BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21704_g1_i1 len=1828 path=[199:0-856 3987:857-857 3993:858-859
1057:860-1330 3885:1331-1412 1528:1413-1827]

Length=1828
                                                                      Score     E

ref|XP_009348736.1|  PREDICTED: uncharacterized protein At2g29880...    242   5e-69   
ref|XP_008351512.1|  PREDICTED: uncharacterized protein LOC103414933    241   1e-68   
ref|XP_007028029.1|  Uncharacterized protein isoform 2                  241   1e-68   
ref|XP_007028028.1|  Uncharacterized protein isoform 1                  241   3e-68   
ref|XP_007204813.1|  hypothetical protein PRUPE_ppa026716mg             238   1e-67   
ref|XP_010278191.1|  PREDICTED: uncharacterized protein LOC104612473    157   1e-67   
ref|XP_007028030.1|  Uncharacterized protein isoform 3                  234   1e-67   
ref|XP_008241090.1|  PREDICTED: uncharacterized protein LOC103339...    238   2e-67   
ref|XP_008241091.1|  PREDICTED: uncharacterized protein LOC103339...    235   1e-66   
ref|XP_008379252.1|  PREDICTED: uncharacterized protein LOC103442253    162   1e-64   
ref|XP_008220650.1|  PREDICTED: uncharacterized protein LOC103320717    157   9e-64   
ref|XP_007221952.1|  hypothetical protein PRUPE_ppa001711mg             156   3e-63   
ref|XP_010548574.1|  PREDICTED: uncharacterized protein LOC104819...    170   5e-63   
gb|KDP23537.1|  hypothetical protein JCGZ_23370                         155   8e-63   
ref|XP_009363470.1|  PREDICTED: uncharacterized protein LOC103953458    153   1e-62   
emb|CBI21156.3|  unnamed protein product                                162   1e-62   
ref|XP_006483530.1|  PREDICTED: uncharacterized protein LOC102618...    165   1e-62   
ref|XP_006483529.1|  PREDICTED: uncharacterized protein LOC102618...    165   2e-62   
gb|KDO67404.1|  hypothetical protein CISIN_1g045211mg                   165   2e-62   
ref|XP_006450261.1|  hypothetical protein CICLE_v10010556mg             165   2e-62   
ref|XP_006483531.1|  PREDICTED: uncharacterized protein LOC102618...    165   2e-62   
ref|XP_008452827.1|  PREDICTED: uncharacterized protein LOC103493736    162   3e-62   
ref|XP_002309683.2|  hypothetical protein POPTR_0006s28170g             160   3e-62   Populus trichocarpa [western balsam poplar]
ref|XP_002515411.1|  conserved hypothetical protein                     164   3e-62   Ricinus communis
emb|CAN79208.1|  hypothetical protein VITISV_025934                     159   8e-62   Vitis vinifera
ref|XP_010648765.1|  PREDICTED: uncharacterized protein LOC100266462    147   1e-61   
gb|KHG17660.1|  hypothetical protein F383_05320                         158   2e-61   
ref|XP_011031427.1|  PREDICTED: uncharacterized protein LOC105130...    157   3e-61   
ref|XP_011031426.1|  PREDICTED: uncharacterized protein LOC105130...    157   3e-61   
ref|XP_007145773.1|  hypothetical protein PHAVU_007G266500g             221   4e-61   
gb|KGN55417.1|  hypothetical protein Csa_4G651830                       155   5e-61   
ref|XP_002512353.1|  hypothetical protein RCOM_1431030                  154   6e-61   Ricinus communis
ref|XP_010049859.1|  PREDICTED: uncharacterized protein LOC104438410    161   1e-60   
ref|XP_007011690.1|  Uncharacterized protein TCM_036890                 157   2e-60   
gb|KCW82661.1|  hypothetical protein EUGRSUZ_C04039                     160   3e-60   
ref|XP_004145581.1|  PREDICTED: uncharacterized protein LOC101212813    152   2e-59   
gb|KDP33499.1|  hypothetical protein JCGZ_07070                         162   6e-59   
ref|XP_011081984.1|  PREDICTED: uncharacterized protein LOC105164...    152   1e-58   
ref|XP_011081985.1|  PREDICTED: uncharacterized protein LOC105164...    152   1e-58   
gb|KHN29638.1|  Hypothetical protein glysoja_016260                     161   1e-58   
ref|XP_006578110.1|  PREDICTED: uncharacterized protein LOC100813...    160   2e-58   
ref|XP_010278767.1|  PREDICTED: uncharacterized protein LOC104612...    144   3e-58   
ref|XP_008246500.1|  PREDICTED: uncharacterized protein LOC103344...    146   3e-58   
ref|XP_010278768.1|  PREDICTED: uncharacterized protein LOC104612...    143   3e-58   
ref|XP_010278766.1|  PREDICTED: uncharacterized protein LOC104612...    143   3e-58   
ref|XP_008246499.1|  PREDICTED: uncharacterized protein LOC103344...    146   3e-58   
ref|XP_010274349.1|  PREDICTED: uncharacterized protein LOC104609...    213   4e-58   
emb|CDY66941.1|  BnaA04g28320D                                          154   7e-58   
emb|CDY36147.1|  BnaC04g37470D                                          154   7e-58   
ref|NP_180068.1|  uncharacterized protein                               154   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001118381.1|  uncharacterized protein                            154   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006295713.1|  hypothetical protein CARUB_v10024832mg             151   2e-57   
ref|XP_009140602.1|  PREDICTED: uncharacterized protein LOC103864591    152   2e-57   
ref|XP_010274346.1|  PREDICTED: uncharacterized protein LOC104609...    210   3e-57   
ref|XP_010548576.1|  PREDICTED: uncharacterized protein LOC104819...    146   7e-57   
ref|XP_006588882.1|  PREDICTED: uncharacterized protein LOC100798...    209   9e-57   
ref|XP_006588880.1|  PREDICTED: uncharacterized protein LOC100798...    208   2e-56   
ref|XP_006405068.1|  hypothetical protein EUTSA_v10000052mg             150   3e-56   
gb|KHN37754.1|  hypothetical protein glysoja_043783                     208   3e-56   
ref|XP_002280955.3|  PREDICTED: uncharacterized protein LOC100245953    140   6e-56   Vitis vinifera
emb|CBI36750.3|  unnamed protein product                                140   7e-56   
ref|XP_007136933.1|  hypothetical protein PHAVU_009G086300g             152   7e-56   
ref|XP_006588878.1|  PREDICTED: uncharacterized protein LOC100798...    208   8e-56   
gb|KHG06400.1|  hypothetical protein F383_09497                         139   1e-55   
ref|XP_010243132.1|  PREDICTED: uncharacterized protein LOC104587...    142   1e-55   
ref|XP_010417250.1|  PREDICTED: uncharacterized protein LOC104703...    146   2e-55   
ref|XP_010417251.1|  PREDICTED: uncharacterized protein LOC104703...    146   2e-55   
ref|XP_010243130.1|  PREDICTED: uncharacterized protein LOC104587...    141   3e-55   
gb|EYU22000.1|  hypothetical protein MIMGU_mgv1a001545mg                140   3e-55   
ref|XP_010429484.1|  PREDICTED: uncharacterized protein LOC104713...    148   6e-55   
ref|XP_010429483.1|  PREDICTED: uncharacterized protein LOC104713...    148   7e-55   
emb|CAN61085.1|  hypothetical protein VITISV_041918                     137   8e-55   Vitis vinifera
ref|XP_010549953.1|  PREDICTED: uncharacterized protein LOC104820...    129   5e-54   
ref|XP_010549970.1|  PREDICTED: uncharacterized protein LOC104820...    128   5e-54   
ref|XP_010549978.1|  PREDICTED: uncharacterized protein LOC104820...    128   6e-54   
ref|XP_007206452.1|  hypothetical protein PRUPE_ppa018255mg             134   1e-53   
ref|XP_004497637.1|  PREDICTED: uncharacterized protein LOC101498...    205   1e-53   
ref|XP_004497635.1|  PREDICTED: uncharacterized protein LOC101498...    205   2e-53   
gb|KHN35917.1|  hypothetical protein glysoja_037803                     201   7e-53   
ref|XP_006575275.1|  PREDICTED: uncharacterized protein LOC100806...    199   1e-52   
ref|XP_010556713.1|  PREDICTED: uncharacterized protein At2g29880...    128   5e-52   
ref|XP_010556715.1|  PREDICTED: uncharacterized protein At2g29880...    128   5e-52   
gb|KEH41857.1|  Myb/SANT-like DNA-binding domain protein                199   9e-52   
ref|XP_010556714.1|  PREDICTED: uncharacterized protein At2g29880...    125   2e-51   
ref|XP_010556717.1|  PREDICTED: uncharacterized protein At2g29880...    128   3e-51   
ref|XP_006575274.1|  PREDICTED: uncharacterized protein LOC100806...    192   3e-50   
gb|KDO59524.1|  hypothetical protein CISIN_1g002555mg                   127   2e-48   
gb|KDO87097.1|  hypothetical protein CISIN_1g009421mg                   122   2e-48   
gb|KDO59523.1|  hypothetical protein CISIN_1g002555mg                   127   3e-48   
gb|KDO59522.1|  hypothetical protein CISIN_1g002555mg                   127   4e-48   
ref|XP_006396427.1|  hypothetical protein EUTSA_v10028655mg             125   4e-48   
ref|XP_006433278.1|  hypothetical protein CICLE_v10000218mg             127   4e-48   
ref|XP_007030898.1|  Uncharacterized protein isoform 7                  130   3e-47   
ref|XP_007030897.1|  Uncharacterized protein isoform 6                  130   3e-47   
ref|XP_007030895.1|  Uncharacterized protein isoform 4                  130   3e-47   
ref|XP_011023569.1|  PREDICTED: uncharacterized protein LOC105125008    110   4e-46   
ref|XP_010429383.1|  PREDICTED: uncharacterized protein LOC104713...    116   2e-45   
ref|XP_010429375.1|  PREDICTED: uncharacterized protein LOC104713...    116   2e-45   
gb|KHN20378.1|  hypothetical protein glysoja_039676                     124   6e-45   
ref|XP_003520746.1|  PREDICTED: uncharacterized protein LOC100787...    125   1e-44   
ref|XP_007030894.1|  Uncharacterized protein isoform 3                  125   1e-44   
ref|XP_007030893.1|  Uncharacterized protein isoform 2                  125   2e-44   
ref|XP_007030892.1|  Uncharacterized protein isoform 1                  125   2e-44   
ref|XP_002319555.2|  hypothetical protein POPTR_0013s02600g             119   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006375772.1|  hypothetical protein POPTR_0013s02600g             118   9e-44   
ref|XP_006588881.1|  PREDICTED: uncharacterized protein LOC100798...    169   3e-43   
ref|XP_006581328.1|  PREDICTED: uncharacterized protein LOC102665...    154   2e-41   
ref|XP_006581326.1|  PREDICTED: uncharacterized protein LOC102665...    153   2e-41   
ref|XP_006581327.1|  PREDICTED: uncharacterized protein LOC102665...    154   3e-41   
gb|KHN07011.1|  hypothetical protein glysoja_023194                     153   4e-41   
emb|CAN79665.1|  hypothetical protein VITISV_038207                     120   3e-40   Vitis vinifera
ref|XP_002319557.2|  hypothetical protein POPTR_0013s02610g             105   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010549994.1|  PREDICTED: uncharacterized protein LOC104820...    102   2e-38   
gb|KGN66102.1|  hypothetical protein Csa_1G570760                       131   2e-38   
ref|XP_007030896.1|  Uncharacterized protein isoform 5                  159   2e-38   
ref|XP_010550004.1|  PREDICTED: uncharacterized protein LOC104820...    101   2e-38   
ref|XP_010549988.1|  PREDICTED: uncharacterized protein LOC104820...    101   3e-38   
ref|XP_008370507.1|  PREDICTED: uncharacterized protein LOC103433971    110   6e-38   
ref|XP_007051025.1|  Uncharacterized protein isoform 1                  156   1e-37   
ref|XP_008450682.1|  PREDICTED: uncharacterized protein LOC103492...    128   1e-37   
ref|XP_008450681.1|  PREDICTED: uncharacterized protein LOC103492...    128   1e-37   
ref|XP_008359531.1|  PREDICTED: uncharacterized protein LOC103423241    149   3e-37   
gb|KHG22508.1|  hypothetical protein F383_28776                         153   3e-37   
ref|XP_008387127.1|  PREDICTED: uncharacterized protein LOC103449...    143   3e-36   
gb|KHG08380.1|  hypothetical protein F383_35832                         148   4e-36   
ref|XP_008387125.1|  PREDICTED: uncharacterized protein LOC103449...    143   6e-36   
ref|XP_007201020.1|  hypothetical protein PRUPE_ppa005589mg             149   1e-35   
ref|XP_006480027.1|  PREDICTED: uncharacterized protein LOC102620...    149   2e-35   
emb|CBI36907.3|  unnamed protein product                                146   4e-35   
ref|XP_010103403.1|  hypothetical protein L484_007472                   147   4e-35   
gb|KHG22507.1|  hypothetical protein F383_28775                         143   7e-35   
gb|KHG01346.1|  hypothetical protein F383_21691                         143   8e-35   
ref|XP_006444433.1|  hypothetical protein CICLE_v10019662mg             147   9e-35   
ref|XP_002523138.1|  conserved hypothetical protein                     146   1e-34   Ricinus communis
gb|KHG01347.1|  hypothetical protein F383_21692                         123   1e-34   
ref|XP_007224304.1|  hypothetical protein PRUPE_ppa020132mg             101   4e-34   
ref|XP_009348752.1|  PREDICTED: uncharacterized protein At2g29880...    143   6e-34   
ref|XP_008345684.1|  PREDICTED: uncharacterized protein LOC103408624    142   9e-34   
ref|XP_008451523.1|  PREDICTED: uncharacterized protein LOC103492784    144   1e-33   
ref|XP_011007802.1|  PREDICTED: uncharacterized protein LOC105113349    144   1e-33   
ref|XP_004136161.1|  PREDICTED: uncharacterized protein LOC101220968    144   2e-33   
ref|XP_004291373.1|  PREDICTED: uncharacterized protein LOC101310774  99.4    4e-33   
ref|XP_002301492.2|  hypothetical protein POPTR_0002s20170g             141   5e-33   Populus trichocarpa [western balsam poplar]
gb|KGN44981.1|  hypothetical protein Csa_7G405870                       140   2e-32   
ref|XP_008235166.1|  PREDICTED: uncharacterized protein LOC103334021    139   4e-32   
ref|XP_008221408.1|  PREDICTED: uncharacterized protein LOC103321390  95.1    4e-32   
ref|XP_007163153.1|  hypothetical protein PHAVU_001G210700g             139   4e-32   
ref|XP_008369078.1|  PREDICTED: uncharacterized protein LOC103432...    136   1e-31   
ref|XP_004513955.1|  PREDICTED: uncharacterized protein LOC101500...  95.5    3e-31   
ref|XP_006480028.1|  PREDICTED: uncharacterized protein LOC102620...    135   4e-31   
gb|KDO87096.1|  hypothetical protein CISIN_1g009421mg                   135   4e-31   
ref|XP_008345617.1|  PREDICTED: uncharacterized protein LOC103408553    134   5e-31   
ref|XP_002269324.1|  PREDICTED: uncharacterized protein At2g29880       136   5e-31   Vitis vinifera
ref|XP_008369077.1|  PREDICTED: uncharacterized protein LOC103432...    135   6e-31   
ref|XP_008369076.1|  PREDICTED: uncharacterized protein LOC103432...    136   6e-31   
ref|XP_010247462.1|  PREDICTED: uncharacterized protein LOC104590478  95.1    6e-31   
ref|XP_007051026.1|  Uncharacterized protein isoform 2                  134   8e-31   
ref|XP_010104516.1|  hypothetical protein L484_025489                   133   8e-31   
ref|XP_006444434.1|  hypothetical protein CICLE_v10019662mg             135   2e-30   
emb|CAN71765.1|  hypothetical protein VITISV_026917                     136   4e-30   Vitis vinifera
ref|XP_007146152.1|  hypothetical protein PHAVU_006G016600g             103   5e-30   
ref|XP_008392051.1|  PREDICTED: uncharacterized protein LOC103454236    126   6e-30   
ref|XP_007146151.1|  hypothetical protein PHAVU_006G016600g             103   6e-30   
ref|XP_006583985.1|  PREDICTED: uncharacterized protein LOC100785...    103   7e-30   
ref|XP_006583986.1|  PREDICTED: uncharacterized protein LOC100785...    103   1e-29   
gb|KHN28185.1|  Hypothetical protein glysoja_024003                     103   1e-29   
ref|XP_006583988.1|  PREDICTED: uncharacterized protein LOC100785...    103   1e-29   
ref|XP_003529492.2|  PREDICTED: uncharacterized protein LOC100785...    103   1e-29   
ref|XP_004513956.1|  PREDICTED: uncharacterized protein LOC101500...  95.5    2e-29   
ref|XP_010664794.1|  PREDICTED: uncharacterized protein LOC100259109  80.9    4e-29   
ref|XP_009144586.1|  PREDICTED: uncharacterized protein LOC103868226    129   5e-29   
ref|XP_008367355.1|  PREDICTED: uncharacterized protein LOC103430986    122   5e-29   
emb|CDX97259.1|  BnaA02g20500D                                          129   8e-29   
emb|CDY01920.1|  BnaC02g28070D                                          129   9e-29   
ref|XP_006289855.1|  hypothetical protein CARUB_v10003465mg             125   2e-27   
ref|XP_010254519.1|  PREDICTED: uncharacterized protein LOC104595...  80.1    3e-27   
gb|KEH33535.1|  Myb/SANT-like DNA-binding domain protein              89.7    8e-27   
gb|KEH33536.1|  Myb/SANT-like DNA-binding domain protein              92.4    4e-26   
ref|XP_011079607.1|  PREDICTED: uncharacterized protein LOC105163085    122   4e-26   
ref|XP_010243131.1|  PREDICTED: uncharacterized protein LOC104587...    122   7e-26   
gb|AAC78711.1|  hypothetical protein                                    119   9e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAN79210.1|  hypothetical protein VITISV_025936                     117   1e-25   Vitis vinifera
ref|XP_007015359.1|  Uncharacterized protein TCM_040985               80.9    1e-25   
gb|AAK93640.1|  unknown protein                                         119   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567224.1|  uncharacterized protein                               119   1e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KDP28208.1|  hypothetical protein JCGZ_13979                         120   2e-25   
ref|XP_010069880.1|  PREDICTED: uncharacterized protein LOC104456727    120   2e-25   
ref|XP_006604733.1|  PREDICTED: uncharacterized protein LOC100816...    114   2e-25   
ref|XP_010456065.1|  PREDICTED: uncharacterized protein LOC104737...    118   4e-25   
ref|XP_010474449.1|  PREDICTED: uncharacterized protein At2g29880...    118   7e-25   
ref|XP_006581325.1|  PREDICTED: uncharacterized protein LOC100777826    117   7e-25   
ref|XP_010422621.1|  PREDICTED: uncharacterized protein LOC104707...    116   1e-24   
emb|CBI19844.3|  unnamed protein product                              79.7    2e-24   
ref|XP_010254523.1|  PREDICTED: uncharacterized protein LOC104595...  80.1    3e-23   
gb|EYU46769.1|  hypothetical protein MIMGU_mgv1a005302mg                109   4e-22   
ref|XP_008370506.1|  PREDICTED: uncharacterized protein At2g29880...    107   6e-22   
ref|XP_006604735.1|  PREDICTED: uncharacterized protein LOC100816...    103   1e-21   
ref|XP_006604734.1|  PREDICTED: uncharacterized protein LOC100816...    103   1e-21   
gb|KHN43484.1|  hypothetical protein glysoja_002067                     104   4e-21   
ref|XP_006855092.1|  hypothetical protein AMTR_s00031p00170040        89.4    7e-21   
gb|KEH34780.1|  Myb/SANT-like DNA-binding domain protein              66.2    1e-20   
gb|AES71102.2|  Myb/SANT-like DNA-binding domain protein              66.2    1e-20   
ref|XP_003600851.1|  hypothetical protein MTR_3g070080                66.2    1e-20   
ref|XP_006841437.1|  hypothetical protein AMTR_s00003p00059470        76.6    3e-19   
ref|XP_010266333.1|  PREDICTED: cell cycle checkpoint protein RAD17     100   1e-18   
ref|XP_011015848.1|  PREDICTED: uncharacterized protein LOC105119409  96.7    2e-18   
ref|XP_010647019.1|  PREDICTED: uncharacterized protein At2g29880...  95.1    5e-18   
ref|XP_007041888.1|  Uncharacterized protein TCM_006656               94.0    1e-17   
emb|CDY66940.1|  BnaA04g28310D                                        92.8    2e-17   
ref|XP_010269912.1|  PREDICTED: uncharacterized protein LOC104606...  86.7    2e-17   
ref|XP_010269913.1|  PREDICTED: uncharacterized protein LOC104606...  86.7    2e-17   
ref|XP_010269914.1|  PREDICTED: uncharacterized protein LOC104606...  86.7    2e-17   
emb|CAN62558.1|  hypothetical protein VITISV_009206                   89.0    6e-17   Vitis vinifera
ref|XP_006855095.1|  hypothetical protein AMTR_s00031p00171740        79.7    6e-17   
ref|XP_010266818.1|  PREDICTED: uncharacterized protein At2g29880...  91.7    8e-17   
emb|CDP09648.1|  unnamed protein product                              93.6    8e-17   
ref|XP_006380548.1|  hypothetical protein POPTR_0007s08950g           91.3    9e-17   
ref|XP_002532700.1|  conserved hypothetical protein                   91.3    1e-16   Ricinus communis
gb|ACU19592.1|  unknown                                               90.9    1e-16   Glycine max [soybeans]
gb|KDP29623.1|  hypothetical protein JCGZ_18785                       90.5    1e-16   
ref|XP_010649279.1|  PREDICTED: cell cycle checkpoint protein RAD17   86.7    2e-16   
emb|CBI17340.3|  unnamed protein product                              86.7    2e-16   
ref|XP_006836181.1|  hypothetical protein AMTR_s00101p00062870        80.5    2e-16   
ref|XP_010090316.1|  hypothetical protein L484_024981                 90.1    2e-16   
ref|XP_010059455.1|  PREDICTED: uncharacterized protein LOC104447415  88.6    4e-16   
gb|KCW74901.1|  hypothetical protein EUGRSUZ_E03640                   88.2    5e-16   
ref|XP_006422637.1|  hypothetical protein CICLE_v10028943mg           88.6    7e-16   
ref|XP_006486766.1|  PREDICTED: uncharacterized protein At2g29880...  88.6    7e-16   
ref|XP_003612211.1|  hypothetical protein MTR_5g022570                88.6    8e-16   
ref|XP_010068404.1|  PREDICTED: uncharacterized protein LOC104455287  86.7    8e-16   
gb|KCW86084.1|  hypothetical protein EUGRSUZ_B02784                   87.8    1e-15   
ref|XP_007046644.1|  Radiation sensitive 17, putative                 83.6    1e-15   
ref|XP_006836060.1|  hypothetical protein AMTR_s00114p00089730        71.2    2e-15   
gb|KCW45759.1|  hypothetical protein EUGRSUZ_L00423                   87.4    2e-15   
ref|XP_011001991.1|  PREDICTED: uncharacterized protein At2g29880...  86.7    3e-15   
ref|XP_002305504.2|  hypothetical protein POPTR_0004s17870g           86.3    3e-15   Populus trichocarpa [western balsam poplar]
ref|XP_006847615.1|  hypothetical protein AMTR_s00014p00247240        75.9    4e-15   
ref|XP_010040478.1|  PREDICTED: uncharacterized protein LOC104429300  85.5    7e-15   
ref|XP_008865885.1|  hypothetical protein H310_03701                  84.0    9e-15   
ref|XP_010038886.1|  PREDICTED: uncharacterized protein LOC104427494  84.0    1e-14   
ref|XP_010059244.1|  PREDICTED: uncharacterized protein LOC104447172  84.0    1e-14   
ref|XP_011099874.1|  PREDICTED: uncharacterized protein LOC105178...  81.3    1e-14   
ref|XP_011099875.1|  PREDICTED: uncharacterized protein LOC105178...  81.3    1e-14   
ref|XP_011099876.1|  PREDICTED: uncharacterized protein LOC105178...  81.3    1e-14   
gb|KCW65848.1|  hypothetical protein EUGRSUZ_G03193                   84.3    2e-14   
ref|XP_003538883.1|  PREDICTED: uncharacterized protein LOC100808608  84.3    2e-14   
ref|XP_010050617.1|  PREDICTED: uncharacterized protein LOC104439217  84.3    2e-14   
ref|XP_002999199.1|  conserved hypothetical protein                   72.0    2e-14   
ref|XP_009793592.1|  PREDICTED: uncharacterized protein LOC104240448  84.7    2e-14   
ref|XP_003527525.1|  PREDICTED: uncharacterized protein LOC100810618  84.3    2e-14   
emb|CDP01870.1|  unnamed protein product                              77.0    2e-14   
ref|XP_009837858.1|  hypothetical protein H257_12380                  84.0    2e-14   
ref|XP_004230089.1|  PREDICTED: uncharacterized protein LOC101259373  84.3    2e-14   
ref|XP_006347741.1|  PREDICTED: uncharacterized protein LOC102581412  84.3    3e-14   
ref|XP_010067670.1|  PREDICTED: uncharacterized protein LOC104454505  83.6    3e-14   
ref|XP_010027108.1|  PREDICTED: uncharacterized protein LOC104417550  83.6    3e-14   
gb|AFK47882.1|  unknown                                               83.6    3e-14   
ref|XP_006844614.1|  hypothetical protein AMTR_s00016p00221080        84.0    3e-14   
ref|XP_010041986.1|  PREDICTED: uncharacterized protein LOC104430983  82.0    4e-14   
gb|KCW80371.1|  hypothetical protein EUGRSUZ_C01733                   82.4    4e-14   
ref|XP_006432350.1|  hypothetical protein CICLE_v10001966mg           83.2    4e-14   
ref|XP_010050743.1|  PREDICTED: uncharacterized protein LOC104439364  82.8    4e-14   
ref|XP_008793930.1|  PREDICTED: uncharacterized protein LOC103710...  75.1    4e-14   
ref|XP_006573546.1|  PREDICTED: uncharacterized protein LOC102661909  83.2    4e-14   
ref|XP_008793928.1|  PREDICTED: uncharacterized protein LOC103710...  75.1    4e-14   
ref|XP_008793929.1|  PREDICTED: uncharacterized protein LOC103710...  74.7    5e-14   
gb|KDO39637.1|  hypothetical protein CISIN_1g021965mg                 82.8    5e-14   
gb|AET02503.2|  Myb/SANT-like DNA-binding domain protein              82.8    6e-14   
ref|XP_003628027.1|  hypothetical protein MTR_8g041580                82.8    6e-14   
ref|XP_010274960.1|  PREDICTED: uncharacterized protein At2g29880...  81.3    7e-14   
ref|XP_008864592.1|  hypothetical protein H310_02748                  82.4    7e-14   
ref|XP_010431239.1|  PREDICTED: uncharacterized protein LOC104715543  82.0    8e-14   
ref|XP_004512153.1|  PREDICTED: uncharacterized protein LOC101508187  82.0    1e-13   
ref|XP_010091325.1|  hypothetical protein L484_012218                 82.0    1e-13   
ref|XP_009399184.1|  PREDICTED: uncharacterized protein At2g29880...  70.5    1e-13   
ref|XP_011001990.1|  PREDICTED: uncharacterized protein LOC105109...  81.3    2e-13   
ref|XP_009361927.1|  PREDICTED: uncharacterized protein LOC103952126  81.3    2e-13   
ref|XP_002269434.1|  PREDICTED: uncharacterized protein At2g29880...  80.5    3e-13   Vitis vinifera
ref|XP_007157895.1|  hypothetical protein PHAVU_002G106800g           81.3    3e-13   
ref|XP_010054607.1|  PREDICTED: uncharacterized protein LOC104442930  78.6    4e-13   
ref|XP_008375324.1|  PREDICTED: uncharacterized protein LOC103438569  80.5    4e-13   
ref|XP_010540195.1|  PREDICTED: uncharacterized protein LOC104814049  80.1    4e-13   
ref|XP_002529640.1|  conserved hypothetical protein                   69.3    4e-13   
ref|XP_006403932.1|  hypothetical protein EUTSA_v10011017mg           79.7    4e-13   
ref|XP_007204771.1|  hypothetical protein PRUPE_ppa015622mg           80.1    4e-13   
gb|KCW47096.1|  hypothetical protein EUGRSUZ_K00902                   77.0    5e-13   
ref|XP_010054641.1|  PREDICTED: uncharacterized protein LOC104442967  79.7    5e-13   
ref|XP_008346549.1|  PREDICTED: uncharacterized protein LOC103409504  79.7    6e-13   
gb|KCW74866.1|  hypothetical protein EUGRSUZ_E03604                   79.7    6e-13   
ref|XP_010045918.1|  PREDICTED: uncharacterized protein LOC104434744  79.7    6e-13   
ref|XP_009355121.1|  PREDICTED: uncharacterized protein LOC103946189  79.7    7e-13   
gb|KHG12315.1|  DNA ligase                                            79.3    7e-13   
ref|XP_003634877.1|  PREDICTED: uncharacterized protein At2g29880...  79.3    7e-13   
ref|XP_004140924.1|  PREDICTED: uncharacterized protein LOC101213668  79.3    8e-13   
ref|XP_010271443.1|  PREDICTED: uncharacterized protein At2g29880...  79.3    8e-13   
ref|XP_010927399.1|  PREDICTED: uncharacterized protein LOC105049453  68.2    8e-13   
ref|XP_007010745.1|  Uncharacterized protein TCM_044690               79.3    9e-13   
ref|XP_009614803.1|  PREDICTED: uncharacterized protein At2g29880     79.3    1e-12   
gb|KDP24000.1|  hypothetical protein JCGZ_25388                       73.2    1e-12   
ref|XP_006287730.1|  hypothetical protein CARUB_v10000941mg           53.9    1e-12   
emb|CBI40648.3|  unnamed protein product                              78.6    1e-12   
ref|XP_002275183.1|  PREDICTED: uncharacterized protein At2g29880...  78.6    1e-12   
gb|KCW67600.1|  hypothetical protein EUGRSUZ_F01358                   79.0    1e-12   
gb|KDP40586.1|  hypothetical protein JCGZ_24585                       78.6    1e-12   
ref|XP_002525567.1|  conserved hypothetical protein                   78.2    2e-12   
ref|XP_002304818.1|  hypothetical protein POPTR_0003s19000g           78.2    2e-12   
ref|XP_011020492.1|  PREDICTED: uncharacterized protein LOC105122857  78.2    2e-12   
ref|XP_008456640.1|  PREDICTED: uncharacterized protein LOC103496536  78.2    2e-12   
ref|XP_008881402.1|  hypothetical protein H310_15195                  76.3    2e-12   
ref|XP_008230639.1|  PREDICTED: uncharacterized protein LOC103329893  77.8    2e-12   
ref|XP_007215739.1|  hypothetical protein PRUPE_ppa009122mg           77.8    2e-12   
ref|XP_010064200.1|  PREDICTED: uncharacterized protein LOC104451176  77.8    3e-12   
gb|KHG19884.1|  hypothetical protein F383_07120                       78.2    3e-12   
ref|XP_010503821.1|  PREDICTED: uncharacterized protein LOC104780965  76.6    4e-12   
emb|CDX97275.1|  BnaA02g20660D                                        77.4    4e-12   
ref|XP_008242096.1|  PREDICTED: cell cycle checkpoint protein RAD17   73.9    4e-12   
ref|XP_010452487.1|  PREDICTED: uncharacterized protein LOC104734585  53.1    5e-12   
ref|XP_009770395.1|  PREDICTED: uncharacterized protein LOC104221108  76.6    5e-12   
ref|NP_849289.1|  uncharacterized protein                             76.3    6e-12   
ref|XP_010651687.1|  PREDICTED: uncharacterized protein LOC104879688  75.9    6e-12   
ref|XP_010247492.1|  PREDICTED: uncharacterized protein At2g29880...  76.3    6e-12   
ref|XP_006361960.1|  PREDICTED: uncharacterized protein LOC102591738  76.6    8e-12   
gb|KCW54933.1|  hypothetical protein EUGRSUZ_I00904                   76.3    8e-12   
ref|XP_006836906.1|  hypothetical protein AMTR_s00099p00128470        68.6    8e-12   
ref|XP_009587452.1|  PREDICTED: uncharacterized protein At2g29880...  67.8    9e-12   
ref|NP_192164.1|  uncharacterized protein                             76.3    9e-12   
ref|XP_009115807.1|  PREDICTED: uncharacterized protein LOC103841...  74.7    9e-12   
ref|XP_010042430.1|  PREDICTED: uncharacterized protein LOC104431504  76.3    9e-12   
ref|XP_010042635.1|  PREDICTED: uncharacterized protein LOC104431770  75.1    1e-11   
ref|XP_009144553.1|  PREDICTED: uncharacterized protein LOC103868202  75.9    1e-11   
ref|XP_010423422.1|  PREDICTED: uncharacterized protein LOC104708532  52.4    1e-11   
ref|XP_006288287.1|  hypothetical protein CARUB_v10001530mg           75.9    1e-11   
ref|XP_010043722.1|  PREDICTED: uncharacterized protein LOC104432858  75.5    1e-11   
ref|NP_001031574.1|  uncharacterized protein                          75.9    1e-11   
ref|XP_010113321.1|  hypothetical protein L484_026652                 67.0    2e-11   
ref|XP_009115806.1|  PREDICTED: uncharacterized protein LOC103841...  73.9    2e-11   
ref|XP_004233570.1|  PREDICTED: uncharacterized protein At2g29880...  75.5    2e-11   
ref|XP_006344968.1|  PREDICTED: uncharacterized protein At2g29880...  49.3    2e-11   
ref|XP_004135631.1|  PREDICTED: uncharacterized protein LOC101210893  74.3    2e-11   
ref|XP_010422576.1|  PREDICTED: uncharacterized protein LOC104707842  75.1    2e-11   
ref|XP_010429824.1|  PREDICTED: uncharacterized protein LOC104714231  74.7    2e-11   
emb|CDX73733.1|  BnaC08g22700D                                        73.6    4e-11   
ref|XP_006366577.1|  PREDICTED: uncharacterized protein LOC102582732  73.6    4e-11   
ref|XP_010273669.1|  PREDICTED: uncharacterized protein At2g29880...  61.2    5e-11   
ref|XP_010317250.1|  PREDICTED: uncharacterized protein At2g29880...  67.8    5e-11   
ref|XP_004157258.1|  PREDICTED: uncharacterized LOC101210893          73.2    6e-11   
ref|XP_010245132.1|  PREDICTED: uncharacterized protein At2g29880...  68.9    8e-11   
emb|CDX77993.1|  BnaA09g31880D                                        72.0    1e-10   
emb|CDY59618.1|  BnaCnng35350D                                        72.0    1e-10   
ref|XP_008908799.1|  hypothetical protein PPTG_13140                  70.1    1e-10   
ref|XP_009379367.1|  PREDICTED: uncharacterized protein At2g29880...  72.4    1e-10   
ref|XP_008370337.1|  PREDICTED: uncharacterized protein LOC103433828  72.0    2e-10   
ref|XP_009379366.1|  PREDICTED: uncharacterized protein At2g29880...  72.0    2e-10   
emb|CDY65567.1|  BnaCnng47720D                                        71.6    3e-10   
gb|ETL35806.1|  hypothetical protein L916_12114                       68.6    4e-10   
ref|XP_006396465.1|  hypothetical protein EUTSA_v10028829mg           71.2    4e-10   
gb|ETI42396.1|  hypothetical protein F443_12468                       68.6    4e-10   
gb|KCW86277.1|  hypothetical protein EUGRSUZ_B02958                   70.9    5e-10   
ref|XP_010662416.1|  PREDICTED: uncharacterized protein At2g29880...  65.9    5e-10   
ref|XP_010662420.1|  PREDICTED: uncharacterized protein At2g29880...  65.9    5e-10   
ref|XP_010277195.1|  PREDICTED: uncharacterized protein At2g29880...  71.2    5e-10   
gb|ETI38259.1|  hypothetical protein, variant                         68.2    6e-10   
ref|XP_010491117.1|  PREDICTED: uncharacterized protein LOC104768775  47.4    6e-10   
ref|XP_010058707.1|  PREDICTED: uncharacterized protein LOC104446565  69.3    7e-10   
ref|XP_010314218.1|  PREDICTED: uncharacterized protein LOC104644998  69.7    7e-10   
ref|NP_196199.1|  uncharacterized protein                             47.4    7e-10   
gb|AFK37972.1|  unknown                                               68.2    8e-10   
gb|AAU90272.1|  expressed protein                                     69.3    9e-10   
ref|XP_009401216.1|  PREDICTED: uncharacterized protein LOC103985286  70.1    9e-10   
ref|XP_003629672.1|  F-box family protein                             72.0    1e-09   
ref|XP_002898799.1|  conserved hypothetical protein                   58.9    1e-09   
ref|XP_010314199.1|  PREDICTED: uncharacterized protein At2g29880...  69.3    1e-09   
ref|NP_001050751.2|  Os03g0643100                                     68.6    1e-09   
ref|XP_007403752.1|  hypothetical protein MELLADRAFT_58699            70.1    2e-09   
ref|XP_010063337.1|  PREDICTED: uncharacterized protein LOC104450467  69.3    2e-09   
gb|ETK96729.1|  hypothetical protein L915_00618                       67.0    2e-09   
dbj|BAC16199.1|  hypothetical protein                                 68.2    2e-09   
dbj|BAD20095.1|  unknown protein                                      67.8    2e-09   
ref|XP_010279315.1|  PREDICTED: uncharacterized protein At2g29880...  69.7    2e-09   
gb|KCW49570.1|  hypothetical protein EUGRSUZ_K03095                   68.9    2e-09   
gb|KHN10658.1|  hypothetical protein glysoja_046746                   67.4    2e-09   
ref|XP_006665188.1|  PREDICTED: uncharacterized protein At2g29880...  67.8    2e-09   
ref|XP_010034358.1|  PREDICTED: uncharacterized protein LOC104423591  68.2    3e-09   
ref|XP_010267361.1|  PREDICTED: uncharacterized protein LOC104604620  68.6    3e-09   
ref|XP_010058686.1|  PREDICTED: uncharacterized protein LOC104446541  68.6    3e-09   
gb|AAK27803.1|AC022457_6  hypothetical protein                        67.0    3e-09   
dbj|BAC83684.1|  unknown protein                                      67.4    3e-09   
ref|XP_010909873.1|  PREDICTED: uncharacterized protein LOC105035862  68.2    3e-09   
emb|CBI23125.3|  unnamed protein product                              67.8    4e-09   
ref|XP_006836323.1|  hypothetical protein AMTR_s00092p00067380        68.2    4e-09   
ref|XP_010244094.1|  PREDICTED: uncharacterized protein LOC104588...  58.5    4e-09   
ref|XP_010244095.1|  PREDICTED: uncharacterized protein LOC104588...  58.5    4e-09   
ref|XP_010258435.1|  PREDICTED: uncharacterized protein LOC104598211  66.6    5e-09   
ref|XP_004287793.1|  PREDICTED: uncharacterized protein LOC101294...  67.8    5e-09   
ref|XP_010279316.1|  PREDICTED: uncharacterized protein At2g29880...  67.4    7e-09   
ref|XP_010058526.1|  PREDICTED: uncharacterized protein LOC104446365  68.6    8e-09   
ref|XP_002902804.1|  conserved hypothetical protein                   65.9    8e-09   
gb|KHN17857.1|  hypothetical protein glysoja_017908                   68.6    9e-09   
gb|ETI38258.1|  hypothetical protein F443_15951                       65.1    9e-09   
ref|XP_003537479.1|  PREDICTED: uncharacterized protein LOC100798...  68.6    1e-08   
gb|KEH24444.1|  Myb/SANT-like DNA-binding domain protein              67.4    1e-08   
gb|KEH18220.1|  Myb/SANT-like DNA-binding domain protein              66.2    1e-08   
ref|XP_010327304.1|  PREDICTED: uncharacterized protein LOC104649544  67.8    1e-08   
ref|XP_003628330.1|  hypothetical protein MTR_8g052440                66.2    1e-08   
ref|XP_009825148.1|  hypothetical protein H257_02976                  66.6    1e-08   
emb|CDP07076.1|  unnamed protein product                              66.2    1e-08   
ref|XP_010658482.1|  PREDICTED: uncharacterized protein LOC104881124  65.9    1e-08   
gb|KGN66564.1|  hypothetical protein Csa_1G629700                     65.5    1e-08   
ref|XP_003608293.1|  FBD-associated F-box protein                     68.2    2e-08   
gb|AES88264.2|  Myb/SANT-like DNA-binding domain protein              68.2    2e-08   
ref|XP_008246059.1|  PREDICTED: uncharacterized protein At2g29880...  65.9    2e-08   
gb|AES90490.2|  Myb/SANT-like DNA-binding domain protein              67.8    2e-08   
gb|KEH26975.1|  Myb/SANT-like DNA-binding domain protein              65.5    2e-08   
ref|XP_003606067.1|  FBD-associated F-box protein                     67.8    2e-08   
gb|EMS50453.1|  hypothetical protein TRIUR3_16909                     66.6    3e-08   
ref|XP_006827059.1|  hypothetical protein AMTR_s00010p00233080        65.9    3e-08   
ref|XP_009782470.1|  PREDICTED: uncharacterized protein LOC104231211  65.1    3e-08   
gb|AET02817.2|  Myb/SANT-like DNA-binding domain protein              64.7    3e-08   
gb|KEH37138.1|  Myb/SANT-like DNA-binding domain protein              65.1    3e-08   
ref|XP_010690561.1|  PREDICTED: uncharacterized protein LOC104904075  65.1    3e-08   
ref|XP_010026285.1|  PREDICTED: uncharacterized protein LOC104416617  65.5    3e-08   
ref|XP_007203246.1|  hypothetical protein PRUPE_ppa019469mg           66.2    3e-08   
ref|XP_003552852.1|  PREDICTED: uncharacterized protein LOC100793...  67.0    3e-08   
ref|XP_006591372.1|  PREDICTED: uncharacterized protein LOC100798...  66.6    4e-08   
gb|KHN07638.1|  hypothetical protein glysoja_019745                   66.6    4e-08   
ref|XP_010647374.1|  PREDICTED: uncharacterized protein LOC104878...  65.1    5e-08   
ref|XP_008777569.1|  PREDICTED: uncharacterized protein LOC103697...  64.3    5e-08   
ref|XP_010647368.1|  PREDICTED: uncharacterized protein LOC104878...  65.1    5e-08   
ref|XP_010263418.1|  PREDICTED: uncharacterized protein LOC104601676  62.8    6e-08   
ref|XP_010264772.1|  PREDICTED: uncharacterized protein LOC104602691  62.8    7e-08   
ref|XP_004287794.1|  PREDICTED: uncharacterized protein LOC101294...  63.9    7e-08   
gb|KEH24039.1|  Myb/SANT-like DNA-binding domain protein              64.3    7e-08   
ref|XP_010909976.1|  PREDICTED: uncharacterized protein LOC105035954  63.9    7e-08   
ref|XP_008244442.1|  PREDICTED: uncharacterized protein At2g29880...  63.9    9e-08   
gb|EMS55255.1|  Putative nuclease HARBI1                              65.1    9e-08   
ref|XP_011012645.1|  PREDICTED: uncharacterized protein At2g29880...  63.9    9e-08   
ref|XP_004305277.1|  PREDICTED: uncharacterized protein LOC101313730  64.3    1e-07   
ref|XP_003589014.1|  PIF-like protein                                 63.9    1e-07   
ref|XP_010680079.1|  PREDICTED: cell cycle checkpoint protein RAD17   65.1    1e-07   
ref|XP_003628341.1|  PIF-like protein                                 63.5    1e-07   
gb|KCW49628.1|  hypothetical protein EUGRSUZ_K03150                   62.8    1e-07   
ref|XP_011016662.1|  PREDICTED: uncharacterized protein At2g29880...  63.2    1e-07   
ref|XP_011016672.1|  PREDICTED: uncharacterized protein At2g29880...  63.2    2e-07   
ref|XP_010665236.1|  PREDICTED: uncharacterized protein LOC104882713  63.2    2e-07   
ref|XP_010655873.1|  PREDICTED: uncharacterized protein At2g29880...  63.2    2e-07   
emb|CDP19744.1|  unnamed protein product                              63.9    2e-07   
gb|KDQ13310.1|  hypothetical protein BOTBODRAFT_45272                 61.2    2e-07   
ref|XP_008231541.1|  PREDICTED: uncharacterized protein At2g29880...  60.8    2e-07   
ref|XP_008649749.1|  PREDICTED: uncharacterized protein At2g29880...  63.5    2e-07   
ref|XP_009605996.1|  PREDICTED: uncharacterized protein At2g29880...  62.4    2e-07   
ref|XP_009373896.1|  PREDICTED: uncharacterized protein LOC103962851  62.4    3e-07   
ref|XP_008669926.1|  PREDICTED: uncharacterized protein At2g29880...  63.2    3e-07   
gb|EMT22819.1|  hypothetical protein F775_04123                       62.8    3e-07   
ref|XP_002307798.1|  hypothetical protein POPTR_0005s27380g           62.8    3e-07   
ref|XP_004308208.1|  PREDICTED: uncharacterized protein LOC101308913  62.0    3e-07   
ref|XP_010652552.1|  PREDICTED: uncharacterized protein At2g29880...  62.8    3e-07   
ref|XP_003606529.1|  NDX1 homeobox protein                            63.9    4e-07   
ref|XP_008237018.1|  PREDICTED: uncharacterized protein LOC103335769  60.8    4e-07   
ref|XP_009605995.1|  PREDICTED: uncharacterized protein At2g29880...  62.0    4e-07   
ref|XP_006381633.1|  hypothetical protein POPTR_0006s14515g           60.5    4e-07   
ref|XP_007163510.1|  hypothetical protein PHAVU_001G240000g           63.5    4e-07   
ref|XP_008356840.1|  PREDICTED: uncharacterized protein LOC103420558  62.0    4e-07   
ref|XP_008657441.1|  PREDICTED: uncharacterized protein At2g29880...  62.4    5e-07   
ref|XP_004972131.1|  PREDICTED: uncharacterized protein At2g29880...  60.8    5e-07   
gb|EYU30810.1|  hypothetical protein MIMGU_mgv1a021774mg              59.7    5e-07   
ref|XP_007222435.1|  hypothetical protein PRUPE_ppa006118mg           62.4    5e-07   
ref|XP_009595068.1|  PREDICTED: uncharacterized protein LOC104091439  59.7    6e-07   
ref|XP_003337014.2|  hypothetical protein PGTG_18727                  62.4    6e-07   
gb|EYU35481.1|  hypothetical protein MIMGU_mgv1a013729mg              60.5    6e-07   
gb|KHN45567.1|  hypothetical protein glysoja_033546                   60.8    6e-07   
ref|XP_008220887.1|  PREDICTED: uncharacterized protein LOC103320927  61.6    6e-07   
ref|XP_009351225.1|  PREDICTED: uncharacterized protein LOC103942747  61.6    6e-07   
ref|XP_006656711.1|  PREDICTED: uncharacterized protein LOC102720611  58.5    7e-07   
ref|XP_006584777.1|  PREDICTED: uncharacterized protein LOC102664...  60.8    7e-07   
ref|XP_002451557.1|  hypothetical protein SORBIDRAFT_04g003675        57.8    7e-07   
ref|XP_008674681.1|  PREDICTED: uncharacterized protein At2g29880...  62.0    7e-07   
ref|XP_006587055.1|  PREDICTED: uncharacterized protein LOC102661...  61.2    7e-07   
ref|XP_004986322.1|  PREDICTED: uncharacterized protein LOC101761490  60.8    7e-07   
ref|XP_006586289.1|  PREDICTED: uncharacterized protein LOC102659822  60.5    7e-07   
ref|XP_006593192.1|  PREDICTED: uncharacterized protein LOC102662943  61.2    8e-07   
ref|XP_009804065.1|  PREDICTED: uncharacterized protein LOC104249351  51.6    8e-07   
ref|XP_003561644.1|  PREDICTED: uncharacterized protein LOC100831507  61.6    8e-07   
ref|XP_007208523.1|  hypothetical protein PRUPE_ppa025768mg           62.4    8e-07   
ref|XP_004986836.1|  PREDICTED: uncharacterized protein LOC101764198  60.5    8e-07   
gb|KEH23715.1|  Myb/SANT-like DNA-binding domain protein              61.2    8e-07   
ref|XP_002455971.1|  hypothetical protein SORBIDRAFT_03g028280        57.8    8e-07   
ref|XP_006420050.1|  hypothetical protein CICLE_v10006620mg           61.2    9e-07   
ref|XP_006584775.1|  PREDICTED: uncharacterized protein LOC102664...  60.8    9e-07   
ref|XP_008229479.1|  PREDICTED: uncharacterized protein LOC103328853  61.2    1e-06   
ref|XP_004307609.1|  PREDICTED: uncharacterized protein LOC101292548  60.8    1e-06   
ref|XP_004977833.1|  PREDICTED: uncharacterized protein LOC101768475  60.5    1e-06   
gb|EMT29388.1|  hypothetical protein F775_22863                       61.6    1e-06   
gb|ETO61064.1|  hypothetical protein F444_20860                       50.8    1e-06   
ref|XP_006605555.1|  PREDICTED: uncharacterized protein LOC102667...  59.3    1e-06   
ref|XP_006660226.1|  PREDICTED: uncharacterized protein LOC102702962  58.2    1e-06   
ref|XP_008222122.1|  PREDICTED: uncharacterized protein At2g29880...  60.5    1e-06   
ref|XP_010652561.1|  PREDICTED: uncharacterized protein LOC100853265  60.8    1e-06   
ref|XP_010068072.1|  PREDICTED: uncharacterized protein At2g29880...  59.7    1e-06   
emb|CDJ26617.1|  unnamed protein product                              60.1    1e-06   
emb|CDM80034.1|  unnamed protein product                              61.2    1e-06   



