BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21707_g2_i2 len=1231 path=[1:0-720 @722@!:721-1089 1349:1090-1230]

Length=1231
                                                                      Score     E

gb|EPS61315.1|  hypothetical protein M569_13482                         256   1e-71   
emb|CDP14893.1|  unnamed protein product                                228   8e-70   
emb|CDP06267.1|  unnamed protein product                                231   4e-68   
ref|XP_011087203.1|  PREDICTED: uncharacterized protein LOC105168...    238   2e-65   
ref|XP_011087202.1|  PREDICTED: uncharacterized protein LOC105168...    238   2e-65   
ref|XP_011087199.1|  PREDICTED: uncharacterized protein LOC105168...    238   2e-65   
ref|XP_009588932.1|  PREDICTED: uncharacterized protein LOC104086...    238   2e-65   
ref|XP_009594415.1|  PREDICTED: uncharacterized protein LOC104090916    237   6e-65   
ref|XP_009777756.1|  PREDICTED: uncharacterized protein LOC104227...    236   8e-65   
emb|CBI15290.3|  unnamed protein product                                236   9e-65   
ref|XP_009790879.1|  PREDICTED: uncharacterized protein LOC104238260    236   9e-65   
ref|XP_010663421.1|  PREDICTED: uncharacterized protein LOC100256...    236   1e-64   
ref|XP_002266656.1|  PREDICTED: uncharacterized protein LOC100256...    236   1e-64   Vitis vinifera
emb|CDP14890.1|  unnamed protein product                                234   9e-64   
ref|XP_008346826.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    221   1e-63   
ref|XP_007037182.1|  Ubiquitin carboxyl-terminal hydrolase-relate...    232   2e-63   
gb|KDP31191.1|  hypothetical protein JCGZ_11567                         231   9e-63   
ref|XP_011071732.1|  PREDICTED: uncharacterized protein LOC105157...    230   1e-62   
ref|XP_011042624.1|  PREDICTED: uncharacterized protein LOC105138...    230   1e-62   
ref|XP_011071733.1|  PREDICTED: uncharacterized protein LOC105157...    230   1e-62   
ref|XP_011042622.1|  PREDICTED: uncharacterized protein LOC105138...    230   1e-62   
ref|XP_011042623.1|  PREDICTED: uncharacterized protein LOC105138...    230   1e-62   
gb|ABL66740.1|  At3g47900                                               217   1e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006354834.1|  PREDICTED: uncharacterized protein LOC102605106    229   3e-62   
ref|XP_008239780.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    228   7e-62   
ref|XP_007210436.1|  hypothetical protein PRUPE_ppa000140mg             228   7e-62   
ref|XP_006476671.1|  PREDICTED: uncharacterized protein LOC102612...    228   7e-62   
gb|KDO76021.1|  hypothetical protein CISIN_1g000306mg                   228   7e-62   
ref|XP_006439669.1|  hypothetical protein CICLE_v10018472mg             228   7e-62   
ref|XP_004508791.1|  PREDICTED: uncharacterized protein LOC101496...    228   1e-61   
ref|XP_004508792.1|  PREDICTED: uncharacterized protein LOC101496...    228   1e-61   
ref|XP_004241561.1|  PREDICTED: uncharacterized protein LOC101248307    228   1e-61   
ref|XP_002511504.1|  conserved hypothetical protein                     227   2e-61   Ricinus communis
ref|XP_010028652.1|  PREDICTED: uncharacterized protein LOC104418879    227   2e-61   
ref|XP_010515103.1|  PREDICTED: inactive ubiquitin carboxyl-termi...    217   2e-61   
ref|XP_011028695.1|  PREDICTED: uncharacterized protein LOC105128...    226   2e-61   
ref|XP_011028696.1|  PREDICTED: uncharacterized protein LOC105128...    226   2e-61   
ref|XP_010272205.1|  PREDICTED: uncharacterized protein LOC104608...    226   3e-61   
ref|XP_010272203.1|  PREDICTED: uncharacterized protein LOC104608...    226   3e-61   
ref|XP_004301306.1|  PREDICTED: uncharacterized protein LOC101311291    226   4e-61   
emb|CDY61846.1|  BnaAnng17800D                                          214   8e-61   
ref|XP_009369371.1|  PREDICTED: uncharacterized protein LOC103958...    224   1e-60   
ref|XP_009369372.1|  PREDICTED: uncharacterized protein LOC103958...    224   1e-60   
ref|XP_009588935.1|  PREDICTED: uncharacterized protein LOC104086...    224   2e-60   
ref|XP_006374498.1|  hypothetical protein POPTR_0015s07770g             224   2e-60   
ref|XP_010426256.1|  PREDICTED: uncharacterized protein LOC104711264    223   3e-60   
dbj|BAE98837.1|  hypothetical protein                                   219   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009777758.1|  PREDICTED: uncharacterized protein LOC104227...    222   6e-60   
ref|XP_010678605.1|  PREDICTED: uncharacterized protein LOC104894...    222   9e-60   
ref|XP_010678604.1|  PREDICTED: uncharacterized protein LOC104894...    222   1e-59   
gb|KFK34091.1|  hypothetical protein AALP_AA5G101000                    221   1e-59   
gb|KFK34092.1|  hypothetical protein AALP_AA5G101000                    221   1e-59   
ref|XP_006367707.1|  PREDICTED: uncharacterized protein LOC102592123    221   1e-59   
ref|XP_010256025.1|  PREDICTED: uncharacterized protein LOC104596...    221   2e-59   
ref|XP_010256018.1|  PREDICTED: uncharacterized protein LOC104596...    221   2e-59   
ref|XP_010256010.1|  PREDICTED: uncharacterized protein LOC104596...    221   2e-59   
gb|KHG14770.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       221   2e-59   
gb|KFK34093.1|  hypothetical protein AALP_AA5G101100                    221   2e-59   
gb|KGN63643.1|  hypothetical protein Csa_1G008490                       221   2e-59   
ref|XP_004138296.1|  PREDICTED: uncharacterized protein LOC101212702    221   3e-59   
emb|CAB41149.1|  putative protein                                       208   3e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008453168.1|  PREDICTED: uncharacterized protein LOC103493...    220   3e-59   
gb|KEH31899.1|  ubiquitin carboxyl-terminal hydrolase-like protein      220   3e-59   
ref|XP_010112586.1|  Inactive ubiquitin carboxyl-terminal hydrola...    219   6e-59   
ref|NP_190372.3|  ubiquitin carboxyl-terminal hydrolase-related p...    219   1e-58   Arabidopsis thaliana [mouse-ear cress]
emb|CDY36917.1|  BnaA06g17020D                                          215   1e-58   
ref|NP_001118788.1|  ubiquitin carboxyl-terminal hydrolase-relate...    218   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190374.4|  ubiquitin carboxyl-terminal hydrolase-related p...    218   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010318961.1|  PREDICTED: uncharacterized protein LOC101250879    218   2e-58   
ref|XP_007155356.1|  hypothetical protein PHAVU_003G194200g             218   2e-58   
gb|KHN18514.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       218   2e-58   
ref|XP_009343439.1|  PREDICTED: uncharacterized protein LOC103935...    217   3e-58   
ref|XP_009343438.1|  PREDICTED: uncharacterized protein LOC103935...    217   3e-58   
ref|XP_006600664.1|  PREDICTED: uncharacterized protein LOC100800...    216   9e-58   
ref|XP_002877584.1|  predicted protein                                  216   9e-58   
ref|XP_009149862.1|  PREDICTED: uncharacterized protein LOC103873189    216   1e-57   
ref|XP_006579548.1|  PREDICTED: uncharacterized protein LOC100799...    216   1e-57   
ref|XP_006579549.1|  PREDICTED: uncharacterized protein LOC100799...    216   1e-57   
gb|KHN48649.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       215   1e-57   
ref|XP_010503407.1|  PREDICTED: uncharacterized protein LOC104780...    215   2e-57   
ref|XP_006404317.1|  hypothetical protein EUTSA_v10010059mg             215   2e-57   
ref|XP_010503406.1|  PREDICTED: uncharacterized protein LOC104780...    214   3e-57   
ref|XP_010503405.1|  PREDICTED: uncharacterized protein LOC104780...    214   3e-57   
ref|XP_006292726.1|  hypothetical protein CARUB_v10018972mg             214   3e-57   
ref|XP_010515104.1|  PREDICTED: uncharacterized protein LOC104791003    214   4e-57   
ref|XP_010426263.1|  PREDICTED: uncharacterized protein LOC104711...    214   4e-57   
ref|XP_010426262.1|  PREDICTED: uncharacterized protein LOC104711...    214   4e-57   
gb|KDO76019.1|  hypothetical protein CISIN_1g000306mg                   214   7e-57   
gb|KDO76020.1|  hypothetical protein CISIN_1g000306mg                   213   7e-57   
ref|XP_006290495.1|  hypothetical protein CARUB_v10016569mg             213   1e-56   
ref|XP_010550646.1|  PREDICTED: uncharacterized protein LOC104821450    213   1e-56   
ref|XP_009149858.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    213   1e-56   
ref|XP_002877583.1|  hypothetical protein ARALYDRAFT_485153             213   1e-56   
ref|XP_006404318.1|  hypothetical protein EUTSA_v10010060mg             212   2e-56   
gb|EYU35900.1|  hypothetical protein MIMGU_mgv1a000162mg                212   2e-56   
ref|XP_010546042.1|  PREDICTED: uncharacterized protein LOC104818...    211   3e-56   
ref|XP_010546039.1|  PREDICTED: uncharacterized protein LOC104818...    211   3e-56   
ref|XP_010546041.1|  PREDICTED: uncharacterized protein LOC104818...    211   4e-56   
ref|NP_001142026.1|  uncharacterized protein LOC100274180               196   4e-56   Zea mays [maize]
ref|XP_006841144.1|  hypothetical protein AMTR_s00086p00132870          209   2e-55   
emb|CDY25237.1|  BnaC02g30130D                                          196   3e-55   
gb|KEH31898.1|  ubiquitin carboxyl-terminal hydrolase-like protein      206   2e-54   
dbj|BAK03191.1|  predicted protein                                      201   4e-54   
ref|XP_006651069.1|  PREDICTED: uncharacterized protein LOC102718817    205   6e-54   
ref|XP_008809577.1|  PREDICTED: uncharacterized protein LOC103721...    205   6e-54   
ref|XP_008809576.1|  PREDICTED: uncharacterized protein LOC103721...    205   6e-54   
ref|NP_001049069.1|  Os03g0165600                                       197   8e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010907346.1|  PREDICTED: uncharacterized protein LOC105034...    204   1e-53   
ref|NP_001132623.1|  uncharacterized protein LOC100194097               190   1e-53   Zea mays [maize]
ref|XP_010907344.1|  PREDICTED: uncharacterized protein LOC105034...    203   3e-53   
ref|XP_010932991.1|  PREDICTED: uncharacterized protein LOC105053498    200   3e-52   
ref|XP_002465805.1|  hypothetical protein SORBIDRAFT_01g046140          200   3e-52   Sorghum bicolor [broomcorn]
ref|XP_008668323.1|  PREDICTED: uncharacterized protein LOC100274...    199   4e-52   
gb|EEC74581.1|  hypothetical protein OsI_10153                          199   6e-52   Oryza sativa Indica Group [Indian rice]
gb|EEE58383.1|  hypothetical protein OsJ_09540                          199   9e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EMS52635.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54       196   1e-50   
ref|XP_010229142.1|  PREDICTED: uncharacterized protein LOC100846067    195   2e-50   
ref|XP_004987161.1|  PREDICTED: uncharacterized protein LOC101782159    194   2e-50   
emb|CAB41871.1|  putative protein                                       179   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AFW89724.1|  hypothetical protein ZEAMMB73_873945                    191   3e-49   
ref|XP_008658138.1|  PREDICTED: uncharacterized protein LOC100194...    191   3e-49   
ref|XP_008658137.1|  PREDICTED: uncharacterized protein LOC100194...    191   3e-49   
ref|XP_008658140.1|  PREDICTED: uncharacterized protein LOC100194...    191   3e-49   
ref|XP_009386389.1|  PREDICTED: uncharacterized protein LOC103973...    189   1e-48   
ref|XP_009386394.1|  PREDICTED: uncharacterized protein LOC103973...    189   1e-48   
gb|AFW89587.1|  hypothetical protein ZEAMMB73_931714                    186   7e-48   
ref|XP_002324086.2|  hypothetical protein POPTR_0017s12500g             156   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010907345.1|  PREDICTED: uncharacterized protein LOC105034...    160   1e-38   
ref|XP_010661023.1|  PREDICTED: uncharacterized protein LOC104881688    160   1e-38   
ref|XP_001762441.1|  predicted protein                                  159   2e-38   
ref|XP_010661001.1|  PREDICTED: uncharacterized protein LOC104881...    157   7e-38   
ref|XP_011035827.1|  PREDICTED: uncharacterized protein LOC105133495    155   4e-37   
emb|CBI35030.3|  unnamed protein product                                154   9e-37   
gb|ABF94151.1|  Ubiquitin carboxyl-terminal hydrolase family prot...    153   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002324087.2|  hypothetical protein POPTR_0017s12510g             146   3e-34   Populus trichocarpa [western balsam poplar]
ref|XP_006373344.1|  hypothetical protein POPTR_0017s12500g             141   8e-34   
ref|XP_008374916.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   4e-31   
ref|XP_005849436.1|  hypothetical protein CHLNCDRAFT_21625              124   4e-30   
ref|XP_005650621.1|  hypothetical protein COCSUDRAFT_64969              129   1e-28   
ref|XP_010661002.1|  PREDICTED: uncharacterized protein LOC104881...    129   2e-28   
emb|CAB41150.1|  putative protein                                       121   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528658.1|  PREDICTED: uncharacterized protein LOC104805...    121   6e-26   
ref|XP_010528656.1|  PREDICTED: uncharacterized protein LOC104805...    121   6e-26   
ref|XP_010528659.1|  PREDICTED: uncharacterized protein LOC104805...    121   7e-26   
ref|XP_010528655.1|  PREDICTED: uncharacterized protein LOC104805...    121   7e-26   
ref|XP_010528653.1|  PREDICTED: uncharacterized protein LOC104805...    121   7e-26   
ref|XP_010528654.1|  PREDICTED: uncharacterized protein LOC104805...    121   7e-26   
ref|XP_006600667.1|  PREDICTED: uncharacterized protein LOC100800...    119   2e-25   
ref|XP_005650623.1|  hypothetical protein COCSUDRAFT_61074              119   4e-25   
ref|XP_006489588.1|  PREDICTED: uncharacterized protein LOC102612613    110   2e-22   
ref|XP_005849226.1|  hypothetical protein CHLNCDRAFT_21653              101   3e-22   
ref|XP_008658139.1|  PREDICTED: uncharacterized protein LOC100194...    102   5e-22   
ref|XP_010556181.1|  PREDICTED: uncharacterized protein LOC104825529    107   1e-21   
ref|XP_010551215.1|  PREDICTED: uncharacterized protein LOC104821...    106   3e-21   
ref|XP_010551225.1|  PREDICTED: uncharacterized protein LOC104821...    106   3e-21   
ref|XP_010551234.1|  PREDICTED: uncharacterized protein LOC104821...    106   3e-21   
emb|CDY42920.1|  BnaC05g47310D                                          105   6e-21   
ref|XP_005851100.1|  hypothetical protein CHLNCDRAFT_137643             105   6e-21   
ref|XP_010510751.1|  PREDICTED: uncharacterized protein LOC104786...    103   2e-20   
emb|CDY49345.1|  BnaA05g33070D                                          103   2e-20   
ref|XP_002886822.1|  hypothetical protein ARALYDRAFT_338628             100   3e-20   
emb|CDX91518.1|  BnaC02g16420D                                        99.8    4e-20   
ref|XP_010510750.1|  PREDICTED: uncharacterized protein LOC104786...    102   4e-20   
ref|XP_006485802.1|  PREDICTED: uncharacterized protein LOC102630787    102   5e-20   
ref|XP_010473156.1|  PREDICTED: uncharacterized protein LOC104752660    102   7e-20   
ref|XP_002502922.1|  predicted protein                                99.0    2e-19   Micromonas commoda
ref|XP_006302827.1|  hypothetical protein CARUB_v10020958mg           95.1    2e-19   
emb|CBI35029.3|  unnamed protein product                                100   2e-19   
gb|ABE97183.1|  unknown                                               97.8    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009124029.1|  PREDICTED: uncharacterized protein LOC103848948    100   3e-19   
ref|XP_010470405.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  97.1    4e-19   
ref|XP_004334106.1|  ubiquitin carboxyl-terminal hydrolase            99.4    4e-19   
ref|XP_010470398.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  97.1    4e-19   
ref|XP_010470403.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  97.1    5e-19   
ref|XP_009127389.1|  PREDICTED: uncharacterized protein LOC103852221  99.4    5e-19   
ref|XP_006485855.1|  PREDICTED: uncharacterized protein LOC102624054  99.0    5e-19   
emb|CDX91514.1|  BnaC02g16460D                                        99.4    5e-19   
ref|NP_199966.1|  ubiquitin carboxyl-terminal hydrolase-related p...  99.4    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301529.1|  hypothetical protein CARUB_v10021957mg           95.1    6e-19   
ref|XP_010417917.1|  PREDICTED: uncharacterized protein LOC104703...  99.0    7e-19   
ref|XP_010417916.1|  PREDICTED: uncharacterized protein LOC104703...  99.0    7e-19   
ref|XP_010444564.1|  PREDICTED: uncharacterized protein LOC104727...  99.0    7e-19   
ref|XP_010444569.1|  PREDICTED: uncharacterized protein LOC104727...  99.0    7e-19   
ref|XP_010444568.1|  PREDICTED: uncharacterized protein LOC104727...  99.0    7e-19   
ref|XP_010444557.1|  PREDICTED: uncharacterized protein LOC104727...  99.0    8e-19   
ref|XP_010444563.1|  PREDICTED: uncharacterized protein LOC104727...  99.0    8e-19   
ref|XP_010463375.1|  PREDICTED: uncharacterized protein LOC104743...  98.6    8e-19   
ref|XP_010463360.1|  PREDICTED: uncharacterized protein LOC104743...  99.0    8e-19   
ref|XP_010470394.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  96.7    8e-19   
ref|XP_010463334.1|  PREDICTED: uncharacterized protein LOC104743...  98.6    9e-19   
ref|XP_010463339.1|  PREDICTED: uncharacterized protein LOC104743...  98.6    9e-19   
ref|XP_010463280.1|  PREDICTED: uncharacterized protein LOC104743...  98.6    9e-19   
ref|XP_009124028.1|  PREDICTED: uncharacterized protein LOC103848947  98.6    1e-18   
emb|CDX91517.1|  BnaC02g16430D                                        98.6    1e-18   
gb|KFK40075.1|  hypothetical protein AALP_AA3G326900                  98.2    1e-18   
ref|NP_176699.1|  ubiquitin carboxyl-terminal hydrolase-related p...  98.2    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300665.1|  hypothetical protein CARUB_v10019695mg           98.2    1e-18   
ref|NP_176695.1|  ubiquitin carboxyl-terminal hydrolase family pr...  94.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010551187.1|  PREDICTED: uncharacterized protein LOC104821...  97.8    2e-18   
ref|XP_010551196.1|  PREDICTED: uncharacterized protein LOC104821...  97.8    2e-18   
ref|XP_002888325.1|  hypothetical protein ARALYDRAFT_475527           97.8    2e-18   
ref|XP_006301581.1|  hypothetical protein CARUB_v10022019mg           94.4    2e-18   
ref|NP_180331.2|  ubiquitin carboxyl-terminal hydrolase-related p...  97.4    2e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAY82254.1|  hypothetical protein At2g27650                        97.1    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180333.2|  ubiquitin carboxyl-terminal hydrolase-related p...  97.1    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CDY16393.1|  BnaA02g11970D                                        97.1    3e-18   
ref|XP_010418961.1|  PREDICTED: uncharacterized protein LOC104704602  97.1    3e-18   
ref|XP_006419161.1|  hypothetical protein EUTSA_v10003075mg           93.6    5e-18   
ref|XP_006301509.1|  hypothetical protein CARUB_v10021935mg           96.3    5e-18   
ref|XP_005835712.1|  hypothetical protein GUITHDRAFT_68514            94.4    6e-18   
ref|XP_002888322.1|  hypothetical protein ARALYDRAFT_315481           95.9    7e-18   
ref|XP_006293590.1|  hypothetical protein CARUB_v10022537mg           95.9    7e-18   
ref|XP_006302633.1|  hypothetical protein CARUB_v10020738mg           92.4    8e-18   
emb|CDY66310.1|  BnaCnng50250D                                        94.7    1e-17   
gb|KFK27933.1|  hypothetical protein AALP_AA8G449800                  94.7    2e-17   
ref|NP_974091.1|  ubiquitin carboxyl-terminal hydrolase-related p...  94.4    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|AAD26881.1|AC007230_15  Contains similarity to F13P17.8 gi|333...  94.4    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130183.1|  PREDICTED: uncharacterized protein LOC103854...  94.0    3e-17   
ref|XP_010513792.1|  PREDICTED: uncharacterized protein LOC104789850  93.6    4e-17   
ref|XP_010483885.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  93.6    4e-17   
ref|XP_010478210.1|  PREDICTED: uncharacterized protein LOC104757180  88.2    5e-17   
ref|XP_010470411.1|  PREDICTED: uncharacterized protein LOC104750...  90.5    6e-17   
ref|XP_005849431.1|  hypothetical protein CHLNCDRAFT_143978           92.0    8e-17   
ref|XP_002865865.1|  hypothetical protein ARALYDRAFT_495225           92.8    8e-17   
ref|XP_006279927.1|  hypothetical protein CARUB_v10025784mg           92.4    9e-17   
emb|CDX89680.1|  BnaC03g45940D                                        89.7    1e-16   
gb|AAD26868.1|AC007230_2  Contains similarity to F13P17.8 gi|3337...  92.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176690.1|  ubiquitin carboxyl-terminal hydrolase-related p...  92.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
gb|AAD26878.1|AC007230_12  T23K8.8                                    88.6    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130179.1|  PREDICTED: uncharacterized protein LOC103854963  92.0    1e-16   
ref|XP_010470413.1|  PREDICTED: uncharacterized protein LOC104750...  89.0    2e-16   
ref|XP_010462083.1|  PREDICTED: uncharacterized protein LOC104742...  91.7    2e-16   
ref|XP_010470412.1|  PREDICTED: uncharacterized protein LOC104750...  89.0    2e-16   
emb|CCI44338.1|  unnamed protein product                              91.3    2e-16   
ref|XP_010470414.1|  PREDICTED: uncharacterized protein LOC104750...  88.6    2e-16   
emb|CDY30684.1|  BnaA02g33060D                                        91.7    2e-16   
ref|XP_010512636.1|  PREDICTED: uncharacterized protein LOC104788...  88.6    2e-16   
ref|XP_009137058.1|  PREDICTED: uncharacterized protein LOC103861104  87.4    2e-16   
ref|XP_006300300.1|  hypothetical protein CARUB_v10019699mg           91.3    3e-16   
emb|CDY16392.1|  BnaA02g11960D                                        89.0    3e-16   
ref|NP_176692.3|  ubiquitin carboxyl-terminal hydrolase-related p...  90.5    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513508.1|  PREDICTED: uncharacterized protein LOC104789520  90.1    5e-16   
emb|CDY16395.1|  BnaA02g11990D                                        90.1    5e-16   
ref|XP_010512408.1|  PREDICTED: uncharacterized protein LOC104788352  87.4    6e-16   
ref|XP_010512635.1|  PREDICTED: uncharacterized protein LOC104788...  89.4    6e-16   
ref|XP_002879149.1|  predicted protein                                90.1    6e-16   
ref|XP_006301514.1|  hypothetical protein CARUB_v10021940mg           90.1    6e-16   
ref|XP_009127442.1|  PREDICTED: uncharacterized protein LOC103852285  87.0    8e-16   
gb|KFK44967.1|  hypothetical protein AALP_AA1G326800                  89.7    9e-16   
gb|KFK44968.1|  hypothetical protein AALP_AA1G326800                  89.7    9e-16   
ref|XP_010418962.1|  PREDICTED: uncharacterized protein LOC104704603  89.0    1e-15   
ref|XP_002888314.1|  hypothetical protein ARALYDRAFT_475522           89.4    1e-15   
ref|XP_010457951.1|  PREDICTED: uncharacterized protein LOC104739333  89.4    1e-15   
ref|XP_006485854.1|  PREDICTED: uncharacterized protein LOC102623763  84.0    1e-15   
gb|AAD26877.1|AC007230_11  T23K8.7                                    86.3    2e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CDY02277.1|  BnaA03g38900D                                        87.4    2e-15   
gb|KFK27934.1|  hypothetical protein AALP_AA8G449900                  88.6    2e-15   
ref|XP_010513509.1|  PREDICTED: uncharacterized protein LOC104789522  88.2    2e-15   
ref|NP_176696.1|  ubiquitin carboxyl-terminal hydrolase-like protein  84.7    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAD26870.1|AC007230_4  T23K8.5                                     85.9    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470410.1|  PREDICTED: uncharacterized protein LOC104750320  85.9    3e-15   
ref|XP_009130184.1|  PREDICTED: uncharacterized protein LOC103854...  88.2    3e-15   
ref|NP_176693.3|  ubiquitin carboxyl-terminal hydrolase family pr...  85.5    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010495309.1|  PREDICTED: uncharacterized protein LOC104772383  85.5    3e-15   
gb|AAD26874.1|AC007230_8  Contains similarity to F13P17.8 gi|3337...  87.8    4e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CCA21421.1|  inactive ubiquitin carboxylterminal hydrolase pu...  87.4    4e-15   
ref|XP_002886823.1|  ubiquitin carboxyl-terminal hydrolase family...  84.0    4e-15   
ref|XP_010500848.1|  PREDICTED: uncharacterized protein LOC104778...  87.4    4e-15   
emb|CDY49344.1|  BnaA05g33060D                                        87.0    5e-15   
ref|XP_010477870.1|  PREDICTED: uncharacterized protein LOC104756909  87.4    5e-15   
ref|XP_010483879.1|  PREDICTED: uncharacterized protein LOC104762312  87.4    5e-15   
ref|XP_006306043.1|  hypothetical protein CARUB_v10011347mg           87.4    5e-15   
ref|XP_002879145.1|  predicted protein                                87.0    6e-15   
ref|XP_006394449.1|  hypothetical protein EUTSA_v10005405mg           87.0    6e-15   
gb|AAO37180.1|  hypothetical protein                                  85.9    6e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAD26869.1|AC007230_3  Contains similarity to F13P17.8 gi|3337...  86.7    8e-15   Arabidopsis thaliana [mouse-ear cress]
emb|CCA17718.1|  inactive ubiquitin carboxylterminal hydrolase pu...  86.3    9e-15   
ref|XP_006293585.1|  hypothetical protein CARUB_v10022532mg           86.7    9e-15   
ref|XP_002864760.1|  predicted protein                                86.7    9e-15   
gb|AAC73038.1|  hypothetical protein                                  84.7    1e-14   
emb|CDX91515.1|  BnaC02g16450D                                        84.3    1e-14   
ref|XP_010500847.1|  PREDICTED: uncharacterized protein LOC104778...  86.3    1e-14   
ref|XP_010457940.1|  PREDICTED: uncharacterized protein LOC104739326  85.9    1e-14   
ref|XP_010495408.1|  PREDICTED: uncharacterized protein LOC104772502  84.7    2e-14   
ref|XP_009127387.1|  PREDICTED: uncharacterized protein LOC103852219  83.2    2e-14   
gb|KDO29340.1|  hypothetical protein SPRG_05876                       84.7    3e-14   
ref|XP_006279917.1|  hypothetical protein CARUB_v10025775mg           85.1    3e-14   
gb|EMT08058.1|  hypothetical protein F775_01377                       84.7    3e-14   
ref|XP_010495311.1|  PREDICTED: uncharacterized protein LOC104772385  80.1    4e-14   
ref|XP_010513305.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  84.3    4e-14   
ref|XP_002950399.1|  hypothetical protein VOLCADRAFT_104654           84.7    5e-14   
ref|XP_005651661.1|  hypothetical protein COCSUDRAFT_64075            84.3    5e-14   
ref|XP_010462084.1|  PREDICTED: uncharacterized protein LOC104742...  83.6    8e-14   
ref|XP_009520782.1|  hypothetical protein PHYSODRAFT_486120           83.2    8e-14   
emb|CCI49802.1|  unnamed protein product                              83.2    1e-13   
emb|CCI49801.1|  unnamed protein product                              83.2    1e-13   
ref|XP_008609366.1|  hypothetical protein SDRG_05430                  82.8    1e-13   
emb|CCI49804.1|  unnamed protein product                              82.8    1e-13   
emb|CCI49805.1|  unnamed protein product                              82.8    1e-13   
ref|XP_002904802.1|  inactive ubiquitin carboxyl-terminal hydrola...  82.8    1e-13   
emb|CCI49806.1|  unnamed protein product                              82.8    1e-13   
emb|CCI49803.1|  unnamed protein product                              82.8    1e-13   
ref|XP_005849851.1|  hypothetical protein CHLNCDRAFT_143024           82.8    2e-13   
ref|XP_001846945.1|  ubiquitin specific proteinase                    82.0    3e-13   
gb|ETL78878.1|  hypothetical protein L917_20391                       81.6    3e-13   
ref|XP_008914902.1|  hypothetical protein PPTG_18621                  81.3    3e-13   
gb|ETM32151.1|  hypothetical protein L914_20396                       81.3    4e-13   
gb|AAG51537.1|AC037424_2  unknown protein, 5' partial; 1-1723         79.7    4e-13   
ref|NP_201001.1|  ubiquitin carboxyl-terminal hydrolase-related p...  81.3    4e-13   
dbj|BAB08882.1|  unnamed protein product                              81.3    4e-13   
emb|CDY16394.1|  BnaA02g11980D                                        79.3    5e-13   
ref|NP_201000.1|  ubiquitin carboxyl-terminal hydrolase-related p...  81.3    5e-13   
ref|XP_008869256.1|  hypothetical protein H310_06110                  81.3    5e-13   
dbj|BAB08881.1|  unnamed protein product                              80.9    5e-13   
ref|XP_006663581.1|  PREDICTED: uncharacterized protein LOC102714238  78.6    6e-13   
ref|XP_008186681.1|  PREDICTED: uncharacterized protein LOC100161...  80.9    7e-13   
ref|XP_002886817.1|  ubiquitin thiolesterase                          78.6    7e-13   
ref|XP_008186679.1|  PREDICTED: uncharacterized protein LOC100161...  80.9    7e-13   
ref|XP_008186680.1|  PREDICTED: uncharacterized protein LOC100161...  80.9    7e-13   
ref|XP_009826625.1|  hypothetical protein, variant                    80.5    7e-13   
ref|XP_009826624.1|  hypothetical protein H257_03984                  80.1    9e-13   
ref|XP_002864761.1|  hypothetical protein ARALYDRAFT_332429           80.1    1e-12   
gb|KDO57470.1|  hypothetical protein CISIN_1g000686mg                 79.7    1e-12   
ref|NP_175654.1|  ubiquitin carboxyl-terminal hydrolase-related p...  79.7    2e-12   
emb|CDY66311.1|  BnaCnng50260D                                        77.0    2e-12   
gb|KDO74622.1|  hypothetical protein CISIN_1g037237mg                 79.0    3e-12   
ref|XP_007037185.1|  Ubiquitin carboxyl-terminal hydrolase-relate...  79.0    3e-12   
ref|NP_175652.1|  ubiquitin carboxyl-terminal hydrolase-related p...  79.0    3e-12   
ref|XP_007037186.1|  Ubiquitin carboxyl-terminal hydrolase-relate...  79.0    3e-12   
gb|EMS61776.1|  hypothetical protein TRIUR3_25854                     78.2    5e-12   
ref|XP_002894379.1|  hypothetical protein ARALYDRAFT_892254           77.8    6e-12   
gb|KDO29892.1|  hypothetical protein SPRG_04959                       77.4    6e-12   
ref|XP_002037069.1|  GM12311                                          77.8    7e-12   
ref|NP_726893.2|  echinus, isoform A                                  77.8    7e-12   
ref|XP_002100154.1|  GE16315                                          77.8    7e-12   
ref|XP_001976824.1|  GG18676                                          77.8    7e-12   
ref|NP_570078.2|  echinus, isoform B                                  77.8    7e-12   
emb|CAA20016.1|  EG:EG0002.3                                          77.8    7e-12   
ref|NP_001096877.1|  echinus, isoform C                               77.8    7e-12   
ref|XP_007110911.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_007166667.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_007110909.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_007166663.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_006394457.1|  hypothetical protein EUTSA_v10005598mg           77.4    8e-12   
ref|XP_007166665.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_007110907.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_007110906.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    8e-12   
ref|XP_007166668.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    9e-12   
ref|XP_007110908.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    9e-12   
ref|XP_007166666.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    9e-12   
gb|EEE52370.1|  hypothetical protein OsJ_34442                        77.0    9e-12   
ref|XP_008481560.1|  PREDICTED: uncharacterized protein LOC103518279  77.4    9e-12   
ref|XP_007110910.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  77.4    9e-12   
gb|ABA94712.1|  expressed protein                                     77.0    9e-12   
ref|NP_001176638.1|  Os11g0599101                                     77.0    9e-12   
ref|XP_008453169.1|  PREDICTED: uncharacterized protein LOC103493...  77.4    9e-12   
ref|XP_002120975.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  76.6    1e-11   
ref|XP_010446238.1|  PREDICTED: uncharacterized protein LOC104729036  74.7    1e-11   
ref|XP_002058196.1|  GJ15954                                          77.0    1e-11   
ref|XP_002071871.1|  GK10224                                          77.0    1e-11   
ref|XP_002011343.1|  GI16477                                          77.0    1e-11   
ref|XP_004084347.1|  PREDICTED: uncharacterized protein LOC101172628  77.0    1e-11   
ref|XP_002105690.1|  anon-072                                         77.0    1e-11   
ref|XP_008603855.1|  hypothetical protein SDRG_00167                  76.3    2e-11   
ref|XP_001995724.1|  GH17608                                          76.6    2e-11   
gb|EMT07916.1|  hypothetical protein F775_24100                       76.3    2e-11   
ref|XP_006004990.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  76.3    2e-11   
gb|KDO34017.1|  hypothetical protein SPRG_01291                       75.9    2e-11   
ref|XP_008615509.1|  hypothetical protein SDRG_11256                  75.9    2e-11   
ref|XP_004520047.1|  PREDICTED: uncharacterized protein LOC101463...  76.3    2e-11   
ref|XP_002879148.1|  hypothetical protein ARALYDRAFT_901771           72.0    3e-11   
ref|XP_004520049.1|  PREDICTED: uncharacterized protein LOC101463...  75.9    3e-11   
ref|XP_001966308.1|  GF22096                                          75.9    3e-11   
ref|XP_002585988.1|  hypothetical protein BRAFLDRAFT_255652           73.9    3e-11   
ref|XP_006394458.1|  hypothetical protein EUTSA_v10005669mg           75.5    4e-11   
ref|XP_005565558.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    4e-11   
ref|XP_005565550.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    5e-11   
ref|XP_005565555.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    5e-11   
ref|XP_005565553.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    5e-11   
ref|XP_001691026.1|  hypothetical protein CHLREDRAFT_144600           75.1    5e-11   
ref|XP_005565556.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    5e-11   
ref|XP_005565557.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    5e-11   
ref|XP_005565560.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  75.1    5e-11   
emb|CDY30685.1|  BnaA02g33070D                                        74.7    6e-11   
ref|XP_002888312.1|  hypothetical protein ARALYDRAFT_475521           74.7    7e-11   
ref|XP_010237577.1|  PREDICTED: uncharacterized protein LOC104584503  69.3    8e-11   
ref|XP_002888311.1|  hypothetical protein ARALYDRAFT_315474           74.3    8e-11   
ref|XP_005171014.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.9    1e-10   
ref|XP_004520050.1|  PREDICTED: uncharacterized protein LOC101463...  73.9    1e-10   
ref|XP_010513791.1|  PREDICTED: uncharacterized protein LOC104789849  71.2    1e-10   
ref|XP_001654828.1|  ubiquitin specific proteinase                    73.6    1e-10   
gb|KFV49370.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54     70.1    1e-10   
gb|KFP71398.1|  Inactive ubiquitin carboxyl-terminal hydrolase 53     70.5    1e-10   
ref|XP_009669542.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.6    2e-10   
ref|XP_009669549.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.6    2e-10   
ref|XP_005185710.1|  PREDICTED: uncharacterized protein LOC101888198  73.6    2e-10   
ref|XP_009939859.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_008502218.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_005263135.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    2e-10   
ref|NP_001188495.1|  inactive ubiquitin carboxyl-terminal hydrola...  73.2    2e-10   
ref|XP_004383284.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_003967035.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_008062463.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_008062461.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_010900269.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    2e-10   
ref|XP_008062462.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_005481493.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
ref|XP_010678606.1|  PREDICTED: uncharacterized protein LOC104894...  73.2    2e-10   
ref|XP_009876730.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  73.2    2e-10   
gb|KFQ77113.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54     70.5    2e-10   
gb|KFQ24060.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54     70.5    2e-10   
ref|XP_010193417.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    2e-10   
ref|XP_009584486.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...  72.8    2e-10   
ref|XP_010126740.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    2e-10   
gb|KFQ09493.1|  Inactive ubiquitin carboxyl-terminal hydrolase 54     70.1    2e-10   
ref|XP_007520444.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    2e-10   
ref|XP_002199015.2|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.5    3e-10   
ref|XP_006814545.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_005156918.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    3e-10   
ref|XP_006874655.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...  72.4    3e-10   
gb|AFW89721.1|  hypothetical protein ZEAMMB73_873945                  65.9    3e-10   
ref|XP_010477882.1|  PREDICTED: uncharacterized protein LOC104756918  72.4    3e-10   
ref|XP_004549620.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_005015737.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    3e-10   
ref|XP_009305609.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.8    3e-10   
ref|XP_005726844.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_005814530.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_005942098.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_421621.4|  PREDICTED: inactive ubiquitin carboxyl-terminal...  72.4    3e-10   
ref|XP_004942143.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_004942141.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_010712697.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_006787209.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_004942144.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_005457080.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
ref|XP_003972052.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.4    3e-10   
emb|CDQ64216.1|  unnamed protein product                              72.4    4e-10   
ref|XP_005726843.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.0    4e-10   
ref|XP_010239097.1|  PREDICTED: uncharacterized protein LOC100821334  68.6    4e-10   
ref|XP_006630065.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.0    4e-10   
ref|XP_010743237.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.0    4e-10   
ref|XP_003755143.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.0    4e-10   
ref|XP_010774334.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    4e-10   
ref|XP_005807237.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    4e-10   
ref|XP_008315118.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    5e-10   
ref|XP_006804206.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    5e-10   
ref|XP_566191.4|  AGAP000205-PA                                       72.0    5e-10   
ref|XP_003436937.1|  AGAP000205-PB                                    72.0    5e-10   
ref|XP_006663582.1|  PREDICTED: uncharacterized protein LOC102714512  71.6    5e-10   
ref|XP_007551828.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    5e-10   
ref|XP_004915992.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  72.0    5e-10   
ref|XP_007232818.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_009081300.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_002935811.2|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_007258811.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_006630960.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_004915986.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_008947773.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.5    6e-10   
ref|XP_007255231.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_010862209.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.6    6e-10   
ref|XP_009305611.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    6e-10   
ref|XP_007258808.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    7e-10   
ref|XP_008284913.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    7e-10   
ref|XP_010774333.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    7e-10   
gb|EEE52371.1|  hypothetical protein OsJ_34444                        71.2    8e-10   
ref|XP_004624438.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...  71.2    8e-10   
ref|XP_009080980.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.1    8e-10   
dbj|BAC29609.1|  unnamed protein product                              69.7    8e-10   
ref|XP_005681337.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    8e-10   
ref|NP_001068218.1|  Os11g0598900                                     71.2    8e-10   
ref|XP_005083634.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    8e-10   
ref|XP_007258810.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    8e-10   
ref|XP_006519770.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  71.2    8e-10   
ref|XP_005468261.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    9e-10   
ref|XP_005468262.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    9e-10   
ref|XP_010789473.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    9e-10   
ref|XP_010789471.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    9e-10   
ref|XP_006519767.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_007577066.1|  PREDICTED: LOW QUALITY PROTEIN: inactive ubi...  70.9    1e-09   
emb|CAG02292.1|  unnamed protein product                              70.5    1e-09   
gb|EEC84994.1|  hypothetical protein OsI_32276                        70.9    1e-09   
ref|XP_004353141.1|  ubiquitin carboxyl-terminal hydrolase            70.5    1e-09   
dbj|BAE24394.1|  unnamed protein product                              70.1    1e-09   
ref|XP_006519769.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_006519764.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_009243746.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_004931139.1|  PREDICTED: uncharacterized protein LOC101744043  70.9    1e-09   
ref|XP_004615516.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|NP_084456.2|  inactive ubiquitin carboxyl-terminal hydrolase 54   70.9    1e-09   
ref|XP_006519766.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_004273167.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_009305022.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_005263134.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.5    1e-09   
ref|XP_006663516.1|  PREDICTED: uncharacterized protein LOC102714870  70.5    1e-09   
ref|XP_005263133.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.5    1e-09   
ref|XP_009305020.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_009305019.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
ref|XP_009305018.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   
dbj|BAC33102.1|  unnamed protein product                              69.7    1e-09   
ref|XP_008516028.1|  PREDICTED: inactive ubiquitin carboxyl-termi...  70.9    1e-09   



