293



>gb|ADK71011.1| gibberellin 3-beta-hydroxylase [Trigonella caerulea]
Length=294

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 181/291 (62%), Gaps = 10/291 (3%)
 Frame = +2

Query  266   LDDHSPVNSSS--TQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQ  439
             LDDH+ +NS++   + SVPVIDL DP A   I  AC+TWG+FQV NHGIP++LL  ++  
Sbjct  5     LDDHTLINSNNIMKESSVPVIDLNDPNASKLIGHACKTWGVFQVVNHGIPISLLDDIQWV  64

Query  440   TRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QD  607
              +  F L   QKL+A R P  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QD
Sbjct  65    GQTLFSLPSHQKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQD  124

Query  608   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  778
             Y+ +C +V  Y   M+ LA  L  LM   +      I W       ++   A LQ+N  P
Sbjct  125   YAKYCDIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVENACAALQLNSYP  184

Query  779   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  958
              CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  
Sbjct  185   SCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQQEGFGWVTVPPLHGGLVVNVGDLFH  243

Query  959   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             I+SNG++ SVLHR +V++   R SVAY +G   NVEI P  KL+ PT+ P+
Sbjct  244   ILSNGLYPSVLHRVLVNRTRQRFSVAYLYGAPSNVEICPHEKLVGPTQPPL  294



>ref|XP_010449018.1| PREDICTED: gibberellin 3-beta-dioxygenase 3-like [Camelina sativa]
Length=351

 Score =   261 bits (667),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/339 (42%), Positives = 200/339 (59%), Gaps = 20/339 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             D IIP+DF     LP+SH+W          S    +PVI L +P     ++ ACE WG+F
Sbjct  16    DRIIPLDFTNTKTLPNSHVWSKTEPEPKPMSL--PIPVISLSNPDQHVLLRQACEEWGVF  73

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
              +T+HG+P +LL  +E Q +R F L   +K+ A RSP   TGYG+ RIS F+D  MW+EG
Sbjct  74    HITDHGVPRSLLHNVECQMKRLFSLPMHRKILAVRSPDESTGYGVVRISMFYDKLMWSEG  133

Query  566   FTVAGSPL-EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW--  715
             F+V GS L  HA      D++ FC+V+E+YQ  M DL+  L  ++   +      + W  
Sbjct  134   FSVLGSSLRRHATLLWPDDHAQFCNVMEEYQKAMDDLSLRLITMLMVSLGLTHEDLGWLV  193

Query  716   -*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPN  892
               + G  G    Q++LQ+N  P+CPDP  AMG A HTD+SL+T+LYQ  NI GL++  P 
Sbjct  194   PEKTG-SGTDSIQSFLQLNSYPVCPDPHLAMGLAPHTDSSLLTILYQ-GNIPGLEIQSPQ  251

Query  893   LN---WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
              +   WI VEP   ++V+ +GDL  IISNG F++ +HRA+V+K HHR S A+F GP KN+
Sbjct  252   EDGSKWIGVEPIEGSLVIIMGDLSHIISNGQFRTTMHRAVVNKTHHRFSAAFFAGPPKNL  311

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEM  1180
             +I P          P+YR + W  YL  K  +F KAL +
Sbjct  312   QIGPLTG--DKNHPPIYRRLIWEEYLAAKATHFNKALTL  348



>gb|ADK70993.1| gibberellin 3-beta-hydroxylase [Medicago sativa]
Length=298

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 182/295 (62%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV G    W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQGEGSGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>ref|XP_006389781.1| hypothetical protein EUTSA_v10019663mg [Eutrema salsugineum]
 gb|ESQ27067.1| hypothetical protein EUTSA_v10019663mg [Eutrema salsugineum]
Length=351

 Score =   261 bits (666),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/334 (41%), Positives = 200/334 (60%), Gaps = 15/334 (4%)
 Frame = +2

Query  224   DFNKADQLPHSHIW----LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQV  391
             D      LP S  W     D     +S + +ES+P+IDL DP     +  AC+TWG FQ+
Sbjct  12    DLGSLQTLPESFTWKLTGADSVLSPSSETVEESIPLIDLSDPDVTTLLGNACKTWGAFQI  71

Query  392   TNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFT  571
              NHGI   LL  +E  ++ FF++  E+KL A  S   V+GYG PRIS FF  +MW+EGFT
Sbjct  72    ANHGISQKLLDDIESLSKTFFDMPSEKKLEAASSDKGVSGYGEPRISLFFKKKMWSEGFT  131

Query  572   VA-GSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RC  724
             +A GS   H       D++ +C ++E+Y+ +M  LA  L   +   +   +  I W  + 
Sbjct  132   IADGSYRNHFLSLWPHDFTKYCGIIEEYEGEMEKLASRLLCCILGSLGVTVDDIEWAYKA  191

Query  725   GMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWI  904
                G +  +  +++N  P+CP+P RA+G A HTD++++T+L+Q SN+ GLQV+     W+
Sbjct  192   KNSGSKVGRRAIRLNHYPVCPEPERAIGLAAHTDSTILTILHQ-SNMGGLQVFREECGWV  250

Query  905   DVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSL  1081
              VEP   A+VVN+GDL  I+SNG   SV+HRA V+    RIS+AY + GP+ +VEI P  
Sbjct  251   TVEPVPGALVVNIGDLFHILSNGKIPSVIHRARVNHNRSRISIAYLWGGPAGDVEIRPIS  310

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             K++ P    +YRPI+WN YL IKY+ F KAL+ I
Sbjct  311   KIVGPVGPSLYRPITWNEYLRIKYQVFDKALDAI  344



>ref|XP_004291424.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score =   260 bits (665),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 140/337 (42%), Positives = 196/337 (58%), Gaps = 15/337 (4%)
 Frame = +2

Query  194   NQEIDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACET  373
             +Q    +IP+DF  A  LP S++W +    + S + Q+S+PVIDL DP A   I  ACET
Sbjct  6     DQAYKDVIPLDFTSAKTLPDSYVWPESDD-LYSGTDQQSIPVIDLMDPNATQLIIQACET  64

Query  374   WGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSV-TGYGIPRISRFFDSQ  550
             WG+FQ+ NHGIP  L+  +E QT R F L  EQKL+  R+PG V TGYG P        +
Sbjct  65    WGVFQLINHGIPQKLVEDVESQTHRLFALPAEQKLKTLRTPGKVSTGYGNPPSQALLPRK  124