>ref|XP_009348736.1| PREDICTED: uncharacterized protein At2g29880 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009348743.1| PREDICTED: uncharacterized protein At2g29880 isoform X1 [Pyrus 
x bretschneideri]
Length=452

 Score =   242 bits (618),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPEM+PYRTKV+ +YNEL II GH VADGRYSLSC+D+DFENE + +E + PT  D KK
Sbjct  112   AHPEMQPYRTKVISHYNELCIICGHAVADGRYSLSCYDVDFENEARGMEFQDPTDADPKK  171

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             IDWS+ M+Q F++LML++V +GNK+  TFK K+WI MIT FN  FGF +G+ VLK R+N+
Sbjct  172   IDWSQIMDQFFVELMLDEVCKGNKVGCTFKKKSWITMITCFNEKFGFHHGRAVLKNRYNV  231

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LR+ Y +V  LL Q GF W E  Q +VA+D VW K I+A   F  YRNK++ +Y D+ +I
Sbjct  232   LRKHYSSVNALLDQKGFTWDETQQKVVADDPVWNKYIEAHPSFHMYRNKAMPYYSDLCVI  291

Query  792   CGNETPTFQYG  760
             CGNE    + G
Sbjct  292   CGNEARLLKNG  302


 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   S ++S+ +R+NWT   D +FI+L+L+Q+ KGN+T   F KQAW +MI LF++++  
Sbjct  1     MYAGSSTTSDHVRANWTPSQDSFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+DTD+LKNRYK LRKQY   K +++Q +F WD+++QM+T +D  W++YIK     Q + 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQVDFRWDETQQMITADDNVWNNYIKAHPEMQPY-  119

Query  1387  NHLKIIAHY  1361
                K+I+HY
Sbjct  120   -RTKVISHY  127


 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 0/138 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T  D  + +W+ + +  FI LMLEQV +GNK    F+ +AW  MI  FN  FGF+Y   +
Sbjct  7     TTSDHVRANWTPSQDSFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGFKYDTDI  66

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA    + YR K +S 
Sbjct  67    LKNRYKRLRKQYSEMKSLVDQVDFRWDETQQMITADDNVWNNYIKAHPEMQPYRTKVISH  126

Query  813   YKDMSIICGNETPTFQYG  760
             Y ++ IICG+     +Y 
Sbjct  127   YNELCIICGHAVADGRYS  144


 Score = 96.7 bits (239),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              ME    + ++  + +W+ +MD +F+EL+LD++ KGN+   +F K++W+ MI  F+ K+ 
Sbjct  158   GMEFQDPTDADPKKIDWSQIMDQFFVELMLDEVCKGNKVGCTFKKKSWITMITCFNEKFG  217

Query  1567  CKHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
               H   VLKNRY  LRK Y +   +L+Q  F WD+++Q V  +D  W+ YI+ 
Sbjct  218   FHHGRAVLKNRYNVLRKHYSSVNALLDQKGFTWDETQQKVVADDPVWNKYIEA  270



>ref|XP_008351512.1| PREDICTED: uncharacterized protein LOC103414933 [Malus domestica]
Length=452

 Score =   241 bits (615),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 140/185 (76%), Gaps = 0/185 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPEM+PYRTKV+ +Y+EL II GH VADGRYSLSC+D+DFENE + +E + PT  D KK
Sbjct  112   AHPEMQPYRTKVISHYDELCIICGHAVADGRYSLSCYDMDFENEARGMEFQDPTDADPKK  171

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             IDWS+ M+Q F++LML++V++GNK+  TFK K+WI MIT FN  FGFQ+G+ VLK R+N+
Sbjct  172   IDWSQIMDQFFVELMLDEVRKGNKVGCTFKKKSWITMITCFNEKFGFQHGRAVLKNRYNV  231

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LR+ Y +V  LL Q GF W E  Q +VA+D VW K I+A   F  YRNK++ +Y D+ +I
Sbjct  232   LRKHYSSVNALLDQKGFTWDETQQKVVADDPVWNKYIEAHPSFHMYRNKAMPYYSDLCVI  291

Query  792   CGNET  778
             CGNE 
Sbjct  292   CGNEA  296


 Score =   127 bits (318),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             S ++S+ +R+NWT   D++FI+L+L+Q+ KGN+T   F KQAW +MI LF++++  K+DT
Sbjct  5     SSTTSDHVRANWTPSQDNFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGFKYDT  64

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLK  1376
             D+LKNRYK LRKQY   K +++Q  F WD+++QM+T +D+ W++YIK     Q +    K
Sbjct  65    DILKNRYKRLRKQYSEMKSLVDQGNFRWDETQQMITADDBVWNNYIKAHPEMQPYRT--K  122

Query  1375  IIAHY  1361
             +I+HY
Sbjct  123   VISHY  127


 Score =   123 bits (308),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 79/138 (57%), Gaps = 0/138 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T  D  + +W+ + +  FI LMLEQV +GNK    F+ +AW  MI  FN  FGF+Y   +
Sbjct  7     TTSDHVRANWTPSQDNFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGFKYDTDI  66

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA    + YR K +S 
Sbjct  67    LKNRYKRLRKQYSEMKSLVDQGNFRWDETQQMITADDBVWNNYIKAHPEMQPYRTKVISH  126

Query  813   YKDMSIICGNETPTFQYG  760
             Y ++ IICG+     +Y 
Sbjct  127   YDELCIICGHAVADGRYS  144


 Score = 99.0 bits (245),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              ME    + ++  + +W+ +MD +F+EL+LD+++KGN+   +F K++W+ MI  F+ K+ 
Sbjct  158   GMEFQDPTDADPKKIDWSQIMDQFFVELMLDEVRKGNKVGCTFKKKSWITMITCFNEKFG  217

Query  1567  CKHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              +H   VLKNRY  LRK Y +   +L+Q  F WD+++Q V  +D  W+ YI+ 
Sbjct  218   FQHGRAVLKNRYNVLRKHYSSVNALLDQKGFTWDETQQKVVADDPVWNKYIEA  270



>ref|XP_007028029.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY08531.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=454

 Score =   241 bits (615),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+M+ YRTKVVPYY EL +I GH VADGRYSLSCFD+DFENE K  +DK P+  D  K
Sbjct  112   AHPDMQSYRTKVVPYYTELCVICGHIVADGRYSLSCFDVDFENEEKGADDKTPSSCDRTK  171

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             IDW+ TM+Q+F++LML+QV +GNK+  T K KAW+ MIT FN  FG Q+ + VLK R+ +
Sbjct  172   IDWTPTMDQYFLELMLDQVHKGNKVGCTLKKKAWVSMITLFNAKFGLQHSRAVLKNRYKI  231

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LR QY ++K LL++ GF W E  +M++A+DRVW K +K    FRR++NKS+  Y DM II
Sbjct  232   LRSQYASIKTLLTEKGFHWDETQKMVIADDRVWNKYVKEHPEFRRFKNKSMPCYDDMCII  291

Query  792   CGNETPT  772
             C NE+ +
Sbjct  292   CCNESTS  298


 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 92/137 (67%), Gaps = 4/137 (3%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             MEDDS S ++ +R+NWT   D +F+ELL++Q+Q  N+T  +F + AW++MI  F+ K+  
Sbjct  1     MEDDSLSDTDNVRANWTPPQDQFFVELLVEQVQMRNKTDHAFKQLAWVDMITQFNSKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D DVLKNR+K +RKQY+  KI L+Q+ F WD+  QMV  ++ KWD+Y+K     Q + 
Sbjct  61    KYDIDVLKNRFKRMRKQYNEMKILLDQSGFKWDEEVQMVKADNNKWDEYLKAHPDMQSY-  119

Query  1387  NHLKIIAHYILVSFVVC  1337
                K++ +Y  +  V+C
Sbjct  120   -RTKVVPYYTELC-VIC  134


 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 86/144 (60%), Gaps = 0/144 (0%)
 Frame = -2

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             +ED   +  D  + +W+   +Q F++L++EQVQ  NK +  FK  AW+ MIT FN+ FGF
Sbjct  1     MEDDSLSDTDNVRANWTPPQDQFFVELLVEQVQMRNKTDHAFKQLAWVDMITQFNSKFGF  60

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             +Y   VLK RF  +R+QY  +K LL Q GF W E  QM+ A++  W + +KA    + YR
Sbjct  61    KYDIDVLKNRFKRMRKQYNEMKILLDQSGFKWDEEVQMVKADNNKWDEYLKAHPDMQSYR  120

Query  831   NKSLSFYKDMSIICGNETPTFQYG  760
              K + +Y ++ +ICG+     +Y 
Sbjct  121   TKVVPYYTELCVICGHIVADGRYS  144


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = -1

Query  1753  RGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             +GA +D + SS +  + +WT  MD YF+EL+LDQ+ KGN+   +  K+AW+ MI LF+ K
Sbjct  157   KGA-DDKTPSSCDRTKIDWTPTMDQYFLELMLDQVHKGNKVGCTLKKKAWVSMITLFNAK  215

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQ  1397
             +  +H   VLKNRYK LR QY + K +L +  F WD++++MV  +D  W+ Y+K     +
Sbjct  216   FGLQHSRAVLKNRYKILRSQYASIKTLLTEKGFHWDETQKMVIADDRVWNKYVKEHPEFR  275

Query  1396  KFSNHLKIIAHYILVSFVVC  1337
             +F N  K +  Y  +  + C
Sbjct  276   RFKN--KSMPCYDDMCIICC  293



>ref|XP_007028028.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY08530.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=494

 Score =   241 bits (615),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+M+ YRTKVVPYY EL +I GH VADGRYSLSCFD+DFENE K  +DK P+  D  K
Sbjct  152   AHPDMQSYRTKVVPYYTELCVICGHIVADGRYSLSCFDVDFENEEKGADDKTPSSCDRTK  211

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             IDW+ TM+Q+F++LML+QV +GNK+  T K KAW+ MIT FN  FG Q+ + VLK R+ +
Sbjct  212   IDWTPTMDQYFLELMLDQVHKGNKVGCTLKKKAWVSMITLFNAKFGLQHSRAVLKNRYKI  271

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LR QY ++K LL++ GF W E  +M++A+DRVW K +K    FRR++NKS+  Y DM II
Sbjct  272   LRSQYASIKTLLTEKGFHWDETQKMVIADDRVWNKYVKEHPEFRRFKNKSMPCYDDMCII  331

Query  792   CGNETPT  772
             C NE+ +
Sbjct  332   CCNESTS  338


 Score =   125 bits (314),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 100/159 (63%), Gaps = 5/159 (3%)
 Frame = -1

Query  1807  IPRLPYSYTSSRLSALKNRG-AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRT  1631
             IP        + ++A   RG  MEDDS S ++ +R+NWT   D +F+ELL++Q+Q  N+T
Sbjct  19    IPHFARKRLEAAITAQSQRGKEMEDDSLSDTDNVRANWTPPQDQFFVELLVEQVQMRNKT  78

Query  1630  STSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQM  1454
               +F + AW++MI  F+ K+  K+D DVLKNR+K +RKQY+  KI L+Q+ F WD+  QM
Sbjct  79    DHAFKQLAWVDMITQFNSKFGFKYDIDVLKNRFKRMRKQYNEMKILLDQSGFKWDEEVQM  138