>gb|EPS61315.1| hypothetical protein M569_13482 [Genlisea aurea]
Length=1566

 Score =   256 bits (653),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 156/251 (62%), Gaps = 55/251 (22%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIAL------SNLYPDSN------------  1104
             CVTCALY+IF ALSM S + +R+AVAPTSLR++L      SN + +              
Sbjct  1312  CVTCALYEIFIALSMMSKDNKRDAVAPTSLRVSLSNLYPNSNFFQEGQMNDASEVLGVIF  1371

Query  1103  -------------------------------------FFQEVMHKKRSFDELMNLLLRDY  1035
                                                  F  + M  + SFDEL+NL+  ++
Sbjct  1372  HCLHQSFASPASVSLSAAESVTGSWDCSDPSCIAHSIFGMDAMCSEYSFDELLNLVEMNH  1431

Query  1034  LLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVP  855
              L CDPDA GCGKLN I+H L +PPHVFT V+GW+NT ES+DDI+ATLSALS EIDIS  
Sbjct  1432  QLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNTSESVDDIKATLSALSMEIDISAL  1491

Query  854   YHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQ  675
             Y GLDP+ KH LVSVVCYY QHYHC A+SR+ E+WIMYDDK VK IG WDDV+ MC KG 
Sbjct  1492  YRGLDPQTKHALVSVVCYYGQHYHCFAFSRETEQWIMYDDKTVKAIGGWDDVIAMCEKGH  1551

Query  674   LQPQVLFFEAA  642
             LQPQVL FEAA
Sbjct  1552  LQPQVLLFEAA  1562



>emb|CDP14893.1| unnamed protein product [Coffea canephora]
Length=150

 Score =   228 bits (582),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = -3

Query  1088  MHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLD  909
             M  + SFDEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+NTCE +D
Sbjct  1     MCPESSFDELLNLVEMNHQLACDPEARGCGKLNYIHHILSTPPHVFTTVLGWQNTCEHVD  60

Query  908   DIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKN  729
             DI+ATL+ALSTE+DISV Y GLDPKN+H LVSVVCYY QHYHC AYS+DHE+W+MYDDK 
Sbjct  61    DIKATLTALSTEMDISVLYRGLDPKNRHCLVSVVCYYGQHYHCFAYSQDHERWLMYDDKT  120

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             VK IG W+DVL MC +G LQPQVL FEA N
Sbjct  121   VKVIGGWEDVLTMCERGHLQPQVLLFEAVN  150



>emb|CDP06267.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 162/309 (52%), Gaps = 112/309 (36%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE--------------  1092
             CV CALYDIF+AL+ AS++ +REAVAPTSLRIALSNLYPDSNFFQE              
Sbjct  35    CVVCALYDIFSALNTASVDARREAVAPTSLRIALSNLYPDSNFFQEGQMNDASEVLGVIF  94

Query  1091  --------------------------------VMHKKRSFDELMNLLLRDYLLVCDPDAN  1008
                                             VM  + S DEL+NL+  ++ L CDP+A 
Sbjct  95    DCLHRLFTSTMLHFILPQYQCQCSAYYEDTFQVMCPESSLDELLNLVEMNHQLACDPEAG  154

Query  1007  GCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNK  828
             GCGKL+ I+H L T PHVFT V+GW+NTCE +DDI ATL+ALSTE+DISV Y GLD KN+
Sbjct  155   GCGKLSYIHHILSTTPHVFTTVLGWQNTCEHVDDITATLTALSTEMDISVLYRGLDLKNR  214

Query  827   H---------------------HLVSV------------------VCYYRQHYHCVAYSR  765
                                   H+ +                   VCYY QHYHC AYS+
Sbjct  215   QICQQRNLPIKGCSLSLLLSHTHIYTPLLKILLLKIPDLFSTMDKVCYYGQHYHCFAYSQ  274

Query  764   DHEKWIMYDDKNVK---------------------------EIGSWDDVLMMCIKGQLQP  666
             DHE+W+MY DK VK                            IG W+DVL MC +G LQP
Sbjct  275   DHERWLMYVDKTVKVNPICLAFIPSIPLFHKTNKHLRFEIYVIGGWEDVLTMCERGHLQP  334

Query  665   QVLFFEAAN  639
             QVLFFEA N
Sbjct  335   QVLFFEAVN  343



>ref|XP_011087203.1| PREDICTED: uncharacterized protein LOC105168755 isoform X3 [Sesamum 
indicum]
Length=1590

 Score =   238 bits (608),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDPDA GCGKLN I+H L +PPHVFT V+GW+N+CES
Sbjct  1439  KVMCPENSFDELLNLVEMNHQLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNSCES  1498

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+ALSTEIDISV Y GLDP+NK  LVSVVCYY QHYHC AYSRDHE+WIMYDD
Sbjct  1499  VDDITATLAALSTEIDISVLYRGLDPQNKRCLVSVVCYYGQHYHCFAYSRDHEQWIMYDD  1558

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W+DVL MC +G LQPQVLFFEA N
Sbjct  1559  KTVKVIGGWNDVLTMCERGHLQPQVLFFEAVN  1590


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIF ALSM   + +REAVAPTSLR+ALSNLYPDS+FFQE
Sbjct  1302  CVICALYDIFIALSMGPKDNRREAVAPTSLRVALSNLYPDSSFFQE  1347



>ref|XP_011087202.1| PREDICTED: uncharacterized protein LOC105168755 isoform X2 [Sesamum 
indicum]
Length=1622

 Score =   238 bits (607),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDPDA GCGKLN I+H L +PPHVFT V+GW+N+CES
Sbjct  1471  KVMCPENSFDELLNLVEMNHQLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNSCES  1530

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+ALSTEIDISV Y GLDP+NK  LVSVVCYY QHYHC AYSRDHE+WIMYDD
Sbjct  1531  VDDITATLAALSTEIDISVLYRGLDPQNKRCLVSVVCYYGQHYHCFAYSRDHEQWIMYDD  1590

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W+DVL MC +G LQPQVLFFEA N
Sbjct  1591  KTVKVIGGWNDVLTMCERGHLQPQVLFFEAVN  1622


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIF ALSM   + +REAVAPTSLR+ALSNLYPDS+FFQE
Sbjct  1334  CVICALYDIFIALSMGPKDNRREAVAPTSLRVALSNLYPDSSFFQE  1379



>ref|XP_011087199.1| PREDICTED: uncharacterized protein LOC105168755 isoform X1 [Sesamum 
indicum]
 ref|XP_011087200.1| PREDICTED: uncharacterized protein LOC105168755 isoform X1 [Sesamum 
indicum]
Length=1627

 Score =   238 bits (607),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDPDA GCGKLN I+H L +PPHVFT V+GW+N+CES
Sbjct  1476  KVMCPENSFDELLNLVEMNHQLACDPDAGGCGKLNYIHHILSSPPHVFTTVLGWQNSCES  1535

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+ALSTEIDISV Y GLDP+NK  LVSVVCYY QHYHC AYSRDHE+WIMYDD
Sbjct  1536  VDDITATLAALSTEIDISVLYRGLDPQNKRCLVSVVCYYGQHYHCFAYSRDHEQWIMYDD  1595

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W+DVL MC +G LQPQVLFFEA N
Sbjct  1596  KTVKVIGGWNDVLTMCERGHLQPQVLFFEAVN  1627


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIF ALSM   + +REAVAPTSLR+ALSNLYPDS+FFQE
Sbjct  1339  CVICALYDIFIALSMGPKDNRREAVAPTSLRVALSNLYPDSSFFQE  1384



>ref|XP_009588932.1| PREDICTED: uncharacterized protein LOC104086396 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588933.1| PREDICTED: uncharacterized protein LOC104086396 isoform X1 [Nicotiana 
tomentosiformis]
Length=1623

 Score =   238 bits (607),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +  GCGKLN I+H L TPPHVFTIV+GW+NTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH L+SVVCYY QHYHC AY  DH +W+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSWDDVL+MC +G LQPQVLFFEA N
Sbjct  1592  KTVKVIGSWDDVLVMCERGHLQPQVLFFEAVN  1623


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALS AS ET RE VAP+SLRIALSNLYPD+NFFQE
Sbjct  1335  CVICALYDIFTALSTASTETCRETVAPSSLRIALSNLYPDNNFFQE  1380



>ref|XP_009594415.1| PREDICTED: uncharacterized protein LOC104090916 [Nicotiana tomentosiformis]
 ref|XP_009594416.1| PREDICTED: uncharacterized protein LOC104090916 [Nicotiana tomentosiformis]
Length=1641

 Score =   237 bits (604),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+  GC KLN I+H L  PPHVFT V+GW+NTCES
Sbjct  1490  KVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSAPPHVFTTVLGWQNTCES  1549

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH+LVSVVCYY QHYHC AYSRD  +WIMYDD
Sbjct  1550  VDDIKATLSALSTEVDIGVLYRGLDPKNKHYLVSVVCYYGQHYHCFAYSRDRGQWIMYDD  1609

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG WDDVL+MC +G LQPQVLFFEA N
Sbjct  1610  KTVKVIGGWDDVLVMCERGHLQPQVLFFEAVN  1641


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTALSMAS E +REAVAPT+LRIALSNLYPDSNFFQE  
Sbjct  1353  CVVCALYDIFTALSMASTEMRREAVAPTTLRIALSNLYPDSNFFQEAQ  1400



>ref|XP_009777756.1| PREDICTED: uncharacterized protein LOC104227244 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009777757.1| PREDICTED: uncharacterized protein LOC104227244 isoform X1 [Nicotiana 
sylvestris]
Length=1623

 Score =   236 bits (603),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +  GCGKLN I+H L TPPHVFTIV+GW+NTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH L+SVVCYY QHYHC AY  DH +W+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG WDDVL+MC +G LQPQVLFFEA N
Sbjct  1592  KTVKVIGGWDDVLVMCERGHLQPQVLFFEAVN  1623


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALS AS E  R+ VAP+SLRIALSNLYPDSNFFQE
Sbjct  1335  CVICALYDIFTALSTASTEICRKTVAPSSLRIALSNLYPDSNFFQE  1380



>emb|CBI15290.3| unnamed protein product [Vitis vinifera]
Length=1552

 Score =   236 bits (603),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+A GCGK N I+H L TPPHVFTIV+GW+NTCES
Sbjct  1401  KVMCAESSFDELLNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCES  1460

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEID+SV Y GLDPKN++ LVSVVCYY QHYHC AYS +HE+W+MYDD
Sbjct  1461  ADDITATLAALNTEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDD  1520

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSWD+VL MC +G LQPQVLFFEA N
Sbjct  1521  KTVKVIGSWDNVLTMCERGHLQPQVLFFEAVN  1552


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T+REAVAP++LRIALSNLYPDSNFFQE  
Sbjct  1264  CVVCALYEIFTALSVASTDTRREAVAPSALRIALSNLYPDSNFFQEAQ  1311



>ref|XP_009790879.1| PREDICTED: uncharacterized protein LOC104238260 [Nicotiana sylvestris]
 ref|XP_009790880.1| PREDICTED: uncharacterized protein LOC104238260 [Nicotiana sylvestris]
Length=1635

 Score =   236 bits (603),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+  GC KLN I+H L  PPHVFT V+GW+NTCES
Sbjct  1484  KVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSAPPHVFTTVLGWQNTCES  1543

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI + Y GLDPKNKH+LVSVVCYY QHYHC AYSRD  +WIMYDD
Sbjct  1544  VDDIKATLSALSTEVDIGILYRGLDPKNKHYLVSVVCYYGQHYHCFAYSRDRGQWIMYDD  1603

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG WDDVL+MC +G LQPQVLFFEA N
Sbjct  1604  KTVKVIGGWDDVLVMCERGHLQPQVLFFEAVN  1635


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTALSMAS E +REAVAP++LRIALSNLYPDSNFFQE  
Sbjct  1347  CVVCALYDIFTALSMASTEMRREAVAPSTLRIALSNLYPDSNFFQEAQ  1394



>ref|XP_010663421.1| PREDICTED: uncharacterized protein LOC100256959 isoform X2 [Vitis 
vinifera]
Length=1649

 Score =   236 bits (602),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+A GCGK N I+H L TPPHVFTIV+GW+NTCES
Sbjct  1498  KVMCAESSFDELLNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCES  1557

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEID+SV Y GLDPKN++ LVSVVCYY QHYHC AYS +HE+W+MYDD
Sbjct  1558  ADDITATLAALNTEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDD  1617

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSWD+VL MC +G LQPQVLFFEA N
Sbjct  1618  KTVKVIGSWDNVLTMCERGHLQPQVLFFEAVN  1649


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T+REAVAP++LRIALSNLYPDSNFFQE  
Sbjct  1361  CVVCALYEIFTALSVASTDTRREAVAPSALRIALSNLYPDSNFFQEAQ  1408



>ref|XP_002266656.1| PREDICTED: uncharacterized protein LOC100256959 isoform X1 [Vitis 
vinifera]
Length=1653

 Score =   236 bits (602),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+A GCGK N I+H L TPPHVFTIV+GW+NTCES
Sbjct  1502  KVMCAESSFDELLNLVEMNHQLACDPEAGGCGKFNYIHHILSTPPHVFTIVLGWQNTCES  1561

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEID+SV Y GLDPKN++ LVSVVCYY QHYHC AYS +HE+W+MYDD
Sbjct  1562  ADDITATLAALNTEIDVSVLYRGLDPKNRYCLVSVVCYYGQHYHCFAYSHEHERWVMYDD  1621

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSWD+VL MC +G LQPQVLFFEA N
Sbjct  1622  KTVKVIGSWDNVLTMCERGHLQPQVLFFEAVN  1653


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T+REAVAP++LRIALSNLYPDSNFFQE  
Sbjct  1365  CVVCALYEIFTALSVASTDTRREAVAPSALRIALSNLYPDSNFFQEAQ  1412



>emb|CDP14890.1| unnamed protein product [Coffea canephora]
Length=1704

 Score =   234 bits (596),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+NTCE 
Sbjct  1553  KVMCPESSFDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPHVFTTVLGWQNTCEH  1612

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATL+AL TE+DISV Y GLDPKN+H LVSVVCYY QHYHC AYS+DHE+W+MYDD
Sbjct  1613  VDDIKATLTALCTEMDISVLYRGLDPKNRHCLVSVVCYYGQHYHCFAYSQDHERWLMYDD  1672

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W+DVL MC +G LQPQVL FEA N
Sbjct  1673  KTVKVIGGWEDVLTMCERGHLQPQVLLFEAVN  1704


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIF AL+ AS++ +REAVAPTSLRIALSNLYPDSNFFQE
Sbjct  1416  CVVCALYDIFAALNTASVDARREAVAPTSLRIALSNLYPDSNFFQE  1461



>ref|XP_008346826.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
[Malus domestica]
Length=384

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+N +  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  233   KVMCTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHHILTTPPHVFTTVLGWQKTCES  292

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI+ATL+AL+TEIDISV Y GLDPK  H+LVSVVCYY QHYHC AYS D   WIMYDD
Sbjct  293   ADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHDRGCWIMYDD  352

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  353   KTVKVIGGWADVLTMCERGHLQPQVLFFEAVN  384


 Score = 82.4 bits (202),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEV  1089
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE 
Sbjct  96    CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEA  142



>ref|XP_007037182.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 ref|XP_007037183.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 ref|XP_007037184.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 gb|EOY21683.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 gb|EOY21684.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
 gb|EOY21685.1| Ubiquitin carboxyl-terminal hydrolase-related protein isoform 
1 [Theobroma cacao]
Length=1628

 Score =   232 bits (592),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +V+  + SFDEL+NL+ R++ L CDP+A GC +LNCI+H L  PPHVFT V+GW+NT E 
Sbjct  1477  KVLCAESSFDELLNLVERNHQLACDPEAGGCRRLNCIHHILSNPPHVFTTVLGWQNTSEC  1536

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+ EIDISV Y GLDPKNKHHLVSVVCYY QHYHC AYS DHE+WI YDD
Sbjct  1537  ADDIAATLAALNNEIDISVLYRGLDPKNKHHLVSVVCYYGQHYHCFAYSHDHERWIKYDD  1596

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DV+ MC +G+LQPQVLFFEA N
Sbjct  1597  KTVKVIGGWADVVKMCEQGRLQPQVLFFEAVN  1628


 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IF+AL+++S + +RE VAPTSLR+ALSNLYPDSNFFQE  
Sbjct  1340  CVVCALYEIFSALNISSTDARREPVAPTSLRVALSNLYPDSNFFQEAQ  1387



>gb|KDP31191.1| hypothetical protein JCGZ_11567 [Jatropha curcas]
Length=1615

 Score =   231 bits (588),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 123/152 (81%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             + M  + SFDEL+NL+  ++ L CDP++ GCGKLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1464  KAMCAESSFDELLNLVEMNHQLACDPESGGCGKLNYIHHILSTPPHVFTTVLGWQNTCES  1523

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALSTEIDISV Y GLDPK+ H LVSVVCYY QHYHC AYS+DHE WIMYDD
Sbjct  1524  ADDIAATLAALSTEIDISVLYRGLDPKSTHTLVSVVCYYGQHYHCFAYSQDHEWWIMYDD  1583

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             + VK +G+W DVL MC +G LQPQVLFFEA N
Sbjct  1584  RTVKVVGNWADVLSMCERGHLQPQVLFFEAVN  1615


 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTALS+AS + +RE VAPTSLRIALSNLYPDSNFFQE  
Sbjct  1327  CVVCALYDIFTALSIASTDMRREPVAPTSLRIALSNLYPDSNFFQEAQ  1374



>ref|XP_011071732.1| PREDICTED: uncharacterized protein LOC105157124 isoform X1 [Sesamum 
indicum]
Length=1594

 Score =   230 bits (587),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM+   SFDEL+NL+  ++ L CDP++ GCGK N I+H L TPPHVFT V+GW+NTCE 
Sbjct  1443  KVMYPDNSFDELLNLVEMNHQLACDPESGGCGKPNYIHHILSTPPHVFTTVLGWQNTCER  1502

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             ++DI ATL+ALSTEID+SV Y GLDP+N+H LVSVVCYY QHYHC AYSRDHE+WIMYDD
Sbjct  1503  IEDITATLAALSTEIDVSVLYRGLDPQNRHCLVSVVCYYGQHYHCFAYSRDHEQWIMYDD  1562

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W+DVL MC +G LQPQ+L +EA N
Sbjct  1563  KTVKVIGGWNDVLTMCERGHLQPQLLLYEAVN  1594


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIF ALSMAS + +REAVAPTSLR+ALSNLYPDSNFFQE
Sbjct  1306  CVICALYDIFFALSMASKDNRREAVAPTSLRVALSNLYPDSNFFQE  1351



>ref|XP_011042624.1| PREDICTED: uncharacterized protein LOC105138272 isoform X3 [Populus 
euphratica]
 ref|XP_011042625.1| PREDICTED: uncharacterized protein LOC105138272 isoform X4 [Populus 
euphratica]
Length=1513

 Score =   230 bits (587),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  +  FDEL+NL+  ++LL CDP+A GCGK N INH   TPPHVFT V+GW+ TCES
Sbjct  1362  KVMCVESCFDELLNLVEMNHLLTCDPEAGGCGKPNYINHIKTTPPHVFTTVLGWRKTCES  1421

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATL+ALSTEIDISV YHGLD +N   LVSVVCYY QHYHC AYS DH +WIMYDD
Sbjct  1422  IDDIKATLAALSTEIDISVFYHGLDLENIRSLVSVVCYYGQHYHCFAYSHDHSQWIMYDD  1481

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSW DVL+MC KG LQPQVLFFEA N
Sbjct  1482  KTVKVIGSWTDVLIMCEKGHLQPQVLFFEAGN  1513


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDI TA+SMAS +T+REAVAPTSLRIALSNLYP+SNFFQE
Sbjct  1224  CVVCALYDILTAISMASTDTRREAVAPTSLRIALSNLYPNSNFFQE  1269



>ref|XP_011071733.1| PREDICTED: uncharacterized protein LOC105157124 isoform X2 [Sesamum 
indicum]
Length=1586

 Score =   230 bits (587),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM+   SFDEL+NL+  ++ L CDP++ GCGK N I+H L TPPHVFT V+GW+NTCE 
Sbjct  1435  KVMYPDNSFDELLNLVEMNHQLACDPESGGCGKPNYIHHILSTPPHVFTTVLGWQNTCER  1494

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             ++DI ATL+ALSTEID+SV Y GLDP+N+H LVSVVCYY QHYHC AYSRDHE+WIMYDD
Sbjct  1495  IEDITATLAALSTEIDVSVLYRGLDPQNRHCLVSVVCYYGQHYHCFAYSRDHEQWIMYDD  1554

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W+DVL MC +G LQPQ+L +EA N
Sbjct  1555  KTVKVIGGWNDVLTMCERGHLQPQLLLYEAVN  1586


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIF ALSMAS + +REAVAPTSLR+ALSNLYPDSNFFQE
Sbjct  1298  CVICALYDIFFALSMASKDNRREAVAPTSLRVALSNLYPDSNFFQE  1343



>ref|XP_011042622.1| PREDICTED: uncharacterized protein LOC105138272 isoform X1 [Populus 
euphratica]
Length=1544

 Score =   230 bits (587),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FDEL+NL+  ++LL CDP+A GCGK N INH   TPPHVFT V+GW+ TCES+DDI+ATL
Sbjct  1401  FDELLNLVEMNHLLTCDPEAGGCGKPNYINHIKTTPPHVFTTVLGWRKTCESIDDIKATL  1460

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             +ALSTEIDISV YHGLD +N   LVSVVCYY QHYHC AYS DH +WIMYDDK VK IGS
Sbjct  1461  AALSTEIDISVFYHGLDLENIRSLVSVVCYYGQHYHCFAYSHDHSQWIMYDDKTVKVIGS  1520

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             W DVL+MC KG LQPQVLFFEA N
Sbjct  1521  WTDVLIMCEKGHLQPQVLFFEAGN  1544


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDI TA+SMAS +T+REAVAPTSLRIALSNLYP+SNFFQE
Sbjct  1255  CVVCALYDILTAISMASTDTRREAVAPTSLRIALSNLYPNSNFFQE  1300



>ref|XP_011042623.1| PREDICTED: uncharacterized protein LOC105138272 isoform X2 [Populus 
euphratica]
Length=1542

 Score =   230 bits (586),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/144 (73%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FDEL+NL+  ++LL CDP+A GCGK N INH   TPPHVFT V+GW+ TCES+DDI+ATL
Sbjct  1399  FDELLNLVEMNHLLTCDPEAGGCGKPNYINHIKTTPPHVFTTVLGWRKTCESIDDIKATL  1458

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             +ALSTEIDISV YHGLD +N   LVSVVCYY QHYHC AYS DH +WIMYDDK VK IGS
Sbjct  1459  AALSTEIDISVFYHGLDLENIRSLVSVVCYYGQHYHCFAYSHDHSQWIMYDDKTVKVIGS  1518

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             W DVL+MC KG LQPQVLFFEA N
Sbjct  1519  WTDVLIMCEKGHLQPQVLFFEAGN  1542


 Score = 85.1 bits (209),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDI TA+SMAS +T+REAVAPTSLRIALSNLYP+SNFFQE
Sbjct  1253  CVVCALYDILTAISMASTDTRREAVAPTSLRIALSNLYPNSNFFQE  1298



>gb|ABL66740.1| At3g47900 [Arabidopsis thaliana]
Length=367

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 139/196 (71%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V   + SFDEL+
Sbjct  173   CIAHSLFGMDIFEQLNCYSCGLESRHLKYTSF---FHNINASALRTMKVTCAENSFDELL  229

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGKLN I+H L TPPHVFT V+GW+NTCE+++DI ATL+AL+T
Sbjct  230   NLVEMNHQLACDPETGGCGKLNHIHHILTTPPHVFTTVLGWQNTCETVEDIAATLAALNT  289

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + LVSVVCYY QHYHC A+SR+H++WIMYDDK VK IGSW DVL
Sbjct  290   EIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAHSREHDQWIMYDDKTVKVIGSWIDVL  349

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVL +E
Sbjct  350   SMCERGHLQPQVLLYE  365


 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS  1071
             CV C+LY+IFTALS AS E Q E VAP+SLRIALSNLYPDS+FFQE      S
Sbjct  80    CVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQMNDAS  132



>ref|XP_006354834.1| PREDICTED: uncharacterized protein LOC102605106 [Solanum tuberosum]
Length=1638

 Score =   229 bits (584),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+  GC KLN I+H L  PPH+FT V+GW+NTCE 
Sbjct  1487  KVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSAPPHIFTTVLGWQNTCED  1546

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH L+SVVCYY QHYHC AYS D  +W+MYDD
Sbjct  1547  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYSHDRGQWLMYDD  1606

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG WDDVL+MC +G LQPQVLFFEA N
Sbjct  1607  KTVKVIGGWDDVLVMCERGHLQPQVLFFEAVN  1638


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTAL+ AS E QREA+APTSLRIALSNLYPDSNFFQE  
Sbjct  1350  CVVCALYDIFTALNTASTEMQREAIAPTSLRIALSNLYPDSNFFQEAQ  1397



>ref|XP_008239780.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103338359 
[Prunus mume]
Length=1580

 Score =   228 bits (581),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1429  KVMCAESSYDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPHVFTTVLGWQKTCES  1488

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS D E WIMYDD
Sbjct  1489  ADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDRECWIMYDD  1548

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC KG LQPQVLFFEA N
Sbjct  1549  KTVKVIGGWADVLTMCEKGHLQPQVLFFEAVN  1580


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IF ALS AS + +REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1292  CVVCALYEIFIALSNASADMRREAVAPTSLRIALSNLYPESNFFQEAQ  1339



>ref|XP_007210436.1| hypothetical protein PRUPE_ppa000140mg [Prunus persica]
 gb|EMJ11635.1| hypothetical protein PRUPE_ppa000140mg [Prunus persica]
Length=1649

 Score =   228 bits (581),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1498  KVMCAESSYDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPHVFTTVLGWQKTCES  1557

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS D E WIMYDD
Sbjct  1558  ADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDRECWIMYDD  1617

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC KG LQPQVLFFEA N
Sbjct  1618  KTVKVIGGWADVLTMCEKGHLQPQVLFFEAVN  1649


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS + +REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1361  CVVCALYEIFTALSNASADMRREAVAPTSLRIALSNLYPESNFFQEAQ  1408



>ref|XP_006476671.1| PREDICTED: uncharacterized protein LOC102612465 isoform X1 [Citrus 
sinensis]
Length=1634

 Score =   228 bits (581),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S DEL+NL+  ++ L CDP A GC KLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1483  KVMCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCES  1542

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALS EIDIS+ Y GLDPK +H LVSVVCYY QHYHC AYS D E+WIMYDD
Sbjct  1543  FDDITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDD  1602

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK +GSW DVL MC +G LQPQVLFFEA N
Sbjct  1603  KTVKVVGSWSDVLSMCERGHLQPQVLFFEAVN  1634


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T++EAVAPTSLRIALSNLYPDSNFFQE  
Sbjct  1346  CVVCALYEIFTALSIASTDTRKEAVAPTSLRIALSNLYPDSNFFQEAQ  1393



>gb|KDO76021.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1634

 Score =   228 bits (581),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S DEL+NL+  ++ L CDP A GC KLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1483  KVMCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCES  1542

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALS EIDIS+ Y GLDPK +H LVSVVCYY QHYHC AYS D E+WIMYDD
Sbjct  1543  FDDITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDD  1602

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK +GSW DVL MC +G LQPQVLFFEA N
Sbjct  1603  KTVKVVGSWSDVLSMCERGHLQPQVLFFEAVN  1634


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T++EAVAPTSLRIALSNLYPDSNFFQE  
Sbjct  1346  CVVCALYEIFTALSIASTDTRKEAVAPTSLRIALSNLYPDSNFFQEAQ  1393



>ref|XP_006439669.1| hypothetical protein CICLE_v10018472mg [Citrus clementina]
 gb|ESR52909.1| hypothetical protein CICLE_v10018472mg [Citrus clementina]
Length=1634

 Score =   228 bits (581),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S DEL+NL+  ++ L CDP A GC KLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1483  KVMCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCES  1542

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALS EIDIS+ Y GLDPK +H LVSVVCYY QHYHC AYS D E+WIMYDD
Sbjct  1543  FDDITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDD  1602

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK +GSW DVL MC +G LQPQVLFFEA N
Sbjct  1603  KTVKVVGSWSDVLSMCERGHLQPQVLFFEAVN  1634


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T++EAVAPTSLRIALSNLYPDSNFFQE  
Sbjct  1346  CVVCALYEIFTALSIASTDTRKEAVAPTSLRIALSNLYPDSNFFQEAQ  1393



>ref|XP_004508791.1| PREDICTED: uncharacterized protein LOC101496590 isoform X1 [Cicer 
arietinum]
Length=1649

 Score =   228 bits (580),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFD+L+NL+ R++ L CD + +GCGKLN I+HFL TPPHVF  V+GW+NTCES
Sbjct  1498  KVMFPESSFDKLLNLVERNHQLACDLEVDGCGKLNHIHHFLSTPPHVFMTVLGWQNTCES  1557

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALST+IDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS +HE+WIMYDD
Sbjct  1558  ADDITATLAALSTKIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHEHEQWIMYDD  1617

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL +C +G LQPQVLFFEA N
Sbjct  1618  KTVKIIGGWADVLTVCERGHLQPQVLFFEAVN  1649


 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL +AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1361  CVVCALYEIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1408



>ref|XP_004508792.1| PREDICTED: uncharacterized protein LOC101496590 isoform X2 [Cicer 
arietinum]
Length=1648

 Score =   228 bits (580),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFD+L+NL+ R++ L CD + +GCGKLN I+HFL TPPHVF  V+GW+NTCES
Sbjct  1497  KVMFPESSFDKLLNLVERNHQLACDLEVDGCGKLNHIHHFLSTPPHVFMTVLGWQNTCES  1556

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALST+IDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS +HE+WIMYDD
Sbjct  1557  ADDITATLAALSTKIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHEHEQWIMYDD  1616

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL +C +G LQPQVLFFEA N
Sbjct  1617  KTVKIIGGWADVLTVCERGHLQPQVLFFEAVN  1648


 Score = 80.9 bits (198),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL +AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1360  CVVCALYEIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1407



>ref|XP_004241561.1| PREDICTED: uncharacterized protein LOC101248307 [Solanum lycopersicum]
Length=1638

 Score =   228 bits (580),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+  GC KLN I+H L  PPH+FT V+GW+NTCE 
Sbjct  1487  KVMCPESSFDELLNLVEMNHQLACDPEVGGCEKLNYIHHILSAPPHIFTTVLGWQNTCED  1546

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH L SVVCYY QHYHC AYS D  +WIMYDD
Sbjct  1547  VDDIKATLSALSTEVDIGVLYRGLDPKNKHCLTSVVCYYGQHYHCFAYSHDRGQWIMYDD  1606

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG WDDVL+MC +G LQPQVLFFEA N
Sbjct  1607  KTVKVIGGWDDVLVMCERGHLQPQVLFFEAVN  1638


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTAL+ AS E QREA+APTSLRIALSNLYP+SNFFQE  
Sbjct  1350  CVVCALYDIFTALNTASTEMQREAIAPTSLRIALSNLYPNSNFFQEAQ  1397



>ref|XP_002511504.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52106.1| conserved hypothetical protein [Ricinus communis]
Length=1617

 Score =   227 bits (578),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+N +  ++ L CDP++ GCGKLN I+H L TPP+VFT VIGW+NTCES
Sbjct  1466  KVMCAESSFDELLNQVEMNHQLACDPESGGCGKLNYIHHILSTPPYVFTTVIGWQNTCES  1525