Query  551   MWTEGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*  718
             +W EGFT+ GSP + A+     D+  FC +++DYQ Q R LA+ L   +F  +   + W 
Sbjct  125   LWQEGFTIMGSPADQAKVLWPNDHQGFCDIMDDYQKQARGLAEQLIRTIFIFLTIKVNW-  183

Query  719   RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLN  898
                       QA LQ+N  P CPDPTR +G   HTD+SL+T+L+  S   GLQV+   + 
Sbjct  184   ---FDDPTMCQAALQLNSFPPCPDPTRVLGLPPHTDSSLLTILH--SRTEGLQVFK-GVG  237

Query  899   WIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPS  1078
             WI V+PN  +++VN+GDL+ I+SNG F SV HRA V +  HRISVAYF+    +  ++P 
Sbjct  238   WITVQPNPESLIVNVGDLLHILSNGRFVSVFHRAAVVQKKHRISVAYFYWSPLDCTVSPL  297

Query  1079  LK--LIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             L        + P YR ++   Y  +K K+    L ++
Sbjct  298   LSKNFADSKQVPKYRSVTSKEYHVLKAKHSRDTLSVV  334



>gb|ADK70977.1| gibberellin 3-beta-hydroxylase [Medicago minima]
Length=286

 Score =   258 bits (660),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 177/287 (62%), Gaps = 8/287 (3%)
 Frame = +2

Query  269   DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTRR  448
             DDH+ V  S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   + 
Sbjct  1     DDHTLVKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQT  60

Query  449   FFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYSD  616
              F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    Q+Y+ 
Sbjct  61    LFTLPSHQKLKAIRSPDGVSGYGLARISSFFTKLMWSEGFTIVGSPLDHFRQLWPQEYAK  120

Query  617   FCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PICP  787
             +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P CP
Sbjct  121   YCDTVLQYDEAMKKLAGKLMWLMLDSLGIAMEDIKWAGSKAQFDEKACAAMQLNSYPSCP  180

Query  788   DPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQIIS  967
             DP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+S
Sbjct  181   DPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHILS  239

Query  968   NGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             NG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   NGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  286



>ref|XP_007221040.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
 gb|EMJ22239.1| hypothetical protein PRUPE_ppa015241mg [Prunus persica]
Length=356

 Score =   261 bits (666),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 195/330 (59%), Gaps = 17/330 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +P DF    ++P  + W  L++H  ++S    +SVP+IDL DP A   I  AC TWG+FQ
Sbjct  23    VPDDFKSLHEIPEEYAWTNLNEHPSLDS----DSVPIIDLNDPNASQLISHACTTWGVFQ  78

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P  ++  ME   +  F L  EQKL+A R PG ++GYG   IS F+D ++W+E F
Sbjct  79    LINHGVPNNVVEDMESVAQSLFSLPAEQKLKAARGPGGISGYGPQLISAFWDKKLWSECF  138

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPLEH      Q Y+  CS+ E+Y  ++  L   L  +M   +      + W   G
Sbjct  139   TILGSPLEHYAKLWPQGYTKICSITEEYDKELGRLCSRLMWIMLASLGISKEDVKW--SG  196

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
               G       LQ+N  P CPDP RAMG   HTD++LVT+++Q S I GLQV+     W  
Sbjct  197   PKGDNQEAHVLQLNSYPACPDPDRAMGLVAHTDSTLVTIVHQ-SKICGLQVFQEGTGWFT  255

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDLM I+SNG + SVLHR +V++   R+SV Y +GP  NV I+P  KL
Sbjct  256   VPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQPRLSVVYTYGPPDNVPISPIPKL  315

Query  1088  IKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1174
             +  +   +Y P++ W+ Y+D K K  GKAL
Sbjct  316   LSASHPALYPPVTNWSEYIDTKTKLKGKAL  345



>gb|ADK71023.1| gibberellin 3-beta-hydroxylase [Trifolium albopurpureum]
Length=292

 Score =   258 bits (660),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 135/291 (46%), Positives = 182/291 (63%), Gaps = 13/291 (4%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE---SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEE  436
             LDDH+  NS++  +   SVP+IDL DP A   I  AC+TWG++QV NHGIP++LL  ++ 
Sbjct  4     LDDHT-TNSNNIMKDPSSVPIIDLSDPNASKLIGHACKTWGVYQVVNHGIPLSLLDDIQW  62

Query  437   QTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----Q  604
               +  F L   QKL+A RSP  VTGYG+ RIS FF   MW+EGFT+ GSPL+H +    Q
Sbjct  63    VGQTLFSLPSHQKLKAIRSPDGVTGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQ  122

Query  605   DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*  775
             DY+ +C +V  Y   M+ LA+ L  LM   +      I W        +   A +Q+N  
Sbjct  123   DYAKYCDIVLQYDGAMKKLAEKLMLLMLDSLGITKEDIIW-ANSKAQFEKACAAMQLNSY  181

Query  776   PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLM  955
             PICPDP RAMG A HTD++ +T+L Q S+I+GLQV      W+ V P    +V+N+GDL 
Sbjct  182   PICPDPDRAMGLAPHTDSTFLTILSQ-SDISGLQVQREGFGWVTVPPLHGGLVINVGDLF  240

Query  956   QIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
              I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  241   HILSNGLYPSVLHRVLVNRIRQRFSVAYLYGPPSNVEICPHAKLVGPTQPP  291



>gb|ADK71002.1| gibberellin 3-beta-hydroxylase [Medicago tenoreana]
Length=287

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/285 (46%), Positives = 176/285 (62%), Gaps = 8/285 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +  S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  4     LDDHTLIKESTTNSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  63

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H +    QDY+
Sbjct  64    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQDYA  123

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
              +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  124   KYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  183

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  184   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVGDLFHIL  242

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPT  1099
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT
Sbjct  243   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPT  287



>ref|XP_002887836.1| gibberellin 3-oxidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64095.1| gibberellin 3-oxidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 197/331 (60%), Gaps = 19/331 (6%)
 Frame = +2

Query  245   LPHSHIW--------LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNH  400
             LP S  W        L   S V+S + +ES+PVIDL DP     I  AC+TWG FQ+ NH
Sbjct  19    LPDSFTWKLTAADSVLPPSSAVSSGTVEESIPVIDLSDPDVTTLIGNACKTWGAFQIANH  78

Query  401   GIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAG  580
             GI   LL  +E  ++  F++  E+KL A  S   V+GYG PRIS FF+ +MW+EGFT+A 
Sbjct  79    GISQKLLDDIESLSKTLFDMPSERKLEAASSDKGVSGYGEPRISPFFEKKMWSEGFTIAD  138