Query  1453  VTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILVSFVVC  1337
             V  ++ KWD+Y+K     Q +    K++ +Y  +  V+C
Sbjct  139   VKADNNKWDEYLKAHPDMQSY--RTKVVPYYTELC-VIC  174


 Score =   120 bits (301),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 85/138 (62%), Gaps = 0/138 (0%)
 Frame = -2

Query  1197  KILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAF  1018
             K +ED   +  D  + +W+   +Q F++L++EQVQ  NK +  FK  AW+ MIT FN+ F
Sbjct  39    KEMEDDSLSDTDNVRANWTPPQDQFFVELLVEQVQMRNKTDHAFKQLAWVDMITQFNSKF  98

Query  1017  GFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRR  838
             GF+Y   VLK RF  +R+QY  +K LL Q GF W E  QM+ A++  W + +KA    + 
Sbjct  99    GFKYDIDVLKNRFKRMRKQYNEMKILLDQSGFKWDEEVQMVKADNNKWDEYLKAHPDMQS  158

Query  837   YRNKSLSFYKDMSIICGN  784
             YR K + +Y ++ +ICG+
Sbjct  159   YRTKVVPYYTELCVICGH  176


 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = -1

Query  1753  RGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             +GA +D + SS +  + +WT  MD YF+EL+LDQ+ KGN+   +  K+AW+ MI LF+ K
Sbjct  197   KGA-DDKTPSSCDRTKIDWTPTMDQYFLELMLDQVHKGNKVGCTLKKKAWVSMITLFNAK  255

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQ  1397
             +  +H   VLKNRYK LR QY + K +L +  F WD++++MV  +D  W+ Y+K     +
Sbjct  256   FGLQHSRAVLKNRYKILRSQYASIKTLLTEKGFHWDETQKMVIADDRVWNKYVKEHPEFR  315

Query  1396  KFSNHLKIIAHYILVSFVVC  1337
             +F N  K +  Y  +  + C
Sbjct  316   RFKN--KSMPCYDDMCIICC  333



>ref|XP_007204813.1| hypothetical protein PRUPE_ppa026716mg [Prunus persica]
 gb|EMJ06012.1| hypothetical protein PRUPE_ppa026716mg [Prunus persica]
Length=445

 Score =   238 bits (608),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 138/185 (75%), Gaps = 8/185 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPEM+PYRTKVV YYNEL II GH VADGRYSLSC+D+DFENE        P  DD K 
Sbjct  112   AHPEMQPYRTKVVSYYNELCIICGHAVADGRYSLSCYDVDFENE-------DPINDDPK-  163

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             I+WS+TM+Q F++LML++V +GNK+ R+FK K+W+ MIT+FN  FGFQ+G+ VLK R+++
Sbjct  164   IEWSQTMDQFFVELMLDEVCKGNKVGRSFKKKSWVSMITSFNEKFGFQHGRAVLKNRYSI  223

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
              RR Y ++K LL Q GF W E  Q +VA+DRVW K IKA   F  YRNK++ +Y DM II
Sbjct  224   FRRHYSSIKILLDQRGFKWDETEQKMVADDRVWNKYIKAHPSFHMYRNKAMPYYSDMCII  283

Query  792   CGNET  778
             CGNE 
Sbjct  284   CGNEA  288


 Score =   124 bits (310),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 88/129 (68%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M++    + + LR+NWT   D +FI+LLL+Q++KGN+T   F KQ W +MI LF+ K+  
Sbjct  1     MDETLVYTGDHLRANWTPPQDSFFIDLLLEQVRKGNKTGHGFRKQGWADMIVLFNTKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+DTD+LKNRYK LRKQY   K +++Q  F WD+S+QM+T +D  W+DYIK     Q + 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQAIFRWDESQQMITADDSVWNDYIKAHPEMQPYR  120

Query  1387  NHLKIIAHY  1361
                K++++Y
Sbjct  121   T--KVVSYY  127


 Score =   120 bits (300),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+   +  FI L+LEQV++GNK    F+ + W  MI  FNT FGF+Y   +LK 
Sbjct  10    DHLRANWTPPQDSFFIDLLLEQVRKGNKTGHGFRKQGWADMIVLFNTKFGFKYDTDILKN  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA    + YR K +S+Y +
Sbjct  70    RYKRLRKQYSEMKSLVDQAIFRWDESQQMITADDSVWNDYIKAHPEMQPYRTKVVSYYNE  129

Query  804   MSIICGNETPTFQYG  760
             + IICG+     +Y 
Sbjct  130   LCIICGHAVADGRYS  144


 Score = 93.2 bits (230),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+  MD +F+EL+LD++ KGN+   SF K++W+ MI  F+ K+  +H   VLKNRY   R
Sbjct  166   WSQTMDQFFVELMLDEVCKGNKVGRSFKKKSWVSMITSFNEKFGFQHGRAVLKNRYSIFR  225

Query  1519  KQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             + Y + KI L+Q  F WD++ Q +  +D  W+ YIK 
Sbjct  226   RHYSSIKILLDQRGFKWDETEQKMVADDRVWNKYIKA  262



>ref|XP_010278191.1| PREDICTED: uncharacterized protein LOC104612473 [Nelumbo nucifera]
 ref|XP_010278193.1| PREDICTED: uncharacterized protein LOC104612473 [Nelumbo nucifera]
 ref|XP_010278194.1| PREDICTED: uncharacterized protein LOC104612473 [Nelumbo nucifera]
 ref|XP_010278195.1| PREDICTED: uncharacterized protein LOC104612473 [Nelumbo nucifera]
 ref|XP_010278196.1| PREDICTED: uncharacterized protein LOC104612473 [Nelumbo nucifera]
Length=1114

 Score =   157 bits (397),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 84/200 (42%), Positives = 112/200 (56%), Gaps = 7/200 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED----KIP  1174
             AHP+   YR K VP YN L +I+G    DGRYS    + D E+E    KI  +    +  
Sbjct  438   AHPDARSYRIKTVPSYNNLCLIYGKESVDGRYSRLARNTDLEDENPGKKIGGEERYIQAV  497

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                D  + DW+ +M+++FI LMLEQV +GNK++ TF  +AWI M   FN  FG Q+ K V
Sbjct  498   VGSDRSRTDWTPSMDRYFIDLMLEQVHKGNKIDHTFTKQAWIDMTDLFNEKFGSQHDKDV  557

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L++R+  LR+QY  +K LL Q GF W E  QMI A D VW   IK     R YR K+   
Sbjct  558   LRSRYKNLRKQYNDMKILLDQGGFAWDETRQMITANDDVWDAYIKEHPDARSYRTKTKPN  617

Query  813   YKDMSIICGNETPTFQYGYP  754
             Y D+ II G  +   +  +P
Sbjct  618   YSDLCIIYGKSSTDGRQKHP  637


 Score =   129 bits (324),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = -1

Query  1765  ALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIAL  1586
             A K    +E  +  S++  R+ WT  MD YFIELLLDQ+ +GN+   +F  QAW++M+ L
Sbjct  320   AAKTGEGIESQTPISNDRSRTYWTPPMDRYFIELLLDQVHRGNKIGHTFISQAWIDMVTL  379

Query  1585  FSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             F+ K+  +HD DVLKNRYKHLR+QY++  I LEQ+ F WD++RQMVT +D  WD YIK  
Sbjct  380   FNAKFGSRHDKDVLKNRYKHLRRQYNDINILLEQSGFSWDETRQMVTADDHVWDAYIKAH  439


 Score =   165 bits (417),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/347 (33%), Positives = 182/347 (52%), Gaps = 31/347 (9%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV-----KILEDKIPTK  1168
             AHP+   YRTK +P Y++L +I+G    DG  SLS  DID ++++       L+ + P+ 
Sbjct  765   AHPDARSYRTKTMPNYSDLCLIYGRANVDGGNSLSGHDIDADDDILGVNIGGLDQQAPSS  824

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D    DW+  M+ +FI+LML+QV  GN+++ TF  +AW HM+  FN  F   Y K VL+
Sbjct  825   SDLSSTDWTSEMDHYFIELMLDQVHGGNQVDHTFNEQAWRHMLAMFNAKFESHYDKDVLE  884

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L++QY  +K LL+Q GF W    QMI A+D +W   +K       Y+ + L+ Y 
Sbjct  885   NRYRNLKKQYNDIKILLNQSGFSWDIAQQMITADDDIWNIYLKEHPDAPSYKAQILANYN  944

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKE-------------GNLreveeive  667
             D+S ICGNET T +      +  +F   I+Q  G+               +L +  + + 
Sbjct  945   DLSAICGNET-TDERDNHSCQDVDFSQDILQMNGESFESLQSPVMSTFPRDLVDNVQELS  1003

Query  666   dddereEKKCRYDTKEP--KEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkk  493
             +     E   +++ ++   +   +   +++  +E   G+ D + EM   VT+ T +++  
Sbjct  1004  NSGREMEMSDQHNKRQLVIQSVSQHSRKVHRTSE---GVLDVISEMTGLVTSFTNKKE--  1058

Query  492   kKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
                ++ IE+VI  LQA+P++DDD  L        E   KAK FLALD
Sbjct  1059  ---NVSIENVIAALQAVPDIDDDLLLDACDLLEDEK--KAKTFLALD  1100


 Score =   116 bits (290),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = -1

Query  1753  RGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             R    ++S +SS+  R++WT  MD YFI+++L+Q+ +GN     FSKQAW +MI LF+ K
Sbjct  651   RSGHYNESLTSSDRSRTDWTPPMDRYFIDIMLEQVHRGNMIDHKFSKQAWNDMITLFNAK  710

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +   HD DVL++RYK+LRK+Y++ +I L+   F WD+SRQMV  +D  WD YIK  
Sbjct  711   FGSYHDKDVLRSRYKNLRKRYNDMRILLDHTGFAWDESRQMVIADDNTWDAYIKAH  766


 Score =   141 bits (356),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 105/185 (57%), Gaps = 4/185 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE----DKIPTKDD  1162
             HP+   YRTK  P Y++L II+G +  DGR       +D +++   +     ++  T  D
Sbjct  604   HPDARSYRTKTKPNYSDLCIIYGKSSTDGRQKHPGHIMDADDDAPGVRSGHYNESLTSSD  663

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               + DW+  M+++FI +MLEQV  GN ++  F  +AW  MIT FN  FG  + K VL++R
Sbjct  664   RSRTDWTPPMDRYFIDIMLEQVHRGNMIDHKFSKQAWNDMITLFNAKFGSYHDKDVLRSR  723

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
             +  LR++Y  ++ LL   GF W E  QM++A+D  W   IKA    R YR K++  Y D+
Sbjct  724   YKNLRKRYNDMRILLDHTGFAWDESRQMVIADDNTWDAYIKAHPDARSYRTKTMPNYSDL  783

Query  801   SIICG  787
              +I G
Sbjct  784   CLIYG  788


 Score =   123 bits (308),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 81/107 (76%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +   S+  R++WT  MD YFI+L+L+Q+ KGN+   +F+KQAW++M  LF+ K+  +HD 
Sbjct  496   AVVGSDRSRTDWTPSMDRYFIDLMLEQVHKGNKIDHTFTKQAWIDMTDLFNEKFGSQHDK  555

Query  1552  DVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVL++RYK+LRKQY++ KI L+Q  F WD++RQM+T ND+ WD YIK
Sbjct  556   DVLRSRYKNLRKQYNDMKILLDQGGFAWDETRQMITANDDVWDAYIK  602


 Score =   155 bits (393),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 77/197 (39%), Positives = 115/197 (58%), Gaps = 6/197 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV------KILEDKIPT  1171
              HP    YRT+  P YN+L II G++ A G+++    D   E++V      + +E + P 
Sbjct  274   GHPHARSYRTRTFPNYNDLCIIHGNSTAGGKHNQLGQDKHLEDDVLAAKTGEGIESQTPI  333

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              +D  +  W+  M+++FI+L+L+QV  GNK+  TF ++AWI M+T FN  FG ++ K VL
Sbjct  334   SNDRSRTYWTPPMDRYFIELLLDQVHRGNKIGHTFISQAWIDMVTLFNAKFGSRHDKDVL  393

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  LRRQY  +  LL Q GF W E  QM+ A+D VW   IKA    R YR K++  Y
Sbjct  394   KNRYKHLRRQYNDINILLEQSGFSWDETRQMVTADDHVWDAYIKAHPDARSYRIKTVPSY  453

Query  810   KDMSIICGNETPTFQYG  760
              ++ +I G E+   +Y 
Sbjct  454   NNLCLIYGKESVDGRYS  470


 Score =   101 bits (252),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + +S +  R++WT  MD YFI+L+LDQ+Q+GN+   +FSKQAW +M+ LF+ K+  ++  
Sbjct  167   ASTSIDRPRTDWTPSMDRYFIDLMLDQLQRGNKIDHTFSKQAWTDMVILFNEKFSSQYGK  226

Query  1552  DVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              VL++RYK L K   + T +LEQN F WDD++  VT  D+ WD YIK
Sbjct  227   RVLRHRYKKLWKYCSDITVLLEQNGFSWDDTQHRVTAADDIWDVYIK  273


 Score =   140 bits (354),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 74/188 (39%), Positives = 110/188 (59%), Gaps = 4/188 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE----DKIPTKDD  1162
             HP+   Y+TK V  YN+L +I+G+T ADGRYS S  D+D +++V  ++        T  D
Sbjct  113   HPDARSYKTKTVLNYNDLCMIYGYTAADGRYSRSSHDVDIDDDVSSMKIGGSAHASTSID  172

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               + DW+ +M+++FI LML+Q+Q GNK++ TF  +AW  M+  FN  F  QYGK VL+ R
Sbjct  173   RPRTDWTPSMDRYFIDLMLDQLQRGNKIDHTFSKQAWTDMVILFNEKFSSQYGKRVLRHR  232

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
             +  L +    +  LL Q+GF W +    + A D +W   IK   + R YR ++   Y D+
Sbjct  233   YKKLWKYCSDITVLLEQNGFSWDDTQHRVTAADDIWDVYIKGHPHARSYRTRTFPNYNDL  292

Query  801   SIICGNET  778
              II GN T
Sbjct  293   CIIHGNST  300


 Score =   106 bits (265),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  M+ YFI+L+LDQ+ +GN+   +F+KQAW +M+ LF+ K+  ++D DVLK+RY 
Sbjct  13    RTYWTPTMERYFIDLMLDQMHRGNKIGHTFNKQAWTDMLTLFNAKFGSQYDKDVLKSRYT  72

Query  1528  HLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +L KQ+++ KI LEQ+ F WD++RQMV   D  WD Y K+ 
Sbjct  73    NLWKQFNDIKILLEQSGFAWDETRQMVIAEDYVWDAYTKIH  113


 Score =   121 bits (304),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 79/130 (61%), Gaps = 0/130 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT  D  +  W+ TME++FI LML+Q+  GNK+  TF  +AW  M+T FN  FG QY K 
Sbjct  6     PTIGDRSRTYWTPTMERYFIDLMLDQMHRGNKIGHTFNKQAWTDMLTLFNAKFGSQYDKD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK+R+  L +Q+  +K LL Q GF W E  QM++AED VW    K     R Y+ K++ 
Sbjct  66    VLKSRYTNLWKQFNDIKILLEQSGFAWDETRQMVIAEDYVWDAYTKIHPDARSYKTKTVL  125

Query  816   FYKDMSIICG  787
              Y D+ +I G
Sbjct  126   NYNDLCMIYG  135


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 84/115 (73%), Gaps = 1/115 (1%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G ++  + SSS+   ++WT  MD YFIEL+LDQ+  GN+   +F++QAW  M+A+F+ 
Sbjct  813   NIGGLDQQAPSSSDLSSTDWTSEMDHYFIELMLDQVHGGNQVDHTFNEQAWRHMLAMFNA  872

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K++  +D DVL+NRY++L+KQY++ KI L Q+ F WD ++QM+T +D+ W+ Y+K
Sbjct  873   KFESHYDKDVLENRYRNLKKQYNDIKILLNQSGFSWDIAQQMITADDDIWNIYLK  927



>ref|XP_007028030.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 ref|XP_007028031.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 ref|XP_007028032.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY08532.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY08533.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY08534.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=339

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 135/183 (74%), Gaps = 0/183 (0%)
 Frame = -2

Query  1320  MEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKIDWS  1141
             M+ YRTKVVPYY EL +I GH VADGRYSLSCFD+DFENE K  +DK P+  D  KIDW+
Sbjct  1     MQSYRTKVVPYYTELCVICGHIVADGRYSLSCFDVDFENEEKGADDKTPSSCDRTKIDWT  60

Query  1140  ETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQ  961
              TM+Q+F++LML+QV +GNK+  T K KAW+ MIT FN  FG Q+ + VLK R+ +LR Q
Sbjct  61    PTMDQYFLELMLDQVHKGNKVGCTLKKKAWVSMITLFNAKFGLQHSRAVLKNRYKILRSQ  120

Query  960   YFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNE  781
             Y ++K LL++ GF W E  +M++A+DRVW K +K    FRR++NKS+  Y DM IIC NE
Sbjct  121   YASIKTLLTEKGFHWDETQKMVIADDRVWNKYVKEHPEFRRFKNKSMPCYDDMCIICCNE  180

Query  780   TPT  772
             + +
Sbjct  181   STS  183


 Score =   107 bits (268),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 86/140 (61%), Gaps = 4/140 (3%)
 Frame = -1

Query  1753  RGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             +GA +D + SS +  + +WT  MD YF+EL+LDQ+ KGN+   +  K+AW+ MI LF+ K
Sbjct  42    KGA-DDKTPSSCDRTKIDWTPTMDQYFLELMLDQVHKGNKVGCTLKKKAWVSMITLFNAK  100

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQ  1397
             +  +H   VLKNRYK LR QY + K +L +  F WD++++MV  +D  W+ Y+K     +
Sbjct  101   FGLQHSRAVLKNRYKILRSQYASIKTLLTEKGFHWDETQKMVIADDRVWNKYVKEHPEFR  160

Query  1396  KFSNHLKIIAHYILVSFVVC  1337
             +F N  K +  Y  +  + C
Sbjct  161   RFKN--KSMPCYDDMCIICC  178



>ref|XP_008241090.1| PREDICTED: uncharacterized protein LOC103339558 isoform X1 [Prunus 
mume]
Length=452

 Score =   238 bits (607),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 140/185 (76%), Gaps = 1/185 (1%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPEM+ YRTKVV YYNEL II GH VADGRYSLSC+D+DFENE   ++ + P  DD K 
Sbjct  112   AHPEMQLYRTKVVSYYNELCIICGHAVADGRYSLSCYDVDFENEAIGIDCQDPINDDPK-  170

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             I+WS+TM+Q F++LML++V +GNK+ R+FK K+W+ MIT+FN  F FQ+G+ VLK R+++
Sbjct  171   IEWSQTMDQFFVELMLDEVCKGNKVGRSFKKKSWVSMITSFNEKFRFQHGRAVLKNRYSI  230

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
              RR Y ++K LL Q GF W E  Q +VA+DRVW K IKA   FR YRNK++ +Y DM II
Sbjct  231   FRRHYSSIKILLDQRGFKWDETEQKMVADDRVWNKYIKAHPSFRMYRNKAMPYYSDMCII  290

Query  792   CGNET  778
             CGNE 
Sbjct  291   CGNEA  295


 Score =   126 bits (316),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     S+ + LR+NWT   D +FI+LLL+Q+ KGN+T   F KQAW +MI LF+ K+  
Sbjct  1     MNSGFSSTGDHLRANWTPPQDSFFIDLLLEQVSKGNKTGHGFRKQAWADMIVLFNTKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+DTD+LKNRYK LRKQY   K +++Q  F WD+S+QM+T +D  W+DYIK     Q + 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQGNFRWDESQQMITADDSVWNDYIKAHPEMQLYR  120

Query  1387  NHLKIIAHY  1361
                K++++Y
Sbjct  121   T--KVVSYY  127


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+   +  FI L+LEQV +GNK    F+ +AW  MI  FNT FGF+Y   +LK 
Sbjct  10    DHLRANWTPPQDSFFIDLLLEQVSKGNKTGHGFRKQAWADMIVLFNTKFGFKYDTDILKN  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA    + YR K +S+Y +
Sbjct  70    RYKRLRKQYSEMKSLVDQGNFRWDESQQMITADDSVWNDYIKAHPEMQLYRTKVVSYYNE  129

Query  804   MSIICGNETPTFQYG  760
             + IICG+     +Y 
Sbjct  130   LCIICGHAVADGRYS  144


 Score = 94.4 bits (233),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+  MD +F+EL+LD++ KGN+   SF K++W+ MI  F+ K++ +H   VLKNRY   R
Sbjct  173   WSQTMDQFFVELMLDEVCKGNKVGRSFKKKSWVSMITSFNEKFRFQHGRAVLKNRYSIFR  232

Query  1519  KQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             + Y + KI L+Q  F WD++ Q +  +D  W+ YIK 
Sbjct  233   RHYSSIKILLDQRGFKWDETEQKMVADDRVWNKYIKA  269



>ref|XP_008241091.1| PREDICTED: uncharacterized protein LOC103339558 isoform X2 [Prunus 
mume]
Length=450

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 139/185 (75%), Gaps = 3/185 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPEM+ YRTKVV YYNEL II GH VADGRYSLSC+D+DFENE    +D  P  DD K 
Sbjct  112   AHPEMQLYRTKVVSYYNELCIICGHAVADGRYSLSCYDVDFENEGIDCQD--PINDDPK-  168

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             I+WS+TM+Q F++LML++V +GNK+ R+FK K+W+ MIT+FN  F FQ+G+ VLK R+++
Sbjct  169   IEWSQTMDQFFVELMLDEVCKGNKVGRSFKKKSWVSMITSFNEKFRFQHGRAVLKNRYSI  228

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
              RR Y ++K LL Q GF W E  Q +VA+DRVW K IKA   FR YRNK++ +Y DM II
Sbjct  229   FRRHYSSIKILLDQRGFKWDETEQKMVADDRVWNKYIKAHPSFRMYRNKAMPYYSDMCII  288

Query  792   CGNET  778
             CGNE 
Sbjct  289   CGNEA  293


 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/129 (47%), Positives = 87/129 (67%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     S+ + LR+NWT   D +FI+LLL+Q+ KGN+T   F KQAW +MI LF+ K+  
Sbjct  1     MNSGFSSTGDHLRANWTPPQDSFFIDLLLEQVSKGNKTGHGFRKQAWADMIVLFNTKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+DTD+LKNRYK LRKQY   K +++Q  F WD+S+QM+T +D  W+DYIK     Q + 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQGNFRWDESQQMITADDSVWNDYIKAHPEMQLYR  120

Query  1387  NHLKIIAHY  1361
                K++++Y
Sbjct  121   T--KVVSYY  127


 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 79/135 (59%), Gaps = 0/135 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+   +  FI L+LEQV +GNK    F+ +AW  MI  FNT FGF+Y   +LK 
Sbjct  10    DHLRANWTPPQDSFFIDLLLEQVSKGNKTGHGFRKQAWADMIVLFNTKFGFKYDTDILKN  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA    + YR K +S+Y +
Sbjct  70    RYKRLRKQYSEMKSLVDQGNFRWDESQQMITADDSVWNDYIKAHPEMQLYRTKVVSYYNE  129

Query  804   MSIICGNETPTFQYG  760
             + IICG+     +Y 
Sbjct  130   LCIICGHAVADGRYS  144


 Score = 94.4 bits (233),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+  MD +F+EL+LD++ KGN+   SF K++W+ MI  F+ K++ +H   VLKNRY   R
Sbjct  171   WSQTMDQFFVELMLDEVCKGNKVGRSFKKKSWVSMITSFNEKFRFQHGRAVLKNRYSIFR  230

Query  1519  KQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             + Y + KI L+Q  F WD++ Q +  +D  W+ YIK 
Sbjct  231   RHYSSIKILLDQRGFKWDETEQKMVADDRVWNKYIKA  267



>ref|XP_008379252.1| PREDICTED: uncharacterized protein LOC103442253 [Malus domestica]
Length=777

 Score =   162 bits (410),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 131/335 (39%), Positives = 179/335 (53%), Gaps = 23/335 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK--  1156
             HP+   YR K +P YN+LR+IF     DGRYS   F+ D   E+  L       D     
Sbjct  441   HPDARSYRVKTIPGYNKLRVIFEEETYDGRYSRLAFNSDPSGELADLMTGAEKNDTPYIP  500

Query  1155  ----KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
                  IDW+ TM+++FI LM++Q+  GNK+N TF  +AW  M+ +FN  FG Q  K  L+
Sbjct  501   VLPLPIDWTPTMDRYFIDLMIDQLHSGNKINHTFNEQAWAQMLESFNMKFGIQCDKHALE  560

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +Q+  +  +L+  GFMW E  QMI AED +W+  IK       YRN  L  Y 
Sbjct  561   DRYACLVKQHDCISSILTHAGFMWDETQQMITAEDDIWEAYIKEHPDAISYRNAFLGGYS  620

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPI---IQTTGKEGNLreveeivedddereEKKC  637
             D+S IC N     ++    V  G    PI   I+  G  G+L+ + E VE  D++ ++  
Sbjct  621   DLSKICVNRELDGKFSGQGV--GMQAGPIVFEIEMNGASGDLQLLAEDVEISDQQRKRP-  677

Query  636   RYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
                T  P  P  G S+  ++T  +   + A  EMV  VT L   + K+K N   IE  I 
Sbjct  678   ---TLTPPNP--GRSKKAQKTGKDT--QKAPTEMVGGVTKLA--DNKEKNNCTSIEKAID  728

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              LQA+P M  DD+L+LDACD LED+ KAK FLALD
Sbjct  729   ALQALPGM--DDELMLDACDLLEDERKAKTFLALD  761


 Score =   114 bits (284),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -1

Query  1780  SSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWL  1601
             +S + A + +G+    + + SE  R+ WT +MD Y +ELL DQ+ +GN+   +F  QAW 
Sbjct  320   TSHVKAGEGKGSQ---TPNVSERSRTYWTPIMDRYLLELLQDQVHRGNKLGQTFITQAWN  376

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDD  1424
             +M+  F+ ++K  HD DVLKNR+KH RKQY++ KI L+   F WD+SR+MVT  D  WD 
Sbjct  377   DMVVSFNVRFKSHHDKDVLKNRFKHWRKQYNDIKILLKHGGFSWDESREMVTAEDSVWDG  436

Query  1423  YIK  1415
             YIK
Sbjct  437   YIK  439


 Score =   141 bits (355),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 105/189 (56%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDK------IPTK  1168
             HP+  PYRTK V  +NEL +I+G+T ADGRYS S  D+D ++E + +          P+ 
Sbjct  114   HPDARPYRTKPVLNFNELCLIYGYTTADGRYSRSSHDVDLDDEGQGVTTGDGMGSLAPSS  173

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              +  + +WS  M+Q+FI +MLEQV  GNK +  F  +AW  M+  FN  FG Q+   VL+
Sbjct  174   SERPRTEWSLEMDQYFIDIMLEQVSIGNKPDNAFNKQAWTVMLAKFNEEFGPQHSLRVLR  233

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y     LL Q  F W E   MIVA+D VW    K + + R Y+ K+L    
Sbjct  234   HRYKKLLKYYSDATILLRQKDFSWDETQHMIVADDEVWDAYTKVRPHARTYKTKALPNLF  293

Query  807   DMSIICGNE  781
              MS++   E
Sbjct  294   SMSLLFTTE  302


 Score =   108 bits (271),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 77/108 (71%), Gaps = 1/108 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + ++S+  R+ WT  M+ YFI+L+L+Q+ +G R   +F+KQAW EM+++F+ ++   +D 
Sbjct  6     AAANSDRSRTYWTPTMERYFIDLMLEQLHRGARVGHTFNKQAWTEMLSVFNAQFGSHYDK  65

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             DVLK+RY  L KQ+++ K IL QN F WD+SRQMV  +D  WD YIKV
Sbjct  66    DVLKSRYTTLWKQFNDVKNILGQNGFSWDESRQMVVADDYIWDAYIKV  113


 Score =   108 bits (271),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 64/194 (33%), Positives = 96/194 (49%), Gaps = 7/194 (4%)
 Frame = -2

Query  1326  PEMEPYRTKVVPYYNELRIIFGHTV---ADGRYSLSCFDIDFENEVKILEDK---IPTKD  1165
             P    Y+TK +P    + ++F        D    L   ++D  + VK  E K    P   
Sbjct  279   PHARTYKTKALPNLFSMSLLFTTECDLGTDNHLHLQK-NLDDTSHVKAGEGKGSQTPNVS  337

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  +  W+  M+++ ++L+ +QV  GNKL +TF  +AW  M+ +FN  F   + K VLK 
Sbjct  338   ERSRTYWTPIMDRYLLELLQDQVHRGNKLGQTFITQAWNDMVVSFNVRFKSHHDKDVLKN  397

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             RF   R+QY  +K LL   GF W E  +M+ AED VW   IK     R YR K++  Y  
Sbjct  398   RFKHWRKQYNDIKILLKHGGFSWDESREMVTAEDSVWDGYIKNHPDARSYRVKTIPGYNK  457

Query  804   MSIICGNETPTFQY  763
             + +I   ET   +Y
Sbjct  458   LRVIFEEETYDGRY  471


 Score = 99.0 bits (245),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 73/114 (64%), Gaps = 1/114 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   + SSSE  R+ W+  MD YFI+++L+Q+  GN+   +F+KQAW  M+A F+ ++ 
Sbjct  165   GMGSLAPSSSERPRTEWSLEMDQYFIDIMLEQVSIGNKPDNAFNKQAWTVMLAKFNEEFG  224

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
              +H   VL++RYK L K Y +  I L Q +F WD+++ M+  +DE WD Y KV+
Sbjct  225   PQHSLRVLRHRYKKLLKYYSDATILLRQKDFSWDETQHMIVADDEVWDAYTKVR  278


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 79/134 (59%), Gaps = 0/134 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+ TME++FI LMLEQ+  G ++  TF  +AW  M++ FN  FG  Y K VLK+
Sbjct  11    DRSRTYWTPTMERYFIDLMLEQLHRGARVGHTFNKQAWTEMLSVFNAQFGSHYDKDVLKS  70

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  L +Q+  VK +L Q+GF W E  QM+VA+D +W   IK     R YR K +  + +
Sbjct  71    RYTTLWKQFNDVKNILGQNGFSWDESRQMVVADDYIWDAYIKVHPDARPYRTKPVLNFNE  130