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEIDISV Y GLDPK+ H LVSVVCYY QHYHC AYS+D  +WIMYDD
Sbjct  1526  ADDIAATLAALNTEIDISVLYRGLDPKSMHGLVSVVCYYGQHYHCFAYSQDQGRWIMYDD  1585

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSW DVL MC +G LQPQVLFFEA N
Sbjct  1586  KTVKVIGSWADVLSMCERGHLQPQVLFFEAVN  1617


 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IF AL+ AS + +REAVAPTSLRIALSNLYPDSNFFQE  
Sbjct  1329  CVVCALYEIFNALNAASTDMRREAVAPTSLRIALSNLYPDSNFFQEAQ  1376



>ref|XP_010028652.1| PREDICTED: uncharacterized protein LOC104418879 [Eucalyptus grandis]
 gb|KCW83491.1| hypothetical protein EUGRSUZ_B00398 [Eucalyptus grandis]
Length=1614

 Score =   227 bits (578),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +V   + SFD+L+N++  ++ L CDP++ GCGK N  +HFL T PHVFT V+GW+NTCES
Sbjct  1463  KVTSSESSFDQLLNIVEMNHQLTCDPESGGCGKFNYKHHFLSTAPHVFTTVVGWQNTCES  1522

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATLSALSTEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS +HEKWIMYDD
Sbjct  1523  ADDIAATLSALSTEIDISVLYRGLDPKHMHNLVSVVCYYGQHYHCFAYSCEHEKWIMYDD  1582

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEA  645
             K VK IGSW DVL MC +G LQPQVLFFEA
Sbjct  1583  KTVKVIGSWADVLTMCERGHLQPQVLFFEA  1612


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTALS A+ + ++EA+APT+LRIALSNLYPDSNFFQE  
Sbjct  1327  CVVCALYDIFTALSTATADARKEAIAPTALRIALSNLYPDSNFFQEAQ  1374



>ref|XP_010515103.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 54-like 
[Camelina sativa]
Length=478

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 139/196 (71%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V + + SFDEL+
Sbjct  284   CIAHSLFGMDIFEQLNCYSCGLESRHMKYTSF---FHNINASALRTMKVTYPENSFDELL  340

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGK N I+H L TPP+VFT V+GW+NTCE+++DI  TL+AL+T
Sbjct  341   NLVEVNHQLACDPETGGCGKPNHIHHILTTPPNVFTTVLGWQNTCETVEDIADTLAALNT  400

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + LVSVVCYY QHYHC AYS +H++WIMYDDKNVK IGSW DVL
Sbjct  401   EIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVL  460

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVLF+E
Sbjct  461   TMCERGHLQPQVLFYE  476


 Score = 77.8 bits (190),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS------F  1068
             CV C+LY++FTALS+AS E+++E VAP+SLRIALSNLYPDS+FFQE      S      F
Sbjct  191   CVVCSLYEVFTALSVASSESRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLAVIF  250

Query  1067  DELMNLLLRDYLL--VCDPDANGCGKLNCIN  981
             D L     +   L      ++N  G  +C N
Sbjct  251   DCLHRSFAQSSSLSDTESAESNSTGSWDCAN  281



>ref|XP_011028695.1| PREDICTED: uncharacterized protein LOC105128635 isoform X1 [Populus 
euphratica]
Length=1573

 Score =   226 bits (577),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +A GCGK N  +H L TPPHVFT V+GW+ TCES
Sbjct  1422  KVMCAESSFDELLNLVEMNHQLACDTEAGGCGKPNYTHHILSTPPHVFTTVLGWQKTCES  1481

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+AL+TEIDISV Y GLDPKN   LVSVVCYY QHYHC AYS+DH++WIMYDD
Sbjct  1482  IDDITATLTALNTEIDISVFYRGLDPKNIRSLVSVVCYYGQHYHCFAYSQDHDQWIMYDD  1541

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSW DVL MC KG LQPQVLFFEA N
Sbjct  1542  KTVKVIGSWTDVLTMCEKGHLQPQVLFFEAGN  1573


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDI TA+S+ S++T+REAVAPTSLRIALSNLYP+SNFFQE
Sbjct  1284  CVVCALYDILTAMSIVSMDTRREAVAPTSLRIALSNLYPNSNFFQE  1329



>ref|XP_011028696.1| PREDICTED: uncharacterized protein LOC105128635 isoform X2 [Populus 
euphratica]
Length=1571

 Score =   226 bits (577),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +A GCGK N  +H L TPPHVFT V+GW+ TCES
Sbjct  1420  KVMCAESSFDELLNLVEMNHQLACDTEAGGCGKPNYTHHILSTPPHVFTTVLGWQKTCES  1479

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+AL+TEIDISV Y GLDPKN   LVSVVCYY QHYHC AYS+DH++WIMYDD
Sbjct  1480  IDDITATLTALNTEIDISVFYRGLDPKNIRSLVSVVCYYGQHYHCFAYSQDHDQWIMYDD  1539

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSW DVL MC KG LQPQVLFFEA N
Sbjct  1540  KTVKVIGSWTDVLTMCEKGHLQPQVLFFEAGN  1571


 Score = 82.8 bits (203),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDI TA+S+ S++T+REAVAPTSLRIALSNLYP+SNFFQE
Sbjct  1282  CVVCALYDILTAMSIVSMDTRREAVAPTSLRIALSNLYPNSNFFQE  1327



>ref|XP_010272205.1| PREDICTED: uncharacterized protein LOC104608045 isoform X2 [Nelumbo 
nucifera]
Length=1744

 Score =   226 bits (577),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             ++M    SFDEL+ L+  ++ L CDP+A GCGKLN I+H L +PPHVFT V+GW+NT ES
Sbjct  1593  KIMCADSSFDELLKLVEMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTSES  1652

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+ALSTE+DI V Y GLDP N+H L+SVVCYY QHYHC AYS +HE+WIMYDD
Sbjct  1653  VDDISATLAALSTELDIGVLYRGLDPGNRHCLISVVCYYGQHYHCFAYSHEHERWIMYDD  1712

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSW DVL+MC +G LQPQVLFFEA N
Sbjct  1713  KTVKVIGSWHDVLVMCERGHLQPQVLFFEAVN  1744


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSMAS +T+REAVAPT LRIALSNLYPDSNFFQE
Sbjct  1456  CVVCALYDIFTALSMASTDTRREAVAPTCLRIALSNLYPDSNFFQE  1501



>ref|XP_010272203.1| PREDICTED: uncharacterized protein LOC104608045 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010272204.1| PREDICTED: uncharacterized protein LOC104608045 isoform X1 [Nelumbo 
nucifera]
Length=1745

 Score =   226 bits (577),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             ++M    SFDEL+ L+  ++ L CDP+A GCGKLN I+H L +PPHVFT V+GW+NT ES
Sbjct  1594  KIMCADSSFDELLKLVEMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTSES  1653

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+ALSTE+DI V Y GLDP N+H L+SVVCYY QHYHC AYS +HE+WIMYDD
Sbjct  1654  VDDISATLAALSTELDIGVLYRGLDPGNRHCLISVVCYYGQHYHCFAYSHEHERWIMYDD  1713

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IGSW DVL+MC +G LQPQVLFFEA N
Sbjct  1714  KTVKVIGSWHDVLVMCERGHLQPQVLFFEAVN  1745


 Score = 87.4 bits (215),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSMAS +T+REAVAPT LRIALSNLYPDSNFFQE
Sbjct  1457  CVVCALYDIFTALSMASTDTRREAVAPTCLRIALSNLYPDSNFFQE  1502



>ref|XP_004301306.1| PREDICTED: uncharacterized protein LOC101311291 [Fragaria vesca 
subsp. vesca]
Length=1635

 Score =   226 bits (575),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1484  KVMCAESSFDELLNLVEMNHQLACDPEAGGCGKLNYIHHILSTPPHVFTTVMGWQNTCES  1543

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              +DI+ATL+AL+TEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS + E W+MYDD
Sbjct  1544  AEDIKATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHERECWVMYDD  1603

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
               VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1604  NTVKVIGGWADVLTMCERGHLQPQVLFFEAVN  1635


 Score = 84.0 bits (206),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1347  CVICALYEIFTALSNASTDTRREAVAPTSLRIALSNLYPESNFFQEAQ  1394



>emb|CDY61846.1| BnaAnng17800D [Brassica napus]
Length=415

 Score =   214 bits (544),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 136/196 (69%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+   L+  +IF  L+  S E +   +  TS      N+   +    +V   + +FDEL+
Sbjct  220   CIAHTLFGMNIFEQLNCNSCELESRHMKYTSF---FHNINASALRNMKVTCPETAFDELL  276

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGK N I HFL TPPHVFT V+GW+NTCES++DI ATL+AL+T
Sbjct  277   NLVEMNHQLACDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAATLAALNT  336

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IGSW DVL
Sbjct  337   EIDISIMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIGSWSDVL  396

Query  695   MMCIKGQLQPQVLFFE  648
              MC KG LQPQ+L +E
Sbjct  397   SMCKKGHLQPQLLLYE  412


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEV  1089
             CV C+LY++ TALS AS E ++E V P++LRIALSNLYPDS+FFQE 
Sbjct  127   CVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPDSSFFQEA  173



>ref|XP_009369371.1| PREDICTED: uncharacterized protein LOC103958773 isoform X1 [Pyrus 
x bretschneideri]
Length=1631

 Score =   224 bits (572),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+N +  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1480  KVMSTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHHILSTPPHVFTTVLGWQKTCES  1539

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI+ATL+AL+TEIDISV Y GLDPK  H+LVSVVCYY QHYHC AYS D   WIMYDD
Sbjct  1540  ADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHDRGCWIMYDD  1599

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1600  KTVKVIGGWADVLTMCERGHLQPQVLFFEAVN  1631


 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1343  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQ  1390



>ref|XP_009369372.1| PREDICTED: uncharacterized protein LOC103958773 isoform X2 [Pyrus 
x bretschneideri]
Length=1629

 Score =   224 bits (571),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+N +  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1478  KVMSTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHHILSTPPHVFTTVLGWQKTCES  1537

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI+ATL+AL+TEIDISV Y GLDPK  H+LVSVVCYY QHYHC AYS D   WIMYDD
Sbjct  1538  ADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHDRGCWIMYDD  1597

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1598  KTVKVIGGWADVLTMCERGHLQPQVLFFEAVN  1629


 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1341  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQ  1388



>ref|XP_009588935.1| PREDICTED: uncharacterized protein LOC104086396 isoform X2 [Nicotiana 
tomentosiformis]
Length=1616

 Score =   224 bits (570),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +  GCGKLN I+H L TPPHVFTIV+GW+NTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH L+SVVCYY QHYHC AY  DH +W+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQV  660
             K VK IGSWDDVL+MC +G LQPQ+
Sbjct  1592  KTVKVIGSWDDVLVMCERGHLQPQM  1616


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALS AS ET RE VAP+SLRIALSNLYPD+NFFQE
Sbjct  1335  CVICALYDIFTALSTASTETCRETVAPSSLRIALSNLYPDNNFFQE  1380



>ref|XP_006374498.1| hypothetical protein POPTR_0015s07770g [Populus trichocarpa]
 gb|ERP52295.1| hypothetical protein POPTR_0015s07770g [Populus trichocarpa]
Length=1573

 Score =   224 bits (570),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +A GCGK N  +H L TPPHVFT V+GW+ TCES
Sbjct  1422  KVMRAESSFDELLNLVEMNHQLACDTEAGGCGKPNYTHHILSTPPHVFTTVLGWQKTCES  1481

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+AL+TEIDISV Y GLDPKN   LVSVVCYY QHYHC AYS+D ++WIMYDD
Sbjct  1482  IDDITATLTALNTEIDISVFYRGLDPKNIRSLVSVVCYYGQHYHCFAYSQDLDQWIMYDD  1541

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K +K IGSW DVL MC KG LQPQVLFFEA N
Sbjct  1542  KTIKVIGSWTDVLAMCEKGHLQPQVLFFEAGN  1573


 Score = 81.6 bits (200),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDI TA+S+ S++T+REAVAPTSLRIALSNLYP+SNFFQE
Sbjct  1284  CAVCALYDILTAMSIVSMDTRREAVAPTSLRIALSNLYPNSNFFQE  1329



>ref|XP_010426256.1| PREDICTED: uncharacterized protein LOC104711264 [Camelina sativa]
Length=1599

 Score =   223 bits (568),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 139/196 (71%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V H   SFDEL+
Sbjct  1405  CIAHSLFGMDIFEQLNCYSCGLESRHMKYTSF---FHNINASALRTMKVTHPGNSFDELL  1461

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGKLN I+H L TPP+VFT V+GW+NTCE+++DI  TL+AL+T
Sbjct  1462  NLVEVNHQLACDPETGGCGKLNHIHHILTTPPNVFTTVLGWQNTCETVEDIAGTLAALNT  1521

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EID+S+ Y GLDPK+ + LVSVVCYY QHYHC AYS +H++WIMYDDKNVK IGSW DVL
Sbjct  1522  EIDVSIMYRGLDPKSAYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVL  1581

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVLF+E
Sbjct  1582  TMCERGHLQPQVLFYE  1597


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY++FTALS+AS E+++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1312  CVVCSLYEVFTALSVASSESRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1359



>dbj|BAE98837.1| hypothetical protein [Arabidopsis thaliana]
Length=783

 Score =   219 bits (558),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SFDEL+NL+  ++ L CD +A GCGK N I+H L TPPHVFTIV+GW+NTCE+++DI 
Sbjct  637   ENSFDELLNLVEMNHQLACDREAGGCGKRNHIHHILTTPPHVFTIVLGWQNTCETVEDIA  696

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y G+DPKN + LVSVVCYY QHYHC AYS +H++WIMYDD+NVK 
Sbjct  697   ATLAALNTEIDISIMYRGVDPKNTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDQNVKV  756

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  757   IGSWSDVLSMCKRGHLQPQVLLYE  780


 Score = 77.8 bits (190),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY IFTALS AS ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  495   CVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  542



>ref|XP_009777758.1| PREDICTED: uncharacterized protein LOC104227244 isoform X2 [Nicotiana 
sylvestris]
Length=1616

 Score =   222 bits (566),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+NL+  ++ L CD +  GCGKLN I+H L TPPHVFTIV+GW+NTCE+
Sbjct  1472  KVMCPESSFDELLNLVEMNHQLACDSEVGGCGKLNYIHHILSTPPHVFTIVLGWQNTCEN  1531

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI+ATLSALSTE+DI V Y GLDPKNKH L+SVVCYY QHYHC AY  DH +W+MYDD
Sbjct  1532  VDDIKATLSALSTEVDIGVLYRGLDPKNKHRLISVVCYYGQHYHCFAYGHDHGRWVMYDD  1591

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQV  660
             K VK IG WDDVL+MC +G LQPQ+
Sbjct  1592  KTVKVIGGWDDVLVMCERGHLQPQM  1616


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALS AS E  R+ VAP+SLRIALSNLYPDSNFFQE
Sbjct  1335  CVICALYDIFTALSTASTEICRKTVAPSSLRIALSNLYPDSNFFQE  1380



>ref|XP_010678605.1| PREDICTED: uncharacterized protein LOC104894129 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1631

 Score =   222 bits (565),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM +  SFDEL+N +  ++ L CD +A GCGK N I+H L  PPH+FT V+GW+ TCES
Sbjct  1479  KVMCEDTSFDELLNYVEMNHQLACDLEAGGCGKSNHIHHILSNPPHIFTTVLGWQKTCES  1538

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             +DDI ATL+AL+TEIDISV Y GLDPKN H LVSVVCYY QHY+C A+S DHE+WIMYDD
Sbjct  1539  VDDITATLAALATEIDISVLYRGLDPKNVHRLVSVVCYYGQHYYCFAFSHDHERWIMYDD  1598

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             + VK IG+W+DVL MC +G LQPQVLF+EAAN
Sbjct  1599  RTVKVIGAWEDVLSMCERGHLQPQVLFYEAAN  1630


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CAL+DI TAL+MA  + + + VAPT+LRIALSNLYP+SNFFQE
Sbjct  1342  CVVCALFDILTALNMACGDAKSKPVAPTALRIALSNLYPESNFFQE  1387



>ref|XP_010678604.1| PREDICTED: uncharacterized protein LOC104894129 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1642

 Score =   222 bits (565),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -3

Query  1091  VMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESL  912
             VM +  SFDEL+N +  ++ L CD +A GCGK N I+H L  PPH+FT V+GW+ TCES+
Sbjct  1491  VMCEDTSFDELLNYVEMNHQLACDLEAGGCGKSNHIHHILSNPPHIFTTVLGWQKTCESV  1550

Query  911   DDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDK  732
             DDI ATL+AL+TEIDISV Y GLDPKN H LVSVVCYY QHY+C A+S DHE+WIMYDD+
Sbjct  1551  DDITATLAALATEIDISVLYRGLDPKNVHRLVSVVCYYGQHYYCFAFSHDHERWIMYDDR  1610

Query  731   NVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
              VK IG+W+DVL MC +G LQPQVLF+EAAN
Sbjct  1611  TVKVIGAWEDVLSMCERGHLQPQVLFYEAAN  1641


 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CAL+DI TAL+MA  + + + VAPT+LRIALSNLYP+SNFFQE
Sbjct  1342  CVVCALFDILTALNMACGDAKSKPVAPTALRIALSNLYPESNFFQE  1387



>gb|KFK34091.1| hypothetical protein AALP_AA5G101000 [Arabis alpina]
Length=1607

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFTIV+GW+NTCE+++DI AT
Sbjct  1463  SFDELLNLVEMNHQLACDPEAGGCGKLNHIHHILTTPPHVFTIVLGWQNTCETVEDIAAT  1522

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             LSAL+TEIDIS+ Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IG
Sbjct  1523  LSALNTEIDISIIYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIG  1582

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             SW DVL MC +G LQPQVL +E
Sbjct  1583  SWSDVLSMCERGHLQPQVLLYE  1604


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LYDIFT+LS AS ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1319  CVVCSLYDIFTSLSAASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1366



>gb|KFK34092.1| hypothetical protein AALP_AA5G101000 [Arabis alpina]
Length=1610

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+NL+  ++ L CDP+A GCGKLN I+H L TPPHVFTIV+GW+NTCE+++DI AT
Sbjct  1466  SFDELLNLVEMNHQLACDPEAGGCGKLNHIHHILTTPPHVFTIVLGWQNTCETVEDIAAT  1525

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             LSAL+TEIDIS+ Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IG
Sbjct  1526  LSALNTEIDISIIYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIG  1585

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             SW DVL MC +G LQPQVL +E
Sbjct  1586  SWSDVLSMCERGHLQPQVLLYE  1607


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LYDIFT+LS AS ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1322  CVVCSLYDIFTSLSAASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1369



>ref|XP_006367707.1| PREDICTED: uncharacterized protein LOC102592123 [Solanum tuberosum]
Length=1606

 Score =   221 bits (564),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/150 (67%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +V+  + SFD L+NL+  ++ L C+ +  GCGKLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1455  KVVSPESSFDALLNLVEMNHQLSCNSEVGGCGKLNYIHHILSTPPHVFTTVLGWQNTCES  1514

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             + DI ATLSALSTE+DI V YHGL PKNKH L+S+VCYY QHYHC AY+ DH +W+MYDD
Sbjct  1515  VGDITATLSALSTEVDIGVLYHGLAPKNKHCLISMVCYYGQHYHCFAYNWDHGQWVMYDD  1574

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEA  645
             K VK IGSWDDVL+MC +G LQPQVLFFEA
Sbjct  1575  KTVKVIGSWDDVLVMCERGHLQPQVLFFEA  1604


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIFTALS AS ET R+ V PTSLRI+LSNLYPDSNFFQE
Sbjct  1318  CAICALYDIFTALSTASTETCRKTVDPTSLRISLSNLYPDSNFFQE  1363



>ref|XP_010256025.1| PREDICTED: uncharacterized protein LOC104596511 isoform X3 [Nelumbo 
nucifera]
Length=1738

 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+  +  ++ L CDP+A GCGKLN I+H L +PPHVFT V+GW+NTCE+ DDI AT
Sbjct  1594  SFDELLKFVEMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTCENADDISAT  1653

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TE+DI + Y GLDP N+H LVSVVCYY QHYHC AYS + E+W+MYDDK VK IG
Sbjct  1654  LAALTTELDIGILYRGLDPGNRHSLVSVVCYYGQHYHCFAYSHELERWVMYDDKTVKVIG  1713

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL MC +G LQPQVLFFEA N
Sbjct  1714  SWHDVLTMCERGHLQPQVLFFEAVN  1738


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSM S +T++E VAPT LRIALSNLYPDSNFFQE
Sbjct  1450  CVVCALYDIFTALSMTSTDTRKEVVAPTCLRIALSNLYPDSNFFQE  1495



>ref|XP_010256018.1| PREDICTED: uncharacterized protein LOC104596511 isoform X2 [Nelumbo 
nucifera]
Length=1739

 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+  +  ++ L CDP+A GCGKLN I+H L +PPHVFT V+GW+NTCE+ DDI AT
Sbjct  1595  SFDELLKFVEMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTCENADDISAT  1654

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TE+DI + Y GLDP N+H LVSVVCYY QHYHC AYS + E+W+MYDDK VK IG
Sbjct  1655  LAALTTELDIGILYRGLDPGNRHSLVSVVCYYGQHYHCFAYSHELERWVMYDDKTVKVIG  1714

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL MC +G LQPQVLFFEA N
Sbjct  1715  SWHDVLTMCERGHLQPQVLFFEAVN  1739


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSM S +T++E VAPT LRIALSNLYPDSNFFQE
Sbjct  1451  CVVCALYDIFTALSMTSTDTRKEVVAPTCLRIALSNLYPDSNFFQE  1496



>ref|XP_010256010.1| PREDICTED: uncharacterized protein LOC104596511 isoform X1 [Nelumbo 
nucifera]
Length=1743

 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+  +  ++ L CDP+A GCGKLN I+H L +PPHVFT V+GW+NTCE+ DDI AT
Sbjct  1599  SFDELLKFVEMNHQLACDPEAGGCGKLNYIHHILSSPPHVFTTVLGWQNTCENADDISAT  1658

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TE+DI + Y GLDP N+H LVSVVCYY QHYHC AYS + E+W+MYDDK VK IG
Sbjct  1659  LAALTTELDIGILYRGLDPGNRHSLVSVVCYYGQHYHCFAYSHELERWVMYDDKTVKVIG  1718

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL MC +G LQPQVLFFEA N
Sbjct  1719  SWHDVLTMCERGHLQPQVLFFEAVN  1743


 Score = 82.8 bits (203),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/46 (83%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSM S +T++E VAPT LRIALSNLYPDSNFFQE
Sbjct  1455  CVVCALYDIFTALSMTSTDTRKEVVAPTCLRIALSNLYPDSNFFQE  1500



>gb|KHG14770.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Gossypium 
arboreum]
Length=1537

 Score =   221 bits (563),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM ++ SFDEL+NL+ R++ L CD +A GCGKLN ++H L  PPHVFT V+GW+NTCES
Sbjct  1362  KVMSEESSFDELLNLVERNHQLACDQEAGGCGKLNYVHHILSNPPHVFTTVLGWQNTCES  1421

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+ EIDISV Y G+DPKNKH+LVSVVCYY QHYHC AYS DHE+W+MYDD
Sbjct  1422  ADDIAATLAALTNEIDISVLYRGIDPKNKHNLVSVVCYYGQHYHCFAYSHDHERWVMYDD  1481

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQ  663
             + VK IGSW DVL MC +G LQPQ
Sbjct  1482  QTVKVIGSWADVLTMCERGCLQPQ  1505


 Score = 80.9 bits (198),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALY+IFTAL++AS + +RE VAPTSLRIALSNLYPDSNFFQE
Sbjct  1225  CVICALYEIFTALNIASSDARREPVAPTSLRIALSNLYPDSNFFQE  1270



>gb|KFK34093.1| hypothetical protein AALP_AA5G101100 [Arabis alpina]
Length=1619

 Score =   221 bits (563),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SFDEL+NL+  ++ L CDP+A GCGK N I+H L TPPHVFTIV+GW+NTCE+++DI 
Sbjct  1474  ENSFDELLNLVEMNHQLACDPEAGGCGKPNHIHHILTTPPHVFTIVLGWQNTCETVEDIV  1533

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC AYS DH++WIMYDDK VK 
Sbjct  1534  ATLAALNTEIDISIMYRGLDPKSIYSLVSVVCYYGQHYHCFAYSHDHDRWIMYDDKTVKV  1593

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW+DVL MC +G LQPQVL +E
Sbjct  1594  IGSWNDVLSMCERGHLQPQVLLYE  1617


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LYDIFTALS AS ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1332  CVVCSLYDIFTALSAASGETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1379



>gb|KGN63643.1| hypothetical protein Csa_1G008490 [Cucumis sativus]
Length=1608

 Score =   221 bits (562),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+N++  ++ L CD D  GCGKLN I+HFL  PPHVFT V+GW+NTCES
Sbjct  1457  KVMCTESSFDELLNVVEMNHQLACDLDVGGCGKLNYIHHFLAAPPHVFTTVLGWQNTCES  1516

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS D + WI YDD
Sbjct  1517  ADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDKKCWIKYDD  1576

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             + VK IG W DVL MC KG LQPQVLFFEA N
Sbjct  1577  RTVKVIGGWLDVLTMCEKGHLQPQVLFFEAVN  1608


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSMAS + +REAVAPTSLRIALS L PD+ FFQE
Sbjct  1320  CVVCALYDIFTALSMASADARREAVAPTSLRIALSTLCPDNKFFQE  1365



>ref|XP_004138296.1| PREDICTED: uncharacterized protein LOC101212702 [Cucumis sativus]
 ref|XP_004155067.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229576 
[Cucumis sativus]
Length=1594

 Score =   221 bits (562),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+N++  ++ L CD D  GCGKLN I+HFL  PPHVFT V+GW+NTCES
Sbjct  1443  KVMCTESSFDELLNVVEMNHQLACDLDVGGCGKLNYIHHFLAAPPHVFTTVLGWQNTCES  1502

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL+TEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS D + WI YDD
Sbjct  1503  ADDITATLAALNTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDKKCWIKYDD  1562

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             + VK IG W DVL MC KG LQPQVLFFEA N
Sbjct  1563  RTVKVIGGWLDVLTMCEKGHLQPQVLFFEAVN  1594


 Score = 78.2 bits (191),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSMAS + +REAVAPTSLRIALS L PD+ FFQE
Sbjct  1306  CVVCALYDIFTALSMASADARREAVAPTSLRIALSTLCPDNKFFQE  1351



>emb|CAB41149.1| putative protein [Arabidopsis thaliana]
Length=365

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 137/196 (70%), Gaps = 7/196 (4%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V   + SFDEL+
Sbjct  173   CIAHSLFGMDIFEQLNCYSCGLESRHLKYTSF---FHNINASALRTMKVTCAENSFDELL  229

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGKLN I+H L TPPHVFT   GW+NTCE+++DI ATL+AL+T
Sbjct  230   NLVEMNHQLACDPETGGCGKLNHIHHILTTPPHVFTT--GWQNTCETVEDIAATLAALNT  287

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDI++ Y GLDPK+ + LVSVVCYY QHYHC A+SR+H++WIMYDDK VK IGSW DVL
Sbjct  288   EIDINIMYRGLDPKSTYSLVSVVCYYGQHYHCFAHSREHDQWIMYDDKTVKVIGSWIDVL  347

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVL +E
Sbjct  348   SMCERGHLQPQVLLYE  363


 Score = 76.3 bits (186),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEV  1089
             CV C+LY+IFTALS AS E Q E VAP+SLRIALSNLYPDS+FFQE 
Sbjct  80    CVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEA  126



>ref|XP_008453168.1| PREDICTED: uncharacterized protein LOC103493964 isoform X1 [Cucumis 
melo]
Length=1605

 Score =   220 bits (561),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SFDEL+N++  ++ L CD D  GCGKLN I+HFL  PPHVFT V+GW+NTCES
Sbjct  1454  KVMCTESSFDELLNVVEMNHQLACDLDVGGCGKLNYIHHFLTAPPHVFTTVLGWQNTCES  1513

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+AL TEIDISV Y GLDPK+ H+LVSVVCYY QHYHC AYS D + WI YDD
Sbjct  1514  ADDITATLAALDTEIDISVLYRGLDPKSTHNLVSVVCYYGQHYHCFAYSHDKKCWIKYDD  1573

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             + VK IG W DVL MC KG LQPQVLFFEA N
Sbjct  1574  RTVKVIGDWLDVLTMCEKGHLQPQVLFFEAVN  1605


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALSMAS + ++EAVAPTSLRIALS L PD+ FFQE
Sbjct  1317  CVVCALYDIFTALSMASADARKEAVAPTSLRIALSTLCPDNKFFQE  1362



>gb|KEH31899.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=1638

 Score =   220 bits (561),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 125/167 (75%), Gaps = 10/167 (6%)
 Frame = -3

Query  1109  SNFFQEV----------MHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPP  960
             ++FFQ +          M  + S D+L+NL+ R++ L CD +  GCGKLN I+HFL TPP
Sbjct  1472  TSFFQNINANALRTMKAMFPESSLDKLLNLVERNHRLTCDQEVGGCGKLNHIHHFLSTPP  1531

Query  959   HVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHC  780
             HVF  V+GW+NTCES +DI ATL+ALST+IDISV Y GL+PK+ H+LVSVVCYY QHYHC
Sbjct  1532  HVFMTVLGWQNTCESANDIAATLAALSTKIDISVLYRGLNPKSTHNLVSVVCYYGQHYHC  1591

Query  779   VAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
              AYS DH +WIMYDDK VK IG W DVL +C +G LQPQVLFFEA N
Sbjct  1592  FAYSHDHGQWIMYDDKTVKIIGGWGDVLTVCERGHLQPQVLFFEAVN  1638


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTAL +AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1350  CVVCALYDIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1397



>ref|XP_010112586.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Morus notabilis]
 gb|EXC34221.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Morus notabilis]
Length=1634

 Score =   219 bits (559),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 120/153 (78%), Gaps = 1/153 (1%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLT-PPHVFTIVIGWKNTCE  918
             ++M  + SFDEL+NL+  ++ L C+PD  GCGKLN I+H L + PPHVFT V+GW+NTCE
Sbjct  1482  KIMCSESSFDELLNLVEMNHQLTCNPDYGGCGKLNYIHHILSSSPPHVFTTVLGWQNTCE  1541

Query  917   SLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYD  738
             +++DI ATL AL+ EIDISV Y GLDP+N+H LVSVVCYY QHYHC AYS DH +WIMYD
Sbjct  1542  NVEDITATLRALNDEIDISVLYRGLDPRNRHSLVSVVCYYGQHYHCFAYSHDHGRWIMYD  1601

Query  737   DKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             D  VK +GSW DVL  C KG LQPQVLFFEA N
Sbjct  1602  DNTVKVVGSWTDVLKSCEKGHLQPQVLFFEAVN  1634


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CAL +IF+ALS+AS +T+REAVAPTSLR ALSNLYP+SNFF+E
Sbjct  1345  CVICALKEIFSALSIASTDTRREAVAPTSLRTALSNLYPNSNFFKE  1390



>ref|NP_190372.3| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE78343.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1568

 Score =   219 bits (557),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SFDEL+NL+  ++ L CD +A GCGK N I+H L TPPHVFTIV+GW+NTCE+++DI 
Sbjct  1422  ENSFDELLNLVEMNHQLACDREAGGCGKRNHIHHILTTPPHVFTIVLGWQNTCETVEDIA  1481

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y G+DPKN + LVSVVCYY QHYHC AYS +H++WIMYDD+NVK 
Sbjct  1482  ATLAALNTEIDISIMYRGVDPKNTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDQNVKV  1541

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  1542  IGSWSDVLSMCKRGHLQPQVLLYE  1565


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY IFTALS AS ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1280  CVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1327



>emb|CDY36917.1| BnaA06g17020D [Brassica napus]
Length=785

 Score =   215 bits (547),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FDEL+NL+  ++ L CDP+  GCGK N I HFL TPPHVFT V+GW+NTCES++DI AT
Sbjct  641   AFDELLNLVEMNHQLACDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAAT  700

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TEIDIS+ Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IG
Sbjct  701   LAALNTEIDISIMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIG  760

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             SW D+L MC KG LQPQ+L +E
Sbjct  761   SWSDILSMCKKGHLQPQLLLYE  782


 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY++ TALS AS E ++E V P++LRIALSNLYPDS+FFQE  
Sbjct  497   CVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPDSSFFQEAQ  544



>ref|NP_001118788.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE78345.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1607

 Score =   218 bits (556),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SFDEL+NL+  ++ L CDP+  GCGKLN I+H L TPPHVFT V+GW+NTCE+++DI 
Sbjct  1462  ENSFDELLNLVEMNHQLACDPETGGCGKLNHIHHILTTPPHVFTTVLGWQNTCETVEDIA  1521

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC A+SR+H++WIMYDDK VK 
Sbjct  1522  ATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAHSREHDQWIMYDDKTVKV  1581

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  1582  IGSWIDVLSMCERGHLQPQVLLYE  1605


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTALS AS E Q E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1320  CVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQ  1367



>ref|NP_190374.4| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE78344.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1606

 Score =   218 bits (556),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SFDEL+NL+  ++ L CDP+  GCGKLN I+H L TPPHVFT V+GW+NTCE+++DI 
Sbjct  1461  ENSFDELLNLVEMNHQLACDPETGGCGKLNHIHHILTTPPHVFTTVLGWQNTCETVEDIA  1520

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC A+SR+H++WIMYDDK VK 
Sbjct  1521  ATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAHSREHDQWIMYDDKTVKV  1580

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  1581  IGSWIDVLSMCERGHLQPQVLLYE  1604


 Score = 78.2 bits (191),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTALS AS E Q E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1319  CVVCSLYEIFTALSAASSEKQNEPVAPSSLRIALSNLYPDSSFFQEAQ  1366



>ref|XP_010318961.1| PREDICTED: uncharacterized protein LOC101250879 [Solanum lycopersicum]
Length=1593

 Score =   218 bits (555),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFD L+NL+  ++ L C+ +  GCGKLN I+H L TPPHVFT V+GW+NTCES+ DI AT
Sbjct  1449  SFDALLNLVEMNHQLSCNSEVGGCGKLNYIHHILSTPPHVFTTVLGWQNTCESVGDITAT  1508

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             LSALSTE+DI V YHGL PKNKH L+S+VCYY QHY+C AY+ DH +W+MYDDK VK IG
Sbjct  1509  LSALSTEVDIGVLYHGLAPKNKHRLISMVCYYGQHYYCFAYNCDHGQWVMYDDKTVKVIG  1568

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              WDDVL+MC +G LQPQVLFFEA
Sbjct  1569  GWDDVLVMCERGHLQPQVLFFEA  1591


 Score = 77.8 bits (190),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/46 (80%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDIFTALS  S ET R+ V PTSLRI+LSNLYPDSNFFQE
Sbjct  1305  CVICALYDIFTALSTPSTETCRKTVDPTSLRISLSNLYPDSNFFQE  1350



>ref|XP_007155356.1| hypothetical protein PHAVU_003G194200g [Phaseolus vulgaris]
 gb|ESW27350.1| hypothetical protein PHAVU_003G194200g [Phaseolus vulgaris]
Length=1629

 Score =   218 bits (555),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD L+NL+  ++ L CDP+A+GCGKLN I+HFL TPPHVF  V+GW+NTCES DDI ATL
Sbjct  1486  FDNLLNLVEMNHQLACDPEADGCGKLNHIHHFLSTPPHVFMTVLGWQNTCESADDIAATL  1545

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             +ALST I+ISV Y GL+ +  H+LVSVVCYY QHYHC AYS DHE+WIMYDDK VK IG 
Sbjct  1546  AALSTTINISVLYGGLNLECTHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDKTVKVIGG  1605

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             W DVL MC +G LQPQVLFFEA N
Sbjct  1606  WGDVLTMCERGHLQPQVLFFEAVN  1629


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL +AS +++REAVAPTSLRIALSNLYP S+FFQE  
Sbjct  1341  CVVCALYEIFTALDIASKDSRREAVAPTSLRIALSNLYPHSSFFQEAQ  1388



>gb|KHN18514.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Glycine soja]
Length=1523

 Score =   218 bits (554),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = -3

Query  1088  MHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLD  909
             M  + SFD+L+NL+  ++ L CD +A GCGKLN I+H L TPPHVF  V+GW+NTCES +
Sbjct  1374  MFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHLLSTPPHVFMTVLGWQNTCESAN  1433