Query  581   SPLEHA-----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RCGMV  733
             +   +        D++ +C ++E+Y  +M  LA  L + +   +   +  I W  +    
Sbjct  139   ASYRNHFISLWPHDHTKYCGIMEEYVDEMEKLASKLVSCILGSLGVTVEDIGWAHKLEKS  198

Query  734   GLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVE  913
             G +  +  +++N  P+CP+P RAMG A HTD++++T+L+Q SN  GLQV+     WI VE
Sbjct  199   GSKVGRGAIRLNHYPVCPEPERAMGLAAHTDSTILTILHQ-SNTGGLQVFREESGWITVE  257

Query  914   PNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSLKLI  1090
             P    +VVN+GDL  I+SNG   SV+HRA V+    RIS+AY + GP+  V+IAP  KLI
Sbjct  258   PVPGVLVVNMGDLFHILSNGKIPSVVHRAKVNHTRSRISIAYLWGGPAGEVQIAPISKLI  317

Query  1091  KPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              P E  +YR I+W  YL IKY+ F KAL+ I
Sbjct  318   GPVEPSLYRSITWKEYLQIKYEVFDKALDAI  348



>gb|KFK42430.1| hypothetical protein AALP_AA2G255300 [Arabis alpina]
Length=354

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/329 (41%), Positives = 201/329 (61%), Gaps = 11/329 (3%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             DF     LP S+ W   DD     +S++ +S+P I+L DP    ++  AC TWG FQVTN
Sbjct  23    DFTSLRHLPDSYTWTPKDDLLFSAASASDQSLPSINLDDPHLATRVGHACATWGAFQVTN  82

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P  LL  +E  T   F L   +KL+A RS   V+GYG+ RI+ FF+ QMW+EGFTV 
Sbjct  83    HGVPSRLLDDIEFLTGSLFRLPVHRKLKAARSENGVSGYGVARIASFFNKQMWSEGFTVI  142

Query  578   GSPLEHARQDYSD----FCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVG  736
             GSPL+  R+ + +    +C ++++Y+  M+ LA  L  L    +    + I W       
Sbjct  143   GSPLDDFRKLWPNHHVKYCEIIKEYEEHMQKLAAKLMWLALGSLGVEEKDIKW-AWPSSD  201

Query  737   LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEP  916
              Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ ++  GLQV+  ++ W+ V P
Sbjct  202   FQGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLLTILYQ-NDTAGLQVFRDDVGWVTVPP  260

Query  917   NSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKP  1096
                ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  +L+ P
Sbjct  261   VPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDLMISPLPQLVDP  320

Query  1097  TEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
              + P+Y  ++W  YL  K  +F ++L  I
Sbjct  321   LQSPLYPSLTWKQYLATKATHFNQSLSFI  349



>gb|ADK71010.1| gibberellin 3-beta-hydroxylase [Trigonella calliceras]
Length=299

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/296 (46%), Positives = 185/296 (63%), Gaps = 15/296 (5%)
 Frame = +2

Query  266   LDDHSPVNS-------SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLT  424
             LDDH+ +NS       ++T  +VPVIDL DP A   I  AC+TWG++QV NHGIP++LL 
Sbjct  5     LDDHTLINSNNIMKESTTTTTNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPLSLLD  64

Query  425   RMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR-  601
              ++   +  F L   +KL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R 
Sbjct  65    DIQWVGQTLFSLPSHEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQ  124

Query  602   ---QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQ  763
                QD++ +C +V  Y   M+ LA  L  LM   +      I W        + + A +Q
Sbjct  125   LWPQDHAKYCDIVLQYDEPMKKLAGKLMWLMLDSLGITKDDIKWASSKAQFEEKSCAAMQ  184

Query  764   MNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNL  943
             +N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    L W+ V P    +VVN+
Sbjct  185   LNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGLGWVTVPPLXGGLVVNV  243

Query  944   GDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             GDL  I+SNG++ SVLHRA+V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   GDLFHILSNGLYTSVLHRALVNRTRQRFSVAYLYGPPSNVEICPHAKLVGPTQPPL  299



>ref|XP_006301563.1| hypothetical protein CARUB_v10021997mg [Capsella rubella]
 gb|EOA34461.1| hypothetical protein CARUB_v10021997mg [Capsella rubella]
Length=354

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 137/342 (40%), Positives = 204/342 (60%), Gaps = 17/342 (5%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIW----LDDHSPVNSSSTQESVPVIDLYDPQA--VNKIKIAC  367
             + I   +      +P S  W     D   P +S+  +ES+PVIDL DP A  +  I  AC
Sbjct  6     EEICTGNLGSLQTIPDSFTWNVTAEDSVLPPSSAGVEESIPVIDLSDPDATTIQLIGNAC  65

Query  368   ETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDS  547
             +TWG FQV NHGI   LL  +E  ++  F++  E+KL A  S   ++GYG PRIS FF+ 
Sbjct  66    QTWGAFQVANHGISQKLLDDIESLSKTLFDMPSERKLEAASSDKGISGYGEPRISSFFEK  125

Query  548   QMWTEGFTVAGSPLEHA-----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IR  703
             +MW+EGFT+A S   +       QD++++C +VE+Y+ +M  LA  L   +   +   + 
Sbjct  126   KMWSEGFTIADSSYRNHFITLWPQDHTNYCRIVEEYKDEMEKLANRLLCCILGSLGVTVD  185

Query  704   PICW-*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  880
              I W  + G  G +  +  +++N  P+CP+P RAMG A HTD++++T+L+Q SN  GLQV
Sbjct  186   DIGWGQKAGNSGTKLERGAIRLNHYPVCPEPERAMGLAAHTDSTMLTILHQ-SNTGGLQV  244

Query  881   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSK  1057
                   W+ V+P    +VVN+GDL+ I+SNG  +SV+HRA V++   RIS+AY + GP+ 
Sbjct  245   LREESGWVKVDPRPGNLVVNMGDLIHILSNGKIQSVVHRAKVNQTRSRISIAYLWGGPAG  304

Query  1058  NVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             +VEI P  K+I P    +YR ++W  YL IK + F KAL+ I
Sbjct  305   DVEIKPISKIIGPLGTSLYRSVTWKEYLQIKCEVFDKALDAI  346



>ref|XP_003588693.1| Gibberellin 3-beta-dioxygenase [Medicago truncatula]
 gb|AES58944.1| gibberellin 2-beta-dioxygenase [Medicago truncatula]
Length=359

 Score =   260 bits (665),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 138/339 (41%), Positives = 195/339 (58%), Gaps = 21/339 (6%)
 Frame = +2