Query  804   MSIICGNETPTFQY  763
             + +I G  T   +Y
Sbjct  131   LCLIYGYTTADGRY  144


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 76/135 (56%), Gaps = 2/135 (1%)
 Frame = -1

Query  1813  GLIPRLPY-SYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGN  1637
             G   RL + S  S  L+ L       D        L  +WT  MD YFI+L++DQ+  GN
Sbjct  469   GRYSRLAFNSDPSGELADLMTGAEKNDTPYIPVLPLPIDWTPTMDRYFIDLMIDQLHSGN  528

Query  1636  RTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSR  1460
             + + +F++QAW +M+  F+ K+  + D   L++RY  L KQ+   + IL    F+WD+++
Sbjct  529   KINHTFNEQAWAQMLESFNMKFGIQCDKHALEDRYACLVKQHDCISSILTHAGFMWDETQ  588

Query  1459  QMVTGNDEKWDDYIK  1415
             QM+T  D+ W+ YIK
Sbjct  589   QMITAEDDIWEAYIK  603



>ref|XP_008220650.1| PREDICTED: uncharacterized protein LOC103320717 [Prunus mume]
Length=776

 Score =   157 bits (396),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/336 (35%), Positives = 172/336 (51%), Gaps = 25/336 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPTK  1168
             HP+   YR K VP YN+L +IFG   +DGRYS    + D   E+  L       D+  T 
Sbjct  440   HPDARQYRVKTVPGYNKLCVIFGEENSDGRYSRLACNSDPCGELPFLMTGEEKNDQTHTG  499

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
                 ++DW+  M+++FI LML+Q+ +GNK++ TF  +AW HM+ +FN  FG Q  K VL+
Sbjct  500   VVPLRMDWTPAMDRYFIDLMLDQLHQGNKIDHTFNEQAWAHMLESFNMKFGLQCDKYVLE  559

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +Q+  +  LL+  GFMW E  QMI A++  W+  IK      +YRN  L  Y 
Sbjct  560   DRYLCLVKQHDYISILLNHSGFMWDESQQMITADNDTWEAYIKEHPDAIQYRNAFLGSYS  619

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPI-IQTTGKEGNLreveeivedddereEKKCRY  631
             D+S I  N     ++    V      + + I+     G+L           +   +    
Sbjct  620   DLSKIFINTELDGKFSDQGVGMEAGLIALEIEMDSASGDL-----------KLLAEDIEM  668

Query  630   DTKEPKEPCKGPSEINEETEIE---IGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVI  460
               ++ K P   PS     T+ +     M+ A+ EM   VT L   ++     S  IE  I
Sbjct  669   SDQQRKRPTVMPSNSGRSTKAQKTGKDMQKALAEMAGLVTKLANNKEDSNYKS--IESAI  726

Query  459   YILQAMPEMdddddllldacdfledDNKAKVFLALD  352
               LQA+P+M  DD+L+LDACD LED+ KAK FLALD
Sbjct  727   DALQAIPDM--DDELMLDACDLLEDERKAKTFLALD  760


 Score =   116 bits (291),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + + S+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  +AW++M+  F+ +++  HD 
Sbjct  332   TPTVSDRTRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITRAWIDMVTSFNAQFRSHHDK  391

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNRYKHLR+QY++ K +LE   F+WD+SR+M+T  D  WD Y+K
Sbjct  392   DVLKNRYKHLRRQYNDIKNLLEHGGFLWDESREMITAEDNVWDGYVK  438


 Score =   162 bits (410),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 116/189 (61%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PTK  1168
             HP+   Y+TK V  +++L +I+G+T ADGRYS S  D+DF++EV+   + D +    P+ 
Sbjct  113   HPDARLYKTKAVLNFSDLCLIYGYTTADGRYSRSSHDLDFDDEVQGVAMGDGMGTLAPSS  172

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              +  + DWS  M+Q+F+ LML+QV  GNK + TF  KAW  M+  FN  FG Q+GK VL+
Sbjct  173   SERPRTDWSTAMDQYFVDLMLDQVGRGNKTDNTFNKKAWTDMLAKFNEEFGPQHGKRVLR  232

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y     LL ++ F W E+  MIVA+D VW    KA  + R YR K+L  Y 
Sbjct  233   HRYKKLLKYYSDAATLLRKNDFSWDEKRNMIVADDDVWDAYTKAHPHARTYRTKTLPNYY  292

Query  807   DMSIICGNE  781
             DM +I G+E
Sbjct  293   DMFLIFGSE  301


 Score =   101 bits (252),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + ++++  R+ WT  M+ YFI+L+L+Q+ +G R+  +F+KQAW +M+ +F+ K+   +D 
Sbjct  5     TAATNDRSRTYWTPAMERYFIDLMLEQMHRGTRSGHTFNKQAWTDMLTMFNGKFDSHYDK  64

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             DVLK+RY  L KQ+++ K IL Q+ F WD++ QMV  +D  WD YIKV 
Sbjct  65    DVLKSRYTSLWKQFNDVKNILGQSGFSWDEACQMVVADDYIWDAYIKVH  113


 Score =   142 bits (359),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 114/215 (53%), Gaps = 16/215 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG--RYSLSCFDIDFENEVKILEDK---IPTK  1168
             AHP    YRTK +P Y ++ +IFG     G   +     D+D  ++VK+ E K    PT 
Sbjct  276   AHPHARTYRTKTLPNYYDMFLIFGSEPDLGIDNHLHPQKDVDDISKVKVGEGKGGQTPTV  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D  +  W+  M+++ I L+L+QV  GNKL +TF  +AWI M+T+FN  F   + K VLK
Sbjct  336   SDRTRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITRAWIDMVTSFNAQFRSHHDKDVLK  395

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LRRQY  +K LL   GF+W E  +MI AED VW   +K     R+YR K++  Y 
Sbjct  396   NRYKHLRRQYNDIKNLLEHGGFLWDESREMITAEDNVWDGYVKNHPDARQYRVKTVPGYN  455

Query  807   DMSIICGNETPTFQYG-----------YPFVKAGE  736
              + +I G E    +Y             PF+  GE
Sbjct  456   KLCVIFGEENSDGRYSRLACNSDPCGELPFLMTGE  490


 Score =   103 bits (256),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + SSSE  R++W+  MD YF++L+LDQ+ +GN+T  +F+K+AW +M+A F+ ++  +H  
Sbjct  169   APSSSERPRTDWSTAMDQYFVDLMLDQVGRGNKTDNTFNKKAWTDMLAKFNEEFGPQHGK  228

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
              VL++RYK L K Y +   +L +N+F WD+ R M+  +D+ WD Y K  
Sbjct  229   RVLRHRYKKLLKYYSDAATLLRKNDFSWDEKRNMIVADDDVWDAYTKAH  277


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +  W+  ME++FI LMLEQ+  G +   TF  +AW  M+T FN  F   Y K VLK
Sbjct  9     NDRSRTYWTPAMERYFIDLMLEQMHRGTRSGHTFNKQAWTDMLTMFNGKFDSHYDKDVLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L +Q+  VK +L Q GF W E  QM+VA+D +W   IK     R Y+ K++  + 
Sbjct  69    SRYTSLWKQFNDVKNILGQSGFSWDEACQMVVADDYIWDAYIKVHPDARLYKTKAVLNFS  128

Query  807   DMSIICGNETPTFQY  763
             D+ +I G  T   +Y
Sbjct  129   DLCLIYGYTTADGRY  143


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 80/137 (58%), Gaps = 13/137 (9%)
 Frame = -1

Query  1822  EKCGLIPRLPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQK  1643
             + CG    LP+  T       KN     D + +    LR +WT  MD YFI+L+LDQ+ +
Sbjct  478   DPCG---ELPFLMTGEE----KN-----DQTHTGVVPLRMDWTPAMDRYFIDLMLDQLHQ  525

Query  1642  GNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDD  1466
             GN+   +F++QAW  M+  F+ K+  + D  VL++RY  L KQ+    I L  + F+WD+
Sbjct  526   GNKIDHTFNEQAWAHMLESFNMKFGLQCDKYVLEDRYLCLVKQHDYISILLNHSGFMWDE  585

Query  1465  SRQMVTGNDEKWDDYIK  1415
             S+QM+T +++ W+ YIK
Sbjct  586   SQQMITADNDTWEAYIK  602



>ref|XP_007221952.1| hypothetical protein PRUPE_ppa001711mg [Prunus persica]
 gb|EMJ23151.1| hypothetical protein PRUPE_ppa001711mg [Prunus persica]
Length=775

 Score =   156 bits (395),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 119/337 (35%), Positives = 171/337 (51%), Gaps = 24/337 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK--  1156
             HP+   YR K VP YN+L +IFG   +DGRYS    + D   E+  L       D +   
Sbjct  440   HPDARQYRVKTVPGYNKLCVIFGEENSDGRYSRLACNSDPCGELPFLMTGEEKNDQSHTG  499

Query  1155  ---KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                ++DW+  M+++FI LML+Q+ +GNK++ TF  +AW HM+ +FN  FG Q  K VL+ 
Sbjct  500   VPLRMDWTPAMDRYFIDLMLDQLHQGNKIDHTFNEQAWAHMLESFNMKFGLQCDKYVLED  559

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  L +Q+  +  LL+  GFMW E  QMI A++  W+  IK      +YRN  L  Y D
Sbjct  560   RYLCLVKQHDYISILLNHSGFMWDESQQMITADNDTWEAYIKEHPDAIQYRNAFLGSYSD  619

Query  804   MSIICGNETPTFQYGYPFVKAGEFCVPI-IQTTGKEGNLreveeivedddereEKKCRYD  628
             +S I  N     ++    V      V + I+     G+L           +   +     
Sbjct  620   LSKIFINTELDGKFSGQGVGMEAGLVALEIEMDRASGDL-----------QLLAEDIEMS  668

Query  627   TKEPKEPCKGPSEINEET---EIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
              ++ K P   PS     T   + +  M+ A+ EM   VT L   ++     S  IE  I 
Sbjct  669   DQQRKRPTVMPSNSGRSTKAQKTDKDMQKALAEMAGLVTKLANNKEDSNYKS--IESAID  726

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALDPG  346
              LQA+P+M  DD+L+LDACD LED+ KAK FLALD  
Sbjct  727   ALQAIPDM--DDELMLDACDLLEDERKAKTFLALDAA  761


 Score =   115 bits (287),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + + S+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  +AW++M+  F+ +++  HD 
Sbjct  332   TPTVSDRTRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITRAWIDMVTSFNARFRSHHDK  391

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNRYKHLR+QY++ K +LE   F+WD+SR+M+   D  WD Y+K
Sbjct  392   DVLKNRYKHLRRQYNDIKNLLEHGGFLWDESREMIAAEDNVWDGYVK  438


 Score =   166 bits (420),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 117/189 (62%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PTK  1168
             HP+  PY+TK V  +++L +I+G+T ADGRYS S  D+DF++EV+   + D +    P+ 
Sbjct  113   HPDARPYKTKAVLNFSDLCLIYGYTTADGRYSRSSHDLDFDDEVQGVAMGDGMGTLAPSS  172

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              +  + DWS  M+Q+F+ LML+QV  GNK + TF  KAW  M+  FN  FG Q+GK VL+
Sbjct  173   SERPRTDWSPAMDQYFVDLMLDQVGRGNKTDNTFNKKAWTDMLAKFNEEFGPQHGKRVLR  232

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y     LL ++ F W E+  MIVA+D VW    KA  + R YR K+L  Y 
Sbjct  233   HRYKKLLKYYSDAATLLRKNDFSWDEKRNMIVADDDVWDAYTKAHPHSRTYRTKTLPNYY  292

Query  807   DMSIICGNE  781
             DM +I G+E
Sbjct  293   DMFLIFGSE  301


 Score =   101 bits (252),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + ++++  R+ WT  M+ YFI+L+L+Q+ +G R+  +F+KQAW +M+ +F+ K+   +D 
Sbjct  5     TAATNDRSRTYWTPAMERYFIDLMLEQMHRGTRSGHTFNKQAWTDMLTMFNGKFDSHYDK  64

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             DVLK+RY  L KQ+++ K IL Q+ F WD++ QMV  +D  WD YIKV 
Sbjct  65    DVLKSRYTSLWKQFNDVKNILGQSGFSWDEACQMVVADDYIWDAYIKVH  113


 Score =   142 bits (358),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 81/215 (38%), Positives = 114/215 (53%), Gaps = 16/215 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG--RYSLSCFDIDFENEVKILEDK---IPTK  1168
             AHP    YRTK +P Y ++ +IFG     G   +     D+D  ++VK+ E K    PT 
Sbjct  276   AHPHSRTYRTKTLPNYYDMFLIFGSEPDLGIDNHLHPQKDVDDISKVKVGEGKGGQTPTV  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D  +  W+  M+++ I L+L+QV  GNKL +TF  +AWI M+T+FN  F   + K VLK
Sbjct  336   SDRTRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITRAWIDMVTSFNARFRSHHDKDVLK  395

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LRRQY  +K LL   GF+W E  +MI AED VW   +K     R+YR K++  Y 
Sbjct  396   NRYKHLRRQYNDIKNLLEHGGFLWDESREMIAAEDNVWDGYVKNHPDARQYRVKTVPGYN  455

Query  807   DMSIICGNETPTFQYG-----------YPFVKAGE  736
              + +I G E    +Y             PF+  GE
Sbjct  456   KLCVIFGEENSDGRYSRLACNSDPCGELPFLMTGE  490


 Score =   103 bits (257),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + SSSE  R++W+  MD YF++L+LDQ+ +GN+T  +F+K+AW +M+A F+ ++  +H  
Sbjct  169   APSSSERPRTDWSPAMDQYFVDLMLDQVGRGNKTDNTFNKKAWTDMLAKFNEEFGPQHGK  228

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
              VL++RYK L K Y +   +L +N+F WD+ R M+  +D+ WD Y K  
Sbjct  229   RVLRHRYKKLLKYYSDAATLLRKNDFSWDEKRNMIVADDDVWDAYTKAH  277


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 77/135 (57%), Gaps = 0/135 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +  W+  ME++FI LMLEQ+  G +   TF  +AW  M+T FN  F   Y K VLK
Sbjct  9     NDRSRTYWTPAMERYFIDLMLEQMHRGTRSGHTFNKQAWTDMLTMFNGKFDSHYDKDVLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L +Q+  VK +L Q GF W E  QM+VA+D +W   IK     R Y+ K++  + 
Sbjct  69    SRYTSLWKQFNDVKNILGQSGFSWDEACQMVVADDYIWDAYIKVHPDARPYKTKAVLNFS  128

Query  807   DMSIICGNETPTFQY  763
             D+ +I G  T   +Y
Sbjct  129   DLCLIYGYTTADGRY  143


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKY  1571
             G  ++D   +   LR +WT  MD YFI+L+LDQ+ +GN+   +F++QAW  M+  F+ K+
Sbjct  489   GEEKNDQSHTGVPLRMDWTPAMDRYFIDLMLDQLHQGNKIDHTFNEQAWAHMLESFNMKF  548

Query  1570  KCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               + D  VL++RY  L KQ+    I L  + F+WD+S+QM+T +++ W+ YIK
Sbjct  549   GLQCDKYVLEDRYLCLVKQHDYISILLNHSGFMWDESQQMITADNDTWEAYIK  601



>ref|XP_010548574.1| PREDICTED: uncharacterized protein LOC104819951 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010548575.1| PREDICTED: uncharacterized protein LOC104819951 isoform X1 [Tarenaya 
hassleriana]
Length=748

 Score =   170 bits (431),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 118/187 (63%), Gaps = 4/187 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILEDKIPTKDDA  1159
             HPE   Y+TK V  +N+L +I+G+TVADGRYS S  DIDFE+E   V + E  I T +D 
Sbjct  112   HPEARVYKTKAVLNFNDLCLIYGYTVADGRYSRSSHDIDFEDEFQGVNMGESSINT-NDC  170

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              + +W+  M+Q+FI+LML+Q+   NK    F  +AW  M+  FN  FG QYGK VL+ R+
Sbjct  171   PRTEWTPVMDQYFIELMLDQIGRRNKTGDAFSKQAWTDMLVLFNARFGAQYGKRVLRHRY  230

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
             N L + Y  +K ++S+DGF W E  QMI A+D VW   IK   + R YR ++L  Y D+ 
Sbjct  231   NKLLKYYKDMKVIVSKDGFSWDETLQMIAADDDVWDSYIKEHPHARTYRMRTLPNYNDLE  290

Query  798   IICGNET  778
             II GN T
Sbjct  291   IIFGNPT  297


 Score =   100 bits (250),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
              SS++  R+ WT  M+ +FI+L+L+ + +GNR   +F+KQAW EMI +F+ K+  ++D D
Sbjct  5     ASSNDRTRTYWTPSMERFFIDLMLEHMHRGNRIGHTFNKQAWNEMINVFNVKFGSQYDKD  64

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             VLK+RY +L KQY++ K +L  + F WD+++QMV G++  W  YIKV
Sbjct  65    VLKSRYTNLWKQYNSVKNLLGHDGFSWDENQQMVIGDENVWSAYIKV  111


 Score =   145 bits (366),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 116/217 (53%), Gaps = 5/217 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADG---RYSLSCFDIDFENEVKILEDK-IPTKD-  1165
             HP    YR + +P YN+L IIFG+    G      LS   ID  +  K  E K I TK+ 
Sbjct  272   HPHARTYRMRTLPNYNDLEIIFGNPTDQGILPHPVLSKELIDDSSAAKTDERKTIQTKNS  331

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+  M+++ I L+++QV +GNK+ +TF    WI M+TAFN  FG  + K VLK 
Sbjct  332   DRTRTFWTPPMDRYLIDLLVDQVHKGNKVGQTFITSGWIEMVTAFNAKFGSLHNKDVLKN  391

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             RF  LRR Y  + +LL Q+GF+W  R  M++AED +W   I+A    R YR K +  Y+ 
Sbjct  392   RFKHLRRLYNDITFLLQQNGFLWDARRDMVIAEDSIWDTYIQAHPEARSYRVKMVPSYQK  451

Query  804   MSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGN  694
             M +I G E P  +Y +            +  TG E N
Sbjct  452   MCLIFGKEMPDRRYTHLAQAFEPNIAEAVTMTGDEKN  488


 Score =   104 bits (259),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M + S ++++  R+ WT VMD YFIEL+LDQI + N+T  +FSKQAW +M+ LF+ ++  
Sbjct  160   MGESSINTNDCPRTEWTPVMDQYFIELMLDQIGRRNKTGDAFSKQAWTDMLVLFNARFGA  219

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             ++   VL++RY  L K Y + K I+ ++ F WD++ QM+  +D+ WD YIK
Sbjct  220   QYGKRVLRHRYNKLLKYYKDMKVIVSKDGFSWDETLQMIAADDDVWDSYIK  270


 Score =   115 bits (288),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + +D  +  W+ +ME+ FI LMLE +  GN++  TF  +AW  MI  FN  FG QY K V
Sbjct  6     SSNDRTRTYWTPSMERFFIDLMLEHMHRGNRIGHTFNKQAWNEMINVFNVKFGSQYDKDV  65

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY +VK LL  DGF W E  QM++ ++ VW   IK     R Y+ K++  
Sbjct  66    LKSRYTNLWKQYNSVKNLLGHDGFSWDENQQMVIGDENVWSAYIKVHPEARVYKTKAVLN  125

Query  813   YKDMSIICG  787
             + D+ +I G
Sbjct  126   FNDLCLIYG  134


 Score =   107 bits (266),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S+  R+ WT  MD Y I+LL+DQ+ KGN+   +F    W+EM+  F+ K+   H+ DVL
Sbjct  330   NSDRTRTFWTPPMDRYLIDLLVDQVHKGNKVGQTFITSGWIEMVTAFNAKFGSLHNKDVL  389

Query  1543  KNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNR+KHLR+ Y++ T +L+QN F+WD  R MV   D  WD YI  Q   +  S  +K++ 
Sbjct  390   KNRFKHLRRLYNDITFLLQQNGFLWDARRDMVIAEDSIWDTYI--QAHPEARSYRVKMVP  447

Query  1366  HY  1361
              Y
Sbjct  448   SY  449


 Score =   103 bits (258),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILEDK----IPT  1171
             AHPE   YR K+VP Y ++ +IFG  + D RY+     F+ +    V +  D+    +  
Sbjct  434   AHPEARSYRVKMVPSYQKMCLIFGKEMPDRRYTHLAQAFEPNIAEAVTMTGDEKNDYLCG  493

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D    +W++ M++  I LMLEQV  GNK+  TF  +AW  M+ +F+  FG Q    +L
Sbjct  494   SMDPPCTEWTQVMDRCLIDLMLEQVNSGNKIGETFTEQAWADMVESFSKKFGIQTDIYIL  553

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAE-DRVWKKVIKAQQYFRRYRNKSLS-  817
             + R+  L ++   +  +LS   F W E  Q IVA+ D  W+  IK       YR K L  
Sbjct  554   ENRYIYLMKERDDINNILSHCDFSWDENKQTIVADGDESWESYIKEHPDAIMYRGKLLGD  613

Query  816   FYKDMSII  793
              Y+D+  I
Sbjct  614   CYRDLCKI  621


 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             C S +   + WT VMD   I+L+L+Q+  GN+   +F++QAW +M+  FS K+  + D  
Sbjct  492   CGSMDPPCTEWTQVMDRCLIDLMLEQVNSGNKIGETFTEQAWADMVESFSKKFGIQTDIY  551

Query  1549  VLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQ-MVTGNDEKWDDYIK  1415
             +L+NRY +L K+  +   IL   +F WD+++Q +V   DE W+ YIK
Sbjct  552   ILENRYIYLMKERDDINNILSHCDFSWDENKQTIVADGDESWESYIK  598



>gb|KDP23537.1| hypothetical protein JCGZ_23370 [Jatropha curcas]
Length=1077

 Score =   155 bits (393),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 83/212 (39%), Positives = 133/212 (63%), Gaps = 13/212 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKIPTKDDA  1159
             AHP+ + Y+ K +  +N+L +I+ +T ADGRYS S  D+D +++++  ++   +P   + 
Sbjct  112   AHPDAQFYKRKSLMNFNDLCLIYAYTAADGRYSRSSHDVDVDDDIQGLVIGSILPATSER  171

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              K +W+  M++HFI+LML+Q+++GNK +RTF  +AW  ++T FN  F  Q+GK+ LK R+
Sbjct  172   VKSEWTSAMDRHFIELMLDQLKKGNKRDRTFSKQAWKDILTLFNAKFCSQHGKIFLKRRY  231

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               L + Y  ++ LL + GF W ER QMIVA+D VW+K  KA+   R Y+ ++LS Y ++S
Sbjct  232   KKLFKYYSDIRSLLEKKGFSWDERQQMIVADDAVWEKTTKARPDTRSYQKRTLSNYHELS  291

Query  798   IICGNET-----------PTFQYGYPFVKAGE  736
             +I GN+              F+ G   VKAGE
Sbjct  292   LIYGNQVINGHLDHMHLDKNFEDGTVQVKAGE  323


 Score =   114 bits (285),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 73/101 (72%), Gaps = 1/101 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R NWT +M+ YFIEL+LDQ+ KGNR   +F+KQAW +M+ +F+ K+  K+D D LK+ Y 
Sbjct  13    RMNWTPLMERYFIELMLDQMHKGNRMGHTFNKQAWTDMLTMFNAKFGTKYDRDTLKSHYT  72

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +L KQY++ K +LEQN F WDD+R+MV  ND  WD +IK  
Sbjct  73    NLWKQYNDVKSLLEQNGFSWDDTRKMVVANDGVWDAFIKAH  113


 Score =   133 bits (335),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 109/198 (55%), Gaps = 6/198 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN---EVKILEDK---IPT  1171
             A P+   Y+ + +  Y+EL +I+G+ V +G       D +FE+   +VK  E+K   + T
Sbjct  272   ARPDTRSYQKRTLSNYHELSLIYGNQVINGHLDHMHLDKNFEDGTVQVKAGEEKDVYLLT  331

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             + +     WS  M+++ I L+ +Q   GNK+      +AWI MI +FN  FG    K +L
Sbjct  332   RSNGLGPCWSPAMDRYLIDLLQDQALRGNKIGHELTTEAWIEMIGSFNERFGSHLEKNIL  391

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  LR+QY  + +LL Q+GF W E  +M++AED VW   IK     R YRNKS+  Y
Sbjct  392   KNRYEHLRKQYSGINFLLEQNGFSWDEHREMVIAEDYVWDSFIKVHPDARSYRNKSVPSY  451

Query  810   KDMSIICGNETPTFQYGY  757
               + +I G E+   ++ +
Sbjct  452   HKLCVIFGEESSNGRHSH  469


 Score = 94.4 bits (233),  Expect(2) = 5e-50, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++SE ++S WT  MD +FIEL+LDQ++KGN+   +FSKQAW +++ LF+ K+  +H    
Sbjct  167   ATSERVKSEWTSAMDRHFIELMLDQLKKGNKRDRTFSKQAWKDILTLFNAKFCSQHGKIF  226

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             LK RYK L K Y + + +LE+  F WD+ +QM+  +D  W+   K +
Sbjct  227   LKRRYKKLFKYYSDIRSLLEKKGFSWDERQQMIVADDAVWEKTTKAR  273


 Score =   125 bits (313),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 67/187 (36%), Positives = 109/187 (58%), Gaps = 5/187 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL-----EDKIPTKD  1165
             +P+   Y    +P YN+L +IFG T  +GR + SC  +D ++ V  L     +D  P   
Sbjct  745   NPDARSYCNSALPNYNDLFLIFGDTNNNGRLNYSCHLMDTDDYVLGLNVAEDDDPSPVDY  804

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D ++I+W+++ME +FI+L+LEQV +GNK+ +T   +AW  +I +FN   G    K  +++
Sbjct  805   DPQQINWTKSMEIYFIELVLEQVLKGNKVGQTLNEQAWSWIIASFNEQLGLVCDKDAVES  864

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
              +  L  +Y  +  LL+Q+GF W E  Q I+A+D  W+  IK      +YR++ LS Y D
Sbjct  865   WYLSLMEEYNNITDLLNQNGFYWDETEQTIIADDIDWQFYIKEHPGAIKYRDRILSSYND  924

Query  804   MSIICGN  784
             + +I GN
Sbjct  925   LCMIYGN  931


 Score = 88.6 bits (218),  Expect(2) = 9e-46, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 75/113 (66%), Gaps = 5/113 (4%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKY  1571
             GA  +++C S    R++WT  MD +FI+L+L+ +++G+  +  F+KQAW  M+A FS ++
Sbjct  635   GAKVNNNCCS----RTDWTPPMDRFFIDLMLEHVRQGSMVNLRFNKQAWNNMVAKFSAEF  690

Query  1570  KCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               ++D DVL++ +  L K++ + K +L+Q  F WD+ RQM+  +D+ W+ Y K
Sbjct  691   GSQYDKDVLRSHFMILGKRFSSMKNLLDQKGFEWDEVRQMIIADDDTWNSYAK  743


 Score =   119 bits (298),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 99/192 (52%), Gaps = 12/192 (6%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P    Y+T+  P YN+L +I+G++ +DG    S       N                + 
Sbjct  599   NPNARSYKTECKPNYNDLYLIYGNSNSDGGVHQSGPGAKVNNNC------------CSRT  646

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++ FI LMLE V++G+ +N  F  +AW +M+  F+  FG QY K VL++ F +L
Sbjct  647   DWTPPMDRFFIDLMLEHVRQGSMVNLRFNKQAWNNMVAKFSAEFGSQYDKDVLRSHFMIL  706

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
              +++ ++K LL Q GF W E  QMI+A+D  W    K     R Y N +L  Y D+ +I 
Sbjct  707   GKRFSSMKNLLDQKGFEWDEVRQMIIADDDTWNSYAKENPDARSYCNSALPNYNDLFLIF  766

Query  789   GNETPTFQYGYP  754
             G+     +  Y 
Sbjct  767   GDTNNNGRLNYS  778


 Score = 87.0 bits (214),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 43/111 (39%), Positives = 72/111 (65%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSC-SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             +D  C ++S+  R++WT  MD YFI+L+LDQ+ +G++       QAW++M  LF  K++ 
Sbjct  487   DDAQCYANSDCSRADWTPKMDRYFIDLMLDQVIRGHKLDHISDDQAWIDMALLFREKFEL  546

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K D DVL+  Y+ L + +++ K +L Q  F WD+++Q++T  D+ W  YIK
Sbjct  547   KLDKDVLRGCYRSLGRMFNDMKYLLSQRGFAWDETQQLITACDDVWHVYIK  597


 Score =   126 bits (317),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 106/209 (51%), Gaps = 8/209 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL----EDKIPTKDD  1162
             HP+   YR K VP Y++L +IFG   ++GR+S    ++DF+++        + +     D
Sbjct  437   HPDARSYRNKSVPSYHKLCVIFGEESSNGRHSHRAHNVDFDSKGPTFVIGDDAQCYANSD  496

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               + DW+  M+++FI LML+QV  G+KL+    ++AWI M   F   F  +  K VL+  
Sbjct  497   CSRADWTPKMDRYFIDLMLDQVIRGHKLDHISDDQAWIDMALLFREKFELKLDKDVLRGC  556

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
             +  L R +  +KYLLSQ GF W E  Q+I A D VW   IK     R Y+ +    Y D+
Sbjct  557   YRSLGRMFNDMKYLLSQRGFAWDETQQLITACDDVWHVYIKENPNARSYKTECKPNYNDL  616

Query  801   SIICGNETP---TFQYGYPFVKAGEFCVP  724
              +I GN        Q G P  K    C  
Sbjct  617   YLIYGNSNSDGGVHQSG-PGAKVNNNCCS  644


 Score =   114 bits (285),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 83/133 (62%), Gaps = 0/133 (0%)
 Frame = -2

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             +  ++P   D  +++W+  ME++FI+LML+Q+ +GN++  TF  +AW  M+T FN  FG 
Sbjct  1     MSSQVPLGCDRARMNWTPLMERYFIELMLDQMHKGNRMGHTFNKQAWTDMLTMFNAKFGT  60

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             +Y +  LK+ +  L +QY  VK LL Q+GF W +  +M+VA D VW   IKA    + Y+
Sbjct  61    KYDRDTLKSHYTNLWKQYNDVKSLLEQNGFSWDDTRKMVVANDGVWDAFIKAHPDAQFYK  120

Query  831   NKSLSFYKDMSII  793
              KSL  + D+ +I
Sbjct  121   RKSLMNFNDLCLI  133


 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 1/128 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + S  L   W+  MD Y I+LL DQ  +GN+     + +AW+EMI  F+ ++    + ++
Sbjct  331   TRSNGLGPCWSPAMDRYLIDLLQDQALRGNKIGHELTTEAWIEMIGSFNERFGSHLEKNI  390