Query  908   DIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKN  729
             DI  TL+ALST IDISV Y GLDPK  H+LVSVVCYY QHYHC AYS DHE+WIMYDDK 
Sbjct  1434  DITETLAALSTNIDISVLYPGLDPKCIHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDKT  1493

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1494  VKVIGGWADVLTMCERGHLQPQVLFFEAVN  1523


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL  AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1235  CVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1282



>ref|XP_009343439.1| PREDICTED: uncharacterized protein LOC103935400 isoform X2 [Pyrus 
x bretschneideri]
Length=1578

 Score =   217 bits (553),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+N +  ++ L CD +A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1427  KVMCAESSYDELLNHVEMNHQLACDSEARGCGKLNHIHHILSTPPHVFTTVLGWQKTCES  1486

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI+ATL+AL+TEIDISV Y GLDPK  H+LVSVVCYY QHYHC AYS +   WIMYDD
Sbjct  1487  ADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHNRGCWIMYDD  1546

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1547  KTVKVIGGWADVLTMCERGHLQPQVLFFEAVN  1578


 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1290  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQ  1337



>ref|XP_009343438.1| PREDICTED: uncharacterized protein LOC103935400 isoform X1 [Pyrus 
x bretschneideri]
Length=1580

 Score =   217 bits (553),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+N +  ++ L CD +A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1429  KVMCAESSYDELLNHVEMNHQLACDSEARGCGKLNHIHHILSTPPHVFTTVLGWQKTCES  1488

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI+ATL+AL+TEIDISV Y GLDPK  H+LVSVVCYY QHYHC AYS +   WIMYDD
Sbjct  1489  ADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCYYGQHYHCFAYSHNRGCWIMYDD  1548

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             K VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1549  KTVKVIGGWADVLTMCERGHLQPQVLFFEAVN  1580


 Score = 84.3 bits (207),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1292  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQ  1339



>ref|XP_006600664.1| PREDICTED: uncharacterized protein LOC100800030 isoform X1 [Glycine 
max]
 ref|XP_006600665.1| PREDICTED: uncharacterized protein LOC100800030 isoform X2 [Glycine 
max]
 ref|XP_006600666.1| PREDICTED: uncharacterized protein LOC100800030 isoform X3 [Glycine 
max]
Length=1625

 Score =   216 bits (550),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = -3

Query  1088  MHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLD  909
             M  + SFD+L+NL+  ++ L CD +A GCGKLN I+H L TPPHVF  V+GW+NTCES +
Sbjct  1476  MFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHLLSTPPHVFMTVLGWQNTCESAN  1535

Query  908   DIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKN  729
             DI  TL+ALST IDISV Y GLDPK  H+LVSVVCYY QHYHC AYS +HE+WIMYDDK 
Sbjct  1536  DITETLAALSTNIDISVLYPGLDPKCIHNLVSVVCYYGQHYHCFAYSHNHEQWIMYDDKT  1595

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             VK IG W DVL MC +G LQPQVLFFEA N
Sbjct  1596  VKVIGGWADVLTMCERGHLQPQVLFFEAVN  1625


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL  AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1337  CVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1384



>ref|XP_002877584.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53843.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1635

 Score =   216 bits (550),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V   + SFDEL+
Sbjct  1441  CIAHSLFGMDIFEQLNCYSCGLESRHMKYTSF---FHNINASALRTMKVTCTENSFDELL  1497

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CD +  GCGKLN I+H L TPPHVFT V+GW+NTCE+++DI ATL+AL+T
Sbjct  1498  NLVEMNHQLACDSETGGCGKLNHIHHILTTPPHVFTTVLGWQNTCETVEDIAATLAALNT  1557

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + LVSVVCYY QHYHC A+SR+H++WIMYDDK VK IGSW DVL
Sbjct  1558  EIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAHSREHDQWIMYDDKTVKVIGSWSDVL  1617

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVL +E
Sbjct  1618  SMCERGHLQPQVLLYE  1633


 Score = 78.2 bits (191),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IF ALS AS ETQ E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1348  CVVCSLYEIFAALSAASSETQNEPVAPSSLRIALSNLYPDSSFFQEAQ  1395



>ref|XP_009149862.1| PREDICTED: uncharacterized protein LOC103873189 [Brassica rapa]
Length=1579

 Score =   216 bits (550),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FDEL+NL+  ++ L CDP+  GCGK N I HFL TPPHVFT V+GW+NTCES++DI AT
Sbjct  1435  AFDELLNLVEMNHQLACDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAAT  1494

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TEIDIS+ Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IG
Sbjct  1495  LAALNTEIDISIMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIG  1554

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             SW D+L MC KG LQPQ+L +E
Sbjct  1555  SWSDILSMCKKGHLQPQLLLYE  1576


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY++ TALS AS E ++E V P++LRIALSNLYPDS+FFQE  
Sbjct  1291  CVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPDSSFFQEAQ  1338



>ref|XP_006579548.1| PREDICTED: uncharacterized protein LOC100799759 isoform X1 [Glycine 
max]
Length=1625

 Score =   216 bits (549),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFD+L+NL+  ++ L CD +A GCGKLN I+HFL TPPHVF  V+GW+NT ES DDI  T
Sbjct  1481  SFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHFLSTPPHVFMTVLGWQNTSESADDITET  1540

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ALST+ID SV Y GLDPK  H+LVSVVCYY QHYHC AYS DHE+WIMYDDK VK IG
Sbjct  1541  LAALSTKIDTSVLYCGLDPKCVHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDKTVKVIG  1600

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
              W DVL MC +G LQPQVLFFEA N
Sbjct  1601  GWADVLTMCERGHLQPQVLFFEAVN  1625


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL  AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1337  CVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1384



>ref|XP_006579549.1| PREDICTED: uncharacterized protein LOC100799759 isoform X2 [Glycine 
max]
Length=1624

 Score =   216 bits (549),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFD+L+NL+  ++ L CD +A GCGKLN I+HFL TPPHVF  V+GW+NT ES DDI  T
Sbjct  1480  SFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHFLSTPPHVFMTVLGWQNTSESADDITET  1539

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ALST+ID SV Y GLDPK  H+LVSVVCYY QHYHC AYS DHE+WIMYDDK VK IG
Sbjct  1540  LAALSTKIDTSVLYCGLDPKCVHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDKTVKVIG  1599

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
              W DVL MC +G LQPQVLFFEA N
Sbjct  1600  GWADVLTMCERGHLQPQVLFFEAVN  1624


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL  AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1336  CVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1383



>gb|KHN48649.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Glycine soja]
Length=1452

 Score =   215 bits (548),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 115/145 (79%), Gaps = 0/145 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFD+L+NL+  ++ L CD +A GCGKLN I+HFL TPPHVF  V+GW+NT ES DDI  T
Sbjct  1308  SFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHFLSTPPHVFMTVLGWQNTSESADDITET  1367

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ALST+ID SV Y GLDPK  H+LVSVVCYY QHYHC AYS DHE+WIMYDDK VK IG
Sbjct  1368  LAALSTKIDTSVLYCGLDPKCVHNLVSVVCYYGQHYHCFAYSHDHEQWIMYDDKTVKVIG  1427

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
              W DVL MC +G LQPQVLFFEA N
Sbjct  1428  GWADVLTMCERGHLQPQVLFFEAVN  1452


 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL  AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1164  CVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1211



>ref|XP_010503407.1| PREDICTED: uncharacterized protein LOC104780601 isoform X1 [Camelina 
sativa]
 ref|XP_010503408.1| PREDICTED: uncharacterized protein LOC104780601 isoform X2 [Camelina 
sativa]
Length=1565

 Score =   215 bits (548),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             ++SF+EL+NL+  ++ L CDP+A GCGK N I+H L TPPHVFT V+GW+NTCE+++DI 
Sbjct  1419  EKSFEELLNLVEMNHQLACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCETVEDIA  1478

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC  YS +H++WIMYDD+ VK 
Sbjct  1479  ATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFTYSHEHDRWIMYDDQTVKV  1538

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  1539  IGSWSDVLSMCERGHLQPQVLLYE  1562


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS--FDELM  1056
             CV C+LY+IFTALS AS +T++E VAP+SLRIALSNLYPDS+FFQE      S     + 
Sbjct  1277  CVVCSLYEIFTALSAASSQTRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLAVIF  1336

Query  1055  NLLLRDYLLVC------DPDANGCGKLNCINH  978
             + L R +            ++N  G  +C+N 
Sbjct  1337  DCLHRSFAQTSSVSDTESAESNSTGSWDCVNR  1368



>ref|XP_006404317.1| hypothetical protein EUTSA_v10010059mg [Eutrema salsugineum]
 gb|ESQ45770.1| hypothetical protein EUTSA_v10010059mg [Eutrema salsugineum]
Length=1601

 Score =   215 bits (547),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +V   + SFDEL+NL+  ++ L CDPDA GCGK N I+H L TPPHVFT V+GW+NTCE+
Sbjct  1451  KVTFAENSFDELLNLVEMNHQLACDPDAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCEN  1510

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             ++DI ATL+AL+TEIDIS  Y GLDP + + L SVVCYY QHYHC A+S +H++WIMYDD
Sbjct  1511  VEDIAATLAALNTEIDISNMYRGLDPMSTYTLASVVCYYGQHYHCFAFSHEHDRWIMYDD  1570

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             K VK IGSW+DVL+MC +G LQPQVL +E
Sbjct  1571  KTVKVIGSWNDVLLMCERGHLQPQVLLYE  1599


 Score = 77.4 bits (189),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTAL+ AS ETQ+E VAP+SLRIALS LYPDS+FFQE  
Sbjct  1314  CVVCSLYEIFTALNAASSETQKEPVAPSSLRIALSKLYPDSSFFQEAQ  1361



>ref|XP_010503406.1| PREDICTED: uncharacterized protein LOC104780600 isoform X2 [Camelina 
sativa]
Length=1601

 Score =   214 bits (546),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V + + SFDEL+
Sbjct  1407  CIAHSLFGMDIFEQLNCYSCGLESRHMKYTSF---FHNINASALRTMKVTYPENSFDELL  1463

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGK N I+H L TPP+VFT V+GW+NTCE+++DI  TL+AL+T
Sbjct  1464  NLVEVNHQLACDPETGGCGKPNHIHHILTTPPNVFTTVLGWQNTCETVEDIADTLAALNT  1523

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + LVSVVCYY QHYHC AYS +H++WIMYDDKNVK IGSW DVL
Sbjct  1524  EIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVL  1583

Query  695   MMCIKGQLQPQVLFFE  648
              M  +G LQPQVLF+E
Sbjct  1584  TMSERGHLQPQVLFYE  1599


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY++FTALS+AS E+++E V P+SLRIALSNLYPDS+FFQE  
Sbjct  1314  CVVCSLYEVFTALSVASSESRKEPVTPSSLRIALSNLYPDSSFFQEAQ  1361



>ref|XP_010503405.1| PREDICTED: uncharacterized protein LOC104780600 isoform X1 [Camelina 
sativa]
Length=1602

 Score =   214 bits (546),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V + + SFDEL+
Sbjct  1408  CIAHSLFGMDIFEQLNCYSCGLESRHMKYTSF---FHNINASALRTMKVTYPENSFDELL  1464

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+  GCGK N I+H L TPP+VFT V+GW+NTCE+++DI  TL+AL+T
Sbjct  1465  NLVEVNHQLACDPETGGCGKPNHIHHILTTPPNVFTTVLGWQNTCETVEDIADTLAALNT  1524

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + LVSVVCYY QHYHC AYS +H++WIMYDDKNVK IGSW DVL
Sbjct  1525  EIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVL  1584

Query  695   MMCIKGQLQPQVLFFE  648
              M  +G LQPQVLF+E
Sbjct  1585  TMSERGHLQPQVLFYE  1600


 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY++FTALS+AS E+++E V P+SLRIALSNLYPDS+FFQE  
Sbjct  1315  CVVCSLYEVFTALSVASSESRKEPVTPSSLRIALSNLYPDSSFFQEAQ  1362



>ref|XP_006292726.1| hypothetical protein CARUB_v10018972mg [Capsella rubella]
 gb|EOA25624.1| hypothetical protein CARUB_v10018972mg [Capsella rubella]
Length=1603

 Score =   214 bits (546),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V + + SFDEL+
Sbjct  1409  CIAHSLFGMDIFEQLNCYSCGLESRHMKYTSF---FHNINASALRTMKVTYPENSFDELL  1465

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             N +  ++ L CDP+A GCGK N I+H L TPP+VFT V+GW+NTCE+++DI  TL+AL+T
Sbjct  1466  NHVEVNHQLACDPEAGGCGKPNHIHHILTTPPNVFTTVLGWQNTCETVEDIADTLAALNT  1525

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLDPK+ + LVSVVCYY QHYHC AYS +H++WIMYDDKNVK IGSW DVL
Sbjct  1526  EIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDDKNVKVIGSWSDVL  1585

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVL +E
Sbjct  1586  SMCKRGHLQPQVLLYE  1601


 Score = 75.5 bits (184),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             C  C+LY+IFTALS AS E ++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1316  CAVCSLYEIFTALSAASSELRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1363



>ref|XP_010515104.1| PREDICTED: uncharacterized protein LOC104791003 [Camelina sativa]
Length=1565

 Score =   214 bits (545),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 116/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SF+EL+NL+  ++ L CDP+A GCGK N I+H L TPPHVFT V+GW+NTCE+++DI 
Sbjct  1419  ENSFEELLNLVEMNHQLACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCETVEDIA  1478

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC  YS +H +WIMYDD+ VK 
Sbjct  1479  ATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFTYSHEHNRWIMYDDQTVKV  1538

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC KG LQPQVL +E
Sbjct  1539  IGSWSDVLSMCEKGHLQPQVLLYE  1562


 Score = 80.9 bits (198),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTALS AS+ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1277  CVVCSLYEIFTALSAASIETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1324



>ref|XP_010426263.1| PREDICTED: uncharacterized protein LOC104711270 isoform X2 [Camelina 
sativa]
Length=1550

 Score =   214 bits (545),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SF+EL+NL+  ++ + CDP+A GCGK N I+H L TPPHVFT V+GW+NTCE+++DI 
Sbjct  1404  ENSFEELLNLVEMNHQVACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCETVEDIA  1463

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC  YS +H++WIMYDDK VK 
Sbjct  1464  ATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFTYSHEHDRWIMYDDKTVKV  1523

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  1524  IGSWSDVLSMCERGHLQPQVLLYE  1547


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS ET++E VAP+SLRIALS LYPDS+FFQE  
Sbjct  1262  CVVCALYEIFTALSAASSETRKEPVAPSSLRIALSKLYPDSSFFQEAQ  1309



>ref|XP_010426262.1| PREDICTED: uncharacterized protein LOC104711270 isoform X1 [Camelina 
sativa]
Length=1564

 Score =   214 bits (545),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             + SF+EL+NL+  ++ + CDP+A GCGK N I+H L TPPHVFT V+GW+NTCE+++DI 
Sbjct  1418  ENSFEELLNLVEMNHQVACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCETVEDIA  1477

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             ATL+AL+TEIDIS+ Y GLDPK+ + LVSVVCYY QHYHC  YS +H++WIMYDDK VK 
Sbjct  1478  ATLAALNTEIDISIMYRGLDPKSTYSLVSVVCYYGQHYHCFTYSHEHDRWIMYDDKTVKV  1537

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IGSW DVL MC +G LQPQVL +E
Sbjct  1538  IGSWSDVLSMCERGHLQPQVLLYE  1561


 Score = 78.6 bits (192),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS ET++E VAP+SLRIALS LYPDS+FFQE  
Sbjct  1276  CVVCALYEIFTALSAASSETRKEPVAPSSLRIALSKLYPDSSFFQEAQ  1323



>gb|KDO76019.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1691

 Score =   214 bits (544),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S DEL+NL+  ++ L CDP A GC KLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1483  KVMCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCES  1542

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALS EIDIS+ Y GLDPK +H LVSVVCYY QHYHC AYS D E+WIMYDD
Sbjct  1543  FDDITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDD  1602

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQ  663
             K VK +GSW DVL MC +G LQPQ
Sbjct  1603  KTVKVVGSWSDVLSMCERGHLQPQ  1626


 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T++EAVAPTSLRIALSNLYPDSNFFQE  
Sbjct  1346  CVVCALYEIFTALSIASTDTRKEAVAPTSLRIALSNLYPDSNFFQEAQ  1393



>gb|KDO76020.1| hypothetical protein CISIN_1g000306mg [Citrus sinensis]
Length=1630

 Score =   213 bits (543),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 112/144 (78%), Gaps = 0/144 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S DEL+NL+  ++ L CDP A GC KLN I+H L TPPHVFT V+GW+NTCES
Sbjct  1483  KVMCAESSLDELLNLVEMNHQLACDPGAGGCEKLNYIHHILSTPPHVFTTVLGWQNTCES  1542

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              DDI ATL+ALS EIDIS+ Y GLDPK +H LVSVVCYY QHYHC AYS D E+WIMYDD
Sbjct  1543  FDDITATLAALSPEIDISILYRGLDPKRRHSLVSVVCYYGQHYHCFAYSHDQERWIMYDD  1602

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQ  663
             K VK +GSW DVL MC +G LQPQ
Sbjct  1603  KTVKVVGSWSDVLSMCERGHLQPQ  1626


 Score = 85.9 bits (211),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS+AS +T++EAVAPTSLRIALSNLYPDSNFFQE  
Sbjct  1346  CVVCALYEIFTALSIASTDTRKEAVAPTSLRIALSNLYPDSNFFQEAQ  1393



>ref|XP_006290495.1| hypothetical protein CARUB_v10016569mg [Capsella rubella]
 gb|EOA23393.1| hypothetical protein CARUB_v10016569mg [Capsella rubella]
Length=1574

 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +V   ++SFDEL+NL+  ++ + CDP+A GCGK N I+H L TPPHVFT V+GW+NTCE+
Sbjct  1423  KVTFAEKSFDELLNLVEMNHQIACDPEAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCET  1482

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             ++DI ATL AL+TEIDIS+ Y GLDPK+ + LVS+VCYY QHYHC ++S +H +WIMYDD
Sbjct  1483  VEDIAATLEALNTEIDISIVYRGLDPKSTYSLVSMVCYYGQHYHCFSFSHEHNRWIMYDD  1542

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             + VK IGSW DVL MC +G LQPQVL +E
Sbjct  1543  QTVKVIGSWSDVLSMCERGHLQPQVLLYE  1571


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS------F  1068
             CV C+LY+IFTALS AS ET++E VAP+SLRIALSNLYPDS+FFQE      S      F
Sbjct  1286  CVVCSLYEIFTALSAASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQMNDASEVLAVIF  1345

Query  1067  DELMNLLLRDYLL--VCDPDANGCGKLNCINH  978
             D L     ++  L      ++N  G  +C N 
Sbjct  1346  DCLHRSFAQNSSLSDTESAESNSTGSWDCANR  1377



>ref|XP_010550646.1| PREDICTED: uncharacterized protein LOC104821450 [Tarenaya hassleriana]
Length=1639

 Score =   213 bits (542),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SF+EL+N +  ++ L CDP+A GCGK N I+H L TPPHVFT V+GW+NTCE+
Sbjct  1489  KVMCAESSFEELLNFVEMNHQLACDPEAGGCGKPNYIHHILSTPPHVFTTVMGWQNTCET  1548

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              +DI ATL AL+TEIDIS+ Y GLD KN + LVSVVCYY QHYHC AYS DH++W+MYDD
Sbjct  1549  AEDIVATLEALNTEIDISIMYRGLDSKNTYSLVSVVCYYGQHYHCFAYSHDHDRWVMYDD  1608

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             K VK IG W DVL MC +G LQPQVL +E
Sbjct  1609  KTVKVIGKWGDVLSMCERGHLQPQVLLYE  1637


 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS A+ ET++E VAPTSLRIALSNLYP+S+FFQE  
Sbjct  1352  CVVCALYEIFTALSAATSETRKEPVAPTSLRIALSNLYPESSFFQEAQ  1399



>ref|XP_009149858.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103873186 
[Brassica rapa]
Length=1579

 Score =   213 bits (541),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FDEL+NL+  ++ + CDP+  GCGK N I HFL TPPHVFT V+GW+NTCES++DI AT
Sbjct  1435  AFDELLNLVEMNHQIACDPETGGCGKPNHIRHFLNTPPHVFTAVLGWQNTCESVEDIAAT  1494

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TEIDIS+ Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IG
Sbjct  1495  LAALNTEIDISIMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIG  1554

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             SW DVL  C KG LQPQ+L +E
Sbjct  1555  SWTDVLSTCKKGHLQPQLLLYE  1576


 Score = 71.6 bits (174),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY++ TALS AS E ++E V P++LRIALSNLYPDS+FFQE  
Sbjct  1291  CVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPDSSFFQEAQ  1338



>ref|XP_002877583.1| hypothetical protein ARALYDRAFT_485153 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53842.1| hypothetical protein ARALYDRAFT_485153 [Arabidopsis lyrata subsp. 
lyrata]
Length=1571

 Score =   213 bits (541),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 138/196 (70%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V   + SFDEL+
Sbjct  1376  CIAHSLFGMDIFEQLNCYSCGLESRHLKYTSF---FHNINASALRTMKVTCAENSFDELL  1432

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDP+A GCGK N I+H L TPPHVFTIV+GW+NTCE+++DI ATL+AL+T
Sbjct  1433  NLVEMNHQLACDPEAGGCGKPNHIHHILTTPPHVFTIVLGWQNTCETVEDIAATLAALNT  1492

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLD K+ + LVSVVCYY QHYHC A+S +H++WIMYDD+ VK IGSW DVL
Sbjct  1493  EIDISIMYRGLDLKSTYSLVSVVCYYGQHYHCFAHSHEHDRWIMYDDQTVKVIGSWSDVL  1552

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVL +E
Sbjct  1553  SMCERGHLQPQVLLYE  1568


 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+I TALS A+ E ++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1283  CVVCSLYEILTALSAATSEARKEPVAPSSLRIALSNLYPDSSFFQEAQ  1330



>ref|XP_006404318.1| hypothetical protein EUTSA_v10010060mg [Eutrema salsugineum]
 gb|ESQ45771.1| hypothetical protein EUTSA_v10010060mg [Eutrema salsugineum]
Length=1587

 Score =   212 bits (540),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 135/196 (69%), Gaps = 5/196 (3%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DIF  L+  S   +   +  TS      N+   +    +V   + SFDEL+
Sbjct  1393  CIAHSLFGMDIFEQLNCNSCGLESRHMKYTSF---FHNINASALRTMKVTFAENSFDELL  1449

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
             NL+  ++ L CDPDA GCGK N I+H L TPPHVFT V+GW+NTCE+++DI ATL+AL+T
Sbjct  1450  NLVEMNHQLACDPDAGGCGKPNHIHHILTTPPHVFTTVLGWQNTCENVEDIAATLAALNT  1509

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
              IDIS  Y GLDPK+ + L SVVCYY QHYHC AYS + ++WIMYDDK VK IGSW+DVL
Sbjct  1510  VIDISNIYRGLDPKSTYTLASVVCYYGQHYHCFAYSHEQDRWIMYDDKTVKVIGSWNDVL  1569

Query  695   MMCIKGQLQPQVLFFE  648
              MC +G LQPQVL +E
Sbjct  1570  SMCERGHLQPQVLLYE  1585


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTAL+ AS ETQ+E VAP+SLRIALS LYPDS+FFQE  
Sbjct  1300  CVVCSLYEIFTALNGASSETQKEPVAPSSLRIALSKLYPDSSFFQEAQ  1347



>gb|EYU35900.1| hypothetical protein MIMGU_mgv1a000162mg [Erythranthe guttata]
Length=1526

 Score =   212 bits (540),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 120/152 (79%), Gaps = 0/152 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VMH + SFD+L++L+  ++ L CDP+A GCG+ N I+H L TPPHVFTIV+GW+N  ES
Sbjct  1374  KVMHPENSFDKLLSLVEMNHQLTCDPEAGGCGERNYIHHILSTPPHVFTIVLGWQNKRES  1433

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             ++DI ATL+A STEID+SV Y GLDP+N H LVS+VCYY QHYHC A S +H++W MYDD
Sbjct  1434  VEDITATLAAFSTEIDVSVLYRGLDPQNHHRLVSMVCYYGQHYHCFACSGEHDRWTMYDD  1493

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             + VK +G W+DV+ MC +G LQPQVL +EA N
Sbjct  1494  QTVKVVGGWNDVITMCERGHLQPQVLLYEAVN  1525


 Score = 76.6 bits (187),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             CV CALYDI  AL+MAS +  +EAVAPTSLRIALSNLYP+SNFFQ+
Sbjct  1242  CVICALYDILIALNMASTDKTKEAVAPTSLRIALSNLYPNSNFFQQ  1287



>ref|XP_010546042.1| PREDICTED: uncharacterized protein LOC104818245 isoform X3 [Tarenaya 
hassleriana]
Length=1650

 Score =   211 bits (538),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SF+EL+N +  ++ L CDP+A GCGK N I+H L  PP VFT+V+GW+NTCE+
Sbjct  1500  KVMCGESSFEELLNFVEMNHQLTCDPEAGGCGKPNYIHHILSVPPRVFTMVMGWQNTCET  1559

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              +DI ATL+A+ TEIDISV Y GLDPKN + LVSVVCYY QHYHC AYS  H++W+MYDD
Sbjct  1560  AEDIAATLAAVDTEIDISVMYRGLDPKNTYSLVSVVCYYGQHYHCFAYSHAHDRWVMYDD  1619

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             K VK IG+W DVL MC +G LQPQVLF+E
Sbjct  1620  KTVKVIGNWGDVLSMCERGHLQPQVLFYE  1648


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTA   AS ET+++ VAPTSLRIALSNLYPDS+FFQE  
Sbjct  1363  CVVCSLYEIFTAFGAASTETRKQPVAPTSLRIALSNLYPDSSFFQEAQ  1410



>ref|XP_010546039.1| PREDICTED: uncharacterized protein LOC104818245 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546040.1| PREDICTED: uncharacterized protein LOC104818245 isoform X1 [Tarenaya 
hassleriana]
Length=1656

 Score =   211 bits (538),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SF+EL+N +  ++ L CDP+A GCGK N I+H L  PP VFT+V+GW+NTCE+
Sbjct  1506  KVMCGESSFEELLNFVEMNHQLTCDPEAGGCGKPNYIHHILSVPPRVFTMVMGWQNTCET  1565

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              +DI ATL+A+ TEIDISV Y GLDPKN + LVSVVCYY QHYHC AYS  H++W+MYDD
Sbjct  1566  AEDIAATLAAVDTEIDISVMYRGLDPKNTYSLVSVVCYYGQHYHCFAYSHAHDRWVMYDD  1625

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             K VK IG+W DVL MC +G LQPQVLF+E
Sbjct  1626  KTVKVIGNWGDVLSMCERGHLQPQVLFYE  1654


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTA   AS ET+++ VAPTSLRIALSNLYPDS+FFQE  
Sbjct  1369  CVVCSLYEIFTAFGAASTETRKQPVAPTSLRIALSNLYPDSSFFQEAQ  1416



>ref|XP_010546041.1| PREDICTED: uncharacterized protein LOC104818245 isoform X2 [Tarenaya 
hassleriana]
Length=1652

 Score =   211 bits (538),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + SF+EL+N +  ++ L CDP+A GCGK N I+H L  PP VFT+V+GW+NTCE+
Sbjct  1502  KVMCGESSFEELLNFVEMNHQLTCDPEAGGCGKPNYIHHILSVPPRVFTMVMGWQNTCET  1561

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
              +DI ATL+A+ TEIDISV Y GLDPKN + LVSVVCYY QHYHC AYS  H++W+MYDD
Sbjct  1562  AEDIAATLAAVDTEIDISVMYRGLDPKNTYSLVSVVCYYGQHYHCFAYSHAHDRWVMYDD  1621

Query  734   KNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             K VK IG+W DVL MC +G LQPQVLF+E
Sbjct  1622  KTVKVIGNWGDVLSMCERGHLQPQVLFYE  1650


 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY+IFTA   AS ET+++ VAPTSLRIALSNLYPDS+FFQE  
Sbjct  1365  CVVCSLYEIFTAFGAASTETRKQPVAPTSLRIALSNLYPDSSFFQEAQ  1412



>ref|NP_001142026.1| uncharacterized protein LOC100274180 [Zea mays]
 gb|ACF87499.1| unknown [Zea mays]
 tpg|DAA43556.1| TPA: hypothetical protein ZEAMMB73_116284 [Zea mays]
Length=238

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 134/199 (67%), Gaps = 7/199 (4%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  D++  ++  + + +   +  TS      N+   S    ++M    SFDEL+
Sbjct  45    CIAHSLFGMDVYERMNCHNCKMESRRLKYTSF---FHNINASSLRTAKMMCPDSSFDELL  101

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
              +++ +  L CD D  GCGK N I+H L TPPHVFT+V+GW+N  E++DDI ATL+ +ST
Sbjct  102   KVVIMNDQLACDQDVGGCGKPNHIHHILSTPPHVFTVVLGWQNNKENVDDISATLAGIST  161

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLD  +KH LVSVVCYY QHYHC A+     +W+MYDD+ VK +GSW DVL
Sbjct  162   EIDISIFYRGLDQGSKHTLVSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVVGSWGDVL  219

Query  695   MMCIKGQLQPQVLFFEAAN  639
             +MC KG LQPQVLFFE+AN
Sbjct  220   VMCEKGHLQPQVLFFESAN  238



>ref|XP_006841144.1| hypothetical protein AMTR_s00086p00132870 [Amborella trichopoda]
 gb|ERN02819.1| hypothetical protein AMTR_s00086p00132870 [Amborella trichopoda]
Length=1702

 Score =   209 bits (532),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             S D L+ L+  ++ L CDP+A GCG+LN I+H L  PPHVFTIV+GW+NT ESLDDI AT
Sbjct  1558  SLDMLLKLVEMNHQLACDPEAGGCGRLNYIHHILSAPPHVFTIVLGWQNTSESLDDISAT  1617

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TE+DI V Y GL+  NKH +VSVVCYY QHYHC AYS +HEKWIMYDDK VK +G
Sbjct  1618  LAALTTELDIGVIYRGLEEGNKHCIVSVVCYYGQHYHCFAYSHEHEKWIMYDDKTVKLVG  1677

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL  C +G LQPQVLFFEA
Sbjct  1678  GWNQVLDTCQRGHLQPQVLFFEA  1700


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CAL+ IFT++S+AS E ++E VAPT LR+ALSNLYPDSNFFQE  
Sbjct  1415  CVVCALHYIFTSMSVASAEMRKETVAPTCLRVALSNLYPDSNFFQEAQ  1462



>emb|CDY25237.1| BnaC02g30130D [Brassica napus]
Length=306

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/131 (67%), Positives = 105/131 (80%), Gaps = 0/131 (0%)
 Frame = -3

Query  1040  DYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDIS  861
             ++ L CDP+  GCGK N I HFL TPPHVFT V+GW+NTCES++DI ATL+AL+TEIDIS
Sbjct  173   NHQLACDPETGGCGKPNHIRHFLTTPPHVFTAVLGWQNTCESVEDIAATLAALNTEIDIS  232

Query  860   VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIK  681
             + Y GLDPK+ + L SVVCYY QHYHC AYS +H++WIMYDDK VK IGS  DVL MC K
Sbjct  233   IMYRGLDPKSIYSLASVVCYYGQHYHCFAYSHEHDRWIMYDDKTVKVIGSRSDVLSMCKK  292

Query  680   GQLQPQVLFFE  648
             G LQPQ+L +E
Sbjct  293   GHLQPQLLLYE  303


 Score = 70.1 bits (170),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEV  1089
             CV C+LY++ TALS AS E ++E V P++LRIALSNLYPDS+FFQE 
Sbjct  34    CVVCSLYEVLTALSAASREIRKEPVTPSTLRIALSNLYPDSSFFQEA  80



>gb|KEH31898.1| ubiquitin carboxyl-terminal hydrolase-like protein [Medicago 
truncatula]
Length=1637

 Score =   206 bits (524),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 118/160 (74%), Gaps = 10/160 (6%)
 Frame = -3

Query  1109  SNFFQEV----------MHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPP  960
             ++FFQ +          M  + S D+L+NL+ R++ L CD +  GCGKLN I+HFL TPP
Sbjct  1472  TSFFQNINANALRTMKAMFPESSLDKLLNLVERNHRLTCDQEVGGCGKLNHIHHFLSTPP  1531

Query  959   HVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHC  780
             HVF  V+GW+NTCES +DI ATL+ALST+IDISV Y GL+PK+ H+LVSVVCYY QHYHC
Sbjct  1532  HVFMTVLGWQNTCESANDIAATLAALSTKIDISVLYRGLNPKSTHNLVSVVCYYGQHYHC  1591

Query  779   VAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQV  660
              AYS DH +WIMYDDK VK IG W DVL +C +G LQPQ 
Sbjct  1592  FAYSHDHGQWIMYDDKTVKIIGGWGDVLTVCERGHLQPQA  1631


 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIFTAL +AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1350  CVVCALYDIFTALDLASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1397



>dbj|BAK03191.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=693

 Score =   201 bits (512),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD+L+  ++ +  L CDPD  GCGK N I+H L + PHVFT+V+GW+N+ ES+DDI ATL
Sbjct  552   FDDLLKTVIMNDQLACDPDVGGCGKPNHIHHILSSSPHVFTVVLGWQNSKESVDDIAATL  611

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             + +STEIDISV Y GLD  +KH LVSVVCYY QHYHC A+  +H  W+MYDD+ VK IGS
Sbjct  612   AGISTEIDISVFYRGLDRGSKHFLVSVVCYYGQHYHCFAFEDEH--WVMYDDQTVKVIGS  669

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             WDDV++MC KG LQPQVLFFEAAN
Sbjct  670   WDDVVIMCEKGHLQPQVLFFEAAN  693


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY+IF  LS AS E Q EAVAPTSLRIALS  YP++ FFQE
Sbjct  410   CAVCALYNIFVDLSKAS-EGQGEAVAPTSLRIALSKSYPNNRFFQE  454



>ref|XP_006651069.1| PREDICTED: uncharacterized protein LOC102718817 [Oryza brachyantha]
Length=1454

 Score =   205 bits (521),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 104/207 (50%), Positives = 139/207 (67%), Gaps = 25/207 (12%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMAS--LETQREA-------VAPTSLRIALSNLYPDSNFFQEVMH  1083
             CV   L+  DI+  ++  S  LE++R         +  +SLR A  +++PD         
Sbjct  1261  CVAHGLFGMDIYERMNCQSCGLESRRHKYTSFFHNINASSLRTA-KDMFPDY--------  1311

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
                SFD+L+ +++ +  LVCDPD  GCGK N I+H L +PPHVFT+V+GW+N+ ES+DDI
Sbjct  1312  ---SFDDLLRIVIMNDHLVCDPDGGGCGKPNHIHHILSSPPHVFTVVLGWQNSKESVDDI  1368

Query  902   RATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVK  723
               TL+ +STEID+S  Y GLD  +KH LVSVVCYY QHYHC A+  +  +W+MYDD+ VK
Sbjct  1369  SGTLAGISTEIDVSTFYRGLDQGSKHSLVSVVCYYGQHYHCFAF--EDGQWVMYDDQTVK  1426

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +GSWDDVL+MC KG LQPQVLFFE A
Sbjct  1427  AVGSWDDVLIMCKKGHLQPQVLFFEVA  1453


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIFT LS AS E Q EAVAPTSLRIALS  YPDS FFQE
Sbjct  1170  CAVCALYDIFTDLSKAS-EEQGEAVAPTSLRIALSKSYPDSKFFQE  1214



>ref|XP_008809577.1| PREDICTED: uncharacterized protein LOC103721233 isoform X2 [Phoenix 
dactylifera]
Length=1584

 Score =   205 bits (521),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FDEL+ ++  ++ L CD DA GCGK N I+H L +PPHVFT V+GW+NT ES DDI ATL
Sbjct  1443  FDELLKIVEMNHQLACDLDAGGCGKSNHIHHILSSPPHVFTTVLGWQNTNESADDISATL  1502

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             +A++TE+DI V Y GLD  +KH LVSVVCYY QHYHC AY  +HE+W+MYDD+ VK IG 
Sbjct  1503  AAITTEVDIGVLYRGLDQGSKHSLVSVVCYYGQHYHCFAY--EHEQWVMYDDQTVKVIGG  1560

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             WDDV+ MC +G LQPQVLFFEA N
Sbjct  1561  WDDVISMCERGHLQPQVLFFEAVN  1584