Query  212   IIPMDFNKADQLPHSHIWL---DDHSPV--------NSSSTQESVPVIDLYDPQAVNKIK  358
             IIP+DF+    LP SH W    DD S          N       +P+IDL DP A+ +I 
Sbjct  19    IIPLDFSSFRTLPDSHAWPQSNDDGSDNFTSNGCYDNDDEDGSCIPIIDLNDPNAMEQIG  78

Query  359   IACETWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRF  538
             +ACE WG FQ+ NHGIP+  +  +EE+ +R F L  ++KL+A RS G  TGYG  RIS F
Sbjct  79    LACEKWGAFQLKNHGIPLNFIEEVEEEAKRLFSLPSKEKLKALRSAGGGTGYGRARISPF  138

Query  539   FDSQMWTEGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRP  706
             F   MW EGFT+ GSP   A++    DY  FC  +E+YQ QM+ LA+ L  ++    I  
Sbjct  139   FPKFMWHEGFTIMGSPSNDAKKIWPNDYKRFCDTMENYQKQMKTLAEKLTNMILN--ILG  196

Query  707   ICW*RCGMVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYG  886
             I   +   +G       +Q+N+ P CPDP +AMG A HTDTSL T+L+Q S   GLQ++ 
Sbjct  197   ISQEQNKWIGSNNHVGAMQLNFYPCCPDPKKAMGLAPHTDTSLFTILHQ-SQTNGLQLFK  255

Query  887   PNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVE  1066
               + ++ V+P+ N +VVN GD++ I+SN  F+  LHR +V+    R SVAYF+GP  +  
Sbjct  256   EGVGYVPVDPHPNTLVVNTGDILHILSNSRFRCSLHRVVVNDISDRYSVAYFYGPPVDYL  315

Query  1067  IAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             ++P    +     P +R ++   Y+ IK K  G AL +I
Sbjct  316   VSPC---VGDNSLPRFRALTVKDYIGIKAKNLGGALSLI  351



>gb|ADK70986.1| gibberellin 3-beta-hydroxylase [Medicago polyceratia]
Length=291

 Score =   258 bits (658),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/289 (46%), Positives = 178/289 (62%), Gaps = 9/289 (3%)
 Frame = +2

Query  266   LDDHSPV-NSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQT  442
             LDDH+P+   S+   SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   
Sbjct  4     LDDHTPIMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLG  63

Query  443   RRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDY  610
             +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY
Sbjct  64    QTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRLLWPQDY  123

Query  611   SDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PI  781
             +  C  V  Y   M+ LA  L  LM + +   +  I W        +   A +Q+N  P 
Sbjct  124   AKHCETVLQYDEAMKKLAGKLMWLMLESLGITMEDIKWAGSKAQFDEKANAAMQLNSYPS  183

Query  782   CPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQI  961
             CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I
Sbjct  184   CPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHI  242

Query  962   ISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             +SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  243   LSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>ref|XP_008231797.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Prunus mume]
Length=356

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 194/330 (59%), Gaps = 17/330 (5%)
 Frame = +2

Query  215   IPMDFNKADQLPHSHIW--LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQ  388
             +P DF    ++P  + W  L++H  ++S    +SVP+IDL DP A   I  AC TWG+FQ
Sbjct  23    VPDDFKSLHEIPEEYAWTNLNEHPSLDS----DSVPIIDLNDPNASQLISHACRTWGVFQ  78

Query  389   VTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGF  568
             + NHG+P  ++  ME   +  F L  EQKL+  R PG ++GYG+  +S F D ++W+E F
Sbjct  79    LINHGVPNNVVEDMESVAQSLFSLPAEQKLKVARGPGGISGYGLHLVSAFLDKKLWSECF  138

Query  569   TVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCG  727
             T+ GSPLEH      Q Y+  CS+ E+Y  ++  L+  L  +M   +      + W   G
Sbjct  139   TILGSPLEHYAKLWPQGYTKICSITEEYDKELGRLSSRLMWIMLASLGISKEDVKW--SG  196

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
               G       LQ+N  P CPDP R MG   HTD++LVT+++Q S I GLQV+     W  
Sbjct  197   PKGDNHEAHVLQLNSYPACPDPDRVMGLVPHTDSTLVTIVHQ-SKICGLQVFQEGTGWFT  255

Query  908   VEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKL  1087
             V P   A+VVN+GDLM I+SNG + SVLHR +V++   R+SV Y +GP  NV I+P  KL
Sbjct  256   VPPVPGAMVVNVGDLMHILSNGSYVSVLHRVLVNQTQQRLSVVYTYGPPDNVPISPIPKL  315

Query  1088  IKPTEFPMYRPIS-WNAYLDIKYKYFGKAL  1174
             +  +   +Y P++ W+ Y+D K K  GKAL
Sbjct  316   LSASHPALYPPVTNWSEYIDTKTKLKGKAL  345



>ref|XP_004229097.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum lycopersicum]
Length=348

 Score =   259 bits (663),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/334 (40%), Positives = 198/334 (59%), Gaps = 11/334 (3%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWG  379
             +  I+P+DF    ++P+SH+W + ++ P + +    +VP+IDL DP  V  +  AC+TWG
Sbjct  17    LQHILPIDFQSIQEVPNSHLWPNINNVPTSHNDKNPNVPIIDLIDPNVVELMGHACKTWG  76

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             IFQV NHGI +     +E Q RR F L  EQK++  RS   VTGYG  RI+ FF   MW 
Sbjct  77    IFQVVNHGISLKYFDEVESQARRLFALPTEQKVKVVRSTNGVTGYGTARITPFFSKFMWH  136

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  727
             EGFT+  SPL+HA++    DY  FC V+E+YQ +M+ L+  L   +    ++P       
Sbjct  137   EGFTIVDSPLDHAKELWPNDYKKFCDVMENYQTKMKVLSFQLCMFILN-YLQPSH--EHS  193

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
             +   ++  A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W  
Sbjct  194   INSFEFEGA-LQLNSYPCCPNPYHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGWTS  252

Query  908   VEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
             + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP     I+P + 
Sbjct  253   IAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVESIISPLVS  312

Query  1085  LIKPTEFPM-YRPISWNAYLDIKYKYFGKALEMI  1183
                     + YR ++   YL +K K+  K   MI
Sbjct  313   SQDNDGVVLKYRNVTVKEYLGLKAKHLEKVFSMI  346



>gb|ADK70998.1| gibberellin 3-beta-hydroxylase [Medicago secundiflora]
Length=291