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKII  1370
             LKNRY+HLRKQY     +LEQN F WD+ R+MV   D  WD +IKV    + + N     
Sbjct  391   LKNRYEHLRKQYSGINFLLEQNGFSWDEHREMVIAEDYVWDSFIKVHPDARSYRNKSVPS  450

Query  1369  AHYILVSF  1346
              H + V F
Sbjct  451   YHKLCVIF  458


 Score = 79.0 bits (193),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 66/110 (60%), Gaps = 1/110 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             +D S    +  + NWT  M+ YFIEL+L+Q+ KGN+   + ++QAW  +IA F+ +    
Sbjct  797   DDPSPVDYDPQQINWTKSMEIYFIELVLEQVLKGNKVGQTLNEQAWSWIIASFNEQLGLV  856

Query  1561  HDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              D D +++ Y  L ++Y+N T +L QN F WD++ Q +  +D  W  YIK
Sbjct  857   CDKDAVESWYLSLMEEYNNITDLLNQNGFYWDETEQTIIADDIDWQFYIK  906


 Score = 31.6 bits (70),  Expect(2) = 4e-15, Method: Compositional matrix adjust.
 Identities = 13/32 (41%), Positives = 20/32 (63%), Gaps = 0/32 (0%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYS  1234
             HP    YR +++  YN+L +I+G+ V  GR S
Sbjct  908   HPGAIKYRDRILSSYNDLCMIYGNGVLVGRLS  939



>ref|XP_009363470.1| PREDICTED: uncharacterized protein LOC103953458, partial [Pyrus 
x bretschneideri]
Length=762

 Score =   153 bits (386),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 182/352 (52%), Gaps = 27/352 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK--  1156
             HP+   YR K +P YN+LR+IF     DGRYS   F+ D   E+  L       +     
Sbjct  426   HPDARSYRVKTIPGYNKLRVIFEEETYDGRYSRLAFNSDPSGELADLMTGAEKNNTPYIP  485

Query  1155  ----KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
                  IDW+ TM+++FI LM++Q+  GNK+N TF  +AW  M+ +FN  FG Q     L+
Sbjct  486   VVPLPIDWTPTMDRYFIDLMIDQLHSGNKINHTFNEQAWAQMLESFNMKFGIQCDIHALE  545

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +Q+  +  +L+  GFMW E  QMI AED +W+  IK       YRN  L  Y 
Sbjct  546   DRYACLVKQHDCISSILTHTGFMWDETQQMITAEDDIWEAYIKEHPDAISYRNAFLGGYS  605

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPI---IQTTGKEGNLreveeivedddereEKKC  637
             D+S IC N     ++    V  G    PI   I+  G  G+L+ + E V           
Sbjct  606   DLSKICVNRELDGKFSGQGV--GMEAGPIVFEIEMNGASGDLQMLAEDVGIS--------  655

Query  636   RYDTKEPKEPCKGPSEINEETEIEIG--MEDAMQEMVAAVTALTkeekkkkKNSLLIEDV  463
               D +  +     P+ +  +   + G   +    EMV  V  L   ++K  + S  IE  
Sbjct  656   --DQQRKRPTLTPPNSVRSKKAQKTGKDTQKTPAEMVDGVAKLADNKEKNNRTS--IEKA  711

Query  462   IYILQAMPEMdddddllldacdfledDNKAKVFLALDPGlrkkwllrklRPQ  307
             I  LQA+P M  DD+L+LDACD LED+ KAK FLALD  LRKKWLLRKLRPQ
Sbjct  712   IDALQALPGM--DDELMLDACDLLEDERKAKTFLALDGALRKKWLLRKLRPQ  761


 Score =   117 bits (292),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = -1

Query  1780  SSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWL  1601
             +S + A + +G+    + + SE  R+ WT +MD Y +ELL DQ+Q+GN+   +F  QAW 
Sbjct  305   TSHIKAGEGKGSQ---TSNVSERSRTYWTPIMDRYLLELLQDQVQRGNKLGQTFITQAWN  361

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDD  1424
             +M+  F+ ++K  HD DVLKNR+KH RKQY++ KI L+   F WD+SR+MVT  D  WD 
Sbjct  362   DMVVSFNARFKSHHDKDVLKNRFKHWRKQYNDIKILLKHGGFSWDESREMVTAEDSVWDG  421

Query  1423  YIK  1415
             YIK
Sbjct  422   YIK  424


 Score =   147 bits (371),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 108/189 (57%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI------LEDKIPTK  1168
             HP+  PY+TK V  +NEL +I+G+T ADGRYS S  D+DF++EV+       + +  P+ 
Sbjct  99    HPDARPYKTKPVLNFNELCLIYGYTTADGRYSRSSHDVDFDDEVQGVTTGDGMGNLAPSS  158

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              +  + +WS  M+Q+F+ +MLEQV  GNK +  F  +AW  M+  FN  FG Q+   VL+
Sbjct  159   SERPRTEWSLEMDQYFVDIMLEQVSIGNKPDNAFNKQAWTVMLAKFNEEFGPQHSLRVLR  218

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y     LL Q  F W E   MIVA+D VW    K   + R Y+ K+L    
Sbjct  219   HRYKKLLKYYSDATILLRQKDFSWDETRHMIVADDEVWDAYTKVHPHARTYKTKALPNLF  278

Query  807   DMSIICGNE  781
              MS++ G E
Sbjct  279   SMSLLFGTE  287


 Score =   102 bits (255),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 69/97 (71%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  M+ YFI+L+L+Q+ +G R   +F+KQAW EM+++F+ ++   +D DVLK+RY  L 
Sbjct  2     WTPTMERYFIDLMLEQLHRGARVGHTFNKQAWTEMLSVFNAQFGSHYDKDVLKSRYTTLW  61

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              Q+++ K IL QN F WD+SRQMV  +D  WD YIKV
Sbjct  62    MQFNDVKNILGQNGFSWDESRQMVVADDYIWDAYIKV  98


 Score =   112 bits (281),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 98/195 (50%), Gaps = 7/195 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTV---ADGRYSLSCFDIDFENEVKILEDK---IPTK  1168
             HP    Y+TK +P    + ++FG       D    L   ++D  + +K  E K       
Sbjct  263   HPHARTYKTKALPNLFSMSLLFGTECDLGTDNHLHLQK-NLDDTSHIKAGEGKGSQTSNV  321

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              +  +  W+  M+++ ++L+ +QVQ GNKL +TF  +AW  M+ +FN  F   + K VLK
Sbjct  322   SERSRTYWTPIMDRYLLELLQDQVQRGNKLGQTFITQAWNDMVVSFNARFKSHHDKDVLK  381

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              RF   R+QY  +K LL   GF W E  +M+ AED VW   IK     R YR K++  Y 
Sbjct  382   NRFKHWRKQYNDIKILLKHGGFSWDESREMVTAEDSVWDGYIKNHPDARSYRVKTIPGYN  441

Query  807   DMSIICGNETPTFQY  763
              + +I   ET   +Y
Sbjct  442   KLRVIFEEETYDGRY  456


 Score =   100 bits (249),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M + + SSSE  R+ W+  MD YF++++L+Q+  GN+   +F+KQAW  M+A F+ ++ 
Sbjct  150   GMGNLAPSSSERPRTEWSLEMDQYFVDIMLEQVSIGNKPDNAFNKQAWTVMLAKFNEEFG  209

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              +H   VL++RYK L K Y +  I L Q +F WD++R M+  +DE WD Y KV
Sbjct  210   PQHSLRVLRHRYKKLLKYYSDATILLRQKDFSWDETRHMIVADDEVWDAYTKV  262


 Score =   111 bits (277),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 76/128 (59%), Gaps = 0/128 (0%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+ TME++FI LMLEQ+  G ++  TF  +AW  M++ FN  FG  Y K VLK+R+  L 
Sbjct  2     WTPTMERYFIDLMLEQLHRGARVGHTFNKQAWTEMLSVFNAQFGSHYDKDVLKSRYTTLW  61

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
              Q+  VK +L Q+GF W E  QM+VA+D +W   IK     R Y+ K +  + ++ +I G
Sbjct  62    MQFNDVKNILGQNGFSWDESRQMVVADDYIWDAYIKVHPDARPYKTKPVLNFNELCLIYG  121

Query  786   NETPTFQY  763
               T   +Y
Sbjct  122   YTTADGRY  129


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 66/100 (66%), Gaps = 1/100 (1%)
 Frame = -1

Query  1711  LRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             L  +WT  MD YFI+L++DQ+  GN+ + +F++QAW +M+  F+ K+  + D   L++RY
Sbjct  489   LPIDWTPTMDRYFIDLMIDQLHSGNKINHTFNEQAWAQMLESFNMKFGIQCDIHALEDRY  548

Query  1531  KHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               L KQ+   + IL    F+WD+++QM+T  D+ W+ YIK
Sbjct  549   ACLVKQHDCISSILTHTGFMWDETQQMITAEDDIWEAYIK  588



>emb|CBI21156.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   162 bits (409),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HP+   Y+TK V  +N+L +I+G+T ADGRYS S  D+D +++++ +          P  
Sbjct  113   HPDARSYKTKAVLNFNDLYLIYGYTTADGRYSRSSHDMDIDDDIQGMNMGDGMGSIAPLN  172

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + DW+  M+Q FI LML+Q+ +GNK+  TF  +AW  M+  FN  FG Q+GK VL+
Sbjct  173   NERSRTDWTAAMDQFFIDLMLDQLGKGNKIGNTFNKQAWTDMLALFNAKFGPQHGKRVLR  232

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y  V  LL Q GF W +  +MI+A+D VW   IKA  + R YR K+L  YK
Sbjct  233   HRYKKLWKYYSDVTILLKQIGFSWDDEREMILADDDVWDVYIKAHPHARSYRTKTLPNYK  292

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  293   DLGLIYGD  300


 Score =   107 bits (268),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + +S++  R+ WT  M+ YFI+L+LDQ+ +G+R   +F+KQAW +M+ +F+ K+  
Sbjct  1     MGSQTPTSNDRSRTYWTPTMERYFIDLMLDQMHRGSRIGHTFNKQAWTDMLTMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             ++D DVLK RY +L KQ+++ K +L Q+ F WD++RQMV  +D+ WD YIK
Sbjct  61    QYDKDVLKGRYTNLWKQFNDIKNLLGQSGFSWDETRQMVVADDDVWDAYIK  111


 Score =   147 bits (371),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 168/336 (50%), Gaps = 23/336 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP+   YR K VP Y++L +I+G   +DGRYS      D   EV +L      + + P 
Sbjct  436   AHPDARTYRVKTVPSYHKLCVIYGQESSDGRYSRLARYADPICEVPVLMTGEGKDVESPA  495

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D   IDW+  M+ +FI LM+EQ   GNK++  F  +AW HM+T+FN  FG Q  K  L
Sbjct  496   STDTLVIDWTPPMDCYFIDLMVEQASGGNKVDEAFSEQAWAHMVTSFNDKFGLQCDKYFL  555

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+    +QY  +  LL+  GF W+E  Q++ AED +W+  IK       +R+K L  Y
Sbjct  556   ENRYMFFMKQYNDISNLLNYSGFAWNESQQIVTAEDHIWEAYIKGHPDAVSFRDKFLGSY  615

Query  810   KDMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRY  631
              D+  I G         +          P I     +G          +D +   +    
Sbjct  616   SDLCKIFG--IGILDESFSCQDLSMEIDPNIIEVKMDG--------ASEDSQFFVRDSEI  665

Query  630   DTKEPKEPCKGPSEINEETEIEI---GMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVI  460
               +  K     PS +    + +    GM++A+ EM   VT L     K+ KNS+ IE  I
Sbjct  666   PDQSRKRQTAVPSAMEHSRKTQKTMEGMQEALNEMTGMVTTLV--SNKEDKNSISIESAI  723

Query  459   YILQAMPEMdddddllldacdfledDNKAKVFLALD  352
               LQA+P++  DDDLLLDACD LEDD KAK FLALD
Sbjct  724   DALQAIPDI--DDDLLLDACDLLEDDKKAKTFLALD  757


 Score =   119 bits (299),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             L  +K     E  + + S+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW +M+
Sbjct  316   LLGVKAGEGRESQTPTGSDRSRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITQAWADMV  375

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             A F+ K++  HD DVLKNR+KHLR+QY++ KI L+Q+ F WD++R+MVT  D  WD Y K
Sbjct  376   ASFNSKFRSHHDKDVLKNRFKHLRRQYNDIKILLQQSGFSWDETREMVTAEDHVWDAYTK  435

Query  1414  V  1412
              
Sbjct  436   A  436


 Score =   150 bits (380),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 115/214 (54%), Gaps = 11/214 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP    YRTK +P Y +L +I+G  + +G       D D EN++  +      E + PT
Sbjct  276   AHPHARSYRTKTLPNYKDLGLIYGDAINNGMRQ----DKDLENDLLGVKAGEGRESQTPT  331

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNKL +TF  +AW  M+ +FN+ F   + K VL
Sbjct  332   GSDRSRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITQAWADMVASFNSKFRSHHDKDVL  391

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K RF  LRRQY  +K LL Q GF W E  +M+ AED VW    KA    R YR K++  Y
Sbjct  392   KNRFKHLRRQYNDIKILLQQSGFSWDETREMVTAEDHVWDAYTKAHPDARTYRVKTVPSY  451

Query  810   KDMSIICGNETPTFQYGYPFVKAGEFC-VPIIQT  712
               + +I G E+   +Y      A   C VP++ T
Sbjct  452   HKLCVIYGQESSDGRYSRLARYADPICEVPVLMT  485


 Score =   105 bits (262),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             ++E  R++WT  MD +FI+L+LDQ+ KGN+   +F+KQAW +M+ALF+ K+  +H   VL
Sbjct  172   NNERSRTDWTAAMDQFFIDLMLDQLGKGNKIGNTFNKQAWTDMLALFNAKFGPQHGKRVL  231

Query  1543  KNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++RYK L K Y +  I L+Q  F WDD R+M+  +D+ WD YIK 
Sbjct  232   RHRYKKLWKYYSDVTILLKQIGFSWDDEREMILADDDVWDVYIKA  276


 Score =   121 bits (304),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 84/140 (60%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             + PT +D  +  W+ TME++FI LML+Q+  G+++  TF  +AW  M+T FN  FG QY 
Sbjct  4     QTPTSNDRSRTYWTPTMERYFIDLMLDQMHRGSRIGHTFNKQAWTDMLTMFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK R+  L +Q+  +K LL Q GF W E  QM+VA+D VW   IK     R Y+ K+
Sbjct  64    KDVLKGRYTNLWKQFNDIKNLLGQSGFSWDETRQMVVADDDVWDAYIKFHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             +  + D+ +I G  T   +Y
Sbjct  124   VLNFNDLYLIYGYTTADGRY  143


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -1

Query  1735  DSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHD  1556
             +S +S++TL  +WT  MD YFI+L+++Q   GN+   +FS+QAW  M+  F+ K+  + D
Sbjct  492   ESPASTDTLVIDWTPPMDCYFIDLMVEQASGGNKVDEAFSEQAWAHMVTSFNDKFGLQCD  551

Query  1555  TDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                L+NRY    KQY++ + +L  + F W++S+Q+VT  D  W+ YIK
Sbjct  552   KYFLENRYMFFMKQYNDISNLLNYSGFAWNESQQIVTAEDHIWEAYIK  599



>ref|XP_006483530.1| PREDICTED: uncharacterized protein LOC102618929 isoform X2 [Citrus 
sinensis]
Length=794

 Score =   165 bits (417),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 6/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PT  1171
             AHP+   Y+TK +  +++L +I+GHT ADGRYSLS  D+DF +EV+   + D +    P 
Sbjct  129   AHPDARSYKTKALLNFSDLCLIYGHTTADGRYSLSSHDMDFYDEVQGVNMSDGVCSLGPQ  188

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + +W+  M+Q+FI+L+L+Q+  GNK++ TF  +AW +M+  FN  FG Q+GK VL
Sbjct  189   INERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNARFGSQHGKRVL  248

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y     LL QDGF W E  QMI A+D VW   IK     R YR KSL  Y
Sbjct  249   RHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVHPPARAYRMKSLPNY  308

Query  810   KDMSIICGN  784
              D+++I G+
Sbjct  309   NDLALIYGD  317


 Score =   104 bits (259),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M     +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+ 
Sbjct  17    GMAGQVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFG  76

Query  1567  CKHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
              ++D DVLK+RY +L KQ+++   +L Q+ F WD+SRQMV  +D  W+ YIK  
Sbjct  77    SQYDKDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAH  130


 Score =   141 bits (356),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/333 (34%), Positives = 172/333 (52%), Gaps = 18/333 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HP+   YR K VP Y +L +IFG  ++DGRY+    D+D   E+ +L       D + T 
Sbjct  459   HPDARSYRVKTVPSYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSDVEKIDHLNTS  518

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D    DW+  M+++FI LM++Q+  GNK+  TF  ++W  MI AFN  FG Q  K +L+
Sbjct  519   IDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYILE  578

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L RQ+  +  LL   GF+W E  QM++  D  W+  +K       Y++K L  + 
Sbjct  579   SRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVKDYPDAISYKDKFLGNFG  638

Query  807   DMSIICGNETPTFQY-GYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRY  631
             D+  I GNE       G+    + +     ++  G  G+L +   + +   ++  K+   
Sbjct  639   DLCKIFGNELLNENLEGHDLGASTDHNAFEMELEGFSGDL-QYSALDDQMSDQHRKRAAS  697

Query  630   DTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYIL  451
                EP+   K      ++ ++         EMV    A T   KK+ KN   IE+ I  L
Sbjct  698   MLLEPEYSSKAQKPNQKQNDLP--------EMVGVGVATTLPSKKENKNHTAIENAIDAL  749

Query  450   QAMPEMdddddllldacdfledDNKAKVFLALD  352
             QA+ ++  DD+LLLDACD LED+ KAK FLALD
Sbjct  750   QAIADI--DDELLLDACDLLEDERKAKTFLALD  780


 Score =   105 bits (263),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  +++  R+ WT  MD Y I+LLL+Q+ +GN+   +F  Q+W +MI  F+ K+   HD 
Sbjct  351   TPPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDK  410

Query  1552  DVLKNRYKHLRKQYHNTKILEQ-NEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNR+KHLR+ Y   K+L Q   F+WD+SR MVT  D  WD YIK
Sbjct  411   DVLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIK  457


 Score =   131 bits (329),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 109/216 (50%), Gaps = 12/216 (6%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP    YR K +P YN+L +I+G  V D     S  D D + +V I   K+         
Sbjct  294   HPPARAYRMKSLPNYNDLALIYG-DVVDSEIR-SHLDQDKDPDVGISGIKVAGEGKGRQT  351

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P  +D  +  W+  M+++ I L+LEQV  GNKL +TF  ++W  MIT+FN  F   + K 
Sbjct  352   PPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDKD  411

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK RF  LRR Y  +K LL   GF+W E   M+ AED +W   IK     R YR K++ 
Sbjct  412   VLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIKEHPDARSYRVKTVP  471

Query  816   FYKDMSIICGNETPTFQYGYPFVKAGEFC-VPIIQT  712
              Y  + +I G E    +Y          C +P++ +
Sbjct  472   SYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMS  507


 Score =   106 bits (264),  Expect(2) = 6e-53, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -1

Query  1744  MEDDSCSSS----ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             M D  CS      E  R+ W   MD YFIELLLDQI +GN+   +FSKQAW  M+ LF+ 
Sbjct  178   MSDGVCSLGPQINERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNA  237

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             ++  +H   VL++RYK L K Y + T +L Q+ F WD+++QM+  +D  WD YIKV 
Sbjct  238   RFGSQHGKRVLRHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVH  294


 Score =   129 bits (325),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             ++PT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+T FN  FG QY 
Sbjct  21    QVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGSQYD  80

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  V  LL Q GF W E  QM+VA+D  W   IKA    R Y+ K+
Sbjct  81    KDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAHPDARSYKTKA  140

Query  822   LSFYKDMSIICGNETPTFQY  763
             L  + D+ +I G+ T   +Y
Sbjct  141   LLNFSDLCLIYGHTTADGRY  160


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S +    +WT  MD YFI+L++ Q+  GN+   +F++Q+W +MI  F+ K+  + D  +
Sbjct  517   TSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYI  576

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L +Q+ +   +L+   F+WD+++QMV G D+ W+ Y+K
Sbjct  577   LESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVK  621



>ref|XP_006483529.1| PREDICTED: uncharacterized protein LOC102618929 isoform X1 [Citrus 
sinensis]
Length=800

 Score =   165 bits (417),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 6/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PT  1171
             AHP+   Y+TK +  +++L +I+GHT ADGRYSLS  D+DF +EV+   + D +    P 
Sbjct  129   AHPDARSYKTKALLNFSDLCLIYGHTTADGRYSLSSHDMDFYDEVQGVNMSDGVCSLGPQ  188

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + +W+  M+Q+FI+L+L+Q+  GNK++ TF  +AW +M+  FN  FG Q+GK VL
Sbjct  189   INERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNARFGSQHGKRVL  248

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y     LL QDGF W E  QMI A+D VW   IK     R YR KSL  Y
Sbjct  249   RHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVHPPARAYRMKSLPNY  308

Query  810   KDMSIICGN  784
              D+++I G+
Sbjct  309   NDLALIYGD  317


 Score =   104 bits (259),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 77/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M     +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+ 
Sbjct  17    GMAGQVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFG  76

Query  1567  CKHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
              ++D DVLK+RY +L KQ+++   +L Q+ F WD+SRQMV  +D  W+ YIK  
Sbjct  77    SQYDKDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAH  130


 Score =   139 bits (350),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 172/339 (51%), Gaps = 24/339 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------------  1186
             HP+   YR K VP Y +L +IFG  ++DGRY+    D+D   E+ +L             
Sbjct  459   HPDARSYRVKTVPSYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSGKYCITYVEKI  518

Query  1185  DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQY  1006
             D + T  D    DW+  M+++FI LM++Q+  GNK+  TF  ++W  MI AFN  FG Q 
Sbjct  519   DHLNTSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQC  578

Query  1005  GKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNK  826
              K +L++R+  L RQ+  +  LL   GF+W E  QM++  D  W+  +K       Y++K
Sbjct  579   DKYILESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVKDYPDAISYKDK  638

Query  825   SLSFYKDMSIICGNETPTFQY-GYPFVKAGEFCVPIIQTTGKEGNLreveeivedddere  649
              L  + D+  I GNE       G+    + +     ++  G  G+L +   + +   ++ 
Sbjct  639   FLGNFGDLCKIFGNELLNENLEGHDLGASTDHNAFEMELEGFSGDL-QYSALDDQMSDQH  697

Query  648   EKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIE  469
              K+      EP+   K      ++ ++         EMV    A T   KK+ KN   IE
Sbjct  698   RKRAASMLLEPEYSSKAQKPNQKQNDLP--------EMVGVGVATTLPSKKENKNHTAIE  749

Query  468   DVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             + I  LQA+ ++  DD+LLLDACD LED+ KAK FLALD
Sbjct  750   NAIDALQAIADI--DDELLLDACDLLEDERKAKTFLALD  786


 Score =   105 bits (262),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  +++  R+ WT  MD Y I+LLL+Q+ +GN+   +F  Q+W +MI  F+ K+   HD 
Sbjct  351   TPPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDK  410

Query  1552  DVLKNRYKHLRKQYHNTKILEQ-NEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNR+KHLR+ Y   K+L Q   F+WD+SR MVT  D  WD YIK
Sbjct  411   DVLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIK  457


 Score =   134 bits (337),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 113/225 (50%), Gaps = 22/225 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP    YR K +P YN+L +I+G  V D     S  D D + +V I   K+         
Sbjct  294   HPPARAYRMKSLPNYNDLALIYG-DVVDSEIR-SHLDQDKDPDVGISGIKVAGEGKGRQT  351

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P  +D  +  W+  M+++ I L+LEQV  GNKL +TF  ++W  MIT+FN  F   + K 
Sbjct  352   PPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDKD  411

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK RF  LRR Y  +K LL   GF+W E   M+ AED +W   IK     R YR K++ 
Sbjct  412   VLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIKEHPDARSYRVKTVP  471

Query  816   FYKDMSIICGNETPTFQYG-----------YPFVKAGEFCVPIIQ  715
              Y  + +I G E    +Y             P + +G++C+  ++
Sbjct  472   SYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSGKYCITYVE  516


 Score =   106 bits (264),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 73/117 (62%), Gaps = 5/117 (4%)
 Frame = -1

Query  1744  MEDDSCSSS----ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             M D  CS      E  R+ W   MD YFIELLLDQI +GN+   +FSKQAW  M+ LF+ 
Sbjct  178   MSDGVCSLGPQINERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNA  237

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             ++  +H   VL++RYK L K Y + T +L Q+ F WD+++QM+  +D  WD YIKV 
Sbjct  238   RFGSQHGKRVLRHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVH  294


 Score =   129 bits (325),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             ++PT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+T FN  FG QY 
Sbjct  21    QVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGSQYD  80

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  V  LL Q GF W E  QM+VA+D  W   IKA    R Y+ K+
Sbjct  81    KDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAHPDARSYKTKA  140

Query  822   LSFYKDMSIICGNETPTFQY  763
             L  + D+ +I G+ T   +Y
Sbjct  141   LLNFSDLCLIYGHTTADGRY  160


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S +    +WT  MD YFI+L++ Q+  GN+   +F++Q+W +MI  F+ K+  + D  +
Sbjct  523   TSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYI  582

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L +Q+ +   +L+   F+WD+++QMV G D+ W+ Y+K
Sbjct  583   LESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVK  627



>gb|KDO67404.1| hypothetical protein CISIN_1g045211mg [Citrus sinensis]
Length=777

 Score =   165 bits (418),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 6/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PT  1171
             AHP+   Y+TK +  +++L +I+GHT ADGRYSLS  D+DF +EV+   + D +    P 
Sbjct  112   AHPDARSYKTKALLNFSDLCLIYGHTTADGRYSLSSHDMDFYDEVQGVNMSDGVCSLGPQ  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + +W+  M+Q+FI+L+L+Q+  GNK++ TF  +AW +M+  FN  FG Q+GK VL
Sbjct  172   INERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNARFGSQHGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y     LL QDGF W E  QMI A+D VW   IK     R YR KSL  Y
Sbjct  232   RHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVHPPARAYRMKSLPNY  291

Query  810   KDMSIICGN  784
              D+++I G+
Sbjct  292   NDLALIYGD  300


 Score =   103 bits (258),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+  
Sbjct  1     MAGQVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK+RY +L KQ+++   +L Q+ F WD+SRQMV  +D  W+ YIK 
Sbjct  61    QYDKDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKA  112


 Score =   141 bits (356),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/333 (34%), Positives = 172/333 (52%), Gaps = 18/333 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HP+   YR K VP Y +L +IFG  ++DGRY+    D+D   E+ +L       D + T 
Sbjct  442   HPDARSYRVKTVPSYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSDVEKIDHLNTS  501

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D    DW+  M+++FI LM++Q+  GNK+  TF  ++W  MI AFN  FG Q  K +L+
Sbjct  502   IDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYILE  561

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L RQ+  +  LL   GF+W E  QM++  D  W+  +K       Y++K L  + 
Sbjct  562   SRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVKDYPDAISYKDKFLGNFG  621

Query  807   DMSIICGNETPTFQY-GYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRY  631
             D+  I GNE       G+    + +     ++  G  G+L +   + +   ++  K+   
Sbjct  622   DLCKIFGNELLNENLEGHDLGASTDHNAFEMELEGFSGDL-QYSALDDQMSDQHRKRAAS  680

Query  630   DTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYIL  451
                EP+   K      ++ ++         EMV    A T   KK+ KN   IE+ I  L
Sbjct  681   MLLEPEYSSKAQKPNQKQNDLP--------EMVGVGVATTLPSKKENKNHTAIENAIDAL  732

Query  450   QAMPEMdddddllldacdfledDNKAKVFLALD  352
             QA+ ++  DD+LLLDACD LED+ KAK FLALD
Sbjct  733   QAIADI--DDELLLDACDLLEDERKAKTFLALD  763


 Score =   105 bits (262),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  +++  R+ WT  MD Y I+LLL+Q+ +GN+   +F  Q+W +MI  F+ K+   HD 
Sbjct  334   TPPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDK  393

Query  1552  DVLKNRYKHLRKQYHNTKILEQ-NEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNR+KHLR+ Y   K+L Q   F+WD+SR MVT  D  WD YIK
Sbjct  394   DVLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIK  440


 Score =   131 bits (330),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 109/216 (50%), Gaps = 12/216 (6%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP    YR K +P YN+L +I+G  V D     S  D D + +V I   K+         
Sbjct  277   HPPARAYRMKSLPNYNDLALIYG-DVVDSEIR-SHLDQDKDPDVGISGIKVAGEGKGRQT  334

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P  +D  +  W+  M+++ I L+LEQV  GNKL +TF  ++W  MIT+FN  F   + K 
Sbjct  335   PPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDKD  394

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK RF  LRR Y  +K LL   GF+W E   M+ AED +W   IK     R YR K++ 
Sbjct  395   VLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIKEHPDARSYRVKTVP  454

Query  816   FYKDMSIICGNETPTFQYGYPFVKAGEFC-VPIIQT  712
              Y  + +I G E    +Y          C +P++ +
Sbjct  455   SYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMS  490


 Score =   106 bits (264),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = -1

Query  1744  MEDDSCSSS----ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             M D  CS      E  R+ W   MD YFIELLLDQI +GN+   +FSKQAW  M+ LF+ 
Sbjct  161   MSDGVCSLGPQINERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNA  220

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++  +H   VL++RYK L K Y + T +L Q+ F WD+++QM+  +D  WD YIKV
Sbjct  221   RFGSQHGKRVLRHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKV  276


 Score =   130 bits (326),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             ++PT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+T FN  FG QY 
Sbjct  4     QVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  V  LL Q GF W E  QM+VA+D  W   IKA    R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             L  + D+ +I G+ T   +Y
Sbjct  124   LLNFSDLCLIYGHTTADGRY  143


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S +    +WT  MD YFI+L++ Q+  GN+   +F++Q+W +MI  F+ K+  + D  +
Sbjct  500   TSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYI  559

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L +Q+ +   +L+   F+WD+++QMV G D+ W+ Y+K
Sbjct  560   LESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVK  604



>ref|XP_006450261.1| hypothetical protein CICLE_v10010556mg, partial [Citrus clementina]
 gb|ESR63501.1| hypothetical protein CICLE_v10010556mg, partial [Citrus clementina]
Length=775