 Score = 82.0 bits (201),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CAL+DIF+AL+ AS E QREAVAPTSLRIALSNLYPDS FFQE  
Sbjct  1298  CVVCALHDIFSALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQ  1345



>ref|XP_008809576.1| PREDICTED: uncharacterized protein LOC103721233 isoform X1 [Phoenix 
dactylifera]
Length=1599

 Score =   205 bits (521),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/144 (64%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FDEL+ ++  ++ L CD DA GCGK N I+H L +PPHVFT V+GW+NT ES DDI ATL
Sbjct  1458  FDELLKIVEMNHQLACDLDAGGCGKSNHIHHILSSPPHVFTTVLGWQNTNESADDISATL  1517

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             +A++TE+DI V Y GLD  +KH LVSVVCYY QHYHC AY  +HE+W+MYDD+ VK IG 
Sbjct  1518  AAITTEVDIGVLYRGLDQGSKHSLVSVVCYYGQHYHCFAY--EHEQWVMYDDQTVKVIGG  1575

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             WDDV+ MC +G LQPQVLFFEA N
Sbjct  1576  WDDVISMCERGHLQPQVLFFEAVN  1599


 Score = 81.6 bits (200),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CAL+DIF+AL+ AS E QREAVAPTSLRIALSNLYPDS FFQE  
Sbjct  1313  CVVCALHDIFSALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQ  1360



>ref|NP_001049069.1| Os03g0165600 [Oryza sativa Japonica Group]
 dbj|BAF10983.1| Os03g0165600, partial [Oryza sativa Japonica Group]
Length=505

 Score =   197 bits (502),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 14/172 (8%)
 Frame = -3

Query  1157  VAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINH  978
             +  +SLR A  +++PD            SFD+L+ +++ +  L CDP+  GCGK N I+H
Sbjct  347   INASSLRTA-KDMFPD-----------HSFDDLLKIVIMNDHLACDPEDGGCGKPNHIHH  394

Query  977   FLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY  798
              L +PPHVFT+V+GW+N  ES+DDI  TL+ +STEIDIS  Y GLD  +KH LVSVVCYY
Sbjct  395   ILSSPPHVFTVVLGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYY  454

Query  797   RQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              QHYHC A+  +  +W+MYDD+ VK +G+WDDVL+MC KG LQPQVLFFEAA
Sbjct  455   GQHYHCFAF--EDGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQVLFFEAA  504


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIFT LS AS E Q EAVAPTSLRIALS  YP+S FFQE
Sbjct  221   CAVCALYDIFTDLSKAS-EEQGEAVAPTSLRIALSKSYPNSKFFQE  265



>ref|XP_010907346.1| PREDICTED: uncharacterized protein LOC105034021 isoform X3 [Elaeis 
guineensis]
Length=1516

 Score =   204 bits (519),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 125/176 (71%), Gaps = 2/176 (1%)
 Frame = -3

Query  1166  REAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNC  987
             R+ +  T L+ A+       N   ++M     FDEL+ ++  ++ L CDPDA GCGK N 
Sbjct  1343  RKDIFGTGLKNAVGEYNCFLNVIIQIMCPDSCFDELLKIVEMNHQLACDPDARGCGKPNY  1402

Query  986   INHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVV  807
             I+H L +PPHVFT V+GW+NT ES+DDI ATL+A++ E+DI V Y GLD  +KH LVSVV
Sbjct  1403  IHHILSSPPHVFTTVLGWQNTNESVDDISATLAAITIEVDIGVLYRGLDQGSKHSLVSVV  1462

Query  806   CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             CYY QHYHC A+  +HE+W+MYDD+ VK IG W+DV+ MC KG LQPQVLFFEA N
Sbjct  1463  CYYGQHYHCFAF--EHEQWVMYDDQMVKVIGGWNDVISMCEKGHLQPQVLFFEAVN  1516



>ref|NP_001132623.1| uncharacterized protein LOC100194097 [Zea mays]
 gb|ACF81547.1| unknown [Zea mays]
Length=238

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 128/199 (64%), Gaps = 7/199 (4%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+T  L+  D++  ++  + + +   +  TS      N+   S    ++M    SFDEL+
Sbjct  45    CITHNLFGMDVYERMNCHNCKMESRQLKYTSF---FHNINASSLRTAKMMCPDSSFDELL  101

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
              +++ +  L CD D  GCG  N I+H L   PHVFT+V+GW+N  E +DDI ATL+ +ST
Sbjct  102   KVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISATLAGIST  161

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             EIDIS+ Y GLD   KH L SVVCYY QHYHC A+     +W+MYDD+ VK IGSW DVL
Sbjct  162   EIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIGSWGDVL  219

Query  695   MMCIKGQLQPQVLFFEAAN  639
             +MC KG LQPQVLFFEAAN
Sbjct  220   VMCEKGHLQPQVLFFEAAN  238



>ref|XP_010907344.1| PREDICTED: uncharacterized protein LOC105034021 isoform X1 [Elaeis 
guineensis]
Length=1678

 Score =   203 bits (517),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/144 (63%), Positives = 113/144 (78%), Gaps = 2/144 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FDEL+ ++  ++ L CDPDA GCGK N I+H L +PPHVFT V+GW+NT ES+DDI ATL
Sbjct  1537  FDELLKIVEMNHQLACDPDARGCGKPNYIHHILSSPPHVFTTVLGWQNTNESVDDISATL  1596

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             +A++ E+DI V Y GLD  +KH LVSVVCYY QHYHC A+  +HE+W+MYDD+ VK IG 
Sbjct  1597  AAITIEVDIGVLYRGLDQGSKHSLVSVVCYYGQHYHCFAF--EHEQWVMYDDQMVKVIGG  1654

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             W+DV+ MC KG LQPQVLFFEA N
Sbjct  1655  WNDVISMCEKGHLQPQVLFFEAVN  1678


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 55/91 (60%), Gaps = 7/91 (8%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS--FDELM  1056
             CV CAL DIFTAL+ AS E QREAVAPTSLRIALSNLYPDS FFQE      S     + 
Sbjct  1393  CVVCALDDIFTALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQMNDASEVLAVIF  1452

Query  1055  NLLLRDYLLVCDPDA-----NGCGKLNCINH  978
             + L + Y    + DA     N  G  +C N+
Sbjct  1453  DCLHKSYTSSGECDAESLESNSVGSWDCANN  1483



>ref|XP_010932991.1| PREDICTED: uncharacterized protein LOC105053498 [Elaeis guineensis]
Length=1601

 Score =   200 bits (509),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 135/199 (68%), Gaps = 7/199 (4%)
 Frame = -3

Query  1229  CVTCALY--DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELM  1056
             C+  +L+  DI+  +   S   +   +  TS      N+  +S    ++M  + SFD+L+
Sbjct  1408  CIAHSLFGMDIYEQMKCYSCGVESRHLKYTSF---FHNINANSLRTTKIMCAESSFDKLL  1464

Query  1055  NLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALST  876
              ++  ++ L CD DA GCGK N I+H L +PPHVFT V+GW+N+ ES DDI ATL+A+ST
Sbjct  1465  KIVEMNHQLACDLDAGGCGKSNYIHHILSSPPHVFTTVLGWQNSNESADDISATLAAIST  1524

Query  875   EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVL  696
             E+DI V Y GLD  +KH LVSVVCYY QHYHC AY  +HE+W+MYDD+ VK IG W+DV+
Sbjct  1525  EVDIGVLYRGLDQGSKHSLVSVVCYYGQHYHCFAY--EHEQWVMYDDQIVKVIGGWNDVI  1582

Query  695   MMCIKGQLQPQVLFFEAAN  639
              +C +G LQPQVLFFEA N
Sbjct  1583  SICERGHLQPQVLFFEAFN  1601


 Score = 80.9 bits (198),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 55/90 (61%), Gaps = 8/90 (9%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS--FDELM  1056
             CV CALYDIFTAL+ AS E QREAVAPTSLRIALSNLYPD+ FFQE      S     + 
Sbjct  1317  CVVCALYDIFTALTKAS-EGQREAVAPTSLRIALSNLYPDNKFFQEAQMNDASEVLAVIF  1375

Query  1055  NLLLRDYLLVCDPDA-----NGCGKLNCIN  981
             + L + Y    + DA     N  G  +C N
Sbjct  1376  DCLHKSYTSTSECDAESHESNSVGSWDCAN  1405



>ref|XP_002465805.1| hypothetical protein SORBIDRAFT_01g046140 [Sorghum bicolor]
 gb|EER92803.1| hypothetical protein SORBIDRAFT_01g046140 [Sorghum bicolor]
Length=1582

 Score =   200 bits (508),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCGK N I+H L T PHVFT+V+GW+N  ES+DDI AT
Sbjct  1440  SFDELLKVVIMNDQLACDQDVGGCGKPNHIHHILSTFPHVFTVVLGWQNNKESVDDISAT  1499

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD  +KH LVSVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1500  LAGISTEIDISIFYRGLDHGSKHTLVSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1557

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SWDDVL+MC KG LQPQVLFFEAAN
Sbjct  1558  SWDDVLVMCEKGHLQPQVLFFEAAN  1582


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 34/46 (74%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS A+ + Q EAVAPTSLRIALS  YP+S FFQE
Sbjct  1298  CAVCALYGIFIDLSKAA-KGQGEAVAPTSLRIALSKSYPNSKFFQE  1342



>ref|XP_008668323.1| PREDICTED: uncharacterized protein LOC100274180 isoform X1 [Zea 
mays]
Length=1517

 Score =   199 bits (507),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/145 (62%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCGK N I+H L TPPHVFT+V+GW+N  E++DDI AT
Sbjct  1375  SFDELLKVVIMNDQLACDQDVGGCGKPNHIHHILSTPPHVFTVVLGWQNNKENVDDISAT  1434

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD  +KH LVSVVCYY QHYHC A+     +W+MYDD+ VK +G
Sbjct  1435  LAGISTEIDISIFYRGLDQGSKHTLVSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVVG  1492

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFE+AN
Sbjct  1493  SWGDVLVMCEKGHLQPQVLFFESAN  1517


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS A+ +   EAVAPTSLRIALS  YP+S FFQE
Sbjct  1233  CAVCALYGIFIDLSKAA-KGHGEAVAPTSLRIALSKSYPNSKFFQE  1277



>gb|EEC74581.1| hypothetical protein OsI_10153 [Oryza sativa Indica Group]
Length=1598

 Score =   199 bits (506),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 14/172 (8%)
 Frame = -3

Query  1157  VAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINH  978
             +  +SLR A  +++PD            SFD+L+ +++ +  L CDP+  GCGK N I+H
Sbjct  1440  INASSLRTA-KDMFPD-----------HSFDDLLKIVIMNDHLACDPEDGGCGKPNHIHH  1487

Query  977   FLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY  798
              L +PPHVFT+V+GW+N  ES+DDI  TL+ +STEIDIS  Y GLD  +KH LVSVVCYY
Sbjct  1488  ILSSPPHVFTVVLGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYY  1547

Query  797   RQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              QHYHC A+  +  +W+MYDD+ VK +G+WDDVL+MC KG LQPQVLFFEAA
Sbjct  1548  GQHYHCFAF--EDGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQVLFFEAA  1597


 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIFT LS AS E Q EAVAPTSLRIALS  YP+S FFQE
Sbjct  1314  CAVCALYDIFTDLSKAS-EEQGEAVAPTSLRIALSKSYPNSKFFQE  1358



>gb|EEE58383.1| hypothetical protein OsJ_09540 [Oryza sativa Japonica Group]
Length=1601

 Score =   199 bits (505),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 14/172 (8%)
 Frame = -3

Query  1157  VAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINH  978
             +  +SLR A  +++PD            SFD+L+ +++ +  L CDP+  GCGK N I+H
Sbjct  1443  INASSLRTA-KDMFPD-----------HSFDDLLKIVIMNDHLACDPEDGGCGKPNHIHH  1490

Query  977   FLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY  798
              L +PPHVFT+V+GW+N  ES+DDI  TL+ +STEIDIS  Y GLD  +KH LVSVVCYY
Sbjct  1491  ILSSPPHVFTVVLGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYY  1550

Query  797   RQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              QHYHC A+  +  +W+MYDD+ VK +G+WDDVL+MC KG LQPQVLFFEAA
Sbjct  1551  GQHYHCFAF--EDGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQVLFFEAA  1600


 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIFT LS AS E Q EAVAPTSLRIALS  YP+S FFQE
Sbjct  1317  CAVCALYDIFTDLSKAS-EEQGEAVAPTSLRIALSKSYPNSKFFQE  1361



>gb|EMS52635.1| Inactive ubiquitin carboxyl-terminal hydrolase 54 [Triticum urartu]
Length=1581

 Score =   196 bits (497),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 111/144 (77%), Gaps = 2/144 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD+L+  ++ +  L CDPD  GCGK N I+H L + PHVFT+V+GW+N+ ES+ DI ATL
Sbjct  1440  FDDLLKTVIMNDQLACDPDVGGCGKPNHIHHILSSSPHVFTVVLGWQNSKESVGDIAATL  1499

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             + +STEIDISV Y GLD  +KH LVSVVCYY QHYHC A+  +H  W+MYDD+ VK IGS
Sbjct  1500  AGISTEIDISVFYRGLDQGSKHFLVSVVCYYGQHYHCFAFEDEH--WVMYDDQTVKVIGS  1557

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             W DV++MC KG LQPQVLFFEAAN
Sbjct  1558  WADVVIMCEKGHLQPQVLFFEAAN  1581


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY+IF  LS AS E Q EAVAPTSLRIALS  YP++ FFQE
Sbjct  1298  CAVCALYNIFVDLSKAS-EGQGEAVAPTSLRIALSKSYPNNRFFQE  1342



>ref|XP_010229142.1| PREDICTED: uncharacterized protein LOC100846067 [Brachypodium 
distachyon]
Length=1554

 Score =   195 bits (495),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 108/144 (75%), Gaps = 2/144 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD+L+  ++ +  L CDPD  GCGK N I+H L   PHVFT+V+GW+N+ ES+DDI ATL
Sbjct  1413  FDDLLKTVIMNDQLACDPDVGGCGKPNHIHHILSRSPHVFTVVLGWQNSKESVDDISATL  1472

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
             + +STEIDISV Y GLD   KH LVSVVCYY QHYHC A+  +H  W+MYDD+ VK IG 
Sbjct  1473  AGISTEIDISVFYRGLDQGTKHSLVSVVCYYGQHYHCFAFEDEH--WVMYDDQTVKIIGD  1530

Query  710   WDDVLMMCIKGQLQPQVLFFEAAN  639
             W DVL+MC KG LQPQVL FEAAN
Sbjct  1531  WADVLIMCEKGHLQPQVLLFEAAN  1554


 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 57/110 (52%), Gaps = 9/110 (8%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRS--FDELM  1056
             C  CALYDIF  LS AS + Q E VAPTSLRIALS  YP++ FFQE      S     + 
Sbjct  1271  CAVCALYDIFIDLSKAS-KGQGEPVAPTSLRIALSKSYPNNRFFQEGQMNDASEVLGVIF  1329

Query  1055  NLLLRDYLLVCDP-----DANGCGKLNCINHFLLTPPHVFTIVIGWKNTC  921
               L + Y  + D      ++N  G  +C N+  +   H+F + +  +  C
Sbjct  1330  ECLHKSYTCLVDSHAKSHESNSIGSWDCANNSCIA-HHLFGMDVYERMNC  1378



>ref|XP_004987161.1| PREDICTED: uncharacterized protein LOC101782159, partial [Setaria 
italica]
Length=1371

 Score =   194 bits (494),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/145 (61%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ ++  +  L CD D  GCGKLN  +H L + PHVFT+V+GW+N  ES+DDI AT
Sbjct  1229  SFDELLKIVEMNDQLACDQDVGGCGKLNHKHHILSSRPHVFTVVLGWQNNKESVDDISAT  1288

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ +HG+D  +KH LVSVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1289  LAGISTEIDISIFFHGIDQGSKHTLVSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1346

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFEAA+
Sbjct  1347  SWGDVLVMCEKGHLQPQVLFFEAAS  1371


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIF+ LS AS + Q EAVAPTSLRIALS  YP+S FFQE
Sbjct  1087  CAVCALYDIFSDLSKAS-KGQGEAVAPTSLRIALSKSYPNSKFFQE  1131



>emb|CAB41871.1| putative protein [Arabidopsis thaliana]
Length=243

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +V   + SFDEL+NL+  ++ L CD +A GCGK N I+H L TPPHVFTIV+GW+NTCE+
Sbjct  98    DVTCAENSFDELLNLVEMNHQLACDREAGGCGKRNHIHHILTTPPHVFTIVLGWQNTCET  157

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDD  735
             ++DI ATL+AL+TEIDIS+ Y G+DPKN + LVSVVCYY QHYHC AYS +H++WIMYDD
Sbjct  158   VEDIAATLAALNTEIDISIMYRGVDPKNTYSLVSVVCYYGQHYHCFAYSHEHDQWIMYDD  217

Query  734   KNVK  723
             +NVK
Sbjct  218   QNVK  221



>gb|AFW89724.1| hypothetical protein ZEAMMB73_873945 [Zea mays]
Length=1485

 Score =   191 bits (485),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCG  N I+H L   PHVFT+V+GW+N  E +DDI AT
Sbjct  1343  SFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISAT  1402

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD   KH L SVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1403  LAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1460

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFEAAN
Sbjct  1461  SWGDVLVMCEKGHLQPQVLFFEAAN  1485


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS AS + QREAVAPTSLRIALS  YP+S FFQE
Sbjct  1201  CAVCALYGIFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQE  1245



>ref|XP_008658138.1| PREDICTED: uncharacterized protein LOC100194097 isoform X2 [Zea 
mays]
Length=1524

 Score =   191 bits (485),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCG  N I+H L   PHVFT+V+GW+N  E +DDI AT
Sbjct  1382  SFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISAT  1441

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD   KH L SVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1442  LAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1499

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFEAAN
Sbjct  1500  SWGDVLVMCEKGHLQPQVLFFEAAN  1524


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 52/97 (54%), Gaps = 11/97 (11%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNL  1050
             C  CALY IF  LS AS + QREAVAPTSLRIALS  YP+S FFQE+         +   
Sbjct  1242  CAVCALYGIFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQEMNDASEVLGVIFEC  1300

Query  1049  LLRDYL-------LVCDPDANG---CGKLNCINHFLL  969
             L + Y        +  + ++ G   C  ++CI H L 
Sbjct  1301  LHKSYTSRTVYHGVSHEKNSIGSWDCANISCITHNLF  1337



>ref|XP_008658137.1| PREDICTED: uncharacterized protein LOC100194097 isoform X1 [Zea 
mays]
Length=1526

 Score =   191 bits (485),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCG  N I+H L   PHVFT+V+GW+N  E +DDI AT
Sbjct  1384  SFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISAT  1443

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD   KH L SVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1444  LAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1501

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFEAAN
Sbjct  1502  SWGDVLVMCEKGHLQPQVLFFEAAN  1526


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS AS + QREAVAPTSLRIALS  YP+S FFQE
Sbjct  1242  CAVCALYGIFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQE  1286



>ref|XP_008658140.1| PREDICTED: uncharacterized protein LOC100194097 isoform X4 [Zea 
mays]
 gb|AFW89725.1| hypothetical protein ZEAMMB73_873945 [Zea mays]
Length=1495

 Score =   191 bits (485),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 106/145 (73%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCG  N I+H L   PHVFT+V+GW+N  E +DDI AT
Sbjct  1353  SFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISAT  1412

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD   KH L SVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1413  LAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1470

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFEAAN
Sbjct  1471  SWGDVLVMCEKGHLQPQVLFFEAAN  1495


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS AS + QREAVAPTSLRIALS  YP+S FFQE
Sbjct  1211  CAVCALYGIFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQE  1255



>ref|XP_009386389.1| PREDICTED: uncharacterized protein LOC103973523 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1646

 Score =   189 bits (481),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -3

Query  1124  NLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTI  945
             N+  +S    ++M  + SFDEL+  +  ++ L CD +A GCGK N +NH L  PPHVFT 
Sbjct  1487  NINANSLRTAKIMCPESSFDELLKTVEMNHQLSCDVEAGGCGKPNYMNHILSHPPHVFTA  1546

Query  944   VIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSR  765
             V+GW++T ES DDI ATL+A++T++DI + Y G+D   KH LVSVVCYY QHYHC AY  
Sbjct  1547  VLGWQSTNESADDISATLAAITTDVDIGILYCGIDKGCKHSLVSVVCYYGQHYHCFAYEC  1606

Query  764   DHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             D  +W+MYDD+ VK IG W+DVL MC +G LQPQVLFFEA N
Sbjct  1607  D--QWVMYDDQTVKVIGGWNDVLTMCERGHLQPQVLFFEAVN  1646


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIF  L  A  +   +AVAPTSLRIALSNLYPDS FFQE  
Sbjct  1360  CVVCALYDIFLDLRKAFDDGPNDAVAPTSLRIALSNLYPDSKFFQEAQ  1407



>ref|XP_009386394.1| PREDICTED: uncharacterized protein LOC103973523 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1643

 Score =   189 bits (480),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 116/162 (72%), Gaps = 2/162 (1%)
 Frame = -3

Query  1124  NLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTI  945
             N+  +S    ++M  + SFDEL+  +  ++ L CD +A GCGK N +NH L  PPHVFT 
Sbjct  1484  NINANSLRTAKIMCPESSFDELLKTVEMNHQLSCDVEAGGCGKPNYMNHILSHPPHVFTA  1543

Query  944   VIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSR  765
             V+GW++T ES DDI ATL+A++T++DI + Y G+D   KH LVSVVCYY QHYHC AY  
Sbjct  1544  VLGWQSTNESADDISATLAAITTDVDIGILYCGIDKGCKHSLVSVVCYYGQHYHCFAYEC  1603

Query  764   DHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             D  +W+MYDD+ VK IG W+DVL MC +G LQPQVLFFEA N
Sbjct  1604  D--QWVMYDDQTVKVIGGWNDVLTMCERGHLQPQVLFFEAVN  1643


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALYDIF  L  A  +   +AVAPTSLRIALSNLYPDS FFQE  
Sbjct  1357  CVVCALYDIFLDLRKAFDDGPNDAVAPTSLRIALSNLYPDSKFFQEAQ  1404



>gb|AFW89587.1| hypothetical protein ZEAMMB73_931714 [Zea mays]
Length=1179

 Score =   186 bits (473),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCG  N I+H L +  HVF +V+GW+N  E +DDI AT
Sbjct  1037  SFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSSSAHVFIVVLGWQNNKERVDDISAT  1096

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ +STEIDIS+ Y GLD   KH L SVVCYY QHYHC A+     +W+MYDD+ VK IG
Sbjct  1097  LAGISTEIDISIFYRGLDQGGKHTLGSVVCYYGQHYHCFAFKDG--RWVMYDDQTVKVIG  1154

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             SW DVL+MC KG LQPQVLFFEAAN
Sbjct  1155  SWGDVLVMCEKGHLQPQVLFFEAAN  1179


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS AS + QREAVAPTSLRIALS  YP+S FFQE
Sbjct  895   CAVCALYGIFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQE  939



>ref|XP_002324086.2| hypothetical protein POPTR_0017s12500g [Populus trichocarpa]
 gb|EEF04219.2| hypothetical protein POPTR_0017s12500g [Populus trichocarpa]
Length=364

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 98/147 (67%), Gaps = 1/147 (1%)
 Frame = -3

Query  1085  HKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDD  906
             ++  SFDELM L+L D    C+ DA GCGK N I   L TPP VF  V+  +   ES +D
Sbjct  217   NQASSFDELMKLMLMDDCSTCNRDAGGCGKPNRIQFILRTPPLVFICVL-VQTAHESRED  275

Query  905   IRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNV  726
              R TL+AL TE+DI V Y GL P  K+ LVS+VCY+ QHY C +YS +H++W M++D NV
Sbjct  276   TRKTLTALGTELDIGVVYQGLGPGKKYCLVSLVCYHHQHYVCFSYSHEHKRWTMFNDANV  335

Query  725   KEIGSWDDVLMMCIKGQLQPQVLFFEA  645
             + +G WDD+L  C   Q QPQ+LFFEA
Sbjct  336   EVVGCWDDLLSKCSHEQFQPQILFFEA  362



>ref|XP_010907345.1| PREDICTED: uncharacterized protein LOC105034021 isoform X2 [Elaeis 
guineensis]
Length=1652

 Score =   160 bits (404),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 2/116 (2%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FDEL+ ++  ++ L CDPDA GCGK N I+H L +PPHVFT V+GW+NT ES+DDI ATL
Sbjct  1537  FDELLKIVEMNHQLACDPDARGCGKPNYIHHILSSPPHVFTTVLGWQNTNESVDDISATL  1596

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVK  723
             +A++ E+DI V Y GLD  +KH LVSVVCYY QHYHC A+  +HE+W+MYDD+ VK
Sbjct  1597  AAITIEVDIGVLYRGLDQGSKHSLVSVVCYYGQHYHCFAF--EHEQWVMYDDQMVK  1650


 Score = 81.3 bits (199),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CAL DIFTAL+ AS E QREAVAPTSLRIALSNLYPDS FFQE  
Sbjct  1393  CVVCALDDIFTALTKASEEGQREAVAPTSLRIALSNLYPDSKFFQEAQ  1440



>ref|XP_010661023.1| PREDICTED: uncharacterized protein LOC104881688 [Vitis vinifera]
Length=2418

 Score =   160 bits (405),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 104/151 (69%), Gaps = 0/151 (0%)
 Frame = -3

Query  1097  QEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCE  918
             +++ H   SFD L+ L+  D  + C+P+  GCGKLN I+  L  PPH+F +++GW++  E
Sbjct  2264  KKITHMDSSFDNLLKLVKMDDQVTCNPEEGGCGKLNSIDQILSDPPHLFVVLLGWQSVSE  2323

Query  917   SLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYD  738
             + +D+  TL+AL+TEIDI+V Y  LD   K+HL+S+VC++ +H  C AY   H+ W+ Y+
Sbjct  2324  NSEDVSTTLAALTTEIDIAVIYGDLDEGRKYHLISMVCFHSRHLTCFAYDHQHKNWVHYN  2383

Query  737   DKNVKEIGSWDDVLMMCIKGQLQPQVLFFEA  645
             D  V+ IG W+DV+  C +G+ QPQ+LF+EA
Sbjct  2384  DAIVEVIGHWNDVVTKCQQGKFQPQLLFYEA  2414



>ref|XP_001762441.1| predicted protein [Physcomitrella patens]
 gb|EDQ72908.1| predicted protein [Physcomitrella patens]
Length=1559

 Score =   159 bits (403),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 101/150 (67%), Gaps = 1/150 (1%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCD-PDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCE  918
             + ++++ S D+L+ L+  +  L CD  D  GCG+ N ++HFL   PHVFT V+GW+N  E
Sbjct  1410  KALYEESSMDDLLKLVDMNDQLTCDRTDDGGCGRQNHMHHFLQAAPHVFTTVLGWQNGRE  1469

Query  917   SLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYD  738
             S +DI AT+ A+   +D+ V Y GLD   +H LVSVVCYY  HYHC AY+++  +W+M+D
Sbjct  1470  SFEDISATVDAIDVALDVGVIYCGLDKGFQHRLVSVVCYYGLHYHCFAYNQELGRWVMFD  1529

Query  737   DKNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             D  VK IG W DV   C +G LQPQVLF+E
Sbjct  1530  DSTVKVIGEWKDVASTCRRGHLQPQVLFYE  1559



>ref|XP_010661001.1| PREDICTED: uncharacterized protein LOC104881683 isoform X1 [Vitis 
vinifera]
Length=1400

 Score =   157 bits (398),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 95/142 (67%), Gaps = 0/142 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFD+L+ L+    L  CDP+A GCGKLN   HFL +PPHVF  VI  KN  E   DI  T
Sbjct  1253  SFDKLLKLVNASSLFPCDPEAGGCGKLNPTQHFLSSPPHVFITVIDRKNGHERGADISTT  1312

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+ALST+ID+ + Y GLD  N H+L+S+VC+  ++Y C AY  + EKWIM DD+  K IG
Sbjct  1313  LAALSTKIDLGILYEGLDEGNTHYLISLVCFTGKNYRCFAYRHEVEKWIMLDDEECKVIG  1372

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
              W+DV+ +C    LQP +LFFE
Sbjct  1373  CWNDVITVCRTRNLQPLILFFE  1394



>ref|XP_011035827.1| PREDICTED: uncharacterized protein LOC105133495 [Populus euphratica]
Length=2111

 Score =   155 bits (393),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 111/188 (59%), Gaps = 5/188 (3%)
 Frame = -3

Query  1208  DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLL  1029
             DI+       LE + +  +  S  I  S L       + + ++  SFDELM L+L D   
Sbjct  1927  DIYGYCDSCGLEWRHQTFSDFSHYIRSSQLREK----KAIKNQASSFDELMKLMLMDDCS  1982

Query  1028  VCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYH  849
              C+ DA GCGK N I   L TPP VF  VI  +   ES +D R TL+AL TE+DI V Y 
Sbjct  1983  TCNRDAGGCGKHNRIQFILRTPPLVFICVI-VQTAHESREDTRKTLTALGTELDIGVVYQ  2041

Query  848   GLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQ  669
             GL P  K+ LVSVVCY+ QHY C +YS +H++W M++D NV+ +G WDD+L  C   Q Q
Sbjct  2042  GLGPAKKYCLVSVVCYHHQHYVCFSYSHEHKRWTMFNDANVEVVGCWDDLLSKCSHEQFQ  2101

Query  668   PQVLFFEA  645
             PQ+L FEA
Sbjct  2102  PQILCFEA  2109


 Score =   139 bits (351),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 70/148 (47%), Positives = 91/148 (61%), Gaps = 0/148 (0%)
 Frame = -3

Query  1085  HKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDD  906
             ++  SFDELM L+L D  L C+ DA GCGK N I   L TPP VF  V+  +   E  +D
Sbjct  1140  NQASSFDELMKLMLMDDCLTCNRDAGGCGKSNRIQFILRTPPQVFVCVLSTQTARERRED  1199

Query  905   IRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNV  726
             IR TL+AL TE+DI   + G  P N + L S+VCY   HY C  YS + ++W MYD  +V
Sbjct  1200  IRDTLTALDTEVDIGDVFIGQGPGNGYCLTSMVCYDELHYVCFCYSHEGKRWTMYDGVHV  1259

Query  725   KEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
             + IG W ++L  C+   LQPQ+LFFEA 
Sbjct  1260  EVIGFWHNLLDKCVDELLQPQILFFEAG  1287


 Score =   132 bits (331),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 90/141 (64%), Gaps = 1/141 (1%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+   L DY L  + DA+GC + N   +FL TP HVFT V+ W     + +DIR T
Sbjct  1597  SFDELLKPKLVDYHLNLETDADGC-RENHFKYFLQTPSHVFTSVLEWTTIWVAREDIRET  1655

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             L+AL+TEIDI + Y GL    K+ LVSVVCY    Y C  YS + ++W+MYDD +V+ IG
Sbjct  1656  LAALATEIDIGILYQGLGKGKKYRLVSVVCYRGLLYSCFIYSDECKRWMMYDDTHVEVIG  1715

Query  713   SWDDVLMMCIKGQLQPQVLFF  651
             SWD +   C +   QP++LFF
Sbjct  1716  SWDCLCKKCEEKHFQPRILFF  1736



>emb|CBI35030.3| unnamed protein product [Vitis vinifera]
Length=1213

 Score =   154 bits (388),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 74/154 (48%), Positives = 100/154 (65%), Gaps = 1/154 (1%)
 Frame = -3

Query  1109  SNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWK  930
             ++F +   +   SFD+L+ L+    L  CDP+A GCGKLN   HFL +PPHVF I   W+
Sbjct  1055  TSFLRMDTYMDSSFDKLLKLVNASSLFPCDPEAGGCGKLNPTQHFLSSPPHVF-ITGMWQ  1113

Query  929   NTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKW  750
             N  E   DI  TL+ALST+ID+ + Y GLD  N H+L+S+VC+  ++Y C AY  + EKW
Sbjct  1114  NGHERGADISTTLAALSTKIDLGILYEGLDEGNTHYLISLVCFTGKNYRCFAYRHEVEKW  1173

Query  749   IMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
             IM DD+  K IG W+DV+ +C    LQP +LFFE
Sbjct  1174  IMLDDEECKVIGCWNDVITVCRTRNLQPLILFFE  1207



>gb|ABF94151.1| Ubiquitin carboxyl-terminal hydrolase family protein, expressed 
[Oryza sativa Japonica Group]
Length=1579

 Score =   153 bits (386),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 106/172 (62%), Gaps = 36/172 (21%)
 Frame = -3

Query  1157  VAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINH  978
             +  +SLR A  +++PD            SFD+L+ +++ +  L CDP+            
Sbjct  1443  INASSLRTA-KDMFPD-----------HSFDDLLKIVIMNDHLACDPED-----------  1479

Query  977   FLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY  798
                        V+GW+N  ES+DDI  TL+ +STEIDIS  Y GLD  +KH LVSVVCYY
Sbjct  1480  -----------VLGWQNNKESVDDISGTLAGISTEIDISTFYRGLDQGSKHSLVSVVCYY  1528

Query  797   RQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              QHYHC A+  +  +W+MYDD+ VK +G+WDDVL+MC KG LQPQVLFFEAA
Sbjct  1529  GQHYHCFAF--EDGQWVMYDDQTVKVVGNWDDVLVMCKKGHLQPQVLFFEAA  1578


 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALYDIFT LS AS E Q EAVAPTSLRIALS  YP+S FFQE
Sbjct  1317  CAVCALYDIFTDLSKAS-EEQGEAVAPTSLRIALSKSYPNSKFFQE  1361



>ref|XP_002324087.2| hypothetical protein POPTR_0017s12510g [Populus trichocarpa]
 gb|EEF04220.2| hypothetical protein POPTR_0017s12510g [Populus trichocarpa]
Length=1217

 Score =   146 bits (369),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 108/189 (57%), Gaps = 5/189 (3%)
 Frame = -3

Query  1208  DIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLL  1029
             DI+       LE + +  +  S  I  S L    N     +++  SFDEL+ L+L D  L
Sbjct  949   DIYGYCDSCGLEWRHQTFSDFSHYIRSSQLREKKN-----INQASSFDELLKLMLMDDCL  1003

Query  1028  VCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYH  849
              C+ DA GCGK + I   L TPP VF  V+  +   ES +DIR TL+AL TE+DI   Y 
Sbjct  1004  TCNQDAGGCGKPDRIQFILRTPPQVFVCVLSMQTARESREDIRDTLTALDTEVDIGDVYL  1063

Query  848   GLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQ  669
             GL P N + L S+VCY   HY C  YS + ++W MYDD +V+ IG W ++L  C+   LQ
Sbjct  1064  GLGPGNGYFLASMVCYDELHYVCFCYSHEGKRWTMYDDVHVEVIGFWHNLLDKCVDELLQ  1123

Query  668   PQVLFFEAA  642
             P++LFFEA 
Sbjct  1124  PRILFFEAG  1132



>ref|XP_006373344.1| hypothetical protein POPTR_0017s12500g [Populus trichocarpa]
 gb|ERP51141.1| hypothetical protein POPTR_0017s12500g [Populus trichocarpa]
Length=443

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 95/147 (65%), Gaps = 1/147 (1%)
 Frame = -3

Query  1091  VMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESL  912
             +     SF EL+  +L DY L  +PDA+GCG+ N I +FL TP HVFT V+ W     + 
Sbjct  230   IRQGTSSFAELLKPMLVDYHLTLEPDADGCGE-NHIKYFLQTPSHVFTSVLEWTTIWVAR  288

Query  911   DDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDK  732
             +DIR TL+AL+TEIDI + Y GL    K+ LVSVVCY    Y C  YS + ++W+MYDD 
Sbjct  289   EDIRETLAALATEIDIGILYQGLGKGKKYRLVSVVCYCGLLYSCFIYSDECKRWMMYDDT  348

Query  731   NVKEIGSWDDVLMMCIKGQLQPQVLFF  651
             +V+ IGSWD +   C++   QP++LFF
Sbjct  349   HVEVIGSWDCLCKKCVEKHFQPRILFF  375



>ref|XP_008374916.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103438156 
[Malus domestica]
Length=1784

 Score =   137 bits (346),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             +VM  + S+DEL+N +  ++ L CDP+A GCGKLN I+H L TPPHVFT V+GW+ TCES
Sbjct  1685  KVMCTESSYDELLNHVEMNHQLACDPEAGGCGKLNHIHHILTTPPHVFTTVLGWQKTCES  1744