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 177/288 (61%), Gaps = 8/288 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +  S+T   VPVIDL DP A   I  AC+TWG++QV NHGIP+ LL  ++   +
Sbjct  5     LDDHTLIKESNTSSGVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPIGLLDDIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFTLPSQQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYT  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV   +  W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREDSGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             SNG++ SVLHR +V++ + R SVAY +GP  NVEI P  KL+ P + P
Sbjct  244   SNGLYTSVLHRVLVNRTYQRFSVAYLYGPPSNVEICPHEKLVGPNQPP  291



>gb|ADK70964.1| gibberellin 3-beta-hydroxylase [Medicago granadensis]
Length=292

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 177/288 (61%), Gaps = 8/288 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ + +S+T  +VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++    
Sbjct  5     LDDHTLIKNSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGH  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADK70960.1| gibberellin 3-beta-hydroxylase [Medicago ciliaris]
Length=292

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 177/288 (61%), Gaps = 8/288 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +  S+T  +VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  5     LDDHTLIKDSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADK70999.1| gibberellin 3-beta-hydroxylase [Medicago shepardii]
Length=292

 Score =   257 bits (657),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/288 (47%), Positives = 176/288 (61%), Gaps = 8/288 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ V  S+T   VPVIDL DP A   I  AC+TWG++QV NHGIP+ LL  ++   +
Sbjct  5     LDDHTLVKESNTSSGVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPINLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L  +QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFTLPSQQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KQCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADK70983.1| gibberellin 3-beta-hydroxylase [Medicago papillosa]
Length=298

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 182/295 (62%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W++V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQXEGSGWVNVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>gb|ADK70984.1| gibberellin 3-beta-hydroxylase [Medicago pironae]
Length=298

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 181/295 (61%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG+F SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLFTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>ref|XP_004291422.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Fragaria vesca 
subsp. vesca]
Length=353

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 140/344 (41%), Positives = 204/344 (59%), Gaps = 21/344 (6%)
 Frame = +2

Query  206   DSIIPMDFNKADQLPHSHIWL--DDHSPVNSSSTQE---SVPVIDLYDPQAVNKIKIACE  370
             + I+P+DF     +P SH+W   DD     S ST +   SVP+IDL+DP A + I  ACE
Sbjct  11    NHIVPLDFASVQTVPESHVWSESDDEYRCPSGSTADPCLSVPIIDLWDPNATHLIFEACE  70

Query  371   TWGIFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQ  550
              WG+FQ+T HGIP  L+  +E++T+R F L  +QKL+  RSPG+ TGYG   IS FF   
Sbjct  71    KWGVFQLTGHGIPAKLIEEVEDKTQRLFSLPVDQKLKVLRSPGAGTGYGRAMISPFFPKH  130

Query  551   MWTEGFTVAGSPLEHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPI  709
             MW EGFT+ GS  +HA+     DY +FC  +++YQ QM+ L + L  ++ K +    + +
Sbjct  131   MWHEGFTIMGSAADHAKHLWPHDYEEFCVTMDEYQKQMKALIEQLIHIILKSLNISSQKL  190

Query  710   CW*RCGMVGLQWTQ---AYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQV  880
              W +    G   +      LQ+N  P CP+P RAMG AQHTDTSLVT+L   +  +GLQ+
Sbjct  191   SWLKSQCSGHCTSTTPGTALQLNSYPPCPNPNRAMGLAQHTDTSLVTIL--QAQTSGLQI  248

Query  881   YGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKN  1060
             +  ++ WI V+P   A+ VN+GD + I+SNG F +VLHR +V+    R S AYF+GP  +
Sbjct  249   FRDDVGWISVQPVRGALTVNIGDFLHILSNGRFVNVLHRVVVNSI-QRFSAAYFYGPPSD  307

Query  1061  VEIAPSLK--LIKPTE-FPMYRPISWNAYLDIKYKYFGKALEMI  1183
               I+P L   L    E    YR ++   ++ +K K+  + L ++
Sbjct  308   FLISPLLSETLCDSEEAVARYRSVTAKEFIGMKAKHLDRTLSLL  351



>gb|ADK70968.1| gibberellin 3-beta-hydroxylase [Medicago intertexta]
Length=289

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/286 (46%), Positives = 176/286 (62%), Gaps = 8/286 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +  S+T  +VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  5     LDDHTLIKDSTTSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1102
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQ  289



>ref|XP_006389782.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
 gb|ESQ27068.1| hypothetical protein EUTSA_v10019816mg [Eutrema salsugineum]
Length=358

 Score =   259 bits (661),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/334 (41%), Positives = 202/334 (60%), Gaps = 15/334 (4%)
 Frame = +2

Query  215   IPMDFNKAD--QLPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIF  385
             IP+  N AD   LP S+ W  +D    ++S + ES+P IDL DP    ++  AC  WG F
Sbjct  18    IPLS-NLADFRHLPDSYTWTPEDDLLFSASDSDESLPFIDLADPHVAARVGHACTAWGAF  76

Query  386   QVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEG  565
             ++TNHG+P  LL  +E  T   F L   +KL+A RS   ++GYG+ RI+ FF+ QMW+EG
Sbjct  77    RITNHGVPSRLLDDIEFLTGSLFRLPVHRKLKAARSENGISGYGVARIASFFNKQMWSEG  136

Query  566   FTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RC  724
             FTV GSPL+   +     +  +C ++ +Y+  M+ LA  L  L    +    + I W   
Sbjct  137   FTVIGSPLDDFHKLWPMHHLKYCEIITEYEEHMQKLAARLMWLALGSLGVDEKDINW--A  194

Query  725   GMVG-LQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNW  901
             G+    Q  QA +Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQV+  ++ W
Sbjct  195   GLSSDFQGAQAAIQLNHYPICPEPDRAMGLAAHTDSTLMTILYQ-NNTIGLQVFRDDVGW  253

Query  902   IDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSL  1081
             + V P   ++VVN+GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  
Sbjct  254   VTVPPVPGSLVVNVGDLLHILTNGIFPSVLHRARVNHVRSRFSIAYLWGPPSDLMISPLP  313

Query  1082  KLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             KL+ P   P+Y  ++W  YL  K  +F ++L  I
Sbjct  314   KLVNPLHSPLYPSLTWKQYLATKATHFNQSLSFI  347



>gb|ADK70991.1| gibberellin 3-beta-hydroxylase [Medicago rigidula]
Length=291

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/288 (46%), Positives = 175/288 (61%), Gaps = 8/288 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +   +T   VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  5     LDDHTLIKEGTTSSGVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R    QDY+
Sbjct  65    TLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNIGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPP  291