 Score =   165 bits (417),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 6/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PT  1171
             AHP+   Y+TK +  +++L +I+GHT ADGRYSLS  D+DF +EV+   + D +    P 
Sbjct  112   AHPDARSYKTKALLNFSDLCLIYGHTTADGRYSLSSHDMDFYDEVQGVNMSDGVCSLGPQ  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + +W+  M+Q+FI+L+L+Q+  GNK++ TF  +AW +M+  FN  FG Q+GK VL
Sbjct  172   INERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNARFGSQHGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y     LL QDGF W E  QMI A+D VW   IK     R YR KSL  Y
Sbjct  232   RHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVHPPARAYRMKSLPNY  291

Query  810   KDMSIICGN  784
              D+++I G+
Sbjct  292   NDLALIYGD  300


 Score =   103 bits (258),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+  
Sbjct  1     MAGQVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK+RY +L KQ+++   +L Q+ F WD+SRQMV  +D  W+ YIK 
Sbjct  61    QYDKDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKA  112


 Score =   141 bits (356),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/333 (34%), Positives = 172/333 (52%), Gaps = 18/333 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HP+   YR K VP Y +L +IFG  ++DGRY+    D+D   E+ +L       D + T 
Sbjct  442   HPDARSYRVKTVPSYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSDVEKIDHLNTS  501

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D    DW+  M+++FI LM++Q+  GNK+  TF  ++W  MI AFN  FG Q  K +L+
Sbjct  502   IDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYILE  561

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L RQ+  +  LL   GF+W E  QM++  D  W+  +K       Y++K L  + 
Sbjct  562   SRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVKDYPDAISYKDKFLGNFG  621

Query  807   DMSIICGNETPTFQY-GYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRY  631
             D+  I GNE       G+    + +     ++  G  G+L +   + +   ++  K+   
Sbjct  622   DLCKIFGNELLNENLEGHDLGASTDHNAFEMELEGFSGDL-QYSALDDQMSDQHRKRAAS  680

Query  630   DTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYIL  451
                EP+   K      ++ ++         EMV    A T   KK+ KN   IE+ I  L
Sbjct  681   MLLEPEYSSKAQKPNQKQNDLP--------EMVGVGVATTLPSKKENKNHTAIENAIDAL  732

Query  450   QAMPEMdddddllldacdfledDNKAKVFLALD  352
             QA+ ++  DD+LLLDACD LED+ KAK FLALD
Sbjct  733   QAIADI--DDELLLDACDLLEDERKAKTFLALD  763


 Score =   105 bits (262),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  +++  R+ WT  MD Y I+LLL+Q+ +GN+   +F  Q+W +MI  F+ K+   HD 
Sbjct  334   TPPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDK  393

Query  1552  DVLKNRYKHLRKQYHNTKILEQ-NEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNR+KHLR+ Y   K+L Q   F+WD+SR MVT  D  WD YIK
Sbjct  394   DVLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIK  440


 Score =   131 bits (329),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 77/216 (36%), Positives = 109/216 (50%), Gaps = 12/216 (6%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP    YR K +P YN+L +I+G  V D     S  D D + +V I   K+         
Sbjct  277   HPPARAYRMKSLPNYNDLALIYG-DVVDSEIR-SHLDQDKDPDVGISGIKVAGEGKGRQT  334

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P  +D  +  W+  M+++ I L+LEQV  GNKL +TF  ++W  MIT+FN  F   + K 
Sbjct  335   PPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDKD  394

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK RF  LRR Y  +K LL   GF+W E   M+ AED +W   IK     R YR K++ 
Sbjct  395   VLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIKEHPDARSYRVKTVP  454

Query  816   FYKDMSIICGNETPTFQYGYPFVKAGEFC-VPIIQT  712
              Y  + +I G E    +Y          C +P++ +
Sbjct  455   SYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMS  490


 Score =   106 bits (264),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = -1

Query  1744  MEDDSCSSS----ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             M D  CS      E  R+ W   MD YFIELLLDQI +GN+   +FSKQAW  M+ LF+ 
Sbjct  161   MSDGVCSLGPQINERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNA  220

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++  +H   VL++RYK L K Y + T +L Q+ F WD+++QM+  +D  WD YIKV
Sbjct  221   RFGSQHGKRVLRHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKV  276


 Score =   130 bits (326),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             ++PT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+T FN  FG QY 
Sbjct  4     QVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  V  LL Q GF W E  QM+VA+D  W   IKA    R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             L  + D+ +I G+ T   +Y
Sbjct  124   LLNFSDLCLIYGHTTADGRY  143


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S +    +WT  MD YFI+L++ Q+  GN+   +F++Q+W +MI  F+ K+  + D  +
Sbjct  500   TSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYI  559

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L +Q+ +   +L+   F+WD+++QMV G D+ W+ Y+K
Sbjct  560   LESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVK  604



>ref|XP_006483531.1| PREDICTED: uncharacterized protein LOC102618929 isoform X3 [Citrus 
sinensis]
Length=783

 Score =   165 bits (417),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 81/189 (43%), Positives = 119/189 (63%), Gaps = 6/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILEDKI----PT  1171
             AHP+   Y+TK +  +++L +I+GHT ADGRYSLS  D+DF +EV+   + D +    P 
Sbjct  112   AHPDARSYKTKALLNFSDLCLIYGHTTADGRYSLSSHDMDFYDEVQGVNMSDGVCSLGPQ  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + +W+  M+Q+FI+L+L+Q+  GNK++ TF  +AW +M+  FN  FG Q+GK VL
Sbjct  172   INERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNARFGSQHGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y     LL QDGF W E  QMI A+D VW   IK     R YR KSL  Y
Sbjct  232   RHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKVHPPARAYRMKSLPNY  291

Query  810   KDMSIICGN  784
              D+++I G+
Sbjct  292   NDLALIYGD  300


 Score =   103 bits (258),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+  
Sbjct  1     MAGQVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK+RY +L KQ+++   +L Q+ F WD+SRQMV  +D  W+ YIK 
Sbjct  61    QYDKDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKA  112


 Score =   139 bits (350),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/339 (33%), Positives = 172/339 (51%), Gaps = 24/339 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------------  1186
             HP+   YR K VP Y +L +IFG  ++DGRY+    D+D   E+ +L             
Sbjct  442   HPDARSYRVKTVPSYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSGKYCITYVEKI  501

Query  1185  DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQY  1006
             D + T  D    DW+  M+++FI LM++Q+  GNK+  TF  ++W  MI AFN  FG Q 
Sbjct  502   DHLNTSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQC  561

Query  1005  GKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNK  826
              K +L++R+  L RQ+  +  LL   GF+W E  QM++  D  W+  +K       Y++K
Sbjct  562   DKYILESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVKDYPDAISYKDK  621

Query  825   SLSFYKDMSIICGNETPTFQY-GYPFVKAGEFCVPIIQTTGKEGNLreveeivedddere  649
              L  + D+  I GNE       G+    + +     ++  G  G+L +   + +   ++ 
Sbjct  622   FLGNFGDLCKIFGNELLNENLEGHDLGASTDHNAFEMELEGFSGDL-QYSALDDQMSDQH  680

Query  648   EKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIE  469
              K+      EP+   K      ++ ++         EMV    A T   KK+ KN   IE
Sbjct  681   RKRAASMLLEPEYSSKAQKPNQKQNDLP--------EMVGVGVATTLPSKKENKNHTAIE  732

Query  468   DVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             + I  LQA+ ++  DD+LLLDACD LED+ KAK FLALD
Sbjct  733   NAIDALQAIADI--DDELLLDACDLLEDERKAKTFLALD  769


 Score =   105 bits (262),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  +++  R+ WT  MD Y I+LLL+Q+ +GN+   +F  Q+W +MI  F+ K+   HD 
Sbjct  334   TPPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDK  393

Query  1552  DVLKNRYKHLRKQYHNTKILEQ-NEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLKNR+KHLR+ Y   K+L Q   F+WD+SR MVT  D  WD YIK
Sbjct  394   DVLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIK  440


 Score =   134 bits (337),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 78/225 (35%), Positives = 113/225 (50%), Gaps = 22/225 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP    YR K +P YN+L +I+G  V D     S  D D + +V I   K+         
Sbjct  277   HPPARAYRMKSLPNYNDLALIYG-DVVDSEIR-SHLDQDKDPDVGISGIKVAGEGKGRQT  334

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P  +D  +  W+  M+++ I L+LEQV  GNKL +TF  ++W  MIT+FN  F   + K 
Sbjct  335   PPTNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFITQSWNDMITSFNDKFLSHHDKD  394

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK RF  LRR Y  +K LL   GF+W E   M+ AED +W   IK     R YR K++ 
Sbjct  395   VLKNRFKHLRRLYSEIKVLLQHGGFLWDESRDMVTAEDHIWDAYIKEHPDARSYRVKTVP  454

Query  816   FYKDMSIICGNETPTFQYG-----------YPFVKAGEFCVPIIQ  715
              Y  + +I G E    +Y             P + +G++C+  ++
Sbjct  455   SYYKLCVIFGEEMSDGRYNRLAQDLDSSCEIPVLMSGKYCITYVE  499


 Score =   106 bits (264),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 5/116 (4%)
 Frame = -1

Query  1744  MEDDSCSSS----ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             M D  CS      E  R+ W   MD YFIELLLDQI +GN+   +FSKQAW  M+ LF+ 
Sbjct  161   MSDGVCSLGPQINERPRTEWNAEMDQYFIELLLDQIGRGNKIDNTFSKQAWTNMLDLFNA  220

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++  +H   VL++RYK L K Y + T +L Q+ F WD+++QM+  +D  WD YIKV
Sbjct  221   RFGSQHGKRVLRHRYKKLWKYYSDATNLLRQDGFSWDEAQQMIAADDAVWDAYIKV  276


 Score =   130 bits (326),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             ++PT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+T FN  FG QY 
Sbjct  4     QVPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRMGHTFNKQAWTDMLTMFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  V  LL Q GF W E  QM+VA+D  W   IKA    R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVNNLLHQSGFSWDESRQMVVADDFAWNSYIKAHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             L  + D+ +I G+ T   +Y
Sbjct  124   LLNFSDLCLIYGHTTADGRY  143


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S +    +WT  MD YFI+L++ Q+  GN+   +F++Q+W +MI  F+ K+  + D  +
Sbjct  506   TSIDPFGDDWTPQMDRYFIDLMMKQMNGGNKIGHTFTEQSWAQMIEAFNVKFGLQCDKYI  565

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L +Q+ +   +L+   F+WD+++QMV G D+ W+ Y+K
Sbjct  566   LESRYICLMRQHDDICNLLKHGGFVWDEAQQMVMGADDAWEAYVK  610



>ref|XP_008452827.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452828.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452829.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452830.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452831.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452832.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452833.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452834.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
 ref|XP_008452835.1| PREDICTED: uncharacterized protein LOC103493736 [Cucumis melo]
Length=769

 Score =   162 bits (411),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 112/187 (60%), Gaps = 4/187 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDK----IPTKD  1165
             AHP+   YRTK V  +++L +I+G+T ADGRYS S  DIDF+ EV+ +        P   
Sbjct  112   AHPDARSYRTKAVLNFSDLCLIYGYTNADGRYSRSSHDIDFDEEVQAVSTGDTMGCPAPP  171

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + DW+  M+Q+FI+LML Q+  GNK + TF   AW  M+  FN  FG Q+GK VL+ 
Sbjct  172   DRPRTDWTLEMDQYFIELMLGQIGRGNKTSNTFNKHAWTEMLALFNAKFGPQHGKRVLRH  231

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  L + Y  +  LL Q+GF W E  QM+VA D +W   +K   + R YR K+L  Y D
Sbjct  232   RYKKLWKYYSDIMNLLQQNGFCWDEVQQMVVAADDIWDAYVKTHPFARSYRMKALPNYYD  291

Query  804   MSIICGN  784
             + +I GN
Sbjct  292   LVLIYGN  298


 Score =   106 bits (264),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   +  S E  R+ WT VM+ YFI+L+L+Q+ +GNR+  +F+KQAW +M+ +F+ K+  
Sbjct  1     MGSQTIPSHERSRTYWTPVMERYFIDLMLEQLHRGNRSGHTFNKQAWTDMLTMFNTKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK+RY +L KQ+++ K +L  + F WD+ RQMV  +D  WD YIK 
Sbjct  61    QYDKDVLKSRYTNLWKQFNDVKNLLGHSGFSWDEGRQMVIADDYVWDIYIKA  112


 Score =   134 bits (336),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 112/335 (33%), Positives = 167/335 (50%), Gaps = 28/335 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPTK  1168
             HP+   YR K VP Y++L  IFG   ++ RYS    D    N V +L       D++P  
Sbjct  439   HPDARSYRVKTVPSYHKLCFIFGEESSNRRYSRLAHDTHPSNGVPVLMTNERKNDEVPAG  498

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
                  IDW+  M++ FI LML+Q+QEGN   + F  +AW  MI +FN +F  Q  + VL+
Sbjct  499   P-LPMIDWTPQMDRSFIDLMLQQLQEGNTFGQAFSEQAWTRMIISFNESFKLQCDRYVLE  557

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+    +QY  +  LL+ +GF+W+E  Q+I AED +W+   K       Y++K L +Y 
Sbjct  558   DRYFWWMKQYSDIYNLLNHNGFVWNESQQLITAEDNLWEAYAKEHPDALLYKDKFLGYYT  617

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGK--EGNLreveeivedddereEKKCR  634
             D+  I GN       G              Q TG+    NL    +  E       +   
Sbjct  618   DLCKIFGNILDRGVNG--------------QCTGEIDNDNLEIKMDGNEHLLLTSRETQI  663

Query  633   YDTKEPKEPCKGPSEINEETE-IEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
                K P +      E++++    E  ++ A+ EM   V+ L     K++ N   +E  I 
Sbjct  664   SQRKRPADMISLDRELSKKVHRTENDVQKAISEMAGVVSKLV--NMKQQHNYKAVEGAID  721

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              LQA+P++  DD+L+LDACD LED+ KAK F+ALD
Sbjct  722   ALQAIPDI--DDELMLDACDLLEDERKAKTFVALD  754


 Score =   112 bits (281),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 51/120 (43%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +  +K   + E+   + S+  R+ WT  MD Y I+LLL+Q+ +GN+   +F   AW++M+
Sbjct  318   IPEVKGGESNENQMATVSDRTRTYWTPPMDRYLIDLLLEQVHRGNKIGQTFVSHAWIDMV  377

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               F+ +++ +HD DVLKNRYKHLR+ Y+  KI LEQ  F WD++R++VT +D  WD Y K
Sbjct  378   TAFNAQFRAQHDKDVLKNRYKHLRRLYNEIKILLEQRGFSWDENREIVTADDHVWDAYTK  437


 Score =   129 bits (323),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 107/199 (54%), Gaps = 6/199 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKI  1177
             V  HP    YR K +P Y +L +I+G+ + +   +    D + ++ +  +      E+++
Sbjct  272   VKTHPFARSYRMKALPNYYDLVLIYGNVIDNENQNHLELDKNLQDHIPEVKGGESNENQM  331

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              T  D  +  W+  M+++ I L+LEQV  GNK+ +TF + AWI M+TAFN  F  Q+ K 
Sbjct  332   ATVSDRTRTYWTPPMDRYLIDLLLEQVHRGNKIGQTFVSHAWIDMVTAFNAQFRAQHDKD  391

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R+  LRR Y  +K LL Q GF W E  +++ A+D VW    K     R YR K++ 
Sbjct  392   VLKNRYKHLRRLYNEIKILLEQRGFSWDENREIVTADDHVWDAYTKDHPDARSYRVKTVP  451

Query  816   FYKDMSIICGNETPTFQYG  760
              Y  +  I G E+   +Y 
Sbjct  452   SYHKLCFIFGEESSNRRYS  470


 Score =   117 bits (294),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = -2

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
             IP+ + ++   W+  ME++FI LMLEQ+  GN+   TF  +AW  M+T FNT FG QY K
Sbjct  6     IPSHERSRTY-WTPVMERYFIDLMLEQLHRGNRSGHTFNKQAWTDMLTMFNTKFGSQYDK  64

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
              VLK+R+  L +Q+  VK LL   GF W E  QM++A+D VW   IKA    R YR K++
Sbjct  65    DVLKSRYTNLWKQFNDVKNLLGHSGFSWDEGRQMVIADDYVWDIYIKAHPDARSYRTKAV  124

Query  819   SFYKDMSIICG  787
               + D+ +I G
Sbjct  125   LNFSDLCLIYG  135


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 3/123 (2%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +  +  R++WT  MD YFIEL+L QI +GN+TS +F+K AW EM+ALF+ K+  +H   V
Sbjct  169   APPDRPRTDWTLEMDQYFIELMLGQIGRGNKTSNTFNKHAWTEMLALFNAKFGPQHGKRV  228

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKII  1370
             L++RYK L K Y +   +L+QN F WD+ +QMV   D+ WD Y+K   F + +   +K +
Sbjct  229   LRHRYKKLWKYYSDIMNLLQQNGFCWDEVQQMVVAADDIWDAYVKTHPFARSY--RMKAL  286

Query  1369  AHY  1361
              +Y
Sbjct  287   PNY  289


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 1/110 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ++D   +      +WT  MD  FI+L+L Q+Q+GN    +FS+QAW  MI  F+  +K +
Sbjct  491   KNDEVPAGPLPMIDWTPQMDRSFIDLMLQQLQEGNTFGQAFSEQAWTRMIISFNESFKLQ  550

Query  1561  HDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              D  VL++RY    KQY +   +L  N F+W++S+Q++T  D  W+ Y K
Sbjct  551   CDRYVLEDRYFWWMKQYSDIYNLLNHNGFVWNESQQLITAEDNLWEAYAK  600



>ref|XP_002309683.2| hypothetical protein POPTR_0006s28170g [Populus trichocarpa]
 gb|EEE93206.2| hypothetical protein POPTR_0006s28170g [Populus trichocarpa]
Length=760

 Score =   160 bits (405),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 120/190 (63%), Gaps = 6/190 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKD-----  1165
             HP+   Y+TK V  +N+L +I+G+T ADGRYS S  D DF++EV+ +    PT       
Sbjct  113   HPDARSYKTKAVLNFNDLCVIYGYTSADGRYSRSSHDFDFDDEVQGVNMGDPTSSLSSNS  172

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  + +W+  M+Q+F++LML+Q+  GNK + TF  +AW  M+++FN  FG ++ K +L+ 
Sbjct  173   ERPRTEWTAAMDQYFVELMLDQMGRGNKTDNTFVKQAWTDMLSSFNAKFGPRHDKRILRH  232

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA-EDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             R+  L + Y  +K +L Q+GF W E  QMIVA +D+VW   IKA  + R YR K+L  Y 
Sbjct  233   RYKKLAKYYSDLKVILQQNGFSWDETQQMIVADDDKVWDAYIKAHPHARTYRMKTLPNYN  292

Query  807   DMSIICGNET  778
             D+ +I GN +
Sbjct  293   DLVLIYGNAS  302


 Score =   108 bits (269),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+A+F+ K++ ++D DV
Sbjct  7     TSNDRSRTYWTPTMERYFIDLMLEQLHRGNRIGHTFNKQAWTDMLAVFNAKFESQYDKDV  66

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LK+RY +L KQ+++ K +L Q  F WD++R+MV  +D  W DYIKV
Sbjct  67    LKSRYTNLWKQFNDVKELLGQTGFAWDENRKMVVADDGLWHDYIKV  112


 Score =   132 bits (331),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 160/330 (48%), Gaps = 30/330 (9%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+   YR K VP Y +L +I G   + GRYS     ID   E+ +L    P       
Sbjct  440   AHPDARSYRVKTVPGYQKLCVIVGQENSGGRYSRLAQSIDANEEMPVLMTVDPLT-----  494

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             +DW   M ++F+ LMLEQV  GNK++ TF  +AW HM+  FN  FG    K  L+ ++  
Sbjct  495   VDWQPEMNRYFVDLMLEQVHGGNKIDHTFNEQAWAHMVKLFNDKFGLTCDKYSLEKQYVS  554

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L +    +  LLS  GF W    QM+ A+D  W+  +K       Y+NK L  Y D+  I
Sbjct  555   LMKDCNEISSLLSHRGFAWDGTQQMVAADDATWEDHVKGHPEAIAYKNKVLDSYLDLCFI  614

Query  792   CGNETPTFQYGYPF--VKAGEFCVPI-IQTTGKEGNLreveeivedddereEKKCRYDTK  622
               NE    + G P   ++  E  + + I   G +GN +   E               D +
Sbjct  615   QRNEVSDTRLGDPGPPMQNEETAMKVEIVMDGLQGNEQFPVE---------------DIE  659

Query  621   EPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAM  442
                   K P+ +    E+    +   +EM   V+A     KK+ KN + IE  I  LQ +
Sbjct  660   ISDAQKKRPATV---AELSCKAQKIGKEMRCVVSAFA--NKKESKNHMSIESAIETLQTI  714

Query  441   PEMdddddllldacdfledDNKAKVFLALD  352
             P++  DD+LLLDACD LED+ KAK FLALD
Sbjct  715   PDI--DDELLLDACDLLEDERKAKTFLALD  742


 Score =   119 bits (298),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 82/123 (67%), Gaps = 4/123 (3%)
 Frame = -1

Query  1777  SRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLE  1598
             SR  A + +G+    S  SS+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW++
Sbjct  321   SRKKAEEGKGSQ---SLGSSDRTRTYWTPPMDRYLIDLLLDQVHRGNKFGQTFISQAWID  377

Query  1597  MIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDY  1421
             M ALF+ K++  HD DVLKNRYKHLR+ Y+  K +LE + F WD++R+M+T  D  WD Y
Sbjct  378   MAALFNVKFQSHHDKDVLKNRYKHLRRLYNEIKNLLENSGFSWDETREMITAKDHIWDAY  437

Query  1420  IKV  1412
             IK 
Sbjct  438   IKA  440


 Score =   131 bits (330),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 103/197 (52%), Gaps = 6/197 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV---KILEDKIPTK--  1168
             AHP    YR K +P YN+L +I+G+   +G  S    D D E ++   K  E K      
Sbjct  276   AHPHARTYRMKTLPNYNDLVLIYGNASENGVQSNFLEDKDHEADISRKKAEEGKGSQSLG  335

Query  1167  -DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNK  +TF ++AWI M   FN  F   + K VL
Sbjct  336   SSDRTRTYWTPPMDRYLIDLLLDQVHRGNKFGQTFISQAWIDMAALFNVKFQSHHDKDVL  395

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  LRR Y  +K LL   GF W E  +MI A+D +W   IKA    R YR K++  Y
Sbjct  396   KNRYKHLRRLYNEIKNLLENSGFSWDETREMITAKDHIWDAYIKAHPDARSYRVKTVPGY  455

Query  810   KDMSIICGNETPTFQYG  760
             + + +I G E    +Y 
Sbjct  456   QKLCVIVGQENSGGRYS  472


 Score =   111 bits (278),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       S+SE  R+ WT  MD YF+EL+LDQ+ +GN+T  +F KQAW +M++ F+ 
Sbjct  160   NMGDPTSSLSSNSERPRTEWTAAMDQYFVELMLDQMGRGNKTDNTFVKQAWTDMLSSFNA  219

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEK-WDDYIKV  1412
             K+  +HD  +L++RYK L K Y + K IL+QN F WD+++QM+  +D+K WD YIK 
Sbjct  220   KFGPRHDKRILRHRYKKLAKYYSDLKVILQQNGFSWDETQQMIVADDDKVWDAYIKA  276


 Score =   120 bits (302),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 0/141 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             +IPT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+  FN  F  QY 
Sbjct  4     QIPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRIGHTFNKQAWTDMLAVFNAKFESQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  VK LL Q GF W E  +M+VA+D +W   IK     R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVKELLGQTGFAWDENRKMVVADDGLWHDYIKVHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQYG  760
             +  + D+ +I G  +   +Y 
Sbjct  124   VLNFNDLCVIYGYTSADGRYS  144


 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 70/126 (56%), Gaps = 3/126 (2%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             + L  +W   M+ YF++L+L+Q+  GN+   +F++QAW  M+ LF+ K+    D   L+ 
Sbjct  491   DPLTVDWQPEMNRYFVDLMLEQVHGGNKIDHTFNEQAWAHMVKLFNDKFGLTCDKYSLEK  550

Query  1537  RYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             +Y  L K  +  + +L    F WD ++QMV  +D  W+D++K       + N  K++  Y
Sbjct  551   QYVSLMKDCNEISSLLSHRGFAWDGTQQMVAADDATWEDHVKGHPEAIAYKN--KVLDSY  608

Query  1360  ILVSFV  1343
             + + F+
Sbjct  609   LDLCFI  614



>ref|XP_002515411.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46860.1| conserved hypothetical protein [Ricinus communis]
Length=766

 Score =   164 bits (414),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 120/190 (63%), Gaps = 6/190 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDK------IPTK  1168
             HP+   YR+K V  +N+L  I+G+T ADGRYS S  D+DF++E++  ++        PT 
Sbjct  116   HPDARSYRSKSVLNFNDLCFIYGYTSADGRYSRSSHDLDFDDEIQAAKNGDPTVSFAPTN  175

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + +W+  M+Q+F++L+L+ + +GNK +  F  +AW  M+ +FN  FG Q+GK VL+
Sbjct  176   NERPRTEWTAAMDQYFLELLLDHIVKGNKADNAFNKQAWTKMLASFNARFGPQHGKRVLR  235

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +    +KYLL Q+GF W E  QMIVA++ VW   IKA  + R YR K+L  Y 
Sbjct  236   HRYKKLSKYCSDMKYLLKQNGFSWDEMEQMIVADNDVWDAYIKAHPHARAYRMKTLPNYN  295

Query  807   DMSIICGNET  778
             D+ ++ G+ T
Sbjct  296   DLVLVFGDST  305


 Score =   104 bits (259),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +SS+  R+ WT  M+ +F++L+L+ + +GNR   +F+KQAW++M+A+F+ K+  ++D DV
Sbjct  10    TSSDRSRTYWTPTMERFFVDLMLEHMHRGNRIGHTFNKQAWMDMLAMFNAKFGSQYDKDV  69

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LK+RY +L KQ+++ K +L Q+ F WD++R+MV  +D  W+ Y+KV
Sbjct  70    LKSRYTNLWKQFNDVKTLLGQSGFTWDETREMVVADDYVWNAYLKV  115


 Score =   138 bits (347),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 166/335 (50%), Gaps = 31/335 (9%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS-LS-CFDIDFENEVKILEDKIPTKDDA  1159
             AHP+   YR K VP Y +L  IFG   +DGRYS LS   D D E  V ++++   +  D 
Sbjct  441   AHPDARSYRVKTVPGYQKLCAIFGQENSDGRYSRLSKIVDPDGETPVLVIDE---SSMDP  497

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
               IDW   M ++ I LMLEQV  GNK++ TF  +AW  ++ +FN  FG  + + +L+ R+
Sbjct  498   STIDWQPPMSRYLIDLMLEQVHGGNKIDYTFNEQAWTLIVESFNEKFGVLFSRYILENRY  557

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               L ++   +  LLS  GF W    QM+ A+D VW+  I+ Q +   YRNK L  Y D+ 
Sbjct  558   ITLMKECDDINGLLSHSGFAWDVTQQMVTADDAVWEAYIQGQPHAIAYRNKVLENYIDLC  617

Query  798   IICGNETPTFQYGYPFVKAGEFCVPI-----IQTTGKEGNLreveeivedddereEKKCR  634
              I  NE             G+  + +     IQ  G +  L +V    ED    +++K R
Sbjct  618   QIQRNEVSYI---------GDQGLQVQTENDIQEVGVDVLLGDVNIPGEDILSSDQQKKR  668

Query  633   YDTKEPKEPCKGPSEINEETEIEI-GMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
               T    E      +I++E +    GM DA++         T   KK+ KN+  IE+ I 
Sbjct  669   STTTTGNEHSSKMQKISKEMQRTFSGMADAVK---------TSLSKKESKNNGTIENAID  719

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              LQA+P +DD+  L        +   KAK FLALD
Sbjct  720   ALQALPGIDDELLLDACDLLEDDK--KAKTFLALD  752


 Score =   110 bits (274),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + S+++  R+ WT  MD Y I+LLL+Q+ +GN+   +F  QAW +M+A F+ K++  HD 
Sbjct  334   TLSNNDRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFISQAWTDMVASFNVKFQSHHDK  393

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             DVLKNRYKHLR+ Y + K +LE + F WD +R+M+T  D  WD Y K 
Sbjct  394   DVLKNRYKHLRRMYSDIKNLLENSGFSWDSTREMITAEDHVWDAYTKA  441


 Score =   134 bits (337),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 101/195 (52%), Gaps = 4/195 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGR----YSLSCFDIDFENEVKILEDKIPTKD  1165
             AHP    YR K +P YN+L ++FG +  DG     +    +++D          +  + +
Sbjct  279   AHPHARAYRMKTLPNYNDLVLVFGDSTEDGEDTSMHQEKYYEVDIYGTKTGNASQTLSNN  338

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+  M+++ I L+LEQV  GNKL +TF ++AW  M+ +FN  F   + K VLK 
Sbjct  339   DRTRTYWTPPMDRYLIDLLLEQVHRGNKLGQTFISQAWTDMVASFNVKFQSHHDKDVLKN  398

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LRR Y  +K LL   GF W    +MI AED VW    KA    R YR K++  Y+ 
Sbjct  399   RYKHLRRMYSDIKNLLENSGFSWDSTREMITAEDHVWDAYTKAHPDARSYRVKTVPGYQK  458

Query  804   MSIICGNETPTFQYG  760
             +  I G E    +Y 
Sbjct  459   LCAIFGQENSDGRYS  473


 Score =   102 bits (253),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 50/121 (41%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             + A KN       + +++E  R+ WT  MD YF+ELLLD I KGN+   +F+KQAW +M+
Sbjct  159   IQAAKNGDPTVSFAPTNNERPRTEWTAAMDQYFLELLLDHIVKGNKADNAFNKQAWTKML  218

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             A F+ ++  +H   VL++RYK L K   + K +L+QN F WD+  QM+  +++ WD YIK
Sbjct  219   ASFNARFGPQHGKRVLRHRYKKLSKYCSDMKYLLKQNGFSWDEMEQMIVADNDVWDAYIK  278

Query  1414  V  1412
              
Sbjct  279   A  279


 Score =   122 bits (306),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 84/144 (58%), Gaps = 0/144 (0%)
 Frame = -2