Query  914   LDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY  798
              DDI+ATL+AL+TEIDISV Y GLDPK  H+LVSVVC +
Sbjct  1745  ADDIKATLAALNTEIDISVLYRGLDPKTTHNLVSVVCMF  1783


 Score = 84.0 bits (206),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTALS AS +T+REAVAPTSLRIALSNLYP+SNFFQE  
Sbjct  1548  CVVCALYEIFTALSNASADTRREAVAPTSLRIALSNLYPESNFFQEAQ  1595



>ref|XP_005849436.1| hypothetical protein CHLNCDRAFT_21625 [Chlorella variabilis]
 gb|EFN57334.1| hypothetical protein CHLNCDRAFT_21625 [Chlorella variabilis]
Length=158

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 78/129 (60%), Gaps = 2/129 (2%)
 Frame = -3

Query  1025  CDPDANGCGKLNCINHFL-LTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYH  849
             CD D  GCG  N +NHFL  TPP VFT+ + W++  E  D I +TL+AL  E+D+   Y 
Sbjct  27    CDEDLGGCGSPNPVNHFLEGTPPRVFTLQVAWESHSEGPDVIASTLAALDEEVDLGEVYQ  86

Query  848   GLDPK-NKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQL  672
             G+ P   ++ L S+VCYY QHY  +    D   W+M+DD  V  +G W DV   C  G++
Sbjct  87    GVQPGLFRYRLRSMVCYYGQHYQAMVLVPDAGGWLMFDDSRVSGVGGWADVRHKCKAGRI  146

Query  671   QPQVLFFEA  645
             QP VLF+EA
Sbjct  147   QPSVLFYEA  155



>ref|XP_005650621.1| hypothetical protein COCSUDRAFT_64969 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26077.1| hypothetical protein COCSUDRAFT_64969 [Coccomyxa subellipsoidea 
C-169]
Length=1067

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 4/128 (3%)
 Frame = -3

Query  1025  CDPDANGCGKLNCINHFL-LTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYH  849
             CD D  GCG+LN I H L   PP+VFT+ + W++  ES D IRATL+A+  E+D+   Y 
Sbjct  940   CDTDVGGCGQLNSIQHLLEGAPPNVFTVQLAWESQHESSDAIRATLAAIQEEVDVGHIYK  999

Query  848   GLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQ  669
               +P+ ++ L S+VCYY  HYH   ++    +WIM+DD N   +G WD V+  C  G++Q
Sbjct  1000  AQEPR-QYRLRSMVCYYGAHYHAFVHASG--QWIMFDDANTSAVGGWDAVMHKCQLGKIQ  1056

Query  668   PQVLFFEA  645
             P VLFFEA
Sbjct  1057  PSVLFFEA  1064



>ref|XP_010661002.1| PREDICTED: uncharacterized protein LOC104881683 isoform X2 [Vitis 
vinifera]
Length=1391

 Score =   129 bits (324),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 60/114 (53%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFD+L+ L+    L  CDP+A GCGKLN   HFL +PPHVF  VI  KN  E   DI  T
Sbjct  1253  SFDKLLKLVNASSLFPCDPEAGGCGKLNPTQHFLSSPPHVFITVIDRKNGHERGADISTT  1312

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDK  732
             L+ALST+ID+ + Y GLD  N H+L+S+VC+  ++Y C AY  + EKWIM DD+
Sbjct  1313  LAALSTKIDLGILYEGLDEGNTHYLISLVCFTGKNYRCFAYRHEVEKWIMLDDE  1366



>emb|CAB41150.1| putative protein [Arabidopsis thaliana]
Length=1528

 Score =   121 bits (304),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+NL+  ++ L CD +A GCGK N I+H L TPPHVFTIV+GW+NTCE+++DI AT
Sbjct  1432  SFDELLNLVEMNHQLACDREAGGCGKRNHIHHILTTPPHVFTIVLGWQNTCETVEDIAAT  1491

Query  893   LSALSTEIDISVPYHGLDPKN  831
             L+AL+TEIDIS+ Y G+DPKN
Sbjct  1492  LAALNTEIDISIMYRGVDPKN  1512


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV C+LY IFTALS AS ET++E VAP+SLRIALSNLYPDS+FFQE  
Sbjct  1280  CVVCSLYAIFTALSTASSETRKEPVAPSSLRIALSNLYPDSSFFQEAQ  1327



>ref|XP_010528658.1| PREDICTED: uncharacterized protein LOC104805708 isoform X5 [Tarenaya 
hassleriana]
Length=1365

 Score =   121 bits (303),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+  + ++  + +++CDP   GCG  N ++ FL   P VFTIV+ WKN  ES ++I  T
Sbjct  1219  TFENALEVIRVNRMMLCDPVRGGCGHRNHVHQFLTRFPFVFTIVLEWKNN-ESEEEISNT  1277

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              + L TEIDISV +  ++P  K+ LVS+V   ++ ++C+AY  ++E+W++Y     ++IG
Sbjct  1278  ATVLDTEIDISVLFEDVNPLIKYRLVSMVSLGKEEHNCIAY--ENERWVIYARSAKEDIG  1335

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL +C K +++PQ+LFFEA
Sbjct  1336  DWESVLKLCSKRKVRPQILFFEA  1358



>ref|XP_010528656.1| PREDICTED: uncharacterized protein LOC104805708 isoform X4 [Tarenaya 
hassleriana]
Length=1375

 Score =   121 bits (303),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+  + ++  + +++CDP   GCG  N ++ FL   P VFTIV+ WKN  ES ++I  T
Sbjct  1229  TFENALEVIRVNRMMLCDPVRGGCGHRNHVHQFLTRFPFVFTIVLEWKNN-ESEEEISNT  1287

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              + L TEIDISV +  ++P  K+ LVS+V   ++ ++C+AY  ++E+W++Y     ++IG
Sbjct  1288  ATVLDTEIDISVLFEDVNPLIKYRLVSMVSLGKEEHNCIAY--ENERWVIYARSAKEDIG  1345

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL +C K +++PQ+LFFEA
Sbjct  1346  DWESVLKLCSKRKVRPQILFFEA  1368



>ref|XP_010528659.1| PREDICTED: uncharacterized protein LOC104805708 isoform X6 [Tarenaya 
hassleriana]
Length=1332

 Score =   121 bits (303),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+  + ++  + +++CDP   GCG  N ++ FL   P VFTIV+ WKN  ES ++I  T
Sbjct  1186  TFENALEVIRVNRMMLCDPVRGGCGHRNHVHQFLTRFPFVFTIVLEWKNN-ESEEEISNT  1244

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              + L TEIDISV +  ++P  K+ LVS+V   ++ ++C+AY  ++E+W++Y     ++IG
Sbjct  1245  ATVLDTEIDISVLFEDVNPLIKYRLVSMVSLGKEEHNCIAY--ENERWVIYARSAKEDIG  1302

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL +C K +++PQ+LFFEA
Sbjct  1303  DWESVLKLCSKRKVRPQILFFEA  1325



>ref|XP_010528655.1| PREDICTED: uncharacterized protein LOC104805708 isoform X3 [Tarenaya 
hassleriana]
Length=1400

 Score =   121 bits (303),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+  + ++  + +++CDP   GCG  N ++ FL   P VFTIV+ WKN  ES ++I  T
Sbjct  1254  TFENALEVIRVNRMMLCDPVRGGCGHRNHVHQFLTRFPFVFTIVLEWKNN-ESEEEISNT  1312

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              + L TEIDISV +  ++P  K+ LVS+V   ++ ++C+AY  ++E+W++Y     ++IG
Sbjct  1313  ATVLDTEIDISVLFEDVNPLIKYRLVSMVSLGKEEHNCIAY--ENERWVIYARSAKEDIG  1370

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL +C K +++PQ+LFFEA
Sbjct  1371  DWESVLKLCSKRKVRPQILFFEA  1393



>ref|XP_010528653.1| PREDICTED: uncharacterized protein LOC104805708 isoform X1 [Tarenaya 
hassleriana]
Length=1406

 Score =   121 bits (303),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+  + ++  + +++CDP   GCG  N ++ FL   P VFTIV+ WKN  ES ++I  T
Sbjct  1260  TFENALEVIRVNRMMLCDPVRGGCGHRNHVHQFLTRFPFVFTIVLEWKNN-ESEEEISNT  1318

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              + L TEIDISV +  ++P  K+ LVS+V   ++ ++C+AY  ++E+W++Y     ++IG
Sbjct  1319  ATVLDTEIDISVLFEDVNPLIKYRLVSMVSLGKEEHNCIAY--ENERWVIYARSAKEDIG  1376

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL +C K +++PQ+LFFEA
Sbjct  1377  DWESVLKLCSKRKVRPQILFFEA  1399



>ref|XP_010528654.1| PREDICTED: uncharacterized protein LOC104805708 isoform X2 [Tarenaya 
hassleriana]
Length=1401

 Score =   121 bits (303),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+  + ++  + +++CDP   GCG  N ++ FL   P VFTIV+ WKN  ES ++I  T
Sbjct  1255  TFENALEVIRVNRMMLCDPVRGGCGHRNHVHQFLTRFPFVFTIVLEWKNN-ESEEEISNT  1313

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              + L TEIDISV +  ++P  K+ LVS+V   ++ ++C+AY  ++E+W++Y     ++IG
Sbjct  1314  ATVLDTEIDISVLFEDVNPLIKYRLVSMVSLGKEEHNCIAY--ENERWVIYARSAKEDIG  1371

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
              W+ VL +C K +++PQ+LFFEA
Sbjct  1372  DWESVLKLCSKRKVRPQILFFEA  1394



>ref|XP_006600667.1| PREDICTED: uncharacterized protein LOC100800030 isoform X4 [Glycine 
max]
Length=1592

 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -3

Query  1088  MHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLD  909
             M  + SFD+L+NL+  ++ L CD +A GCGKLN I+H L TPPHVF  V+GW+NTCES +
Sbjct  1476  MFAESSFDKLLNLVEMNHQLACDLEAGGCGKLNHIHHLLSTPPHVFMTVLGWQNTCESAN  1535

Query  908   DIRATLSALSTEIDISVPYHGLDPKNKHHLVSV  810
             DI  TL+ALST IDISV Y GLDPK  H+LVSV
Sbjct  1536  DITETLAALSTNIDISVLYPGLDPKCIHNLVSV  1568


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQEVM  1086
             CV CALY+IFTAL  AS +++REAVAPTSLRIALSNLYP SNFFQE  
Sbjct  1337  CVVCALYEIFTALDTASKDSRREAVAPTSLRIALSNLYPHSNFFQEAQ  1384



>ref|XP_005650623.1| hypothetical protein COCSUDRAFT_61074 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26079.1| hypothetical protein COCSUDRAFT_61074 [Coccomyxa subellipsoidea 
C-169]
Length=2379

 Score =   119 bits (297),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 66/174 (38%), Positives = 93/174 (53%), Gaps = 14/174 (8%)
 Frame = -3

Query  1157  VAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINH  978
             V+ T+LR    +L P             +  E +  + R  L  CD D  GCG+   +  
Sbjct  2214  VSTTALRFQALSLEPG--------EASPTLGEALRGVERQTLKSCDTDEGGCGRDQAVLA  2265

Query  977   FLL-TPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKH--HLVSVV  807
             FL  TPP  FT+ + W++  ES  DIRAT++ +   +D+   Y GL PK +H   L S+V
Sbjct  2266  FLEGTPPAAFTLQLAWESHAESSADIRATMATIQETLDLGEVYLGL-PKGQHLYRLSSMV  2324

Query  806   CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEA  645
             CYY  HYH  A+     +WIM+DD     +G+WD V+  C  G++QP VLFFEA
Sbjct  2325  CYYGAHYH--AFVHAGNQWIMFDDATTSAVGAWDSVMHKCQLGKIQPSVLFFEA  2376



>ref|XP_006489588.1| PREDICTED: uncharacterized protein LOC102612613 [Citrus sinensis]
Length=1359

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 85/146 (58%), Gaps = 6/146 (4%)
 Frame = -3

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
             +  SFD L+  L+ + LL C      CG++N I+H L   PHVFTIVIGW+  CES +D+
Sbjct  1207  RGSSFDVLLKQLVLNGLLNC----GACGQINYIHHTLWRLPHVFTIVIGWQRDCESSEDV  1262

Query  902   RATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY--RQHYHCVAYSRDHEKWIMYDDKN  729
              +TLSALS E+DIS  + G  P N + L S+VC    RQ Y    Y+   EK++  D   
Sbjct  1263  SSTLSALSAELDISNLFEGYPPDNIYFLASMVCVSSDRQRYIIFVYNHMLEKYVQSDGAT  1322

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFF  651
              +  GSW DV+  C     +P++LF+
Sbjct  1323  DEVTGSWADVVSTCNSMHSRPKILFY  1348



>ref|XP_005849226.1| hypothetical protein CHLNCDRAFT_21653, partial [Chlorella variabilis]
 gb|EFN57124.1| hypothetical protein CHLNCDRAFT_21653, partial [Chlorella variabilis]
Length=126

 Score =   101 bits (251),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 49/122 (40%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = -3

Query  1007  GCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPK-N  831
             GC K   +   L   P VF++ I W +  E+  DI  TL+AL   +D+S  Y G+ P  +
Sbjct  2     GCNKSCPVTTQLEQAPRVFSLQIAWLSNQEAPQDIGCTLAALDETVDLSEVYQGVQPALH  61

Query  830   KHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFF  651
             ++ L S+VCYY QHY  +    D   W+M+DD  V  +G W DV   C  G +QP VLF+
Sbjct  62    RYRLRSMVCYYGQHYQAMVLVPDAGGWLMFDDSRVSGVGGWADVRRKCEAGHIQPSVLFY  121

Query  650   EA  645
             EA
Sbjct  122   EA  123



>ref|XP_008658139.1| PREDICTED: uncharacterized protein LOC100194097 isoform X3 [Zea 
mays]
Length=1505

 Score =   102 bits (253),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             SFDEL+ +++ +  L CD D  GCG  N I+H L   PHVFT+V+GW+N  E +DDI AT
Sbjct  1384  SFDELLKVVIMNDQLACDQDVGGCGTPNHIDHILSNSPHVFTVVLGWQNNKERVDDISAT  1443

Query  893   LSALSTEIDISVPYHGLDPKNKHHL  819
             L+ +STEIDIS+ Y GLD   KH L
Sbjct  1444  LAGISTEIDISIFYRGLDQGGKHTL  1468


 Score = 31.2 bits (69),  Expect(2) = 5e-22, Method: Composition-based stats.
 Identities = 19/38 (50%), Positives = 20/38 (53%), Gaps = 2/38 (5%)
 Frame = -1

Query  808   FAITDSIITVLPIVVIMRSGSCTMTRM*RKLVAGMMFS  695
             F    SI  VLP    M  GSC MTR  R LV G+M S
Sbjct  1470  FVTMASITIVLP--SRMDGGSCMMTRQSRLLVVGVMCS  1505


 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  1229  CVTCALYDIFTALSMASLETQREAVAPTSLRIALSNLYPDSNFFQE  1092
             C  CALY IF  LS AS + QREAVAPTSLRIALS  YP+S FFQE
Sbjct  1242  CAVCALYGIFIDLSKAS-KGQREAVAPTSLRIALSKSYPNSKFFQE  1286



>ref|XP_010556181.1| PREDICTED: uncharacterized protein LOC104825529 [Tarenaya hassleriana]
Length=1158

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 87/145 (60%), Gaps = 5/145 (3%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++  +  ++ + CD    GCGK N + H +   P +F I + W+   E+ ++I  T 
Sbjct  1011  FEDILKAIRMNFQMYCDTKTGGCGKRNYVCHDITKCPAIFIIELKWEKI-EAGEEISETA  1069

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVK-EI  717
              AL TEIDISV Y G++P   + LVS++ C   + Y C+AY  D  +W +  D  VK EI
Sbjct  1070  KALDTEIDISVLYKGVNPMTNYQLVSMIGCKGEEEYSCIAYEND--RWGVTHDPLVKEEI  1127

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAA  642
             G W++V+  C + +++PQ+LFFEA 
Sbjct  1128  GDWNNVVRFCREREVRPQILFFEAT  1152



>ref|XP_010551215.1| PREDICTED: uncharacterized protein LOC104821900 isoform X1 [Tarenaya 
hassleriana]
Length=1362

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F++++ +    Y + CD    GCGK N + H L   P +F I + W+   E+  +I AT
Sbjct  1212  TFEDILKVNRMGYQICCDKRTGGCGKRNSVRHVLTRYPSIFIIALEWEKN-ETKKEISAT  1270

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEI  717
              +AL+TEIDIS  Y G+D    + LVS++ C   + Y C+A    +E+W+ +D    + +
Sbjct  1271  ANALATEIDISRLYEGVDRFTTYRLVSMIGCSGERDYSCIACH--NERWVRHDSSVKEAV  1328

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAA  642
             G W +V+  C + +L+P+VLFFE+A
Sbjct  1329  GEWRNVVKFCRERKLRPEVLFFESA  1353



>ref|XP_010551225.1| PREDICTED: uncharacterized protein LOC104821900 isoform X2 [Tarenaya 
hassleriana]
Length=1361

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F++++ +    Y + CD    GCGK N + H L   P +F I + W+   E+  +I AT
Sbjct  1211  TFEDILKVNRMGYQICCDKRTGGCGKRNSVRHVLTRYPSIFIIALEWEKN-ETKKEISAT  1269

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEI  717
              +AL+TEIDIS  Y G+D    + LVS++ C   + Y C+A    +E+W+ +D    + +
Sbjct  1270  ANALATEIDISRLYEGVDRFTTYRLVSMIGCSGERDYSCIACH--NERWVRHDSSVKEAV  1327

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAA  642
             G W +V+  C + +L+P+VLFFE+A
Sbjct  1328  GEWRNVVKFCRERKLRPEVLFFESA  1352



>ref|XP_010551234.1| PREDICTED: uncharacterized protein LOC104821900 isoform X3 [Tarenaya 
hassleriana]
Length=1360

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 86/145 (59%), Gaps = 4/145 (3%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F++++ +    Y + CD    GCGK N + H L   P +F I + W+   E+  +I AT
Sbjct  1210  TFEDILKVNRMGYQICCDKRTGGCGKRNSVRHVLTRYPSIFIIALEWEKN-ETKKEISAT  1268

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEI  717
              +AL+TEIDIS  Y G+D    + LVS++ C   + Y C+A    +E+W+ +D    + +
Sbjct  1269  ANALATEIDISRLYEGVDRFTTYRLVSMIGCSGERDYSCIACH--NERWVRHDSSVKEAV  1326

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAA  642
             G W +V+  C + +L+P+VLFFE+A
Sbjct  1327  GEWRNVVKFCRERKLRPEVLFFESA  1351



>emb|CDY42920.1| BnaC05g47310D [Brassica napus]
Length=1076

 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 90/148 (61%), Gaps = 6/148 (4%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             K   ++++ L+  +Y ++CD    GCGK N ++H +   P +FTIV+ W+   E+  +I 
Sbjct  926   KMKLEDILKLIRMEYKMLCDVKTEGCGKANFVHHIISRSPPIFTIVLKWEKN-ETEKEIH  984

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNV-  726
              T  AL  EIDIS  Y G++P   + LVS+V C   + Y C+++ ++  +W+ Y  + + 
Sbjct  985   ETTKALDWEIDISRLYEGVEPNTTYRLVSMVGCGEEEEYICLSFKKN--RWVSYRHEALA  1042

Query  725   -KEIGSWDDVLMMCIKGQLQPQVLFFEA  645
              K +GSW +V+  C K +++P++LF+EA
Sbjct  1043  KKAVGSWKNVVRFCEKMKVRPEILFYEA  1070



>ref|XP_005851100.1| hypothetical protein CHLNCDRAFT_137643 [Chlorella variabilis]
 gb|EFN58998.1| hypothetical protein CHLNCDRAFT_137643 [Chlorella variabilis]
Length=1890

 Score =   105 bits (262),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 48/129 (37%), Positives = 74/129 (57%), Gaps = 1/129 (1%)
 Frame = -3

Query  1025  CDPDANGCGKLNCINHFLLT-PPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYH  849
             CD D  GCG L+ +   LL  PP VFT+ + W++  E    I   L A+  +ID+   Y 
Sbjct  1761  CDTDLGGCGTLHPVRQELLGGPPRVFTLQLVWESHSEEPGAIGGALRAVGEQIDLGQLYA  1820

Query  848   GLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQ  669
             G+ P   + L ++VCYY +HY    +  +  +W+M+DD +   +G+W +V   C  G++Q
Sbjct  1821  GVPPGTMYRLRAMVCYYGRHYSAFVHLPELARWVMFDDSSASSVGAWAEVRRRCETGRVQ  1880

Query  668   PQVLFFEAA  642
             P VLF+EAA
Sbjct  1881  PSVLFYEAA  1889



>ref|XP_010510751.1| PREDICTED: uncharacterized protein LOC104786966 isoform X2 [Camelina 
sativa]
Length=555

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 86/142 (61%), Gaps = 2/142 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +Y ++CD    GCG  N ++H +   P +FTIV+ WK + E+  +I  T 
Sbjct  403   FVDILKVIRMEYKMLCDTTTGGCGITNFVHHIISKCPPIFTIVLEWKKS-ETGKEISETT  461

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              AL  EID+S  Y GL+PK K+ LVS+V C   + Y C+AY ++    +  D    +++G
Sbjct  462   KALDWEIDMSRMYEGLEPKTKYRLVSMVCCGEEEEYFCIAYEKNRWVNLRRDALAGEDVG  521

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             +W  V+  C + +++P++LF+E
Sbjct  522   NWKSVVRFCGERKVRPEILFYE  543



>emb|CDY49345.1| BnaA05g33070D [Brassica napus]
Length=1105

 Score =   103 bits (257),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 88/148 (59%), Gaps = 6/148 (4%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             K   ++++ L+  +Y ++CD    GCGK N ++H +   P +FTIV+ W+   E+  +I 
Sbjct  955   KMKLEDILKLIRMEYKMLCDAKTEGCGKTNFVHHIISRCPPIFTIVLKWEKN-ETEKEIH  1013

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNV-  726
              T  AL  EIDIS  Y G++P   + LVS+V C   + Y C+++ ++   W+ Y  + + 
Sbjct  1014  ETTKALHREIDISRLYEGMEPNTTYRLVSMVGCSEEEEYICLSFKKNQ--WVGYRHEALA  1071

Query  725   -KEIGSWDDVLMMCIKGQLQPQVLFFEA  645
              K +G W +V+  C K +++P++LF+EA
Sbjct  1072  KKAVGDWKNVVRFCEKMKVRPEILFYEA  1099



>ref|XP_002886822.1| hypothetical protein ARALYDRAFT_338628 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63081.1| hypothetical protein ARALYDRAFT_338628 [Arabidopsis lyrata subsp. 
lyrata]
Length=417

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/173 (33%), Positives = 100/173 (58%), Gaps = 9/173 (5%)
 Frame = -3

Query  1157  VAPTSLRIALSNLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINH  978
             +  +SLR   ++L+   ++  + + K  +F+ ++ ++  +  + CD +  GCGK N +  
Sbjct  116   INASSLREVKASLF--FSYTLKSVFKHFTFENIVKVIKMNLKMPCDKE--GCGKRNYVQR  171

Query  977   FLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISV--PYHGLDPKNKHHLVSVVC  804
              +   P VFTI + W    E+  +I  T S L+TEID+SV   Y G     K+ LVS+VC
Sbjct  172   MINKLPSVFTIALEWTKN-ETAGEIYDTASFLATEIDVSVIYQYKGDSTCTKYRLVSMVC  230

Query  803   YYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEA  645
              + + Y+CVAY  ++ +W+ Y    ++ IG WD V+ +C+   ++PQ+LFFE+
Sbjct  231   SHGERYNCVAY--ENNRWVRYLRSEIEVIGDWDSVVSICLTQSIRPQILFFES  281



>emb|CDX91518.1| BnaC02g16420D [Brassica napus]
Length=340

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 87/144 (60%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+ ++  +  + ++ C  +  GC KL+ ++H +   P VFTI + W+N  E+ ++I AT
Sbjct  160   TFERILKFIKINSMVPCKTE--GCEKLSYVDHIIPILPSVFTIALEWENN-ETGEEILAT  216

Query  893   LSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEIDIS    Y G  P+ K++LVS+VC +   Y CVAY  +  +W++Y     + 
Sbjct  217   TSVLATEIDISQIYKYEGGSPETKYNLVSMVCSHGDQYACVAYFNN--RWVIYFPSEQQV  274

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD V+   I+  ++P +LFFE
Sbjct  275   IGDWDSVINTFIRLNMRPDILFFE  298



>ref|XP_010510750.1| PREDICTED: uncharacterized protein LOC104786966 isoform X1 [Camelina 
sativa]
Length=1124

 Score =   102 bits (255),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 86/142 (61%), Gaps = 2/142 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +Y ++CD    GCG  N ++H +   P +FTIV+ WK + E+  +I  T 
Sbjct  972   FVDILKVIRMEYKMLCDTTTGGCGITNFVHHIISKCPPIFTIVLEWKKS-ETGKEISETT  1030

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              AL  EID+S  Y GL+PK K+ LVS+V C   + Y C+AY ++    +  D    +++G
Sbjct  1031  KALDWEIDMSRMYEGLEPKTKYRLVSMVCCGEEEEYFCIAYEKNRWVNLRRDALAGEDVG  1090

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             +W  V+  C + +++P++LF+E
Sbjct  1091  NWKSVVRFCGERKVRPEILFYE  1112



>ref|XP_006485802.1| PREDICTED: uncharacterized protein LOC102630787 [Citrus sinensis]
Length=1333

 Score =   102 bits (255),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 73/122 (60%), Gaps = 3/122 (2%)
 Frame = -3

Query  1007  GCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNK  828
             GCG+LN I H L   PHVF  VI W+   +S +DI  TLSALS E+D+S  + G  P   
Sbjct  1202  GCGQLNSIYHSLWRLPHVFVSVIDWRRGDKSSEDISTTLSALSNELDLSKLFQGYLPDYT  1261

Query  827   HHLVSVVCY--YRQHYHCVAYSRDH-EKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVL  657
             + +VS+VC+   RQH  C  Y   H E ++ + D NV+ IGSWDDV+  C    L P+ L
Sbjct  1262  YFVVSMVCFCKDRQHSVCFLYDDQHDEHYVQHSDSNVEVIGSWDDVISTCNTKCLLPKFL  1321

Query  656   FF  651
             FF
Sbjct  1322  FF  1323



>ref|XP_010473156.1| PREDICTED: uncharacterized protein LOC104752660 [Camelina sativa]
Length=1111

 Score =   102 bits (253),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 86/142 (61%), Gaps = 2/142 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +Y ++CD    GCG  N ++H +   P +FTIV+ WK + E+  +I  T 
Sbjct  965   FVDILKVIRMEYKMLCDTKTGGCGITNFVHHIISKCPPIFTIVLEWKKS-ETGKEICETT  1023

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              AL  EIDIS  Y GL+PK K+ LVS+V C   + Y C+AY ++    +  D    +++G
Sbjct  1024  KALDWEIDISRMYEGLEPKTKYRLVSMVCCGEEEEYFCIAYEKNRWVNLKRDALAREDVG  1083

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             +W  V+  C + +++P++LF+E
Sbjct  1084  NWKSVVRFCGERKVRPELLFYE  1105



>ref|XP_002502922.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64180.1| predicted protein [Micromonas sp. RCC299]
Length=438

 Score = 99.0 bits (245),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 78/142 (55%), Gaps = 14/142 (10%)
 Frame = -3

Query  1025  CDPDANGCGKLNCINHFLLT------PPHVFTIVIGWKNTCESLDDIRATLSALSTEIDI  864
             CD DA GCG +N I H L         P +F + + W++   + D +  TL+ + T +++
Sbjct  293   CDVDAGGCGAMNGIEHALAADGVQRKSPAIFCVALAWESASATSDQVAETLANVQTTLNL  352

Query  863   SVPYHGLDPKNK--HHLVSVVCYYRQHYHCVAYSR-----DHEKWIMYDDKNVKEIGSWD  705
             +  Y    P++   +HL   +CYY +HY   A +       HE+W+++DD   KE+G W+
Sbjct  353   AEVYE-RAPRDAGTYHLRCAMCYYGEHYAAFAVTDAGRFDGHERWMLFDDHRSKEVGEWE  411

Query  704   DVLMMCIKGQLQPQVLFFEAAN  639
             +V  +C  G++QP VLF++  N
Sbjct  412   EVARVCAAGRMQPCVLFYQREN  433



>ref|XP_006302827.1| hypothetical protein CARUB_v10020958mg [Capsella rubella]
 gb|EOA35725.1| hypothetical protein CARUB_v10020958mg [Capsella rubella]
Length=207

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 85/153 (56%), Gaps = 7/153 (5%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             + M +K +F++++ ++  D  + CD +  GC K N +   +  PP VFTI + W+N  E+
Sbjct  46    KAMFEKFTFEKIIQVIRIDLKMPCDKE--GCEKRNYVQRMIYKPPTVFTIALEWENN-ET  102

Query  914   LDDIRATLSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMY  741
               +I  T S L TEIDI+    Y G     K+ L S+VC +   Y+CVAY +  ++W+ +
Sbjct  103   EGEIFDTTSVLKTEIDINTIYQYKGDSAVTKYRLASMVCSHGNQYNCVAYEK--KRWVRH  160

Query  740   DDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
                  + IG WD VL       ++P++LFFE A
Sbjct  161   VGSEEEVIGDWDGVLSKFRNLHIRPEILFFENA  193



>emb|CBI35029.3| unnamed protein product [Vitis vinifera]
Length=1596

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -3

Query  1097  QEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCE  918
             +++ H   SFD L+ L+  D  + C+P+  GCGKLN I+  L  PPH+F +++GW++  E
Sbjct  1489  KKITHMDSSFDNLLKLVKMDDQVTCNPEEGGCGKLNSIDQILSDPPHLFVVLLGWQSVSE  1548

Query  917   SLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVV  807
             + +D+  TL+AL+TEIDI+V Y  LD   K+HL+S+V
Sbjct  1549  NSEDVSTTLAALTTEIDIAVIYGDLDEGRKYHLISMV  1585



>gb|ABE97183.1| unknown [Arabidopsis thaliana]
Length=377

 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  DY ++CD    GCG  N I+H +   P +FTIV+ W+ + E+  +I  T 
Sbjct  231   FVDILKVIRMDYTMLCDIKNGGCGIANFIHHIISKCPPIFTIVLEWEKS-ETEKEISETT  289

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              A   EIDIS  Y GL+PK  + L S+V C  +Q + C+AY ++    +  D    +++G
Sbjct  290   KAFEWEIDISRLYAGLEPKTNYRLASMVGCDEKQEHICIAYEKNRWVNLRRDALAGEDVG  349

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             +W  V+  C + +++P++LF+E
Sbjct  350   NWKSVVRFCGERKVRPEILFYE  371



>ref|XP_009124029.1| PREDICTED: uncharacterized protein LOC103848948 [Brassica rapa]
Length=1201

 Score =   100 bits (248),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 87/148 (59%), Gaps = 6/148 (4%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             K   ++++ L+  +Y ++CD    GCGK N ++H +     +FTIV+ W+   E+  +I 
Sbjct  1051  KMKLEDILKLIRMEYKMLCDAKTEGCGKANFVHHIISRCTPIFTIVLKWEKN-ETEKEIH  1109

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNV-  726
              T  AL  EIDIS  Y G++P   + LVS+V C   + Y C+++ ++   W+ Y  + + 
Sbjct  1110  ETTKALHREIDISRLYEGMEPNTTYRLVSMVGCSEEEEYICLSFKKNQ--WVGYRHEALA  1167

Query  725   -KEIGSWDDVLMMCIKGQLQPQVLFFEA  645
              K +G W +V+  C K +++P++LF+EA
Sbjct  1168  KKAVGDWKNVVRFCEKMKVRPEILFYEA  1195



>ref|XP_010470405.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X7 [Camelina sativa]
 ref|XP_010470406.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X8 [Camelina sativa]
Length=344

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG+ N ++H +   P +FTI + W+   E+  +I  T 
Sbjct  197   FEDILKMIRMEDKMICDVRTGGCGETNFVHHTISRCPPIFTIGLEWEKN-ETEKEISETT  255

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              +L  EIDIS  Y GL+P  K+ LVS++ C   + Y C+AY ++    + ++ K  + +G
Sbjct  256   KSLEWEIDISRLYEGLEPNTKYRLVSMIGCGEEEKYICMAYKKNRWVSLTHEAKIEEVVG  315

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
             +W+ V  +C + +++P++LF+EA
Sbjct  316   NWESVARLCGERKVRPEILFYEA  338



>ref|XP_004334106.1| ubiquitin carboxyl-terminal hydrolase [Acanthamoeba castellanii 
str. Neff]
 gb|ELR12093.1| ubiquitin carboxyl-terminal hydrolase [Acanthamoeba castellanii 
str. Neff]
Length=825

 Score = 99.4 bits (246),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 88/157 (56%), Gaps = 6/157 (4%)
 Frame = -3

Query  1100  FQEVMHKKRSFDELMNLLLRDYLLVC-DPDANGCGKLNCINHFLLTPPHVFTIVIGWKNT  924
             F +   +   FDELM++L    L  C D D   C + N    FL   P VFTI + W + 
Sbjct  251   FDDANRRDIRFDELMSILNDSELKKCPDFDLTECQQQNRNQRFLQNVPKVFTINLVWASP  310

Query  923   CESLDDIRATLSALST----EIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHE  756
               ++++IR TL+ ++     EID+S  ++G++ +  +    ++ YY +HY    + R  +
Sbjct  311   TPTVEEIRQTLTIIAANNALEIDLSTIFYGVERETNYVFRGMIAYYGRHYAAFFHCRSRD  370

Query  755   KWIMYDDKNVKEIG-SWDDVLMMCIKGQLQPQVLFFE  648
             +W+++DD+ +K +G +WDDV+  C +   QP VLF+E
Sbjct  371   QWLIFDDEKIKVVGKTWDDVIANCCRAHWQPSVLFYE  407



>ref|XP_010470398.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X3 [Camelina sativa]
 ref|XP_010470400.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X3 [Camelina sativa]
 ref|XP_010470401.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X4 [Camelina sativa]
 ref|XP_010470402.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X4 [Camelina sativa]
 ref|XP_010470407.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X1 [Camelina sativa]
 ref|XP_010470408.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X1 [Camelina sativa]
Length=367

 Score = 97.1 bits (240),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG+ N ++H +   P +FTI + W+   E+  +I  T 
Sbjct  220   FEDILKMIRMEDKMICDVRTGGCGETNFVHHTISRCPPIFTIGLEWEKN-ETEKEISETT  278

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              +L  EIDIS  Y GL+P  K+ LVS++ C   + Y C+AY ++    + ++ K  + +G
Sbjct  279   KSLEWEIDISRLYEGLEPNTKYRLVSMIGCGEEEKYICMAYKKNRWVSLTHEAKIEEVVG  338

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
             +W+ V  +C + +++P++LF+EA
Sbjct  339   NWESVARLCGERKVRPEILFYEA  361



>ref|XP_010470403.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X5 [Camelina sativa]
 ref|XP_010470404.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X6 [Camelina sativa]
 ref|XP_010470409.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X2 [Camelina sativa]
Length=360

 Score = 97.1 bits (240),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG+ N ++H +   P +FTI + W+   E+  +I  T 
Sbjct  213   FEDILKMIRMEDKMICDVRTGGCGETNFVHHTISRCPPIFTIGLEWEKN-ETEKEISETT  271

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              +L  EIDIS  Y GL+P  K+ LVS++ C   + Y C+AY ++    + ++ K  + +G
Sbjct  272   KSLEWEIDISRLYEGLEPNTKYRLVSMIGCGEEEKYICMAYKKNRWVSLTHEAKIEEVVG  331

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
             +W+ V  +C + +++P++LF+EA
Sbjct  332   NWESVARLCGERKVRPEILFYEA  354



>ref|XP_009127389.1| PREDICTED: uncharacterized protein LOC103852221 [Brassica rapa]
Length=1117

 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 96/172 (56%), Gaps = 17/172 (10%)
 Frame = -3

Query  1118  YPDSNFFQEVMHKKR-----------SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFL  972
             YP+ +F+  VM                F++++ ++  +  ++CD    GCGK N ++H +
Sbjct  945   YPEQSFYGIVMAADSIRDLKCAFGNIKFEDILKMIRMEDKMLCDLKTGGCGKENSVHHII  1004