>gb|ADM47338.1| gibberellin 3-oxidase 2 [Marah macrocarpus]
Length=370

 Score =   259 bits (662),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 134/340 (39%), Positives = 195/340 (57%), Gaps = 32/340 (9%)
 Frame = +2

Query  221   MDFNKADQLPHSHIWLD-DHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             +DF+  ++LP ++ W+  D  P  +  +QE +P+IDL  P A   +  A  +WG FQ  N
Sbjct  22    LDFDSFNELPDTYEWVQPDSIPSPNDQSQEHLPLIDLSLPNAAALVGDAFRSWGAFQAIN  81

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P++LL   E      F L P  K +A R+P  V GYG+ RIS FF  +MW+EGFT+ 
Sbjct  82    HGVPISLLHSFESTVDTLFSLPPSDKHKAARTPDGVDGYGLVRISSFFPKRMWSEGFTIL  141

Query  578   GSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCGMVGL--  739
              SPL H ++    DY+  C + E+Y  +MR L   L             W   G +G+  
Sbjct  142   NSPLHHFQKLWPDDYAKHCEIYEEYDREMRSLCARL------------IWLGLGELGITQ  189

Query  740   ------------QWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVY  883
                         +   A  Q+N  PICPDP RAMG   HTDTSL+T++YQ +N +GLQ  
Sbjct  190   DDVELAGPDRDFKTNPAATQLNSYPICPDPERAMGLGAHTDTSLLTIVYQ-NNTSGLQFL  248

Query  884   GPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNV  1063
                  W+ VEP   A+VV +GDL+QI++NG++KS LH+A V++   R+S+AY FG  +  
Sbjct  249   REGNRWVTVEPVDGALVVQVGDLLQIMTNGLYKSPLHQAFVNRTRKRLSMAYIFGTPETA  308

Query  1064  EIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
             EI+P  KL+ PT+ P+YR ++W  YL  K ++F  AL+ +
Sbjct  309   EISPLKKLLGPTQPPIYRTVTWTEYLGKKAEHFNNALKSV  348



>gb|ADK70959.1| gibberellin 3-beta-hydroxylase [Medicago cancellata]
Length=298

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 181/295 (61%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIEWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHXKLVGPTQPPL  298



>ref|XP_002887835.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64094.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   258 bits (660),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/321 (41%), Positives = 198/321 (62%), Gaps = 10/321 (3%)
 Frame = +2

Query  245   LPHSHIWL-DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALL  421
             LP S+ W   D    ++S++ E++P+IDL DP     +  AC TWG  Q++NHG+P  LL
Sbjct  27    LPDSYTWTPKDDLLFSASASDETLPLIDLSDPHVTTLVGHACTTWGALQISNHGVPSRLL  86

Query  422   TRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR  601
               +E  T   F L  ++KL+A RS   V+GYG+ RI+ FF+ +MW+EGFTV GSPL+  R
Sbjct  87    DDIEFLTGSLFRLNVQRKLKAARSENGVSGYGVARIASFFNKKMWSEGFTVIGSPLQDFR  146

Query  602   Q----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYL  760
             +     +  +C ++E+Y   M+ LA  L  L    +    + I W        Q TQA  
Sbjct  147   KLWPSHHLKYCEIIEEYGEHMQKLAAKLMWLALGSLGVEEKDIKW-AGPNSDFQGTQAAT  205

Query  761   QMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVN  940
             Q+N  PICP+P RAMG A HTD++L+T+LYQ +N  GLQV+  ++ W+ V P   ++VVN
Sbjct  206   QLNHYPICPEPDRAMGLAAHTDSTLMTILYQ-NNTAGLQVFRDDVGWVTVPPVPGSLVVN  264

Query  941   LGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPMYRP  1120
             +GDL+ I++NG+F SVLHRA V+    R S+AY +GP  ++ I+P  +L+ P + P+Y  
Sbjct  265   VGDLLHILTNGIFPSVLHRARVNHVRSRFSMAYLWGPPSDIMISPLPRLVDPLQSPLYPS  324

Query  1121  ISWNAYLDIKYKYFGKALEMI  1183
             ++W  YL  K  +F ++L +I
Sbjct  325   LTWKQYLATKATHFNQSLSII  345



>emb|CDY38660.1| BnaC02g23190D [Brassica napus]
Length=351

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/327 (40%), Positives = 203/327 (62%), Gaps = 15/327 (5%)
 Frame = +2

Query  245   LPHSHIW----LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPV  412
             LP S  W     D   P +S++ +E +PVI+L DP     +  AC+TWG FQ+ NHGI  
Sbjct  19    LPDSFTWNFTAADSLLPPSSATVKEFIPVINLSDPDVTTLLGNACKTWGAFQIANHGISQ  78

Query  413   ALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLE  592
             +LL  +E  ++ FF++  E+KL A  S   V+GYG PRIS FF+ +MW+EG T+A     
Sbjct  79    SLLDDVESLSKTFFDMPSERKLEAASSNKGVSGYGEPRISPFFEKKMWSEGLTIADGSYR  138

Query  593   HA-----RQDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW-*RCGMVGLQW  745
             +       +DY+ +C ++E+Y+ +M +LA  L + +   +   +  I W  +    G + 
Sbjct  139   NQFLTIWPRDYTKYCGIIEEYKGEMENLANRLLSCILGSLGVTVDDIEWAQKTEKSGSKM  198

Query  746   TQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSN  925
              +  +++N  P+CP+P RAMG A HTD+ L+T+L+Q SN+ GLQV+     W+ VEP   
Sbjct  199   GRGVIRLNHYPVCPEPERAMGLAAHTDSCLLTILHQ-SNMGGLQVFKEESGWVTVEPIPG  257

Query  926   AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFF-GPSKNVEIAPSLKLIKPTE  1102
              +VVN+GDL  I+SNG F SV+HRA V++   RIS+AY + GP+ +V+I+P  K++ P  
Sbjct  258   VLVVNIGDLFHILSNGKFPSVVHRARVNQTKSRISIAYLWGGPAGDVKISPISKIVGPVG  317

Query  1103  FPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +YRP++W+ YL IK++ F KAL+ I
Sbjct  318   PYLYRPVTWSEYLRIKFEVFDKALDAI  344



>ref|XP_006338004.1| PREDICTED: gibberellin 3-beta-dioxygenase 1-like [Solanum tuberosum]
Length=349