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             +  ++PT  D  +  W+ TME+ F+ LMLE +  GN++  TF  +AW+ M+  FN  FG 
Sbjct  4     ISSQMPTSSDRSRTYWTPTMERFFVDLMLEHMHRGNRIGHTFNKQAWMDMLAMFNAKFGS  63

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             QY K VLK+R+  L +Q+  VK LL Q GF W E  +M+VA+D VW   +K     R YR
Sbjct  64    QYDKDVLKSRYTNLWKQFNDVKTLLGQSGFTWDETREMVVADDYVWNAYLKVHPDARSYR  123

Query  831   NKSLSFYKDMSIICGNETPTFQYG  760
             +KS+  + D+  I G  +   +Y 
Sbjct  124   SKSVLNFNDLCFIYGYTSADGRYS  147


 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 71/128 (55%), Gaps = 5/128 (4%)
 Frame = -1

Query  1738  DDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKH  1559
             D+S     T+  +W   M  Y I+L+L+Q+  GN+   +F++QAW  ++  F+ K+    
Sbjct  491   DESSMDPSTI--DWQPPMSRYLIDLMLEQVHGGNKIDYTFNEQAWTLIVESFNEKFGVLF  548

Query  1558  DTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNH  1382
                +L+NRY  L K+  +   +L  + F WD ++QMVT +D  W+ YI+ Q     + N 
Sbjct  549   SRYILENRYITLMKECDDINGLLSHSGFAWDVTQQMVTADDAVWEAYIQGQPHAIAYRN-  607

Query  1381  LKIIAHYI  1358
              K++ +YI
Sbjct  608   -KVLENYI  614



>emb|CAN79208.1| hypothetical protein VITISV_025934 [Vitis vinifera]
Length=497

 Score =   159 bits (403),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 114/188 (61%), Gaps = 6/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HP+   Y+TK V  +N+  +I+G+T ADGRYS S  D+D +++V+ +          P  
Sbjct  120   HPDARSYKTKAVLNFNDXYLIYGYTTADGRYSRSSHDMDIDDDVQGMNMGDGMGSIAPLN  179

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + DW+  M+Q FI LML+Q+ +GNK+  TF  +AW  M+  FN  FG Q+GK VL+
Sbjct  180   NERSRTDWTAAMDQFFIDLMLDQLGKGNKIGNTFNKQAWTDMLALFNAKFGPQHGKRVLR  239

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y  V  LL Q GF W +  +MI+A+D VW   IKA  + R YR K+L  YK
Sbjct  240   HRYKKLWKYYSDVTILLKQIGFSWDDEREMILADDDVWDVYIKAHPHARSYRTKTLPNYK  299

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  300   DLGLIYGD  307


 Score =   107 bits (267),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + +S++  R+ WT  M+ YFI+L+LDQ+ +G+R   +F+KQAW +M+ +F+ K+  
Sbjct  1     MGSQTPTSNDRSRTYWTPTMERYFIDLMLDQMHRGSRIGHTFNKQAWTDMLTMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK RY +L KQ+++ K +L Q+ F WD++RQMV  +D+ WD YIK 
Sbjct  61    QYDKDVLKGRYTNLWKQFNDIKNLLGQSGFSWDETRQMVVADDDVWDAYIKT  112


 Score =   150 bits (378),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 115/214 (54%), Gaps = 11/214 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP    YRTK +P Y +L +I+G  + +G       D D EN++  +      E + PT
Sbjct  283   AHPHARSYRTKTLPNYKDLGLIYGDAINNGMRQ----DKDLENDLLGVKAGEGRESQTPT  338

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNKL +TF  +AW  M+ +FN+ F   + K VL
Sbjct  339   GSDRSRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITQAWADMVASFNSKFRSHHDKDVL  398

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K RF  LRRQY  +K LL Q GF W E  +M+ AED VW    KA    R YR K++  Y
Sbjct  399   KNRFKHLRRQYNDIKILLQQSGFSWDETREMVTAEDHVWDAYTKAHPDARTYRVKTVPSY  458

Query  810   KDMSIICGNETPTFQYGYPFVKAGEFC-VPIIQT  712
               + +I G E+   +Y      A   C VP++ T
Sbjct  459   HKLCVIYGQESSDGRYSRLARYADPICEVPVLMT  492


 Score =   104 bits (260),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             ++E  R++WT  MD +FI+L+LDQ+ KGN+   +F+KQAW +M+ALF+ K+  +H   VL
Sbjct  179   NNERSRTDWTAAMDQFFIDLMLDQLGKGNKIGNTFNKQAWTDMLALFNAKFGPQHGKRVL  238

Query  1543  KNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             ++RYK L K Y +  I L+Q  F WDD R+M+  +D+ WD YIK  
Sbjct  239   RHRYKKLWKYYSDVTILLKQIGFSWDDEREMILADDDVWDVYIKAH  284


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 80/122 (66%), Gaps = 1/122 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             L  +K     E  + + S+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW +M+
Sbjct  323   LLGVKAGEGRESQTPTGSDRSRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITQAWADMV  382

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             A F+ K++  HD DVLKNR+KHLR+QY++ KI L+Q+ F WD++R+MVT  D  WD Y K
Sbjct  383   ASFNSKFRSHHDKDVLKNRFKHLRRQYNDIKILLQQSGFSWDETREMVTAEDHVWDAYTK  442

Query  1414  VQ  1409
               
Sbjct  443   AH  444


 Score =   117 bits (293),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 84/147 (57%), Gaps = 7/147 (5%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             + PT +D  +  W+ TME++FI LML+Q+  G+++  TF  +AW  M+T FN  FG QY 
Sbjct  4     QTPTSNDRSRTYWTPTMERYFIDLMLDQMHRGSRIGHTFNKQAWTDMLTMFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYF-------  844
             K VLK R+  L +Q+  +K LL Q GF W E  QM+VA+D VW   IK    F       
Sbjct  64    KDVLKGRYTNLWKQFNDIKNLLGQSGFSWDETRQMVVADDDVWDAYIKTNTNFXQFHPDA  123

Query  843   RRYRNKSLSFYKDMSIICGNETPTFQY  763
             R Y+ K++  + D  +I G  T   +Y
Sbjct  124   RSYKTKAVLNFNDXYLIYGYTTADGRY  150



>ref|XP_010648765.1| PREDICTED: uncharacterized protein LOC100266462 [Vitis vinifera]
Length=752

 Score =   147 bits (370),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 120/336 (36%), Positives = 168/336 (50%), Gaps = 23/336 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP+   YR K VP Y++L +I+G   +DGRYS      D   EV +L      + + P 
Sbjct  417   AHPDARTYRVKTVPSYHKLCVIYGQESSDGRYSRLARYADPICEVPVLMTGEGKDVESPA  476

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D   IDW+  M+ +FI LM+EQ   GNK++  F  +AW HM+T+FN  FG Q  K  L
Sbjct  477   STDTLVIDWTPPMDCYFIDLMVEQASGGNKVDEAFSEQAWAHMVTSFNDKFGLQCDKYFL  536

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+    +QY  +  LL+  GF W+E  Q++ AED +W+  IK       +R+K L  Y
Sbjct  537   ENRYMFFMKQYNDISNLLNYSGFAWNESQQIVTAEDHIWEAYIKGHPDAVSFRDKFLGSY  596

Query  810   KDMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRY  631
              D+  I G         +          P I     +G          +D +   +    
Sbjct  597   SDLCKIFG--IGILDESFSCQDLSMEIDPNIIEVKMDG--------ASEDSQFFVRDSEI  646

Query  630   DTKEPKEPCKGPSEINEETEIEI---GMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVI  460
               +  K     PS +    + +    GM++A+ EM   VT L     K+ KNS+ IE  I
Sbjct  647   PDQSRKRQTAVPSAMEHSRKTQKTMEGMQEALNEMTGMVTTLV--SNKEDKNSISIESAI  704

Query  459   YILQAMPEMdddddllldacdfledDNKAKVFLALD  352
               LQA+P++  DDDLLLDACD LEDD KAK FLALD
Sbjct  705   DALQAIPDI--DDDLLLDACDLLEDDKKAKTFLALD  738


 Score =   119 bits (298),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             L  +K     E  + + S+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW +M+
Sbjct  297   LLGVKAGEGRESQTPTGSDRSRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITQAWADMV  356

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             A F+ K++  HD DVLKNR+KHLR+QY++ KI L+Q+ F WD++R+MVT  D  WD Y K
Sbjct  357   ASFNSKFRSHHDKDVLKNRFKHLRRQYNDIKILLQQSGFSWDETREMVTAEDHVWDAYTK  416

Query  1414  V  1412
              
Sbjct  417   A  417


 Score =   162 bits (409),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HP+   Y+TK V  +N+L +I+G+T ADGRYS S  D+D +++++ +          P  
Sbjct  94    HPDARSYKTKAVLNFNDLYLIYGYTTADGRYSRSSHDMDIDDDIQGMNMGDGMGSIAPLN  153

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + DW+  M+Q FI LML+Q+ +GNK+  TF  +AW  M+  FN  FG Q+GK VL+
Sbjct  154   NERSRTDWTAAMDQFFIDLMLDQLGKGNKIGNTFNKQAWTDMLALFNAKFGPQHGKRVLR  213

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L + Y  V  LL Q GF W +  +MI+A+D VW   IKA  + R YR K+L  YK
Sbjct  214   HRYKKLWKYYSDVTILLKQIGFSWDDEREMILADDDVWDVYIKAHPHARSYRTKTLPNYK  273

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  274   DLGLIYGD  281


 Score = 98.6 bits (244),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = -1

Query  1687  MDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYH  1508
             M+ YFI+L+LDQ+ +G+R   +F+KQAW +M+ +F+ K+  ++D DVLK RY +L KQ++
Sbjct  1     MERYFIDLMLDQMHRGSRIGHTFNKQAWTDMLTMFNAKFGSQYDKDVLKGRYTNLWKQFN  60

Query  1507  NTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             + K +L Q+ F WD++RQMV  +D+ WD YIK
Sbjct  61    DIKNLLGQSGFSWDETRQMVVADDDVWDAYIK  92


 Score =   151 bits (381),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 81/214 (38%), Positives = 115/214 (54%), Gaps = 11/214 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP    YRTK +P Y +L +I+G  + +G       D D EN++  +      E + PT
Sbjct  257   AHPHARSYRTKTLPNYKDLGLIYGDAINNGMRQ----DKDLENDLLGVKAGEGRESQTPT  312

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNKL +TF  +AW  M+ +FN+ F   + K VL
Sbjct  313   GSDRSRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFITQAWADMVASFNSKFRSHHDKDVL  372

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K RF  LRRQY  +K LL Q GF W E  +M+ AED VW    KA    R YR K++  Y
Sbjct  373   KNRFKHLRRQYNDIKILLQQSGFSWDETREMVTAEDHVWDAYTKAHPDARTYRVKTVPSY  432

Query  810   KDMSIICGNETPTFQYGYPFVKAGEFC-VPIIQT  712
               + +I G E+   +Y      A   C VP++ T
Sbjct  433   HKLCVIYGQESSDGRYSRLARYADPICEVPVLMT  466


 Score =   105 bits (261),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             ++E  R++WT  MD +FI+L+LDQ+ KGN+   +F+KQAW +M+ALF+ K+  +H   VL
Sbjct  153   NNERSRTDWTAAMDQFFIDLMLDQLGKGNKIGNTFNKQAWTDMLALFNAKFGPQHGKRVL  212

Query  1543  KNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++RYK L K Y +  I L+Q  F WDD R+M+  +D+ WD YIK 
Sbjct  213   RHRYKKLWKYYSDVTILLKQIGFSWDDEREMILADDDVWDVYIKA  257


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 75/124 (60%), Gaps = 0/124 (0%)
 Frame = -2

Query  1134  MEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYF  955
             ME++FI LML+Q+  G+++  TF  +AW  M+T FN  FG QY K VLK R+  L +Q+ 
Sbjct  1     MERYFIDLMLDQMHRGSRIGHTFNKQAWTDMLTMFNAKFGSQYDKDVLKGRYTNLWKQFN  60

Query  954   AVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETP  775
              +K LL Q GF W E  QM+VA+D VW   IK     R Y+ K++  + D+ +I G  T 
Sbjct  61    DIKNLLGQSGFSWDETRQMVVADDDVWDAYIKFHPDARSYKTKAVLNFNDLYLIYGYTTA  120

Query  774   TFQY  763
               +Y
Sbjct  121   DGRY  124


 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -1

Query  1735  DSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHD  1556
             +S +S++TL  +WT  MD YFI+L+++Q   GN+   +FS+QAW  M+  F+ K+  + D
Sbjct  473   ESPASTDTLVIDWTPPMDCYFIDLMVEQASGGNKVDEAFSEQAWAHMVTSFNDKFGLQCD  532

Query  1555  TDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                L+NRY    KQY++ + +L  + F W++S+Q+VT  D  W+ YIK
Sbjct  533   KYFLENRYMFFMKQYNDISNLLNYSGFAWNESQQIVTAEDHIWEAYIK  580



>gb|KHG17660.1| hypothetical protein F383_05320 [Gossypium arboreum]
Length=772

 Score =   158 bits (400),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 121/188 (64%), Gaps = 6/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTK  1168
             A+P+   Y+TK V  +N+L +I+G+T ADGRYS S  D+DF++EV+ L        +P+ 
Sbjct  112   AYPDARCYKTKAVLNFNDLCLIYGYTTADGRYSRSSHDLDFDDEVQGLNMGDAMGSLPST  171

Query  1167  DDAK-KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             ++ + + +W+  M+Q+FI+LML+Q  +GNK++ TF  +AW  M+  FN  FG Q+GK VL
Sbjct  172   NNERPRTEWNAEMDQYFIELMLDQAGKGNKVDNTFNKQAWTDMLALFNAKFGPQHGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y  VK +L+Q+GF W E   +I A++ VW   IKA  + R YR K+L  +
Sbjct  232   RHRYKKLWKYYSDVKVILNQNGFTWDESQLVITADNAVWDAYIKAHPHARTYRMKTLPNF  291

Query  810   KDMSIICG  787
              D+ +I G
Sbjct  292   NDLGLIYG  299


 Score =   107 bits (268),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 78/112 (70%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + +S +  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+A+F+  +  
Sbjct  1     MGSQTPTSIDRTRTYWTPTMERYFIDLMLEQMHRGNRIGHTFTKQAWTDMLAVFNANFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK+RY +L KQ+++ K +L QN F WD+SRQMV  +D  W+ YIK 
Sbjct  61    QYDKDVLKSRYTNLWKQFNDVKNLLGQNGFSWDESRQMVVADDYVWNAYIKA  112


 Score =   143 bits (360),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 115/218 (53%), Gaps = 6/218 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP    YR K +P +N+L +I+G  + +G  +    + D  +     + K     D  +
Sbjct  276   AHPHARTYRMKTLPNFNDLGLIYGEAIDEGSLNNLTQECDI-SRATAGDRKGSMNCDRTR  334

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W+  M+++ I L+L+QV  GNKL +TF  +AW+ M+T+FN  FG  Y K VLK R+  
Sbjct  335   TFWTPPMDRYLIDLLLDQVHRGNKLGQTFLTQAWVDMVTSFNVKFGSHYDKDVLKNRYKH  394

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYF---RRYRNKSLSFYKDM  802
             LRR Y  +K LL Q GF W E   M++AED VW   IK  Q     R YR K++  Y  +
Sbjct  395   LRRLYNDIKILLEQSGFSWDETRDMVIAEDSVWNAYIKYMQSHPDARSYRVKTVPSYHKL  454

Query  801   SIICGNETPTFQYGYPFVKAG--EFCVPIIQTTGKEGN  694
              +I G E    +Y     KAG  ++   ++ + G E N
Sbjct  455   RVIFGQENCEVRYNRLTQKAGTDDYSTVLMTSNGNEKN  492


 Score =   106 bits (264),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +  L    AM     +++E  R+ W   MD YFIEL+LDQ  KGN+   +F+KQAW +M+
Sbjct  156   VQGLNMGDAMGSLPSTNNERPRTEWNAEMDQYFIELMLDQAGKGNKVDNTFNKQAWTDML  215

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             ALF+ K+  +H   VL++RYK L K Y + K IL QN F WD+S+ ++T ++  WD YIK
Sbjct  216   ALFNAKFGPQHGKRVLRHRYKKLWKYYSDVKVILNQNGFTWDESQLVITADNAVWDAYIK  275

Query  1414  V  1412
              
Sbjct  276   A  276


 Score =   127 bits (320),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 107/340 (31%), Positives = 169/340 (50%), Gaps = 30/340 (9%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------EDKI  1177
             +HP+   YR K VP Y++LR+IFG    + RY+        ++   +L         D +
Sbjct  436   SHPDARSYRVKTVPSYHKLRVIFGQENCEVRYNRLTQKAGTDDYSTVLMTSNGNEKNDHL  495

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P      +++W+  MEQ F+ L+LEQV+E NK+ + F  +AW+HM+ +FN  F  Q  K 
Sbjct  496   PGGIYHLELEWTTPMEQFFMGLLLEQVREQNKIAQAFNEQAWVHMVESFNEKFQLQLDKN  555

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             +L+  +  L +QY  +  LL+ +GF+W    +M+VA + VW+  +K       YR+K L 
Sbjct  556   ILENHYICLLKQYNDICDLLNHNGFIWDNDKKMVVANNDVWEVYVKEHPDAVSYRDKVLG  615

Query  816   FYKDMSIICGNETPTFQYGYPFVKA-GE----FCVPIIQTTGKEGNLreveeiveddder  652
              Y+D+  I  +E      G P  +  GE    F   +I      GNL+ +   +   D++
Sbjct  616   SYRDLCKIFRDEVLE---GIPCGQVLGEGTDCFASEVILDRA-SGNLQTLSGDINLSDQQ  671

Query  651   eEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLI  472
              ++     T + +   K      ++TE E  M+  + +M  AVT L    K   KN   I
Sbjct  672   MKRSIA--TPQLERASKA-----QKTEQE--MQKMLSKMAGAVTRLA--SKNGNKNYSTI  720

Query  471   EDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             E+ +  LQA+P+MDD+  L        E   KAK FLALD
Sbjct  721   ENAVDALQALPDMDDELLLDACDLLEDER--KAKTFLALD  758


 Score =   123 bits (309),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 85/141 (60%), Gaps = 0/141 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             + PT  D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+  FN  FG QY 
Sbjct  4     QTPTSIDRTRTYWTPTMERYFIDLMLEQMHRGNRIGHTFTKQAWTDMLAVFNANFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  VK LL Q+GF W E  QM+VA+D VW   IKA    R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVKNLLGQNGFSWDESRQMVVADDYVWNAYIKAYPDARCYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQYG  760
             +  + D+ +I G  T   +Y 
Sbjct  124   VLNFNDLCLIYGYTTADGRYS  144


 Score =   110 bits (275),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 86/141 (61%), Gaps = 8/141 (6%)
 Frame = -1

Query  1777  SRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLE  1598
             SR +A   +G+M   +C  + T    WT  MD Y I+LLLDQ+ +GN+   +F  QAW++
Sbjct  317   SRATAGDRKGSM---NCDRTRTF---WTPPMDRYLIDLLLDQVHRGNKLGQTFLTQAWVD  370

Query  1597  MIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDY  1421
             M+  F+ K+   +D DVLKNRYKHLR+ Y++ KI LEQ+ F WD++R MV   D  W+ Y
Sbjct  371   MVTSFNVKFGSHYDKDVLKNRYKHLRRLYNDIKILLEQSGFSWDETRDMVIAEDSVWNAY  430

Query  1420  IK-VQMFDQKFSNHLKIIAHY  1361
             IK +Q      S  +K +  Y
Sbjct  431   IKYMQSHPDARSYRVKTVPSY  451


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 68/100 (68%), Gaps = 1/100 (1%)
 Frame = -1

Query  1711  LRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             L   WT  M+ +F+ LLL+Q+++ N+ + +F++QAW+ M+  F+ K++ + D ++L+N Y
Sbjct  502   LELEWTTPMEQFFMGLLLEQVREQNKIAQAFNEQAWVHMVESFNEKFQLQLDKNILENHY  561

Query  1531  KHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               L KQY++   +L  N FIWD+ ++MV  N++ W+ Y+K
Sbjct  562   ICLLKQYNDICDLLNHNGFIWDNDKKMVVANNDVWEVYVK  601



>ref|XP_011031427.1| PREDICTED: uncharacterized protein LOC105130562 isoform X2 [Populus 
euphratica]
Length=760

 Score =   157 bits (397),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKD-----  1165
             HP+   Y+TK V  +N+L +I+G+T ADGRYS S  D DF+++V+ +    PT       
Sbjct  113   HPDARSYKTKAVLNFNDLCVIYGYTSADGRYSRSSHDFDFDDQVQGVNMGDPTSSLSSNS  172

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  + +W+  M+Q+F++LML+Q+  GNK + TF  +AW  M+++FN  FG ++ K +L+ 
Sbjct  173   ERPRTEWTAAMDQYFVELMLDQMGRGNKTDNTFAKQAWTDMLSSFNAKFGPRHDKRILRH  232

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA-EDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             R+  L + Y  +K +L Q+GF W    QMIVA +D+VW   IKA  + R YR K+L  Y 
Sbjct  233   RYKKLAKYYSDLKVILQQNGFSWDVTQQMIVADDDKVWDAYIKAHPHARTYRMKTLPNYN  292

Query  807   DMSIICGNET  778
             D+ +I GN +
Sbjct  293   DLVLIYGNAS  302


 Score =   108 bits (269),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+A+F+ K++ ++D DV
Sbjct  7     TSNDRSRTYWTPTMERYFIDLMLEQLHRGNRIGHTFNKQAWTDMLAVFNAKFESQYDKDV  66

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LK+RY +L KQ+++ K +L Q  F WD++R+MV  +D  W DYIKV
Sbjct  67    LKSRYTNLWKQFNDVKELLGQTGFAWDENRKMVVADDGLWHDYIKV  112


 Score =   138 bits (347),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/330 (35%), Positives = 160/330 (48%), Gaps = 30/330 (9%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+   YR K VP Y +L +I G   + GRYS     ID   E+ +L    P       
Sbjct  440   AHPDARSYRVKTVPGYQKLCVIVGQENSGGRYSRLAQSIDANEEMPVLMTVDPLT-----  494

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             +DW   M ++F+ LMLEQV  GNK++ TF  +AW HM+  FN  FG    K  L+  +  
Sbjct  495   VDWQPEMNRYFVDLMLEQVHGGNKIDHTFNEQAWAHMVKLFNDKFGLTCDKYSLEKHYVS  554

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L +    +  LLS  GF W    QM+ A+D  W+  +K       YRNK L  Y D+  I
Sbjct  555   LMKDCNEISSLLSHRGFAWDGTQQMVTADDATWEDHVKGHPEAIAYRNKVLDSYLDLCFI  614

Query  792   CGNETPTFQYGYPF--VKAGEFCVPI-IQTTGKEGNLreveeivedddereEKKCRYDTK  622
               NE    + G P   ++  E  + + I   G +GN++   E               D +
Sbjct  615   QRNEVSDARLGDPGPPMQNEETAMKVEIVMDGLQGNMQFPVE---------------DVE  659

Query  621   EPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAM  442
              P    K P+ +    E+    +   +EM   V+A     KK+ KN + IE  I  LQ +
Sbjct  660   IPDAQKKRPATV---AELSCKAQKIGKEMRCVVSAFA--NKKESKNHMSIESAIETLQTI  714

Query  441   PEMdddddllldacdfledDNKAKVFLALD  352
             P +  DD+LLLDACD LED+ KAK FLALD
Sbjct  715   PNI--DDELLLDACDLLEDERKAKTFLALD  742


 Score =   116 bits (291),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -1

Query  1777  SRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLE  1598
             SR  A + +G+    S  SS+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW++
Sbjct  321   SRKKAEEGKGSQ---SLGSSDRTRTYWTPPMDRYLIDLLLDQVHRGNKFGQTFISQAWID  377

Query  1597  MIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDY  1421
             M A F+ K++  HD DVLKNRYKHLR+ Y+  K +LE + F WD++R+M+T  D  WD Y
Sbjct  378   MAASFNVKFQSHHDKDVLKNRYKHLRRLYNEIKNLLENSGFSWDETREMITAKDHIWDAY  437

Query  1420  IKV  1412
             IK 
Sbjct  438   IKA  440


 Score =   134 bits (337),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 105/197 (53%), Gaps = 6/197 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV---KILEDKIPTK--  1168
             AHP    YR K +P YN+L +I+G+  A+G  S    D D E ++   K  E K      
Sbjct  276   AHPHARTYRMKTLPNYNDLVLIYGNASANGVQSNFHEDKDHEADISRKKAEEGKGSQSLG  335

Query  1167  -DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNK  +TF ++AWI M  +FN  F   + K VL
Sbjct  336   SSDRTRTYWTPPMDRYLIDLLLDQVHRGNKFGQTFISQAWIDMAASFNVKFQSHHDKDVL  395

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  LRR Y  +K LL   GF W E  +MI A+D +W   IKA    R YR K++  Y
Sbjct  396   KNRYKHLRRLYNEIKNLLENSGFSWDETREMITAKDHIWDAYIKAHPDARSYRVKTVPGY  455

Query  810   KDMSIICGNETPTFQYG  760
             + + +I G E    +Y 
Sbjct  456   QKLCVIVGQENSGGRYS  472


 Score =   111 bits (277),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       S+SE  R+ WT  MD YF+EL+LDQ+ +GN+T  +F+KQAW +M++ F+ 
Sbjct  160   NMGDPTSSLSSNSERPRTEWTAAMDQYFVELMLDQMGRGNKTDNTFAKQAWTDMLSSFNA  219

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEK-WDDYIKV  1412
             K+  +HD  +L++RYK L K Y + K IL+QN F WD ++QM+  +D+K WD YIK 
Sbjct  220   KFGPRHDKRILRHRYKKLAKYYSDLKVILQQNGFSWDVTQQMIVADDDKVWDAYIKA  276


 Score =   120 bits (302),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 0/141 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             +IPT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+  FN  F  QY 
Sbjct  4     QIPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRIGHTFNKQAWTDMLAVFNAKFESQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  VK LL Q GF W E  +M+VA+D +W   IK     R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVKELLGQTGFAWDENRKMVVADDGLWHDYIKVHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQYG  760
             +  + D+ +I G  +   +Y 
Sbjct  124   VLNFNDLCVIYGYTSADGRYS  144


 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 70/126 (56%), Gaps = 3/126 (2%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             + L  +W   M+ YF++L+L+Q+  GN+   +F++QAW  M+ LF+ K+    D   L+ 
Sbjct  491   DPLTVDWQPEMNRYFVDLMLEQVHGGNKIDHTFNEQAWAHMVKLFNDKFGLTCDKYSLEK  550

Query  1537  RYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
              Y  L K  +  + +L    F WD ++QMVT +D  W+D++K       + N  K++  Y
Sbjct  551   HYVSLMKDCNEISSLLSHRGFAWDGTQQMVTADDATWEDHVKGHPEAIAYRN--KVLDSY  608

Query  1360  ILVSFV  1343
             + + F+
Sbjct  609   LDLCFI  614



>ref|XP_011031426.1| PREDICTED: uncharacterized protein LOC105130562 isoform X1 [Populus 
euphratica]
Length=765

 Score =   157 bits (396),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKD-----  1165
             HP+   Y+TK V  +N+L +I+G+T ADGRYS S  D DF+++V+ +    PT       
Sbjct  113   HPDARSYKTKAVLNFNDLCVIYGYTSADGRYSRSSHDFDFDDQVQGVNMGDPTSSLSSNS  172

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  + +W+  M+Q+F++LML+Q+  GNK + TF  +AW  M+++FN  FG ++ K +L+ 
Sbjct  173   ERPRTEWTAAMDQYFVELMLDQMGRGNKTDNTFAKQAWTDMLSSFNAKFGPRHDKRILRH  232

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA-EDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             R+  L + Y  +K +L Q+GF W    QMIVA +D+VW   IKA  + R YR K+L  Y 
Sbjct  233   RYKKLAKYYSDLKVILQQNGFSWDVTQQMIVADDDKVWDAYIKAHPHARTYRMKTLPNYN  292

Query  807   DMSIICGNET  778
             D+ +I GN +
Sbjct  293   DLVLIYGNAS  302


 Score =   108 bits (269),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 79/106 (75%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S++  R+ WT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+A+F+ K++ ++D DV
Sbjct  7     TSNDRSRTYWTPTMERYFIDLMLEQLHRGNRIGHTFNKQAWTDMLAVFNAKFESQYDKDV  66

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LK+RY +L KQ+++ K +L Q  F WD++R+MV  +D  W DYIKV
Sbjct  67    LKSRYTNLWKQFNDVKELLGQTGFAWDENRKMVVADDGLWHDYIKV  112


 Score =   132 bits (332),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/335 (34%), Positives = 161/335 (48%), Gaps = 35/335 (10%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+   YR K VP Y +L +I G   + GRYS     ID   E+ +L    P       
Sbjct  440   AHPDARSYRVKTVPGYQKLCVIVGQENSGGRYSRLAQSIDANEEMPVLMTVDPLT-----  494

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             +DW   M ++F+ LMLEQV  GNK++ TF  +AW HM+  FN  FG    K  L+  +  
Sbjct  495   VDWQPEMNRYFVDLMLEQVHGGNKIDHTFNEQAWAHMVKLFNDKFGLTCDKYSLEKHYVS  554

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKK-----VIKAQQYFRRYRNKSLSFYK  808
             L +    +  LLS  GF W    QM+ A+D  W+      +++       YRNK L  Y 
Sbjct  555   LMKDCNEISSLLSHRGFAWDGTQQMVTADDATWEDHVKHGILQGHPEAIAYRNKVLDSYL  614

Query  807   DMSIICGNETPTFQYGYPF--VKAGEFCVPI-IQTTGKEGNLreveeivedddereEKKC  637
             D+  I  NE    + G P   ++  E  + + I   G +GN++   E             
Sbjct  615   DLCFIQRNEVSDARLGDPGPPMQNEETAMKVEIVMDGLQGNMQFPVE-------------  661

Query  636   RYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
               D + P    K P+ +    E+    +   +EM   V+A     KK+ KN + IE  I 
Sbjct  662   --DVEIPDAQKKRPATV---AELSCKAQKIGKEMRCVVSAFA--NKKESKNHMSIESAIE  714

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              LQ +P +  DD+LLLDACD LED+ KAK FLALD
Sbjct  715   TLQTIPNI--DDELLLDACDLLEDERKAKTFLALD  747


 Score =   116 bits (291),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -1

Query  1777  SRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLE  1598
             SR  A + +G+    S  SS+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW++
Sbjct  321   SRKKAEEGKGSQ---SLGSSDRTRTYWTPPMDRYLIDLLLDQVHRGNKFGQTFISQAWID  377