Query  971   LTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYR  795
                P VFTIV+ W+   E+  +I  T  AL  EID+S  Y GL+P  K+ LVS+V C   
Sbjct  1005  RRCPPVFTIVLEWEKD-ETEKEISETSKALDCEIDMSRLYEGLEPSTKYRLVSMVGCGEE  1063

Query  794   QHYHCVAYSRDHEKWIMYD-DKNVKE-IGSWDDVLMMCIKGQLQPQVLFFEA  645
             + Y C+AY +  ++W+ +    + KE +G+W  V   C + +++P++LF++A
Sbjct  1064  EEYICLAYKK--KRWVRFSLGASAKEVVGNWTSVARFCGERKVRPEILFYKA  1113



>ref|XP_006485855.1| PREDICTED: uncharacterized protein LOC102624054 [Citrus sinensis]
Length=595

 Score = 99.0 bits (245),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 86/152 (57%), Gaps = 10/152 (7%)
 Frame = -3

Query  1091  VMHKKR--SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCE  918
             + +K+R  S +EL+ L+     + C     GCG+LN IN     PPHV T +I W    +
Sbjct  225   LANKRRDMSNEELLELVGIIGRMTC-----GCGQLNLINRAPWCPPHVLTAIIYWPRGDQ  279

Query  917   SLDDIRATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYY--RQHYHCVAYSRDHEK-WI  747
             S +DI  TLSALS E+D+S  + G  P   + +VS+VC    RQH  C  Y   H+K ++
Sbjct  280   SSEDISTTLSALSNEVDVSKLFQGYVPDYTYFIVSMVCCSSDRQHSVCFLYDDQHDKHYV  339

Query  746   MYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFF  651
              + + NV+  GSWDDV+  C + +L P +LF 
Sbjct  340   QHSESNVEVTGSWDDVISTCSRKRLLPILLFL  371



>emb|CDX91514.1| BnaC02g16460D [Brassica napus]
Length=1117

 Score = 99.4 bits (246),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 89/145 (61%), Gaps = 6/145 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N ++H +   P +FT+V+ W+   E+  +I  T 
Sbjct  972   FEDILKMIRMEDEMLCDIKTGGCGKANFVHHIISRCPPIFTVVLEWEKD-ETEKEISETT  1030

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYD-DKNVKE-  720
              AL  EID+S  Y GL+P  K+ LVS+V C   + Y C+AY ++  +W+ +    + KE 
Sbjct  1031  KALDWEIDMSRLYEGLEPSTKYRLVSMVGCGEEEEYICLAYKKN--RWVSFSHGASAKEV  1088

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEA  645
             +G+W  V+  C + +++P++LF+EA
Sbjct  1089  VGNWKSVVRFCEERKVRPEILFYEA  1113



>ref|NP_199966.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 dbj|BAB08669.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED96094.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1149

 Score = 99.4 bits (246),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ +   +Y ++CD  + GCG+ N ++H +   P +FTIV+ W+ + E+  +I  T 
Sbjct  1002  FVDILKVTRMEYKMLCDTRSGGCGRTNIVHHIISRCPPIFTIVLEWEKS-ETEKEISETT  1060

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYH-CVAYSRDHEKWIMYDDKNV--K  723
              AL  EIDIS  Y GL+P   + LVS+V C   +  H C+AY ++  +W+    +++  +
Sbjct  1061  KALEWEIDISRLYEGLEPNTNYRLVSMVGCSEVEEEHICIAYEKN--RWVNLKRESLVGE  1118

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAA  642
             +IG+W  V+  C + +++P++LF+EAA
Sbjct  1119  DIGNWKSVVRFCGEKKVRPEILFYEAA  1145



>ref|XP_006301529.1| hypothetical protein CARUB_v10021957mg, partial [Capsella rubella]
 gb|EOA34427.1| hypothetical protein CARUB_v10021957mg, partial [Capsella rubella]
Length=259

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 87/161 (54%), Gaps = 7/161 (4%)
 Frame = -3

Query  1124  NLYPDSNFFQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTI  945
              L  ++   +E M +K +F++++ ++  D  + CD +  GC K N +   +  PP VFTI
Sbjct  103   GLIINAGTLREAMFEKFTFEKIIQVIRIDLKMPCDKE--GCEKRNYVQRMIYKPPTVFTI  160

Query  944   VIGWKNTCESLDDIRATLSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAY  771
              + W+N  E+  +I  T S L TEIDI+    Y G     K+ L S+VC +   Y+CVAY
Sbjct  161   ALEWENN-ETEGEIFDTTSVLKTEIDINTIYQYKGDSAVTKYRLASMVCSHGNQYNCVAY  219

Query  770   SRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
              +  ++W+       + IG WD VL       ++P++LFFE
Sbjct  220   EK--KRWVRLVGSEEEVIGDWDGVLSKFRNLHIRPEILFFE  258



>ref|XP_010417917.1| PREDICTED: uncharacterized protein LOC104703582 isoform X2 [Camelina 
sativa]
Length=1167

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F ++  ++  +Y L+CD    GCG  N ++H +   P +FTIV+ WK + E+  +I  T 
Sbjct  1018  FVDICKVIRMEYKLLCDIKTGGCGITNFVHHIISKSPPIFTIVLEWKKS-ETEKEISETT  1076

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV--CYYRQHYHCVAYSRDHEKWIMYDDK--NVK  723
              AL  EIDIS  Y GL+P   + LVS+V      + Y+C+AY ++  +W+ +     N +
Sbjct  1077  KALDWEIDISRMYEGLEPNTNYRLVSLVGCGEEEKEYNCLAYVKN--RWVNFRHGALNGE  1134

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +G+W  V+  C + +++P++LF+EAA
Sbjct  1135  NVGNWKSVVRFCGERKVRPEILFYEAA  1161



>ref|XP_010417916.1| PREDICTED: uncharacterized protein LOC104703582 isoform X1 [Camelina 
sativa]
Length=1128

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 87/147 (59%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F ++  ++  +Y L+CD    GCG  N ++H +   P +FTIV+ WK + E+  +I  T 
Sbjct  979   FVDICKVIRMEYKLLCDIKTGGCGITNFVHHIISKSPPIFTIVLEWKKS-ETEKEISETT  1037

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV--CYYRQHYHCVAYSRDHEKWIMYDDK--NVK  723
              AL  EIDIS  Y GL+P   + LVS+V      + Y+C+AY ++  +W+ +     N +
Sbjct  1038  KALDWEIDISRMYEGLEPNTNYRLVSLVGCGEEEKEYNCLAYVKN--RWVNFRHGALNGE  1095

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +G+W  V+  C + +++P++LF+EAA
Sbjct  1096  NVGNWKSVVRFCGERKVRPEILFYEAA  1122



>ref|XP_010444564.1| PREDICTED: uncharacterized protein LOC104727216 isoform X3 [Camelina 
sativa]
 ref|XP_010444565.1| PREDICTED: uncharacterized protein LOC104727216 isoform X3 [Camelina 
sativa]
 ref|XP_010444566.1| PREDICTED: uncharacterized protein LOC104727216 isoform X3 [Camelina 
sativa]
 ref|XP_010444567.1| PREDICTED: uncharacterized protein LOC104727216 isoform X3 [Camelina 
sativa]
Length=1122

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  980   FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1038

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVSV+ C     Y CVAY ++  +W+    + + E  
Sbjct  1039  EALDWEIDISRLYEGVEPNTVYRLVSVIGCGEEGEYICVAYKKN--RWVSLRHETLAEEV  1096

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C K  ++P+VLF+E
Sbjct  1097  VGKWKSVVKFCGKWGVRPEVLFYE  1120



>ref|XP_010444569.1| PREDICTED: uncharacterized protein LOC104727216 isoform X5 [Camelina 
sativa]
Length=981

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  839   FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  897

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVSV+ C     Y CVAY ++  +W+    + + E  
Sbjct  898   EALDWEIDISRLYEGVEPNTVYRLVSVIGCGEEGEYICVAYKKN--RWVSLRHETLAEEV  955

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C K  ++P+VLF+E
Sbjct  956   VGKWKSVVKFCGKWGVRPEVLFYE  979



>ref|XP_010444568.1| PREDICTED: uncharacterized protein LOC104727216 isoform X4 [Camelina 
sativa]
Length=1010

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  868   FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  926

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVSV+ C     Y CVAY ++  +W+    + + E  
Sbjct  927   EALDWEIDISRLYEGVEPNTVYRLVSVIGCGEEGEYICVAYKKN--RWVSLRHETLAEEV  984

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C K  ++P+VLF+E
Sbjct  985   VGKWKSVVKFCGKWGVRPEVLFYE  1008



>ref|XP_010444557.1| PREDICTED: uncharacterized protein LOC104727216 isoform X1 [Camelina 
sativa]
 ref|XP_010444558.1| PREDICTED: uncharacterized protein LOC104727216 isoform X1 [Camelina 
sativa]
 ref|XP_010444559.1| PREDICTED: uncharacterized protein LOC104727216 isoform X1 [Camelina 
sativa]
 ref|XP_010444560.1| PREDICTED: uncharacterized protein LOC104727216 isoform X1 [Camelina 
sativa]
 ref|XP_010444561.1| PREDICTED: uncharacterized protein LOC104727216 isoform X1 [Camelina 
sativa]
Length=1168

 Score = 99.0 bits (245),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  1026  FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1084

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVSV+ C     Y CVAY ++  +W+    + + E  
Sbjct  1085  EALDWEIDISRLYEGVEPNTVYRLVSVIGCGEEGEYICVAYKKN--RWVSLRHETLAEEV  1142

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C K  ++P+VLF+E
Sbjct  1143  VGKWKSVVKFCGKWGVRPEVLFYE  1166



>ref|XP_010444563.1| PREDICTED: uncharacterized protein LOC104727216 isoform X2 [Camelina 
sativa]
Length=1158

 Score = 99.0 bits (245),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 83/144 (58%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  1016  FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1074

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVSV+ C     Y CVAY ++  +W+    + + E  
Sbjct  1075  EALDWEIDISRLYEGVEPNTVYRLVSVIGCGEEGEYICVAYKKN--RWVSLRHETLAEEV  1132

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C K  ++P+VLF+E
Sbjct  1133  VGKWKSVVKFCGKWGVRPEVLFYE  1156



>ref|XP_010463375.1| PREDICTED: uncharacterized protein LOC104743948 isoform X5 [Camelina 
sativa]
 ref|XP_010463380.1| PREDICTED: uncharacterized protein LOC104743948 isoform X5 [Camelina 
sativa]
Length=1066

 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  924   FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  982

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVS++ C     Y+CVAY ++  +W+    + + E  
Sbjct  983   EALDWEIDISRLYEGVEPNTVYRLVSMIGCGEEGEYNCVAYKKN--RWVSLRHETLAEEV  1040

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C + +++P+VLF+E
Sbjct  1041  VGKWKSVVKFCGEWRVRPEVLFYE  1064



>ref|XP_010463360.1| PREDICTED: uncharacterized protein LOC104743948 isoform X4 [Camelina 
sativa]
 ref|XP_010463364.1| PREDICTED: uncharacterized protein LOC104743948 isoform X4 [Camelina 
sativa]
 ref|XP_010463370.1| PREDICTED: uncharacterized protein LOC104743948 isoform X4 [Camelina 
sativa]
Length=1123

 Score = 99.0 bits (245),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  981   FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1039

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVS++ C     Y+CVAY ++  +W+    + + E  
Sbjct  1040  EALDWEIDISRLYEGVEPNTVYRLVSMIGCGEEGEYNCVAYKKN--RWVSLRHETLAEEV  1097

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C + +++P+VLF+E
Sbjct  1098  VGKWKSVVKFCGEWRVRPEVLFYE  1121



>ref|XP_010470394.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X1 [Camelina sativa]
 ref|XP_010470395.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X1 [Camelina sativa]
 ref|XP_010470396.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X2 [Camelina sativa]
 ref|XP_010470397.1| PREDICTED: inactive ubiquitin carboxyl-terminal hydrolase 53-like 
isoform X2 [Camelina sativa]
Length=396

 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG+ N ++H +   P +FTI + W+   E+  +I  T 
Sbjct  249   FEDILKMIRMEDKMICDVRTGGCGETNFVHHTISRCPPIFTIGLEWEKN-ETEKEISETT  307

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              +L  EIDIS  Y GL+P  K+ LVS++ C   + Y C+AY ++    + ++ K  + +G
Sbjct  308   KSLEWEIDISRLYEGLEPNTKYRLVSMIGCGEEEKYICMAYKKNRWVSLTHEAKIEEVVG  367

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
             +W+ V  +C + +++P++LF+EA
Sbjct  368   NWESVARLCGERKVRPEILFYEA  390



>ref|XP_010463334.1| PREDICTED: uncharacterized protein LOC104743948 isoform X2 [Camelina 
sativa]
Length=1151

 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  1009  FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1067

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVS++ C     Y+CVAY ++  +W+    + + E  
Sbjct  1068  EALDWEIDISRLYEGVEPNTVYRLVSMIGCGEEGEYNCVAYKKN--RWVSLRHETLAEEV  1125

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C + +++P+VLF+E
Sbjct  1126  VGKWKSVVKFCGEWRVRPEVLFYE  1149



>ref|XP_010463339.1| PREDICTED: uncharacterized protein LOC104743948 isoform X3 [Camelina 
sativa]
 ref|XP_010463345.1| PREDICTED: uncharacterized protein LOC104743948 isoform X3 [Camelina 
sativa]
 ref|XP_010463353.1| PREDICTED: uncharacterized protein LOC104743948 isoform X3 [Camelina 
sativa]
 ref|XP_010463357.1| PREDICTED: uncharacterized protein LOC104743948 isoform X3 [Camelina 
sativa]
Length=1142

 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  1000  FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1058

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVS++ C     Y+CVAY ++  +W+    + + E  
Sbjct  1059  EALDWEIDISRLYEGVEPNTVYRLVSMIGCGEEGEYNCVAYKKN--RWVSLRHETLAEEV  1116

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C + +++P+VLF+E
Sbjct  1117  VGKWKSVVKFCGEWRVRPEVLFYE  1140



>ref|XP_010463280.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463287.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463292.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463296.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463302.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463307.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463312.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463317.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463323.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
 ref|XP_010463328.1| PREDICTED: uncharacterized protein LOC104743948 isoform X1 [Camelina 
sativa]
Length=1161

 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 85/144 (59%), Gaps = 6/144 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  TL
Sbjct  1019  FEDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISRSPPIFTIVLEWEKN-ETEKEISETL  1077

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y G++P   + LVS++ C     Y+CVAY ++  +W+    + + E  
Sbjct  1078  EALDWEIDISRLYEGVEPNTVYRLVSMIGCGEEGEYNCVAYKKN--RWVSLRHETLAEEV  1135

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             +G W  V+  C + +++P+VLF+E
Sbjct  1136  VGKWKSVVKFCGEWRVRPEVLFYE  1159



>ref|XP_009124028.1| PREDICTED: uncharacterized protein LOC103848947 [Brassica rapa]
Length=1071

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 87/150 (58%), Gaps = 8/150 (5%)
 Frame = -3

Query  1079  KRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIR  900
             K   ++++ L+  +Y ++CD    GCGK N ++H +     +FTIV+ W+   E+  +I 
Sbjct  919   KMKLEDILKLIRMEYKMLCDAKTEGCGKANFVHHIISRCTPIFTIVLKWEKN-ETEKEIH  977

Query  899   ATLSALSTEIDISVPYHGLDPKNKHHLVSVV---CYYRQHYHCVAYSRDHEKWIMYDDKN  729
              T  AL  EIDIS  Y G++P   + LVS+V   C   + Y C+ + ++  +W+ Y  + 
Sbjct  978   ETTKALHREIDISRLYEGMEPNTTYRLVSMVGCTCGEEEEYICLFFKKN--RWVSYRHEA  1035

Query  728   V--KEIGSWDDVLMMCIKGQLQPQVLFFEA  645
             +  K +G W +V+  C K +++P++LF+EA
Sbjct  1036  LAKKAVGGWTNVVRFCEKMKVRPEILFYEA  1065



>emb|CDX91517.1| BnaC02g16430D [Brassica napus]
Length=1063

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 88/145 (61%), Gaps = 2/145 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N ++H +   P +FT+V+ W+   E+  +I  T 
Sbjct  920   FEDILKVIRMEDKMLCDLKTGGCGKANFVHHIISRCPPIFTVVLEWEKH-ETEKEISETT  978

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              AL  EID+S  Y GL+   K+ LVS+V C   + + C+AY +D    + +D    + +G
Sbjct  979   KALDWEIDMSRLYEGLESSTKYRLVSLVGCGEDKEHICLAYEKDRWVGVRHDALTEEAVG  1038

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             +W+ V+  C + +++P++LF+EAA+
Sbjct  1039  NWESVIRFCGERKVRPKILFYEAAH  1063



>gb|KFK40075.1| hypothetical protein AALP_AA3G326900 [Arabis alpina]
Length=1133

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/143 (34%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD+++ ++  +  ++CD    GCG+ N ++H + T P +FTIV+ W+   E+  +I  T 
Sbjct  986   FDDILKMIRMEDKMLCDIKTGGCGEANVVHHIISTCPPIFTIVLKWEKG-ETDKEISETT  1044

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
             +AL  EID+S  Y GL+P  K+ LVS+V C   + Y C+ Y +     +  +    + IG
Sbjct  1045  NALEWEIDMSKLYEGLEPNTKYRLVSMVGCGEAEEYICLVYKKTRWFNVRLEALAKESIG  1104

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
             +W +V+  C + +++P++LF+EA
Sbjct  1105  NWKNVVKFCGERKVRPEILFYEA  1127



>ref|NP_176699.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE34343.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1101

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 86/147 (59%), Gaps = 6/147 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +  ++CD    GCGK N + H + + P +FTIV+ W+   E+  +I  TL
Sbjct  955   FGDIIKVIRMEDKMLCDIKTRGCGKANFVRHTISSCPPIFTIVLKWEKN-ETEKEISGTL  1013

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              A+  EIDIS  Y GL+P   + LVS++ C     Y C+AY ++  +WI    + + E  
Sbjct  1014  KAMDWEIDISKLYEGLEPNTNYRLVSMIGCGEEGEYICMAYKKN--RWISLRHEALIEEV  1071

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             +G W  V+  C + +++P++LF+EAA 
Sbjct  1072  VGIWKSVVRFCGERRVRPEILFYEAAG  1098



>ref|XP_006300665.1| hypothetical protein CARUB_v10019695mg [Capsella rubella]
 gb|EOA33563.1| hypothetical protein CARUB_v10019695mg [Capsella rubella]
Length=1122

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N + H +   P +FTIV+ W+   E+  +I  T 
Sbjct  979   FEDILRVIRVEDEMICDVKTGGCGKTNFVRHTISKCPPIFTIVLEWEKN-ETETEISKTT  1037

Query  890   SALSTEIDISVPYHGL-DPKNKHHLVSVVCYYRQ-HYHCVAYSRDHEKWIMYDDKNVKE-  720
             +AL  EIDIS  Y GL +P  K+ LVS++ Y  +  Y C+AY ++  +W+    + + E 
Sbjct  1038  NALDWEIDISRLYEGLEEPNTKYRLVSMIGYCEEGKYICMAYKKN--RWVSLKHETLAEE  1095

Query  719   -IGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +G+W +V+ +C + +++P++LF+EAA
Sbjct  1096  GVGNWKNVVRICGERRVRPEILFYEAA  1122



>ref|NP_176695.1| ubiquitin carboxyl-terminal hydrolase family protein [Arabidopsis 
thaliana]
 gb|AEE34339.1| ubiquitin carboxyl-terminal hydrolase family protein [Arabidopsis 
thaliana]
Length=309

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 90/152 (59%), Gaps = 8/152 (5%)
 Frame = -3

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
             K  +F+ ++ ++  +  + CD +  GCGK + ++  +   P VFTI + W    E+  +I
Sbjct  143   KDFTFENIIKVIKMNLKMPCDKE--GCGKQSYVHRMITKLPSVFTIALEWTKN-ETAGEI  199

Query  902   RATLSALSTEIDISVPYH--GLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKN  729
               T+S L+TEID++V Y   G     K+ LVS+VC +   Y+CVAY  ++ +W+ Y    
Sbjct  200   FDTVSVLATEIDVNVIYQCEGDIRYTKYRLVSMVCLHGNRYNCVAY--ENNRWVRYLRSE  257

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFFEAAN*F  633
             ++ IG W++V+ +C+K  ++PQ+LFFE    F
Sbjct  258   IEVIGDWENVVSICLKN-IRPQILFFENVRPF  288



>ref|XP_010551187.1| PREDICTED: uncharacterized protein LOC104821865 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010551190.1| PREDICTED: uncharacterized protein LOC104821865 isoform X1 [Tarenaya 
hassleriana]
Length=1162

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 85/144 (59%), Gaps = 5/144 (3%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++  +  ++ + CD    GCGK N + H +   P +F I + W+   E+ ++I    
Sbjct  1015  FEDILKAIRMNFQMYCDTKTGGCGKRNYVCHDITKCPAIFIIELKWEK-IEAGEEISEMA  1073

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVK-EI  717
              AL TEIDIS+ Y G++    + LVS++ C   + Y C+AY  ++ +W +  D  VK EI
Sbjct  1074  KALDTEIDISMLYKGVNLMTNYRLVSMIGCKGEEEYSCIAY--ENNRWGVTHDPLVKEEI  1131

Query  716   GSWDDVLMMCIKGQLQPQVLFFEA  645
             G W+ V+  C + +++PQ+LFFEA
Sbjct  1132  GDWNSVVRFCTEREVRPQILFFEA  1155



>ref|XP_010551196.1| PREDICTED: uncharacterized protein LOC104821865 isoform X2 [Tarenaya 
hassleriana]
Length=1114

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 85/145 (59%), Gaps = 5/145 (3%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++  +  ++ + CD    GCGK N + H +   P +F I + W+   E+ ++I    
Sbjct  967   FEDILKAIRMNFQMYCDTKTGGCGKRNYVCHDITKCPAIFIIELKWEK-IEAGEEISEMA  1025

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVK-EI  717
              AL TEIDIS+ Y G++    + LVS++ C   + Y C+AY  ++ +W +  D  VK EI
Sbjct  1026  KALDTEIDISMLYKGVNLMTNYRLVSMIGCKGEEEYSCIAY--ENNRWGVTHDPLVKEEI  1083

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAA  642
             G W+ V+  C + +++PQ+LFFEA 
Sbjct  1084  GDWNSVVRFCTEREVRPQILFFEAT  1108



>ref|XP_002888325.1| hypothetical protein ARALYDRAFT_475527 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64584.1| hypothetical protein ARALYDRAFT_475527 [Arabidopsis lyrata subsp. 
lyrata]
Length=1106

 Score = 97.8 bits (242),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 86/146 (59%), Gaps = 6/146 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +  ++CD    GCGK N + H + + P +FTIV+ W+   E+  +I  TL
Sbjct  960   FGDIIKVIRMEDTMLCDIKTRGCGKANFVRHTISSCPPIFTIVLEWEKN-ETEKEISETL  1018

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EIDIS  Y GL+P   + LVSV+ C     + C+AY ++  +W+    + + E  
Sbjct  1019  KALDWEIDISRLYEGLEPNTNYRLVSVIGCGEEGEHICMAYKKN--RWVSLRHEALTEEV  1076

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEAA  642
             +G W  V+  C + +++P++LF+EAA
Sbjct  1077  VGIWKSVVRFCGERRVRPEILFYEAA  1102



>ref|XP_006301581.1| hypothetical protein CARUB_v10022019mg [Capsella rubella]
 gb|EOA34479.1| hypothetical protein CARUB_v10022019mg [Capsella rubella]
Length=312

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 84/155 (54%), Gaps = 7/155 (5%)
 Frame = -3

Query  1100  FQEVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTC  921
              +E M +K +F++++ ++  D  + CD    GC K N +   +  PP VFTI + W+N  
Sbjct  150   LREAMFEKFTFEKIIQVIRIDLKMPCD--KQGCEKRNYVQRMIYKPPTVFTIALKWENN-  206

Query  920   ESLDDIRATLSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWI  747
             E+  +I  T S L TEIDI+    Y G     K+ L S+VC +   Y+CVAY  +++ W+
Sbjct  207   ETEGEIFDTTSVLQTEIDINTIYQYKGDSAVTKYRLASMVCSHEDQYNCVAY--ENKGWV  264

Query  746   MYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +     + IG WD VL       + P++LFFE A
Sbjct  265   RHVGSEEEVIGDWDGVLCKFRNLHIPPEILFFENA  299



>ref|NP_180331.2| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEC08021.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1122

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 87/148 (59%), Gaps = 7/148 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  DY ++CD    GCG  N ++H L   P VF IV+ W+ + E+  +I  T 
Sbjct  972   FVDILKVIRMDYTMLCDVKTGGCGITNLVHHILSKCPPVFIIVLEWEKS-ETEKEISETT  1030

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYH-CVAYSRDHEKW--IMYDDKNVK  723
              AL  EIDIS  Y GL P  K+ LVS+V C   +  H C+AY  ++ +W  + +D    +
Sbjct  1031  KALYWEIDISRMYEGLKPNTKYRLVSMVGCGVEEEEHICIAY--ENNRWFNLRHDALTRE  1088

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             ++G+W  V+  C + +++P++LF+EA  
Sbjct  1089  DVGNWKSVVGFCEERKVRPEILFYEATG  1116



>gb|AAY82254.1| hypothetical protein At2g27650 [Arabidopsis thaliana]
Length=999

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  DY ++CD    GCG  N I+H +   P +FTIV+ W+ + E+  +I  T 
Sbjct  853   FVDILKVIRMDYTMLCDIKNGGCGIANFIHHIISKCPPIFTIVLEWEKS-ETEKEISETT  911

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              A   EIDIS  Y GL+PK  + L S+V C  +Q + C+AY ++    +  D    +++G
Sbjct  912   KAFEWEIDISRLYAGLEPKTNYRLASMVGCDEKQEHICIAYEKNRWVNLRRDALAGEDVG  971

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             +W  V+  C + +++P++LF+E
Sbjct  972   NWKSVVRFCGERKVRPEILFYE  993



>ref|NP_180333.2| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEC08022.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1106

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 84/142 (59%), Gaps = 2/142 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  DY ++CD    GCG  N I+H +   P +FTIV+ W+ + E+  +I  T 
Sbjct  960   FVDILKVIRMDYTMLCDIKNGGCGIANFIHHIISKCPPIFTIVLEWEKS-ETEKEISETT  1018

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              A   EIDIS  Y GL+PK  + L S+V C  +Q + C+AY ++    +  D    +++G
Sbjct  1019  KAFEWEIDISRLYAGLEPKTNYRLASMVGCDEKQEHICIAYEKNRWVNLRRDALAGEDVG  1078

Query  713   SWDDVLMMCIKGQLQPQVLFFE  648
             +W  V+  C + +++P++LF+E
Sbjct  1079  NWKSVVRFCGERKVRPEILFYE  1100



>emb|CDY16393.1| BnaA02g11970D [Brassica napus]
Length=1076

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 87/145 (60%), Gaps = 2/145 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCGK N ++H +   P +FT+V+ W+   E+  +I  T 
Sbjct  933   FEDILKMIRMEDKMLCDLKTGGCGKANVVHHIISRCPPIFTVVLEWEKH-ETEKEISETA  991

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              AL  EID+S  Y GL+    + LVS+V C   + + C+AY +D    + +D    + +G
Sbjct  992   KALDWEIDMSRLYEGLESSTNYRLVSLVGCGEDKEHICLAYEKDRWVGVRHDAFTEEAVG  1051

Query  713   SWDDVLMMCIKGQLQPQVLFFEAAN  639
             +W+ V+  C + +++P++LF+EAA+
Sbjct  1052  NWESVIRFCGERKVRPKILFYEAAH  1076



>ref|XP_010418961.1| PREDICTED: uncharacterized protein LOC104704602 [Camelina sativa]
Length=1287

 Score = 97.1 bits (240),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = -3

Query  1076  RSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRA  897
             R F++++ ++  +  ++CD    GCG+ N ++H +   P +F IV+ W+   E+  +I  
Sbjct  1138  RKFEDILKMIRMEDKMICDVRTGGCGETNFVHHTISRCPPIFAIVLEWEKN-ETEKEISE  1196

Query  896   TLSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             T  +L  EIDIS  Y GL+P  K+ LVS++ C   + Y C+A  R+    + ++ K  + 
Sbjct  1197  TTKSLEWEIDISRLYEGLEPNTKYRLVSMIGCGKEEKYICMANKRNRWVSLTHEAKIEEV  1256

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEA  645
             +G+W+ V   C + +++P++LF+EA
Sbjct  1257  VGNWESVARFCGERKVRPEILFYEA  1281



>ref|XP_006419161.1| hypothetical protein EUTSA_v10003075mg, partial [Eutrema salsugineum]
 gb|ESQ37597.1| hypothetical protein EUTSA_v10003075mg, partial [Eutrema salsugineum]
Length=320

 Score = 93.6 bits (231),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 88/144 (61%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+ ++ ++    ++ CD +  GCGK + ++  +   P+VFTI + W+N  E+  ++  T
Sbjct  181   TFENILKVIRITLMMPCDKE--GCGKRSYVDRMINKLPYVFTIALEWENN-ETEGEMLDT  237

Query  893   LSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              SAL+T IDIS    Y G +   K+ LVS+VC++   Y+CVAY  ++++W+ +     + 
Sbjct  238   TSALATVIDISAVYKYEGDNLFTKYRLVSMVCFHGDEYNCVAY--ENKRWVRHFGSKKEV  295

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD VL   +K  ++P++L+FE
Sbjct  296   IGDWDSVLRSFVKLNMRPEILYFE  319



>ref|XP_006301509.1| hypothetical protein CARUB_v10021935mg [Capsella rubella]
 gb|EOA34407.1| hypothetical protein CARUB_v10021935mg [Capsella rubella]
Length=1082

 Score = 96.3 bits (238),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 85/143 (59%), Gaps = 2/143 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG+ N I+  +   P +FTIV+ W+   E+  +I  T 
Sbjct  933   FEDILKVVRMEDKMICDVKTGGCGETNFIHRTISRCPPIFTIVLEWEKN-ETEKEISETT  991

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKEIG  714
              AL  EID+S  + GL+P  K+ LVS+V C   + Y C+AY ++    + ++    + +G
Sbjct  992   KALEWEIDLSRLFEGLEPNTKYRLVSMVGCGEDEEYICMAYKKNRWASLRHEASTEEVVG  1051

Query  713   SWDDVLMMCIKGQLQPQVLFFEA  645
             SW+ V   C + +++P++LF+EA
Sbjct  1052  SWESVARYCAERKVRPEILFYEA  1074



>ref|XP_005835712.1| hypothetical protein GUITHDRAFT_68514 [Guillardia theta CCMP2712]
 gb|EKX48732.1| hypothetical protein GUITHDRAFT_68514 [Guillardia theta CCMP2712]
Length=390

 Score = 94.4 bits (233),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 72/123 (59%), Gaps = 3/123 (2%)
 Frame = -3

Query  1007  GCGKLNCI---NHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDP  837
             GC + N +   +  L + P +F++V+ W+ T  + DDI      L   +D+S+ Y G+  
Sbjct  265   GCKEGNAMFECSQALFSCPDIFSLVLVWETTSATPDDISLLFHQLPLVLDLSLVYSGVPS  324

Query  836   KNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVL  657
              +K+ L  +VC+Y QHY  ++Y    ++W+ YDD +VK +G W +V+  C  G+ QP VL
Sbjct  325   GSKYRLRCMVCFYGQHYVLLSYKPRVKQWVQYDDSSVKRVGDWKEVVERCRLGRFQPNVL  384

Query  656   FFE  648
             F+E
Sbjct  385   FYE  387



>ref|XP_002888322.1| hypothetical protein ARALYDRAFT_315481 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64581.1| hypothetical protein ARALYDRAFT_315481 [Arabidopsis lyrata subsp. 
lyrata]
Length=1127

 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 88/146 (60%), Gaps = 6/146 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG  N ++H +   P +FTIV+ W+   E+  +I  T 
Sbjct  981   FEDVLKVIRMEGEMMCDVKTGGCGTTNFVHHTISRCPPIFTIVLEWEKN-ETEKEISETT  1039

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
             +AL  EIDIS+ Y GL+P   + LVS++ C     + C+AY+++  +W+    + + E  
Sbjct  1040  NALHWEIDISMLYEGLEPNTNYRLVSMIGCVEEGEFICMAYTKN--RWVSLRHETLAEEV  1097

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEAA  642
             +G+W  V+  C + +L+P++LF+EA 
Sbjct  1098  VGNWKSVVRFCGERKLRPEILFYEAT  1123



>ref|XP_006293590.1| hypothetical protein CARUB_v10022537mg [Capsella rubella]
 gb|EOA26488.1| hypothetical protein CARUB_v10022537mg [Capsella rubella]
Length=1104

 Score = 95.9 bits (237),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 83/141 (59%), Gaps = 1/141 (1%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +Y + CD  A+GCG  N ++H +   P +FTIV+ W+   E+  +I  T 
Sbjct  959   FVDILKVIRMEYKMFCDIKADGCGITNFVHHIISKCPPIFTIVLEWEKN-ETGKEIFETA  1017

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGS  711
              AL  EIDIS  Y GL+PK  + LVS+VC   + + C+ Y ++    +  D    +++G+
Sbjct  1018  KALDWEIDISRLYKGLEPKTNYRLVSMVCCREEEHICIVYEKNRWVNLRRDTFAGEDVGT  1077

Query  710   WDDVLMMCIKGQLQPQVLFFE  648
             W  V+  C + +++P+VL +E
Sbjct  1078  WKSVVRFCGERKVRPEVLCYE  1098



>ref|XP_006302633.1| hypothetical protein CARUB_v10020738mg [Capsella rubella]
 gb|EOA35531.1| hypothetical protein CARUB_v10020738mg [Capsella rubella]
Length=290

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 86/153 (56%), Gaps = 7/153 (5%)
 Frame = -3

Query  1094  EVMHKKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCES  915
             + M +K +F++++ ++  D  + CD +  GC K N +   +  PP VFTI + W+N  E+
Sbjct  130   KAMFEKFTFEKIIQVIRIDLKMPCDKE--GCEKRNYVQRMIYKPPTVFTIALEWENN-ET  186

Query  914   LDDIRATLSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMY  741
               +I  T S L TEIDI+    Y G     K+ L S+VC +   Y+CVAY  ++ +W+ +
Sbjct  187   EGEIFDTTSVLKTEIDINTIYQYKGDSAVTKYRLASMVCSHGDLYNCVAY--ENNRWVRH  244

Query  740   DDKNVKEIGSWDDVLMMCIKGQLQPQVLFFEAA  642
                  + IG W+DVL       ++P++LFFE A
Sbjct  245   FCSEKEVIGDWNDVLSKFRNLHIRPEILFFENA  277



>emb|CDY66310.1| BnaCnng50250D, partial [Brassica napus]
Length=1066

 Score = 94.7 bits (234),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 94/169 (56%), Gaps = 14/169 (8%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ +   +Y ++CD    GCG  NC++H +   P +F IV+ W+ + E+  +I  T 
Sbjct  870   FVDVLKVTRMNYKMLCDIKTGGCGTSNCVHHVISRCPPIFIIVLEWEKS-ETEKEISETT  928

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYR--QHYHCVAYSRDHEKWIMYDDKNV--K  723
              AL  EIDIS  Y GL+P   + LVS+V Y    + + C+ Y ++  +W+    +++  +
Sbjct  929   KALEWEIDISRLYEGLEPNTNYRLVSMVGYGEEDEEHICMVYEKN--RWVNLRRESLAGE  986

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEA-------AN*FCMHGTVLLVSST  597
              +GSW  V+  C + +++P++LF+EA       A   C+  TVL   +T
Sbjct  987   VVGSWKSVVRFCGERKIRPEILFYEAVLYTCTCAYFTCLQVTVLAEGTT  1035



>gb|KFK27933.1| hypothetical protein AALP_AA8G449800 [Arabis alpina]
Length=1718

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 85/146 (58%), Gaps = 5/146 (3%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ L+  +  + CD +  GCGK N ++H +   P +FTIV+ W+ + E+  +I  T 
Sbjct  1574  FVDILKLIRMENKMQCDVETGGCGKTNYVHHIINKSPPIFTIVLEWEKS-ETEKEISETT  1632

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNV--KEI  717
              AL  EID+S  Y GL+P   + LVS+V    + + C+AY +   +W+    ++   + +
Sbjct  1633  KALDWEIDMSRLYEGLEPNTNYRLVSMVGCCEEEHICLAYEKT--RWVNLKRESFAGEVV  1690