 Score =   258 bits (658),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 135/336 (40%), Positives = 200/336 (60%), Gaps = 10/336 (3%)
 Frame = +2

Query  203   IDSIIPMDFNKADQLPHSHIWLDDHSPVNSSSTQE-SVPVIDLYDPQAVNKIKIACETWG  379
             +  I+P+DF    ++P+SH+W   ++ + S + +  +VP+IDL  P  V  +  AC+TWG
Sbjct  17    LQHILPIDFQSIQEVPNSHLWPKINNVLTSHNDKNPNVPIIDLLAPNVVELMGHACKTWG  76

Query  380   IFQVTNHGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWT  559
             IFQV NHG+ + L   +E Q RRFF L  EQK++  RS    TGYG  RI+ FF   MW 
Sbjct  77    IFQVVNHGVSLELFDEVEYQARRFFALPAEQKVKVMRSTSGATGYGTARITPFFSKFMWH  136

Query  560   EGFTVAGSPLEHARQ----DYSDFCSVVEDYQAQMRDLAQNLAALMFK*IIRPICW*RCG  727
             EGFT+  SPL+HA++    DY  FC V+E+YQ +M+ L+  L   +    ++P    +  
Sbjct  137   EGFTIMDSPLDHAKKLWPHDYHKFCDVMENYQKKMKVLSFQLCLFILN-YLQP-SQDQHS  194

Query  728   MVGLQWTQAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWID  907
             +   ++  A LQ+N  P CP+P  A+G A HTD+  +T+L+QT+N  GLQ+   +  W  
Sbjct  195   INSFEFAGA-LQLNSYPCCPNPNHALGLAPHTDSLFLTILHQTNNTKGLQILKKDQGWTS  253

Query  908   VEPNSN-AIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLK  1084
             + P SN A++VN+GDL+ I+SNG F SV HR +V +  HR+S+AYFFGP  +  I+P + 
Sbjct  254   IAPVSNDALIVNVGDLLHILSNGEFPSVYHRVLVDQTKHRVSLAYFFGPQVDSMISPLVS  313

Query  1085  LIKPTEFPM-YRPISWNAYLDIKYKYFGKALEMIGF  1189
                     + YR +    YL +K K+  K   MI F
Sbjct  314   SKDNDGVVLKYRNVKVKEYLGLKAKHLEKVFSMIRF  349



>ref|XP_010532143.1| PREDICTED: gibberellin 3-beta-dioxygenase 2-like isoform X1 [Tarenaya 
hassleriana]
Length=362

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/344 (42%), Positives = 198/344 (58%), Gaps = 33/344 (10%)
 Frame = +2

Query  224   DFNKADQLPHSHIWL--DDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTN  397
             D     QLP S  W   DD     +S+ Q ++PVIDL D  A   I  AC +WG FQVTN
Sbjct  22    DLTSLRQLPDSFTWTHEDDLLFSAASNDQNTLPVIDLSDHAAAAAIGRACMSWGAFQVTN  81

Query  398   HGIPVALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVA  577
             HG+P++LL  +E  T   F L   +K+RA R    V+GYG+ RI+ FF  QMW+EGFTV 
Sbjct  82    HGVPLSLLDDIESLTVSLFRLPAHRKMRAARPVDGVSGYGVARIASFFHKQMWSEGFTVT  141

Query  578   GSPLEHARQ----DYSDFC--------SVVEDYQAQMRDLAQNLAALMFK*IIRPICW*R  721
             GS  +H R+     +  +C         V+++Y+  M+ LA  L  L+   +        
Sbjct  142   GSARDHFRKLWPLHHLKYCIYSYPFNSDVIKEYEEHMQKLATKLMWLVLSSL-------G  194

Query  722   CGMVGLQWT---------QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNIT-G  871
                  ++W          QA +Q+N  P+CP+P RAMG A HTD++L+T+LYQ  NIT G
Sbjct  195   VTEADIKWAGPNSDFNGAQAAIQLNHYPVCPEPDRAMGLAAHTDSTLLTVLYQ--NITAG  252

Query  872   LQVYGPNLNWIDVEPNSNAIVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGP  1051
             LQV+   + W+ V P   ++VVN+GDL+ I+SNG   SVLHR  V+K   R SVAY +GP
Sbjct  253   LQVFKDGVGWLTVSPIPGSLVVNIGDLLHILSNGRLPSVLHRVRVNKNRSRFSVAYLWGP  312

Query  1052  SKNVEIAPSLKLIKPTEFPMYRPISWNAYLDIKYKYFGKALEMI  1183
               +V+I+P  KL+ P E P+YRP++W  YL  K  +F  AL +I
Sbjct  313   QSDVQISPIWKLVSPVEPPLYRPVTWKEYLRTKATHFNNALSVI  356



>gb|ADK71008.1| gibberellin 3-beta-hydroxylase [Trigonella balansae]
Length=302

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/303 (45%), Positives = 186/303 (61%), Gaps = 16/303 (5%)
 Frame = +2

Query  254   SHIW--LDDHSPVNS------SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIP  409
             S+ W  LDDH+ +NS      S+   +VPVIDL DP A   I  AC+TWG++QV NHGIP
Sbjct  1     SYTWTHLDDHTLINSNNIMKDSTISTNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIP  60

Query  410   VALLTRMEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPL  589
             ++LL  ++   +  F L   +KL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL
Sbjct  61    ISLLDDIQWVGQTLFSLPSHEKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPL  120

Query  590   EHAR----QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWT  748
             +H +    QDY+ +C +V  Y   ++ LA  L  LM   +      I W        +  
Sbjct  121   DHFQQLWPQDYAKYCDIVLQYDETIKKLAGKLMWLMLDSLGITKEDIKWASSKAQFDEKA  180

Query  749   QAYLQMNW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNA  928
              A +Q+N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV    L W+ V P    
Sbjct  181   CAAMQLNSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGLGWVTVPPLHGG  239

Query  929   IVVNLGDLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             +VVN+GDL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL  PT+ P
Sbjct  240   LVVNVGDLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHAKLGGPTQPP  299

Query  1109  MYR  1117
             ++R
Sbjct  300   LWR  302



>gb|ADK70970.1| gibberellin 3-beta-hydroxylase [Medicago lanigera]
Length=298

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 136/295 (46%), Positives = 179/295 (61%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNS------SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS      S+T  SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESATTSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDD  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++      F L   QKL+A RSP  V+GYG+ R S FF   MW+E FT+ GSPL+H R  
Sbjct  65    IQWLGETLFTLPSHQKLKAIRSPDGVSGYGLARNSSFFPKLMWSEXFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+ +C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q 
Sbjct  125   WPQDYAKYCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQF  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDRAMGLAPHTDSTFLTILSQ-NDISGLQVQREGFEWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GPS NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLYPSVLHRVLVNRTRQRFSVAYLYGPSSNVEICPHEKLVGPTQPPL  298