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAAN  639
             G W  V+  C + +++P++LF+EAA 
Sbjct  1691  GDWKKVVKFCEERKVRPEILFYEAAG  1716



>ref|NP_974091.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE34333.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1147

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 89/147 (61%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F+E++ ++  +  ++CD    GCGK N ++H L   P +FTIV+ W+   E+  +I  T 
Sbjct  1002  FEEILTVIRMEDEMICDVKTGGCGKTNFVHHVLSRCPPIFTIVLEWEKN-ETETEISETA  1060

Query  890   SALSTEIDISVPYHGL-DPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE-  720
              AL+ EIDIS  Y GL +P   + LVS++ C     + C+AY  +  +W+    + + E 
Sbjct  1061  KALAWEIDISRLYEGLEEPNTNYRLVSMIGCGEEGEHICMAYKTN--RWVSLRHEALLEE  1118

Query  719   -IGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +G+W +V+ +C + +++P++LF+EAA
Sbjct  1119  GVGNWKNVVRICGERRVRPEILFYEAA  1145



>gb|AAD26881.1|AC007230_15 Contains similarity to F13P17.8 gi|3337355 hypothetical protein 
from Arabidopsis thaliana BAC gb|AC004481 [Arabidopsis thaliana]
Length=1193

 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 89/147 (61%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F+E++ ++  +  ++CD    GCGK N ++H L   P +FTIV+ W+   E+  +I  T 
Sbjct  1048  FEEILTVIRMEDEMICDVKTGGCGKTNFVHHVLSRCPPIFTIVLEWEKN-ETETEISETA  1106

Query  890   SALSTEIDISVPYHGL-DPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE-  720
              AL+ EIDIS  Y GL +P   + LVS++ C     + C+AY  +  +W+    + + E 
Sbjct  1107  KALAWEIDISRLYEGLEEPNTNYRLVSMIGCGEEGEHICMAYKTN--RWVSLRHEALLEE  1164

Query  719   -IGSWDDVLMMCIKGQLQPQVLFFEAA  642
              +G+W +V+ +C + +++P++LF+EAA
Sbjct  1165  GVGNWKNVVRICGERRVRPEILFYEAA  1191



>ref|XP_009130183.1| PREDICTED: uncharacterized protein LOC103854966 isoform X1 [Brassica 
rapa]
Length=1118

 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 91/153 (59%), Gaps = 10/153 (7%)
 Frame = -3

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
             +K  F +++ +L  +Y ++CD  + GCG  N ++H +   P +F IV+ W+ + E+  +I
Sbjct  970   RKMKFVDVLKVLRMEYKMLCDIKSGGCGTENFVHHLITRCPPIFIIVLEWEKS-ETEKEI  1028

Query  902   RATLSALSTEIDISVPYHGLDPKNKHHLVSVVCY---YRQHYHCVAYSRDHEKWIMYDDK  732
               T  AL  EIDIS  Y GL+P   + LVS+V Y    R+H  C+AY ++  +W+    +
Sbjct  1029  SETTKALEWEIDISRLYEGLEPNTNYRLVSMVGYGDEEREHI-CMAYEKN--RWVNLGRE  1085

Query  731   NV--KEIG-SWDDVLMMCIKGQLQPQVLFFEAA  642
             ++  + +G SW  V+  C + ++QP +LF+EAA
Sbjct  1086  SLAGEVVGNSWKSVVRFCGERKVQPVILFYEAA  1118



>ref|XP_010513792.1| PREDICTED: uncharacterized protein LOC104789850 [Camelina sativa]
Length=1125

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 89/145 (61%), Gaps = 6/145 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++++ ++  +  ++CD    GCG  N ++H +   P +FTI + W+   E+  +I  T 
Sbjct  978   FEDILKMIRMEEKMICDVRTGGCGDTNFVHHTISRCPPIFTIGLEWEKN-ETEKEICETT  1036

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWI-MYDDKNVKEI  717
              +L  EIDIS  Y GL+P  K+ LVS+  C   + Y C+AY ++  +W+ +  + +++E+
Sbjct  1037  KSLEWEIDISRLYEGLEPNTKYRLVSMTGCGEEEEYICMAYKKN--RWVSLTHEASIEEV  1094

Query  716   -GSWDDVLMMCIKGQLQPQVLFFEA  645
              G+W+ V  +C + +++P++LF+EA
Sbjct  1095  VGNWESVARLCGERKVRPEILFYEA  1119



>ref|XP_010483885.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104762315 
[Camelina sativa]
Length=1111

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 88/147 (60%), Gaps = 7/147 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++   Y +VCD +  GCGK N ++H +   P +FTIV+ W+N   + ++I  T 
Sbjct  968   FVDILKVIRMGYKMVCDSETGGCGKTNYVHHIISRCPPIFTIVLEWENRA-TENEISETT  1026

Query  890   SALSTEIDISVPY-HGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNV--K  723
              AL  EI IS  Y  GL+P   + LVS+V C     + C+AY ++  +W+    + +  +
Sbjct  1027  KALDWEIXISRLYEEGLEPNTNYRLVSMVGCSGVGEHICLAYEKN--RWVNLRRECLAGE  1084

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAA  642
             ++G W D++  C + ++QP++LF+EAA
Sbjct  1085  DVGDWKDMVKFCGERKVQPEILFYEAA  1111



>ref|XP_010478210.1| PREDICTED: uncharacterized protein LOC104757180 [Camelina sativa]
Length=186

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 44/148 (30%), Positives = 84/148 (57%), Gaps = 7/148 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
              F +++ ++  ++ + CD    GCGK N ++H +   P +F IV+ W+ + E+  ++  T
Sbjct  38    EFVDIIKVIRMEFKMFCDLKTGGCGKTNFVHHIISKRPPIFIIVLEWEKS-ETEKEVFET  96

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYH-CVAYSRDHEKWIMYDDKNVKE  720
               AL  EIDIS  Y G++P   + LVS+V C   +  H C+ Y ++  +W+       + 
Sbjct  97    TKALEWEIDISRLYEGVEPNTNYRLVSMVGCGEEEEEHICIVYEKN--RWVKLRRTAFEG  154

Query  719   --IGSWDDVLMMCIKGQLQPQVLFFEAA  642
               +G+W +V+  C + +++P++LF+EA 
Sbjct  155   EVVGNWKNVVRYCGERKVRPEILFYEAV  182



>ref|XP_010470411.1| PREDICTED: uncharacterized protein LOC104750321 isoform X1 [Camelina 
sativa]
Length=314

 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 82/146 (56%), Gaps = 7/146 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FD+++ ++  D  + CD +  GCGK+N +   +   P VFTI + W+N  E L ++  T
Sbjct  160   TFDKILQIIRIDLKMPCDKE--GCGKINYVQRMINKLPTVFTIALEWENN-EPLGELFNT  216

Query  893   LSALSTEIDISVP--YHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEIDI     Y G     K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  217   TSVLTTEIDIKTIYLYEGDSECTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  274

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEAA  642
             IG W  VL    +  ++P++LFFE A
Sbjct  275   IGDWGGVLSKFRELHIRPEILFFENA  300



>ref|XP_005849431.1| hypothetical protein CHLNCDRAFT_143978 [Chlorella variabilis]
 gb|EFN57329.1| hypothetical protein CHLNCDRAFT_143978 [Chlorella variabilis]
Length=507

 Score = 92.0 bits (227),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 75/137 (55%), Gaps = 6/137 (4%)
 Frame = -3

Query  1043  RDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDI  864
             +  L  CD D  GCG+   ++H L   P +F++ + W +T ES +DI ATL AL   + +
Sbjct  370   QGQLKTCDEDRGGCGRRYPVHHVLRAAPRLFSLQLSWLSTRESGEDIAATLRALDEHLLL  429

Query  863   SVPYHG-LDPKNKHHLVSVVCYYRQHYHCVAYSRDHE---KWIMYDDKNVKEIGSWDDVL  696
                Y G      ++ L  +  +Y QHY  VA  R  E   +W ++DD  V  +G+W+DV+
Sbjct  430   GEVYAGQAAAGRRYRLRCMAGFYGQHY--VALIRLPELEGQWALFDDSRVSGVGAWEDVV  487

Query  695   MMCIKGQLQPQVLFFEA  645
               C   ++QP VLF+EA
Sbjct  488   RRCEAVRIQPSVLFYEA  504



>ref|XP_002865865.1| hypothetical protein ARALYDRAFT_495225 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42124.1| hypothetical protein ARALYDRAFT_495225 [Arabidopsis lyrata subsp. 
lyrata]
Length=1123

 Score = 92.8 bits (229),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 82/135 (61%), Gaps = 7/135 (5%)
 Frame = -3

Query  1031  LVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPY  852
             ++CD  + GCG  N ++H +   P +FTIV+ W+   E+  ++  T  AL  EIDIS  Y
Sbjct  979   MLCDIKSGGCGMKNIVHHIISRCPPIFTIVLEWEKN-ETEKEVSETTKALEWEIDISRMY  1037

Query  851   HGLDPKNKHHLVSVV-CYYRQHYH-CVAYSRDHEKWIMYDDKNV--KEIGSWDDVLMMCI  684
              GL+P   + LVSVV C   +  H C+AY ++  +W+    +++  ++IG+W  V+  C 
Sbjct  1038  DGLEPNTNYRLVSVVGCSEVEEEHICIAYEKN--RWVNLRRESLVGEDIGNWKSVVRFCG  1095

Query  683   KGQLQPQVLFFEAAN  639
             + +++P++LF+EAA 
Sbjct  1096  ERKVRPEILFYEAAG  1110



>ref|XP_006279927.1| hypothetical protein CARUB_v10025784mg [Capsella rubella]
 gb|EOA12825.1| hypothetical protein CARUB_v10025784mg [Capsella rubella]
Length=1077

 Score = 92.4 bits (228),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 89/146 (61%), Gaps = 6/146 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++ + Y ++CD    GCGK N ++H +   P +FTIV+ W+ +  + ++I  T+
Sbjct  935   FVDILKVIRKGYKMLCDSKTGGCGKRNYVHHIISRCPPIFTIVLEWEKSA-TENEISETV  993

Query  890   SALSTEIDISVPY-HGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNV--KE  720
              AL  EIDIS  Y  G++P   + LVS+V      + C+AY ++  +W+    + +  ++
Sbjct  994   QALDWEIDISRLYEEGIEPNTNYRLVSMVGCSEVEHICLAYEKN--QWVNLRRECLAGED  1051

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEAA  642
             +G W +V+  C + +++P++LF+EAA
Sbjct  1052  VGDWKNVVRFCGERKVRPEILFYEAA  1077



>emb|CDX89680.1| BnaC03g45940D [Brassica napus]
Length=308

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 85/147 (58%), Gaps = 6/147 (4%)
 Frame = -3

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
             K  +F+ ++ ++ R  L++   D  GCGK   +   +   P VFTI + W+   E+ +DI
Sbjct  154   KDFAFENILKVI-RIALMMMPCDKEGCGKQTYVERVISKLPPVFTIAVEWEKN-ETDEDI  211

Query  902   RATLSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKN  729
              AT S LSTEIDIS    Y G     K+ LVS+VC++   Y C+AY  ++  W+++    
Sbjct  212   FATNSVLSTEIDISEIFKYEGDSLFTKYRLVSMVCWHGDQYSCIAY--ENRSWVIHFGIQ  269

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFFE  648
              + IG W+ VL +  + +++P++LFFE
Sbjct  270   NEVIGDWNRVLSIFAELKIRPEILFFE  296



>gb|AAD26868.1|AC007230_2 Contains similarity to F13P17.8 gi|3337355 hypothetical protein 
from Arabidopsis thaliana BAC gb|AC004481. EST gb|AA394560 
comes from this gene [Arabidopsis thaliana]
Length=1159

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGW-KNTCESLDDIRAT  894
             F++++ +      ++CD    GCG +N ++H +   P +FTIV+ W KN  E   DI  T
Sbjct  994   FEDILKMGRMKDGMICDVKTGGCGDINFVHHTISRCPPIFTIVLEWVKNETEK--DISET  1051

Query  893   LSALSTEIDISVPYHGLDPKN-KHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
               AL  EIDIS  Y GL+  N K+ LVS++ C     Y C+AY ++  +W+    + + E
Sbjct  1052  TKALDWEIDISRVYEGLEESNIKYRLVSMIGCVVEGEYICMAYKKN--RWVSLRHEALAE  1109

Query  719   --IGSWDDVLMMCIKGQLQPQVLFFEA  645
               +G+W++V+  C + +++P++LF+EA
Sbjct  1110  EVVGNWNNVVRFCGERKVRPEILFYEA  1136



>ref|NP_176690.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE34331.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1094

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/147 (35%), Positives = 87/147 (59%), Gaps = 9/147 (6%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGW-KNTCESLDDIRAT  894
             F++++ +      ++CD    GCG +N ++H +   P +FTIV+ W KN  E   DI  T
Sbjct  929   FEDILKMGRMKDGMICDVKTGGCGDINFVHHTISRCPPIFTIVLEWVKNETEK--DISET  986

Query  893   LSALSTEIDISVPYHGLDPKN-KHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
               AL  EIDIS  Y GL+  N K+ LVS++ C     Y C+AY ++  +W+    + + E
Sbjct  987   TKALDWEIDISRVYEGLEESNIKYRLVSMIGCVVEGEYICMAYKKN--RWVSLRHEALAE  1044

Query  719   --IGSWDDVLMMCIKGQLQPQVLFFEA  645
               +G+W++V+  C + +++P++LF+EA
Sbjct  1045  EVVGNWNNVVRFCGERKVRPEILFYEA  1071



>gb|AAD26878.1|AC007230_12 T23K8.8 [Arabidopsis thaliana]
Length=270

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 87/157 (55%), Gaps = 8/157 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F++ + ++     + CD +  GCGK N +   +   P VFTI + W++  E+  +I  T
Sbjct  75    TFEKFVQIIRISLKMPCDKE--GCGKRNYVQRMINKLPTVFTIALEWEHN-ETEGEIFDT  131

Query  893   LSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEID+SV   Y G     K+ LVS+VC     Y+CVAY  +  +W+ +     K 
Sbjct  132   TSVLATEIDVSVIYQYEGDSAFTKYRLVSMVCSDGDRYNCVAY--EDNRWVRHVGSQKKV  189

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEAAN*F-CMHGTVL  612
             IG WD VL +  +  ++ ++LFFE  + + C+HG V 
Sbjct  190   IGDWDGVLSIFRELHIRSEILFFENVSSYNCIHGYVF  226



>ref|XP_009130179.1| PREDICTED: uncharacterized protein LOC103854963 [Brassica rapa]
Length=1225

 Score = 92.0 bits (227),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 85/148 (57%), Gaps = 7/148 (5%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ +   +Y ++CD    GCG  NC++H +   P +F IV+ W+ + E+  +I  T 
Sbjct  1077  FVDVLKVTRMNYKMLCDIKTGGCGTSNCVHHVISRCPPIFIIVLEWEKS-ETEKEISETT  1135

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYR--QHYHCVAYSRDHEKWIMYDDKNV--K  723
              AL  EIDIS  Y GL+P     LVS+V Y    + + C+ Y ++  +W+    +++  +
Sbjct  1136  KALEWEIDISRLYEGLEPNTNSRLVSMVGYGEEDEEHICMVYEKN--RWVNLRRESLAGE  1193

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
              + SW  V+  C + +++P++LF+EAA 
Sbjct  1194  VVRSWKSVVRFCGEKKIRPEILFYEAAR  1221



>ref|XP_010470413.1| PREDICTED: uncharacterized protein LOC104750321 isoform X3 [Camelina 
sativa]
Length=311

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FD+++ ++  D  + CD +  GCGK+N +   +   P VFTI + W+N  E L ++  T
Sbjct  160   TFDKILQIIRIDLKMPCDKE--GCGKINYVQRMINKLPTVFTIALEWENN-EPLGELFNT  216

Query  893   LSALSTEIDISVP--YHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEIDI     Y G     K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  217   TSVLTTEIDIKTIYLYEGDSECTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  274

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG W  VL    +  ++P++LFFE
Sbjct  275   IGDWGGVLSKFRELHIRPEILFFE  298



>ref|XP_010462083.1| PREDICTED: uncharacterized protein LOC104742748 isoform X1 [Camelina 
sativa]
Length=1118

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/148 (32%), Positives = 91/148 (61%), Gaps = 6/148 (4%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F +++ ++  +Y   CD +  GCG+ N ++H +   P +FTIV+ W+ + E+  +I  T
Sbjct  971   NFVDILRVICMEYQKSCDIEQGGCGESNFVHHIISRCPPIFTIVLEWEKS-ETEKEISET  1029

Query  893   LSALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNV--K  723
               AL  E+DIS  Y GL+P   + LVS+V C   + + CVAY  ++ +W+    +++  +
Sbjct  1030  TKALDWEMDISRLYVGLEPNTNYRLVSMVGCGEDEEHICVAY--ENNRWVNLKRESLAGE  1087

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEAAN  639
             ++G W+DV+ +  + +++P++LF+EA  
Sbjct  1088  DVGDWNDVISIFGERKVRPEILFYEAVQ  1115



>ref|XP_010470412.1| PREDICTED: uncharacterized protein LOC104750321 isoform X2 [Camelina 
sativa]
Length=313

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FD+++ ++  D  + CD +  GCGK+N +   +   P VFTI + W+N  E L ++  T
Sbjct  160   TFDKILQIIRIDLKMPCDKE--GCGKINYVQRMINKLPTVFTIALEWENN-EPLGELFNT  216

Query  893   LSALSTEIDISVP--YHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEIDI     Y G     K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  217   TSVLTTEIDIKTIYLYEGDSECTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  274

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG W  VL    +  ++P++LFFE
Sbjct  275   IGDWGGVLSKFRELHIRPEILFFE  298



>emb|CCI44338.1| unnamed protein product [Albugo candida]
Length=704

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = -3

Query  1016  DANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDP  837
             D  GC   N     +   P VF + I W     S   ++  LS ++  ID++  +    P
Sbjct  386   DVRGCTGRNIKQRSIHRFPMVFAMSILWATDSASTGQVQQLLSNITNRIDLAKAFDASVP  445

Query  836   ----KNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQ  669
                 +  +HL   VCYY +HY  V YS  H+ W+++DD  V ++G+W+ V+  C+KG+ Q
Sbjct  446   TGAFRTIYHLRGFVCYYGRHYVAVFYSSAHKTWLLFDDSRVLDLGAWNGVVTQCLKGRFQ  505

Query  668   PQVLFFE  648
             P +LF+E
Sbjct  506   PVLLFYE  512



>ref|XP_010470414.1| PREDICTED: uncharacterized protein LOC104750321 isoform X4 [Camelina 
sativa]
Length=310

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FD+++ ++  D  + CD +  GCGK+N +   +   P VFTI + W+N  E L ++  T
Sbjct  160   TFDKILQIIRIDLKMPCDKE--GCGKINYVQRMINKLPTVFTIALEWENN-EPLGELFNT  216

Query  893   LSALSTEIDISVP--YHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEIDI     Y G     K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  217   TSVLTTEIDIKTIYLYEGDSECTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  274

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG W  VL    +  ++P++LFFE
Sbjct  275   IGDWGGVLSKFRELHIRPEILFFE  298



>emb|CDY30684.1| BnaA02g33060D [Brassica napus]
Length=1118

 Score = 91.7 bits (226),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 86/151 (57%), Gaps = 8/151 (5%)
 Frame = -3

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
             +K  F +++ +L  +Y ++CD  + GCG  N ++H +   P +F IV+ W+   E+  +I
Sbjct  970   RKMKFVDVLKVLRMEYKMLCDIKSGGCGTTNFVHHVISRCPPIFIIVLEWEKN-ETEKEI  1028

Query  902   RATLSALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQHYH--CVAYSRDHEKWI-MYDDK  732
               T  AL  EIDIS  Y GL+P   + LVS+V Y  +     C+AY ++  +W+ +  + 
Sbjct  1029  SETTKALEWEIDISRLYEGLEPNTNYRLVSMVGYGEEEREHICMAYEKN--RWVNLRRES  1086

Query  731   NVKEI--GSWDDVLMMCIKGQLQPQVLFFEA  645
                E+   SW +V+  C + ++QP +LF+EA
Sbjct  1087  LAGEVVGNSWKNVVRFCGERKVQPVILFYEA  1117



>ref|XP_010512636.1| PREDICTED: uncharacterized protein LOC104788568 isoform X2 [Camelina 
sativa]
Length=315

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F   + ++  +  ++C+ +  GCGK N + H +   P VFTI   W+N  E+  +I  T
Sbjct  170   TFATTLKIIRLNAKMLCEKE--GCGKRNYVQHMINKLPSVFTIAFEWENN-ETGKEIFDT  226

Query  893   LSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             +S L+T+IDI     Y G  P  K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  227   ISVLATKIDIRKIYKYEGDSPYTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  284

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD VL    +  ++P++LFFE
Sbjct  285   IGDWDGVLNKFRELYIRPEILFFE  308



>ref|XP_009137058.1| PREDICTED: uncharacterized protein LOC103861104 [Brassica rapa]
Length=230

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 82/147 (56%), Gaps = 6/147 (4%)
 Frame = -3

Query  1082  KKRSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDI  903
             K  +F+ ++ ++ R  L++   D  GCGK N +   +   P VF I + W+   E+ +DI
Sbjct  76    KDFAFENILKVI-RIALMMMTCDKEGCGKQNYVERVISKLPAVFAIAVEWEKN-ETEEDI  133

Query  902   RATLSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKN  729
              AT S L+TEIDIS    Y G     K+ LVS+VC +   Y C+AY  ++  W+++    
Sbjct  134   FATTSVLATEIDISEIFKYEGDSLFTKYRLVSMVCCHGDQYSCIAY--ENRSWVIHFGSQ  191

Query  728   VKEIGSWDDVLMMCIKGQLQPQVLFFE  648
              +  G W+ VL +  K +++P++L FE
Sbjct  192   NEVSGDWNRVLSIFAKLKIRPEILLFE  218



>ref|XP_006300300.1| hypothetical protein CARUB_v10019699mg [Capsella rubella]
 gb|EOA33198.1| hypothetical protein CARUB_v10019699mg [Capsella rubella]
Length=1095

 Score = 91.3 bits (225),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/146 (33%), Positives = 83/146 (57%), Gaps = 4/146 (3%)
 Frame = -3

Query  1076  RSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGW-KNTCESLDDIR  900
             R F++++        ++CD    GCG+ N ++H +   P +FT+V+ W KN  E   DI 
Sbjct  939   RKFEDILKATRMKDGIICDIKTGGCGETNFVHHIITRCPPIFTVVLEWVKNETEK--DIF  996

Query  899   ATLSALSTEIDISVPYHGLD-PKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVK  723
              T  AL  EIDIS  Y GL+ P  K+ LVS++      Y C+AY ++    + ++    +
Sbjct  997   ETTKALDWEIDISRLYEGLEEPNIKYRLVSMIGCVEGEYICMAYKKNRWVSLRHEASAEE  1056

Query  722   EIGSWDDVLMMCIKGQLQPQVLFFEA  645
              +G+W +V+  C + +++P++LF+EA
Sbjct  1057  VVGNWKNVIRFCGERKVRPEILFYEA  1082



>emb|CDY16392.1| BnaA02g11960D [Brassica napus]
Length=354

 Score = 89.0 bits (219),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 85/144 (59%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+ ++ ++  + ++ C     GC KL+ ++H + T P VFTI +      E+ ++I AT
Sbjct  174   TFERILKVIKINSMVPCK--TEGCEKLSYVDHIIPTLPSVFTIALE-WENNETEEEILAT  230

Query  893   LSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEIDIS    Y G  P+ K++LVS+VC +   Y CVAY  +  +W++Y     + 
Sbjct  231   TSVLATEIDISEIYKYEGGSPETKYNLVSMVCSHGDQYACVAYFNN--RWVIYFPSEQQV  288

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD V+   I+  ++P +LFFE
Sbjct  289   IGDWDSVINTFIRLNMRPDILFFE  312



>ref|NP_176692.3| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
 gb|AEE34335.1| ubiquitin carboxyl-terminal hydrolase-related protein [Arabidopsis 
thaliana]
Length=1079

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 85/145 (59%), Gaps = 6/145 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F++ + ++  +  ++CD    GCG+ N ++H +   P +FTIV+ W+   E+  +I  T 
Sbjct  936   FEDTLKVIRMNNEMICDVGTGGCGERNLVHHTISRCPPIFTIVLEWEKN-ETEIEIYETT  994

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
             +AL  EIDIS  Y GL+P   + LVS++ C     Y C+AY ++  +W+    +   E  
Sbjct  995   NALHWEIDISRLYEGLEPNTNYRLVSMIGCVEEGEYICMAYEKN--RWVSRRHEASAEEV  1052

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEA  645
             +G+W  V+ +C + +++ +VLF+EA
Sbjct  1053  VGNWKSVVKICGERKIRSEVLFYEA  1077



>ref|XP_010513508.1| PREDICTED: uncharacterized protein LOC104789520 [Camelina sativa]
Length=816

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 88/147 (60%), Gaps = 9/147 (6%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGW-KNTCESLDDIRAT  894
             F++ + ++     ++CD    GCG+ N ++H +   P +FTIV+ W KN  E   +I  T
Sbjct  661   FEDSLKVIRMKDGMICDVKTGGCGETNFVDHTISRCPPIFTIVLEWVKNETEK--EIFET  718

Query  893   LSALSTEIDISVPYHGLDPKN-KHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
               AL  EIDIS  Y GL+  N K+ LVS++ C  +  Y C+AY ++  +W+    + + E
Sbjct  719   TKALDWEIDISRLYEGLEEANIKYRLVSMIGCVEKGEYICMAYKKN--RWVSLRHEALAE  776

Query  719   --IGSWDDVLMMCIKGQLQPQVLFFEA  645
               +G+W++V+  C + +++P++LF+EA
Sbjct  777   EVVGNWNNVIRFCGERKVRPEILFYEA  803



>emb|CDY16395.1| BnaA02g11990D [Brassica napus]
Length=1017

 Score = 90.1 bits (222),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 77/125 (62%), Gaps = 6/125 (5%)
 Frame = -3

Query  1010  NGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKN  831
              GCGK N ++H +   P VFTIV+ W+   E+  +I  T  AL  EID+S  Y GL+P  
Sbjct  890   GGCGKENSVHHIIRRCPPVFTIVLEWEKD-ETEKEISETSKALDWEIDMSRLYEGLEPST  948

Query  830   KHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYD-DKNVKE-IGSWDDVLMMCIKGQLQPQV  660
             K+ LVS+V C   + Y C+AY +  ++WI +    + KE +G+W+ V   C + +++P++
Sbjct  949   KYRLVSMVGCGEEEEYICLAYKK--KRWIKFSLGASAKEVVGNWNSVARFCGERKVRPEI  1006

Query  659   LFFEA  645
             LF++A
Sbjct  1007  LFYKA  1011



>ref|XP_010512408.1| PREDICTED: uncharacterized protein LOC104788352 [Camelina sativa]
Length=314

 Score = 87.4 bits (215),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +FD+++ ++  D  + CD +  GCGK N +   +   P VFTI + W+N  E L ++  T
Sbjct  160   TFDKILQIIRVDLKMPCDKE--GCGKRNYVQRMINKLPTVFTIALEWEND-EPLGELFDT  216

Query  893   LSALSTEIDISVP--YHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L+TEID+     Y G     K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  217   TSVLTTEIDMKTIYLYEGDTAFTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  274

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD V+    +  ++P++LFFE
Sbjct  275   IGDWDGVVRKFRELHIRPEILFFE  298



>ref|XP_010512635.1| PREDICTED: uncharacterized protein LOC104788568 isoform X1 [Camelina 
sativa]
Length=511

 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 85/148 (57%), Gaps = 8/148 (5%)
 Frame = -3

Query  1076  RSFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRA  897
             R+F+  + ++  +  ++CD +  GCGK N +   +   P VFTI + W+N  E+  DI +
Sbjct  30    RAFETTLKIIRLNVKMLCDKE--GCGKRNYVQRVINNLPTVFTIALQWENN-ETSCDIFS  86

Query  896   TLSALSTEIDISV--PYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVK  723
             T++AL TEI IS    Y G     K+ LVS+ C +   Y+C+AY  ++ +W+ Y     +
Sbjct  87    TVAALETEICISAICRYEGDSLYTKYRLVSMACSHGDQYNCIAY--ENSRWVRYFGSEKE  144

Query  722   EIGSWDDVLMMCIK-GQLQPQVLFFEAA  642
              IG W  V+ + +    ++P++LFFE+A
Sbjct  145   VIGDWKSVVNIFVTHDNIRPEILFFESA  172


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 81/144 (56%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F   + ++  +  ++C+ +  GCGK N + H +   P VFTI   W+N  E+  +I  T
Sbjct  366   TFATTLKIIRLNAKMLCEKE--GCGKRNYVQHMINKLPSVFTIAFEWENN-ETGKEIFDT  422

Query  893   LSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
             +S L+T+IDI     Y G  P  K+ LVS+VC +   Y+CVAY  ++  W+ +     + 
Sbjct  423   ISVLATKIDIRKIYKYEGDSPYTKYRLVSMVCSHGDGYNCVAY--ENNGWVRHFRSEKEV  480

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD VL    +  ++P++LFFE
Sbjct  481   IGDWDGVLNKFRELYIRPEILFFE  504



>ref|XP_002879149.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55408.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1084

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 85/145 (59%), Gaps = 3/145 (2%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +Y ++CD    GCG  N ++H +   P +F IV+ W+ + ++  +I  T 
Sbjct  936   FVDILKVIQMEYKMLCDVKTGGCGITNFVHHIISKCPPIFIIVLEWEKS-DTEKEIFDTT  994

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYH-CVAYSRDHEKWIMYDDKNVKEI  717
              AL  EIDIS  Y GL+PK  + LVS+V C   +  H C+ Y ++    +  D    +++
Sbjct  995   KALDWEIDISRLYEGLEPKTNYRLVSMVGCGEEEAEHVCIVYEKNCWVNLRRDALTGEDV  1054

Query  716   GSWDDVLMMCIKGQLQPQVLFFEAA  642
             G+W  V+  C + +++P++LF+EAA
Sbjct  1055  GNWKSVVKFCGEKKVRPEILFYEAA  1079



>ref|XP_006301514.1| hypothetical protein CARUB_v10021940mg [Capsella rubella]
 gb|EOA34412.1| hypothetical protein CARUB_v10021940mg [Capsella rubella]
Length=1121

 Score = 90.1 bits (222),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 81/145 (56%), Gaps = 6/145 (4%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             F +++ ++  +  ++C+    GCGK N +   +   P +FTIV+ W+   ES  +I  TL
Sbjct  969   FADIIKVIRLEDKMLCNIKTRGCGKANFVRRIISRSPPIFTIVLEWEKN-ESKKEISETL  1027

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVV-CYYRQHYHCVAYSRDHEKWIMYDDKNVKE--  720
              AL  EID S  Y G++   K+ LVS++ C     Y C+AY ++  +W+      + E  
Sbjct  1028  KALDWEIDFSRLYEGIESNTKYRLVSMIGCDEEGEYICMAYKKN--RWVSLRHGTLAEEV  1085

Query  719   IGSWDDVLMMCIKGQLQPQVLFFEA  645
             +G W  V+  C + +++P++LF+EA
Sbjct  1086  VGKWKSVVRFCGEWRVRPEILFYEA  1110



>ref|XP_009127442.1| PREDICTED: uncharacterized protein LOC103852285 [Brassica rapa]
Length=321

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 84/144 (58%), Gaps = 7/144 (5%)
 Frame = -3

Query  1073  SFDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRAT  894
             +F+ ++ ++  + ++ C     GC KL+ ++H + T P VFTI +      E+ ++I AT
Sbjct  141   TFERILKVIKINSMVPCK--TEGCEKLSYVDHVIPTLPSVFTIALE-WENNETEEEILAT  197

Query  893   LSALSTEIDIS--VPYHGLDPKNKHHLVSVVCYYRQHYHCVAYSRDHEKWIMYDDKNVKE  720
              S L TEIDIS    Y G  P+ K++LVS+VC +   Y CVAY  +  +W++Y     + 
Sbjct  198   TSVLVTEIDISEIYKYEGGSPETKYNLVSMVCSHGDQYACVAYLNN--RWLIYFPSEQQV  255

Query  719   IGSWDDVLMMCIKGQLQPQVLFFE  648
             IG WD V+   I+  ++P +LFFE
Sbjct  256   IGDWDSVINTFIRLNMRPDILFFE  279



>gb|KFK44967.1| hypothetical protein AALP_AA1G326800 [Arabis alpina]
Length=1777

 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 89/165 (54%), Gaps = 17/165 (10%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD+++ +   +  ++C+     CGK N ++  + T P +FTIV+ W    E+ ++   T 
Sbjct  848   FDDILKMTRMEDKMLCE-----CGKANFVHRSMSTCPFIFTIVLKWVKD-ETEEESSDTT  901

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQH-YHCVAYSRDHEKWIMYDDKNVKE--  720
              AL +EIDIS  Y G+ P   + LVS+VCY  +  Y+C+AY  +   W    D+ + E  
Sbjct  902   KALDSEIDISKLYEGVKPNTIYQLVSMVCYGEEEGYNCLAYKMNQ--WFSLKDEALLEEG  959

Query  719   -IGSWDDVLMMCIKGQLQPQVLFFEAAN*FCMHGTVLLVSSTIFY  588
              +G W+DV+  C + +++P++LF+E        G  L   +  FY
Sbjct  960   LVGDWEDVVRFCKERKVRPEILFYEDP-----EGKELFERAKSFY  999


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 8/121 (7%)
 Frame = -3

Query  1004  CGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKH  825
             CGK N ++  + T P +FTIV+ W    E+ ++I  T  AL  EIDIS  Y GL P  K+
Sbjct  1659  CGKANFVHRIMTTCPFIFTIVLEWVKD-ETAEEISETAKALDREIDISKIYEGLKPNTKY  1717

Query  824   HLVSVVCYYRQH-YHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
              LVS+V Y  +  Y C+A   +  KW    +     +G W DV+  C+  +++P++LF+E
Sbjct  1718  RLVSMVGYGEEEGYICLACKTN--KWFCLKEG----VGDWKDVVRFCVDRKVRPEILFYE  1771

Query  647   A  645
             A
Sbjct  1772  A  1772



>gb|KFK44968.1| hypothetical protein AALP_AA1G326800 [Arabis alpina]
Length=1802

 Score = 89.7 bits (221),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 52/165 (32%), Positives = 89/165 (54%), Gaps = 17/165 (10%)
 Frame = -3

Query  1070  FDELMNLLLRDYLLVCDPDANGCGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATL  891
             FD+++ +   +  ++C+     CGK N ++  + T P +FTIV+ W    E+ ++   T 
Sbjct  873   FDDILKMTRMEDKMLCE-----CGKANFVHRSMSTCPFIFTIVLKWVKD-ETEEESSDTT  926

Query  890   SALSTEIDISVPYHGLDPKNKHHLVSVVCYYRQH-YHCVAYSRDHEKWIMYDDKNVKE--  720
              AL +EIDIS  Y G+ P   + LVS+VCY  +  Y+C+AY  +   W    D+ + E  
Sbjct  927   KALDSEIDISKLYEGVKPNTIYQLVSMVCYGEEEGYNCLAYKMNQ--WFSLKDEALLEEG  984

Query  719   -IGSWDDVLMMCIKGQLQPQVLFFEAAN*FCMHGTVLLVSSTIFY  588
              +G W+DV+  C + +++P++LF+E        G  L   +  FY
Sbjct  985   LVGDWEDVVRFCKERKVRPEILFYEDP-----EGKELFERAKSFY  1024


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 69/121 (57%), Gaps = 8/121 (7%)
 Frame = -3

Query  1004  CGKLNCINHFLLTPPHVFTIVIGWKNTCESLDDIRATLSALSTEIDISVPYHGLDPKNKH  825
             CGK N ++  + T P +FTIV+ W    E+ ++I  T  AL  EIDIS  Y GL P  K+
Sbjct  1684  CGKANFVHRIMTTCPFIFTIVLEWVKD-ETAEEISETAKALDREIDISKIYEGLKPNTKY  1742

Query  824   HLVSVVCYYRQH-YHCVAYSRDHEKWIMYDDKNVKEIGSWDDVLMMCIKGQLQPQVLFFE  648
              LVS+V Y  +  Y C+A   +  KW    +     +G W DV+  C+  +++P++LF+E
Sbjct  1743  RLVSMVGYGEEEGYICLACKTN--KWFCLKEG----VGDWKDVVRFCVDRKVRPEILFYE  1796

Query  647   A  645
             A
Sbjct  1797  A  1797



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3109165223906