>gb|ADK70956.1| gibberellin 3-beta-hydroxylase [Medicago biflora]
Length=295

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/292 (46%), Positives = 177/292 (61%), Gaps = 14/292 (5%)
 Frame = +2

Query  266   LDDHSPVNS------SSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+  NS      S+T   VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLTNSNNTMKESNTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCETVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKANAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++L+T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTLLTILSQ-NDISGLQVQREGFGWVTVPPLQGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTE  1102
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQ  295



>gb|ADK70955.1| gibberellin 3-beta-hydroxylase [Medicago arborea]
Length=298

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 180/294 (61%), Gaps = 14/294 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      +VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSNVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLXE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGXGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             DL  I+SNG++ SVLHR +V++  HR SVAY +GP   VEI P  KL+ PT+ P
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRHRFSVAYLYGPPSKVEICPHEKLVGPTQPP  297



>gb|ADK70989.1| gibberellin 3-beta-hydroxylase [Medicago prostrata]
Length=298

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 135/295 (46%), Positives = 180/295 (61%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      SVPVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSSVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY   C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYDKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQFDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRRRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



>gb|ADK70971.1| gibberellin 3-beta-hydroxylase [Medicago littoralis]
Length=292

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/289 (45%), Positives = 176/289 (61%), Gaps = 8/289 (3%)
 Frame = +2

Query  266   LDDHSPVNSSSTQESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQTR  445
             LDDH+ +   +T   VPVIDL DP A   I  AC+TWG++QV NHGIP++LL  ++   +
Sbjct  5     LDDHTLIKEGTTSSIVPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDEIQWLGQ  64

Query  446   RFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QDYS  613
               F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H +    QDY+
Sbjct  65    TLFTLPSHQKLKAIRSPXGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQDYA  124

Query  614   DFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*PIC  784
               C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+N  P C
Sbjct  125   KHCDTVLQYDEAMKKLAGKLMCLMLDSLGITMEDIKWAGSKAQFDEKACAAMQLNSYPSC  184

Query  785   PDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQII  964
             PDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  I+
Sbjct  185   PDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVGDLFHIL  243

Query  965   SNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   SNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  292



>gb|ADK71012.1| gibberellin 3-beta-hydroxylase [Trigonella coerulescens]
Length=289

 Score =   255 bits (651),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 180/290 (62%), Gaps = 11/290 (4%)
 Frame = +2

Query  269   DDHSPVNSSST---QESVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTRMEEQ  439
             DD++ +NS++      SVPVIDL DP A   I  AC+TWG+FQV NHGIP++LL  ++  
Sbjct  1     DDNTLINSNNIIKESTSVPVIDLNDPNASKLIGHACKTWGVFQVVNHGIPISLLDDIQCL  60

Query  440   TRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR----QD  607
              +  F L  ++KL+A R P  V+GYG+ RIS FF   MW+EGFT+ GSPL+H +    QD
Sbjct  61    GQTLFSLPSQEKLKAIRPPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFQQLWPQD  120

Query  608   YSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQMNW*P  778
             Y+ +C +V  Y   M+ LA  L  LM   +      I W       ++   A LQ+N  P
Sbjct  121   YAKYCDIVLQYDETMKKLAGKLMLLMLDSLGITKEDIKWASSKAQFVEKACAALQLNSYP  180

Query  779   ICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLGDLMQ  958
              CPDP RAMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+GDL  
Sbjct  181   SCPDPDRAMGLAAHTDSTFLTILSQ-NDISGLQVQREGFGWVTVPPLHGGLVVNVGDLFH  239

Query  959   IISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFP  1108
             I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P
Sbjct  240   ILSNGLYTSVLHRVLVNRTRQRYSVAYLYGPPSNVEICPHAKLVGPTQPP  289



>gb|ADK70980.1| gibberellin 3-beta-hydroxylase [Medicago murex]
 gb|ADK70987.1| gibberellin 3-beta-hydroxylase [Medicago polymorpha]
Length=298

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/295 (45%), Positives = 181/295 (61%), Gaps = 14/295 (5%)
 Frame = +2

Query  266   LDDHSPVNSSSTQE------SVPVIDLYDPQAVNKIKIACETWGIFQVTNHGIPVALLTR  427
             LDDH+ +NS++T +      S+PVIDL DP A   I  AC+TWG++QV NHGIP++LL  
Sbjct  5     LDDHTLINSNNTMKESANSSSIPVIDLNDPNASKLIGHACKTWGVYQVVNHGIPISLLDE  64

Query  428   MEEQTRRFFELAPEQKLRAKRSPGSVTGYGIPRISRFFDSQMWTEGFTVAGSPLEHAR--  601
             ++   +  F L   QKL+A RSP  V+GYG+ RIS FF   MW+EGFT+ GSPL+H R  
Sbjct  65    IQWLGQTLFTLPSHQKLKAIRSPDGVSGYGLARISSFFPKLMWSEGFTIVGSPLDHFRQL  124

Query  602   --QDYSDFCSVVEDYQAQMRDLAQNLAALMFK*I---IRPICW*RCGMVGLQWTQAYLQM  766
               QDY+  C  V  Y   M+ LA  L  LM   +   +  I W        +   A +Q+
Sbjct  125   WPQDYAKHCDTVLQYDEAMKKLAGKLMWLMLDSLGITMEDIKWAGSKAQLDEKACAAMQL  184

Query  767   NW*PICPDPTRAMGFAQHTDTSLVTLLYQTSNITGLQVYGPNLNWIDVEPNSNAIVVNLG  946
             N  P CPDP  AMG A HTD++ +T+L Q ++I+GLQV      W+ V P    +VVN+G
Sbjct  185   NSYPSCPDPDHAMGLAPHTDSTFLTILSQ-NDISGLQVQREGSGWVTVPPLHGGLVVNVG  243

Query  947   DLMQIISNGMFKSVLHRAIVSKAHHRISVAYFFGPSKNVEIAPSLKLIKPTEFPM  1111
             DL  I+SNG++ SVLHR +V++   R SVAY +GP  NVEI P  KL+ PT+ P+
Sbjct  244   DLFHILSNGLYTSVLHRVLVNRTRQRFSVAYLYGPPSNVEICPHEKLVGPTQPPL  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3697415815374