Query  1597  MIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDY  1421
             M A F+ K++  HD DVLKNRYKHLR+ Y+  K +LE + F WD++R+M+T  D  WD Y
Sbjct  378   MAASFNVKFQSHHDKDVLKNRYKHLRRLYNEIKNLLENSGFSWDETREMITAKDHIWDAY  437

Query  1420  IKV  1412
             IK 
Sbjct  438   IKA  440


 Score =   134 bits (337),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 74/197 (38%), Positives = 105/197 (53%), Gaps = 6/197 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV---KILEDKIPTK--  1168
             AHP    YR K +P YN+L +I+G+  A+G  S    D D E ++   K  E K      
Sbjct  276   AHPHARTYRMKTLPNYNDLVLIYGNASANGVQSNFHEDKDHEADISRKKAEEGKGSQSLG  335

Query  1167  -DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNK  +TF ++AWI M  +FN  F   + K VL
Sbjct  336   SSDRTRTYWTPPMDRYLIDLLLDQVHRGNKFGQTFISQAWIDMAASFNVKFQSHHDKDVL  395

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  LRR Y  +K LL   GF W E  +MI A+D +W   IKA    R YR K++  Y
Sbjct  396   KNRYKHLRRLYNEIKNLLENSGFSWDETREMITAKDHIWDAYIKAHPDARSYRVKTVPGY  455

Query  810   KDMSIICGNETPTFQYG  760
             + + +I G E    +Y 
Sbjct  456   QKLCVIVGQENSGGRYS  472


 Score =   111 bits (277),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       S+SE  R+ WT  MD YF+EL+LDQ+ +GN+T  +F+KQAW +M++ F+ 
Sbjct  160   NMGDPTSSLSSNSERPRTEWTAAMDQYFVELMLDQMGRGNKTDNTFAKQAWTDMLSSFNA  219

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEK-WDDYIKV  1412
             K+  +HD  +L++RYK L K Y + K IL+QN F WD ++QM+  +D+K WD YIK 
Sbjct  220   KFGPRHDKRILRHRYKKLAKYYSDLKVILQQNGFSWDVTQQMIVADDDKVWDAYIKA  276


 Score =   120 bits (302),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 84/141 (60%), Gaps = 0/141 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             +IPT +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+  FN  F  QY 
Sbjct  4     QIPTSNDRSRTYWTPTMERYFIDLMLEQLHRGNRIGHTFNKQAWTDMLAVFNAKFESQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  VK LL Q GF W E  +M+VA+D +W   IK     R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNDVKELLGQTGFAWDENRKMVVADDGLWHDYIKVHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQYG  760
             +  + D+ +I G  +   +Y 
Sbjct  124   VLNFNDLCVIYGYTSADGRYS  144


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 73/131 (56%), Gaps = 4/131 (3%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             + + L  +W   M+ YF++L+L+Q+  GN+   +F++QAW  M+ LF+ K+    D   L
Sbjct  489   TVDPLTVDWQPEMNRYFVDLMLEQVHGGNKIDHTFNEQAWAHMVKLFNDKFGLTCDKYSL  548

Query  1543  KNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK---VQMFDQKFSNHLK  1376
             +  Y  L K  +  + +L    F WD ++QMVT +D  W+D++K   +Q   +  +   K
Sbjct  549   EKHYVSLMKDCNEISSLLSHRGFAWDGTQQMVTADDATWEDHVKHGILQGHPEAIAYRNK  608

Query  1375  IIAHYILVSFV  1343
             ++  Y+ + F+
Sbjct  609   VLDSYLDLCFI  619



>ref|XP_007145773.1| hypothetical protein PHAVU_007G266500g [Phaseolus vulgaris]
 gb|ESW17767.1| hypothetical protein PHAVU_007G266500g [Phaseolus vulgaris]
Length=449

 Score =   221 bits (562),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 127/336 (38%), Positives = 187/336 (56%), Gaps = 46/336 (14%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----  1177
             C+  HP+ +P++T+++P YN+LRIIFGHTVADGRYSLSCFD+DFE E K L++K      
Sbjct  83    CIKLHPDAQPFKTRLIPNYNDLRIIFGHTVADGRYSLSCFDVDFEYEEKELDEKTITSKG  142

Query  1176  -----PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
                  PT     KIDWS  M+Q F++LM++Q+++GNK++RTF+ + W+HM  +FN  FG 
Sbjct  143   VDNQTPTAFSQGKIDWSPIMDQFFVELMVDQLRKGNKIDRTFRRQTWVHMTESFNKRFGC  202

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             + GKVVL+ RF++LRR Y ++  LL ++GF W +    +VA+D+ W+K I+    FR Y+
Sbjct  203   RCGKVVLRNRFSVLRRHYCSINVLLRKEGFSWDKTQHKVVADDQAWQKCIRVNHSFRLYK  262

Query  831   NKSLSFYKDMSIICGNE--TPTFQYGYP-FVKAGEFCVPIIQTTGKE--GNLreveeive  667
              +S+ FY  M I+C NE  T  F+   P     G   VP  Q    E  G     +   E
Sbjct  263   IRSMPFYSGMCIVCRNEEVTAGFKSNLPKGSSGGNNSVPDAQPLCNEDKGASHLGDADKE  322

Query  666   dddereEKKCRYDTKE--------------------PKEPCKGPSEINEETEIEIGMEDA  547
                   EKK   +T+                      +   K P+ +NE  +       A
Sbjct  323   ALHIGGEKKSFRETQTLTNADNEALQHVGKNVSGHLKRHQPKMPATLNESKK-------A  375

Query  546   MQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMP  439
                M  AVT+LT    K K ++  +++VI +LQA+P
Sbjct  376   RGHMAVAVTSLT----KAKDDNFSVDNVISVLQAIP  407


 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 62/98 (63%), Gaps = 1/98 (1%)
 Frame = -1

Query  1702  NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             +W+ +MD +F+EL++DQ++KGN+   +F +Q W+ M   F+ ++ C+    VL+NR+  L
Sbjct  157   DWSPIMDQFFVELMVDQLRKGNKIDRTFRRQTWVHMTESFNKRFGCRCGKVVLRNRFSVL  216

Query  1522  RKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
             R+ Y +  +L + E F WD ++  V  +D+ W   I+V
Sbjct  217   RRHYCSINVLLRKEGFSWDKTQHKVVADDQAWQKCIRV  254


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 61/123 (50%), Gaps = 27/123 (22%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DDS  S + LR+NWT   D YF ELLL  + KGN+                       
Sbjct  1     MGDDSSLSLDKLRANWTPSQDQYFHELLLCHVHKGNK-----------------------  37

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
                T+VLKNR+K  RKQY+  K I+ Q  F WD+++ M+  +D+ WD  IK+    Q F 
Sbjct  38    ---TEVLKNRFKRFRKQYNEIKMIVSQKGFQWDEAQNMIIADDKAWDACIKLHPDAQPFK  94

Query  1387  NHL  1379
               L
Sbjct  95    TRL  97


 Score = 68.9 bits (167),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 62/135 (46%), Gaps = 26/135 (19%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+ + +Q+F +L+L  V +GNK                            VLK 
Sbjct  10    DKLRANWTPSQDQYFHELLLCHVHKGNKTE--------------------------VLKN  43

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             RF   R+QY  +K ++SQ GF W E   MI+A+D+ W   IK     + ++ + +  Y D
Sbjct  44    RFKRFRKQYNEIKMIVSQKGFQWDEAQNMIIADDKAWDACIKLHPDAQPFKTRLIPNYND  103

Query  804   MSIICGNETPTFQYG  760
             + II G+     +Y 
Sbjct  104   LRIIFGHTVADGRYS  118



>gb|KGN55417.1| hypothetical protein Csa_4G651830 [Cucumis sativus]
Length=1160

 Score =   155 bits (393),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 113/187 (60%), Gaps = 4/187 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE--DKIP--TKD  1165
             AHP+   Y+TK V  +++L +I+G+T ADGRYS S  DIDF++EV+ +   D +      
Sbjct  497   AHPDARSYKTKAVLNFSDLCLIYGYTNADGRYSRSSHDIDFDDEVQAVNAGDTMGCLAPP  556

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + DW+  M+++FI+LML Q+  GNK + TF   AW  M+  FN  FG Q+GK VL+ 
Sbjct  557   DRPRTDWTLEMDRYFIELMLGQIGRGNKTSNTFNKHAWTDMLALFNAKFGPQHGKRVLRH  616

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  L + Y  +  LL Q+GF W E  QM+VA D +W   +K   + R YR K L  Y D
Sbjct  617   RYKKLWKYYSDIMNLLQQNGFCWDEVQQMVVAADDIWDAYVKTHPFARSYRMKPLPNYYD  676

Query  804   MSIICGN  784
             + +I GN
Sbjct  677   LVLIYGN  683


 Score =   108 bits (270),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -1

Query  1765  ALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIAL  1586
             ALK R  M   +  S E  R+ WT VM+ YFI+L+L+Q+ +GNR+  +F+KQAW +M+ +
Sbjct  381   ALKRR--MGSQTIPSHERSRTYWTPVMERYFIDLMLEQLHRGNRSGHTFNKQAWTDMLTM  438

Query  1585  FSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             F+ K+  ++D DVLK+RY +L KQ+++ K +L  + F WD+ RQMV  +D  WD YIK  
Sbjct  439   FNTKFGSQYDKDVLKSRYTNLWKQFNDVKNLLGHSGFSWDEGRQMVIADDYVWDIYIKAH  498


 Score =   136 bits (343),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 113/335 (34%), Positives = 167/335 (50%), Gaps = 27/335 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK-  1153
             HP+   YR K VP Y++L  IFG   +D RYS    D    N   +L       ++    
Sbjct  824   HPDARSYRVKTVPSYHKLCFIFGEESSDRRYSRLAHDTHPSNGAPVLMTDEKKNNEVSAG  883

Query  1152  ----IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                 IDW+  M++ FI LMLEQ+QEGN   + F  +AW HMI +FN  F  Q  + VL+ 
Sbjct  884   PLPMIDWTPQMDRSFIDLMLEQLQEGNTFGQAFSEQAWTHMIVSFNERFKLQCDRYVLED  943

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+    +QY  +  LL  +GF+W+E  Q+I AED +W+   K       Y++K L +Y D
Sbjct  944   RYFWWMKQYSDIYNLLDHNGFVWNESQQLITAEDNLWEAYAKEHPDTLLYKDKFLGYYTD  1003

Query  804   MSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGK--EGNLreveeivedddereEK-KCR  634
             +  I GN       G              Q TG+   GNL    +  E    +  + +  
Sbjct  1004  LCKIFGNILDRGVNG--------------QCTGETNNGNLEIKVDGNEHLLLKSRETQIS  1049

Query  633   YDTKEPKEPCKGPSEINEETE-IEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
                K P +      E++++ +  E  ++ A+ EM   V+ L     K++ N   +E  I 
Sbjct  1050  QQRKRPADIISLDRELSKKVDRTENDVQKAISEMAGVVSKLV--NMKQQHNYKAVEGAID  1107

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              LQA+P++  DD+L+LDACD LED+ KAK F+ALD
Sbjct  1108  ALQAIPDI--DDELMLDACDLLEDERKAKTFVALD  1140


 Score =   113 bits (283),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +S +K   + E+   + S+  R+ WT  MD Y I+LLL+Q+ +GN+   +F   AW++M+
Sbjct  703   ISEVKGGESNENQMATVSDRTRTYWTPPMDRYLIDLLLEQVHRGNKIGQTFVSHAWIDMV  762

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               F+ +++  HD DVLKNRYKHLR+ Y+  KI LEQ  F WD++R++VT +D  WD Y K
Sbjct  763   TAFNAQFRAHHDKDVLKNRYKHLRRLYNEIKILLEQRGFSWDENREIVTADDHVWDAYTK  822


 Score =   127 bits (318),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 106/199 (53%), Gaps = 6/199 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKI  1177
             V  HP    YR K +P Y +L +I+G+ + +   +    D + ++ +  +      E+++
Sbjct  657   VKTHPFARSYRMKPLPNYYDLVLIYGNVIDNENQNHLQLDKNIQDHISEVKGGESNENQM  716

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              T  D  +  W+  M+++ I L+LEQV  GNK+ +TF + AWI M+TAFN  F   + K 
Sbjct  717   ATVSDRTRTYWTPPMDRYLIDLLLEQVHRGNKIGQTFVSHAWIDMVTAFNAQFRAHHDKD  776

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R+  LRR Y  +K LL Q GF W E  +++ A+D VW    K     R YR K++ 
Sbjct  777   VLKNRYKHLRRLYNEIKILLEQRGFSWDENREIVTADDHVWDAYTKDHPDARSYRVKTVP  836

Query  816   FYKDMSIICGNETPTFQYG  760
              Y  +  I G E+   +Y 
Sbjct  837   SYHKLCFIFGEESSDRRYS  855


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = -2

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
             IP+ + ++   W+  ME++FI LMLEQ+  GN+   TF  +AW  M+T FNT FG QY K
Sbjct  391   IPSHERSRTY-WTPVMERYFIDLMLEQLHRGNRSGHTFNKQAWTDMLTMFNTKFGSQYDK  449

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
              VLK+R+  L +Q+  VK LL   GF W E  QM++A+D VW   IKA    R Y+ K++
Sbjct  450   DVLKSRYTNLWKQFNDVKNLLGHSGFSWDEGRQMVIADDYVWDIYIKAHPDARSYKTKAV  509

Query  819   SFYKDMSIICG  787
               + D+ +I G
Sbjct  510   LNFSDLCLIYG  520


 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFIEL+L QI +GN+TS +F+K AW +M+ALF+ K+  +H   VL++RYK
Sbjct  560   RTDWTLEMDRYFIELMLGQIGRGNKTSNTFNKHAWTDMLALFNAKFGPQHGKRVLRHRYK  619

Query  1528  HLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
              L K Y +   +L+QN F WD+ +QMV   D+ WD Y+K   F + +   +K + +Y
Sbjct  620   KLWKYYSDIMNLLQQNGFCWDEVQQMVVAADDIWDAYVKTHPFARSY--RMKPLPNY  674


 Score = 84.3 bits (207),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             +++  S+      +WT  MD  FI+L+L+Q+Q+GN    +FS+QAW  MI  F+ ++K +
Sbjct  876   KNNEVSAGPLPMIDWTPQMDRSFIDLMLEQLQEGNTFGQAFSEQAWTHMIVSFNERFKLQ  935

Query  1561  HDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              D  VL++RY    KQY +   +L+ N F+W++S+Q++T  D  W+ Y K
Sbjct  936   CDRYVLEDRYFWWMKQYSDIYNLLDHNGFVWNESQQLITAEDNLWEAYAK  985



>ref|XP_002512353.1| hypothetical protein RCOM_1431030 [Ricinus communis]
 gb|EEF49805.1| hypothetical protein RCOM_1431030 [Ricinus communis]
Length=1097

 Score =   154 bits (390),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 118/186 (63%), Gaps = 2/186 (1%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE--DKIPTKDDA  1159
              HP+ + Y+ K +  + ++ +I+ +TVADGRYS S  D+D +++++ L      PT  + 
Sbjct  112   THPDSQSYKRKSLMNFTDMCLIYAYTVADGRYSRSSHDVDLDDDIQGLNIVSVGPTSTEH  171

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              K DW+  M++ FI+LML+Q+++GNK +  F  +AW HM+T FN  F  QYG  +LK R+
Sbjct  172   VKKDWTPEMDRCFIELMLDQLKKGNKRDMAFSKQAWKHMLTLFNEKFCSQYGLSLLKRRY  231

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               L + Y  ++ L  + GF W ER QMI+A+D VW+K IKA      YR K+L  Y+D+S
Sbjct  232   KKLFKYYSDIRSLRERSGFSWDERQQMIIADDAVWEKYIKAHPDAHLYRKKTLLNYRDLS  291

Query  798   IICGNE  781
             +I GN+
Sbjct  292   LIYGNQ  297


 Score =   109 bits (273),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+NWT VM+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ K+  K+D D+LK+ Y 
Sbjct  13    RTNWTPVMERYFIDLMLDQMHRGNRMGHTFNKQAWTDMLNMFNAKFGTKYDRDILKSHYT  72

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             +L +QY++ K +LEQN F WDD+++MV   D  WD +IK     Q +
Sbjct  73    NLWRQYNDVKNLLEQNGFSWDDTQKMVIAEDNVWDAFIKTHPDSQSY  119


 Score =   133 bits (335),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 110/197 (56%), Gaps = 10/197 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDA---  1159
             +P+   YR + +P YN+L +IFG    DGR   S   I  +  V  LE  +   DD    
Sbjct  764   YPDARSYRNRTLPNYNDLFLIFGDKNNDGRLDDSSHSIAADGYV--LELDVADDDDGLSL  821

Query  1158  -----KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                   KI+W+++ME +FI+L+LEQV +GNK+ +TF  +AW  +I +FN  FG    K  
Sbjct  822   SGYDRPKINWTKSMEVYFIELLLEQVLKGNKIGQTFNEQAWAWIIASFNEKFGLLCDKDD  881

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             +++ +  L  +Y+ +  LL+Q GF W E  Q ++A+D  WK   K      +YRN+ LS 
Sbjct  882   IESWYLSLMEEYYNITDLLNQKGFAWDEIKQAVIADDDDWKSYFKEHPGANKYRNRILSS  941

Query  813   YKDMSIICGNETPTFQY  763
             Y D+ +I GNE P  ++
Sbjct  942   YNDLFMIYGNEAPVGRF  958


 Score = 87.8 bits (216),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 68/99 (69%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W+ +MD +FI+L+L  +++G+  +  F+KQAW +M++    ++  +HD DVLK+R+ 
Sbjct  664   RTDWSPLMDRFFIDLMLKHVRQGSMVNLRFNKQAWYDMVSKIKAEFGSEHDKDVLKSRFM  723

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +LRK + + K +L+Q  F W++ +QM+  ND  W  Y+K
Sbjct  724   NLRKLFKDMKNLLDQKGFAWNELKQMIVANDNIWKSYVK  762


 Score =   106 bits (265),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 96/212 (45%), Gaps = 12/212 (6%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE--NEVKILEDKIP--TKDD  1162
             HP+   YR K VP Y++L +IFG    +GR S    +ID +  +   I+ D +      D
Sbjct  437   HPDACSYRNKSVPSYHKLCVIFGEESYNGRNSHRAHNIDLDSTDPAFIIRDNVQCHANGD  496

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               + +W+ +M+++FI LML QV  G K + +  N+AWI M   F   F  +  K  LK  
Sbjct  497   CSRTEWTPSMDRYFIDLMLYQVTRGKKTDYSSDNQAWIDMAVLFKEKFELKIDKEFLKGY  556

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                L   +  +K LL Q GF W E  Q++ A D  W    K     R YR K    Y D+
Sbjct  557   HISLGNLFNDMKNLLGQRGFSWDETQQLVKAHDDAWDAYAKEYPDIRSYRTKRTPNYNDL  616

Query  801   SIICGNETPTFQYGYPFVKAGEFCVPIIQTTG  706
              +I G+              G   VP I   G
Sbjct  617   YLIFGDSNSD--------DGGNQLVPGICCDG  640


 Score =   104 bits (259),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = -1

Query  1762  LKNRGAMEDD--SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIA  1589
             ++ R A E+D  + + S     +WT  MD Y I+LL DQ  +GN+     + +AW EMI 
Sbjct  317   IQVRTAEENDIYASAGSNGPGQSWTPAMDRYLIDLLQDQALRGNKIGQKLTIEAWTEMIR  376

Query  1588  LFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LF+ K+   HD   LKNRYKHLR QY+    +LEQN F WD++R+MVT  D  WD  I+V
Sbjct  377   LFTEKFGSHHDKGFLKNRYKHLRSQYNGINFLLEQNGFSWDENREMVTAEDYIWDSIIEV  436

Query  1411  Q  1409
              
Sbjct  437   H  437


 Score =   112 bits (279),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 60/191 (31%), Positives = 97/191 (51%), Gaps = 6/191 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN---EVKILEDK---IPT  1171
             AHP+   YR K +  Y +L +I+G+   +G       D +F++   +V+  E+       
Sbjct  272   AHPDAHLYRKKTLLNYRDLSLIYGNQFINGCGDHVRHDKNFQDGKIQVRTAEENDIYASA  331

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               +     W+  M+++ I L+ +Q   GNK+ +    +AW  MI  F   FG  + K  L
Sbjct  332   GSNGPGQSWTPAMDRYLIDLLQDQALRGNKIGQKLTIEAWTEMIRLFTEKFGSHHDKGFL  391

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  LR QY  + +LL Q+GF W E  +M+ AED +W  +I+       YRNKS+  Y
Sbjct  392   KNRYKHLRSQYNGINFLLEQNGFSWDENREMVTAEDYIWDSIIEVHPDACSYRNKSVPSY  451

Query  810   KDMSIICGNET  778
               + +I G E+
Sbjct  452   HKLCVIFGEES  462


 Score = 94.0 bits (232),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+E ++ +WT  MD  FIEL+LDQ++KGN+   +FSKQAW  M+ LF+ K+  ++   +
Sbjct  167   TSTEHVKKDWTPEMDRCFIELMLDQLKKGNKRDMAFSKQAWKHMLTLFNEKFCSQYGLSL  226

Query  1546  LKNRYKHLRKQYHNTKIL-EQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             LK RYK L K Y + + L E++ F WD+ +QM+  +D  W+ YIK  
Sbjct  227   LKRRYKKLFKYYSDIRSLRERSGFSWDERQQMIIADDAVWEKYIKAH  273


 Score =   122 bits (306),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 106/191 (55%), Gaps = 7/191 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVAD-GRYSLS---CFDID---FENEVKILEDKIPT  1171
             +P++  YRTK  P YN+L +IFG + +D G   L    C D D   F   + +       
Sbjct  599   YPDIRSYRTKRTPNYNDLYLIFGDSNSDDGGNQLVPGICCDGDGFFFWLTLSMFCRVKHQ  658

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
                  + DWS  M++ FI LML+ V++G+ +N  F  +AW  M++     FG ++ K VL
Sbjct  659   NSYCYRTDWSPLMDRFFIDLMLKHVRQGSMVNLRFNKQAWYDMVSKIKAEFGSEHDKDVL  718

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K+RF  LR+ +  +K LL Q GF W+E  QMIVA D +WK  +K     R YRN++L  Y
Sbjct  719   KSRFMNLRKLFKDMKNLLDQKGFAWNELKQMIVANDNIWKSYVKEYPDARSYRNRTLPNY  778

Query  810   KDMSIICGNET  778
              D+ +I G++ 
Sbjct  779   NDLFLIFGDKN  789


 Score = 79.3 bits (194),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++ +  R+ WT  MD YFI+L+L Q+ +G +T  S   QAW++M  LF  K++ K D + 
Sbjct  493   ANGDCSRTEWTPSMDRYFIDLMLYQVTRGKKTDYSSDNQAWIDMAVLFKEKFELKIDKEF  552

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK  +  L   +++ K +L Q  F WD+++Q+V  +D+ WD Y K
Sbjct  553   LKGYHISLGNLFNDMKNLLGQRGFSWDETQQLVKAHDDAWDAYAK  597


 Score =   114 bits (286),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 80/133 (60%), Gaps = 0/133 (0%)
 Frame = -2

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             +  ++P   D  + +W+  ME++FI LML+Q+  GN++  TF  +AW  M+  FN  FG 
Sbjct  1     MNSQVPPGIDRTRTNWTPVMERYFIDLMLDQMHRGNRMGHTFNKQAWTDMLNMFNAKFGT  60

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             +Y + +LK+ +  L RQY  VK LL Q+GF W +  +M++AED VW   IK     + Y+
Sbjct  61    KYDRDILKSHYTNLWRQYNDVKNLLEQNGFSWDDTQKMVIAEDNVWDAFIKTHPDSQSYK  120

Query  831   NKSLSFYKDMSII  793
              KSL  + DM +I
Sbjct  121   RKSLMNFTDMCLI  133


 Score = 85.9 bits (211),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 77/132 (58%), Gaps = 5/132 (4%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             A +DD  S S   R   NWT  M+ YFIELLL+Q+ KGN+   +F++QAW  +IA F+ K
Sbjct  813   ADDDDGLSLSGYDRPKINWTKSMEVYFIELLLEQVLKGNKIGQTFNEQAWAWIIASFNEK  872

Query  1573  YKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQ  1397
             +    D D +++ Y  L ++Y+N T +L Q  F WD+ +Q V  +D+ W  Y K      
Sbjct  873   FGLLCDKDDIESWYLSLMEEYYNITDLLNQKGFAWDEIKQAVIADDDDWKSYFKEHPGAN  932

Query  1396  KFSNHLKIIAHY  1361
             K+ N  +I++ Y
Sbjct  933   KYRN--RILSSY  942



>ref|XP_010049859.1| PREDICTED: uncharacterized protein LOC104438410 [Eucalyptus grandis]
 gb|KCW82660.1| hypothetical protein EUGRSUZ_C04039 [Eucalyptus grandis]
Length=776

 Score =   161 bits (407),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HPE+  Y+TK V  +N+L +I+G+T ADGRYS S  D+DF++E++ +         + + 
Sbjct  113   HPEVRTYKTKSVLNFNDLCLIYGYTSADGRYSRSSHDVDFDDEIQRVNMGDGVGSHVLSN  172

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + DW+ +M+Q+F++LML+QV  GNK   TF  +AW  M+  FN  FG QYGK VL+
Sbjct  173   NERPRTDWTPSMDQYFLELMLDQVGRGNKSGDTFTKQAWTDMLHLFNEKFGPQYGKRVLR  232

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L   Y     LL +DGF W +  QMI A+D VW   IKA  + R YR K L  Y 
Sbjct  233   HRYKKLWNYYSDATLLLQEDGFSWDKTRQMITADDDVWNAHIKANPHARTYRTKVLPNYD  292

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  293   DLVLIYGS  300


 Score =   102 bits (253),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             S++  R+ WT  M+ YFI+L+++ + +GNR   +F+KQAW +M+A+F+ K+  ++D D L
Sbjct  8     SNDRSRTYWTPTMERYFIDLMIEHMHRGNRIGHTFNKQAWTDMLAVFNAKFGSQYDKDAL  67

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             K RY +L +Q+++ K +L QN F WD++RQMV  +D  WD Y+KV 
Sbjct  68    KLRYTNLWRQFNDVKNLLGQNGFSWDETRQMVIADDYVWDAYLKVH  113


 Score =   132 bits (331),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 66/188 (35%), Positives = 102/188 (54%), Gaps = 6/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPTK  1168
             HP+   YR + VP Y++L +IFG    DGRY+      D   E+ IL       D    +
Sbjct  439   HPDARSYRVRTVPSYHKLCVIFGEESFDGRYNHVTHSTDPSCEIPILMTGDELNDLYSPR  498

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +++  ++W+E M+++F  L++E    GNK   T  + AW+ MIT+FN  FG Q G+  L+
Sbjct  499   NESSLVEWTEQMDRYFTDLLIEMTHGGNKNGSTLDDVAWVQMITSFNKQFGLQCGRSDLE  558

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L +QY  +  LLS  GF W E  +M++A+  VW+  +K       YR+K L  Y 
Sbjct  559   SRYIFLMKQYDEISKLLSHGGFAWDEMQKMVIADGEVWEAYMKVDPDACAYRDKVLCCYD  618

Query  807   DMSIICGN  784
             D+  I  N
Sbjct  619   DLRKIYSN  626


 Score =   114 bits (286),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 85/133 (64%), Gaps = 11/133 (8%)
 Frame = -1

Query  1783  TSSRLSALKNR---------GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRT  1631
             T SRL   KN          G   D SC+S  T R+ WT  MD Y I+LLLDQ  KGN+ 
Sbjct  306   TQSRLDQQKNSEDDNIGRKSGKARDKSCTSDRT-RTYWTPPMDRYLIDLLLDQALKGNKL  364

Query  1630  STSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQM  1454
               +F  QAW  M+A F+  ++  ++ D+LKNRYK+LRKQ++  + IL+Q+ F+WD++R+M
Sbjct  365   GQTFITQAWTIMVAHFNANFQSNYEKDILKNRYKYLRKQFNEIRNILKQDGFLWDEAREM  424

Query  1453  VTGNDEKWDDYIK  1415
             +T +D+ WD YIK
Sbjct  425   ITADDQLWDAYIK  437


 Score =   130 bits (327),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 114/218 (52%), Gaps = 6/218 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSL-----SCFDIDFENEVKILEDKIPTK  1168
             A+P    YRTKV+P Y++L +I+G    +G  S      +  D +   +     DK  T 
Sbjct  276   ANPHARTYRTKVLPNYDDLVLIYGSAFDNGTQSRLDQQKNSEDDNIGRKSGKARDKSCTS  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  +   W+  M+++ I L+L+Q  +GNKL +TF  +AW  M+  FN  F   Y K +LK
Sbjct  336   DRTRTY-WTPPMDRYLIDLLLDQALKGNKLGQTFITQAWTIMVAHFNANFQSNYEKDILK  394

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LR+Q+  ++ +L QDGF+W E  +MI A+D++W   IK     R YR +++  Y 
Sbjct  395   NRYKYLRKQFNEIRNILKQDGFLWDEAREMITADDQLWDAYIKEHPDARSYRVRTVPSYH  454

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGN  694
              + +I G E+   +Y +        C   I  TG E N
Sbjct  455   KLCVIFGEESFDGRYNHVTHSTDPSCEIPILMTGDELN  492


 Score =   121 bits (304),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             +IP  +D  +  W+ TME++FI LM+E +  GN++  TF  +AW  M+  FN  FG QY 
Sbjct  4     QIPVSNDRSRTYWTPTMERYFIDLMIEHMHRGNRIGHTFNKQAWTDMLAVFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K  LK R+  L RQ+  VK LL Q+GF W E  QM++A+D VW   +K     R Y+ KS
Sbjct  64    KDALKLRYTNLWRQFNDVKNLLGQNGFSWDETRQMVIADDYVWDAYLKVHPEVRTYKTKS  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             +  + D+ +I G  +   +Y
Sbjct  124   VLNFNDLCLIYGYTSADGRY  143


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 83/123 (67%), Gaps = 3/123 (2%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             S++E  R++WT  MD YF+EL+LDQ+ +GN++  +F+KQAW +M+ LF+ K+  ++   V
Sbjct  171   SNNERPRTDWTPSMDQYFLELMLDQVGRGNKSGDTFTKQAWTDMLHLFNEKFGPQYGKRV  230

Query  1546  LKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKII  1370
             L++RYK L   Y + T +L+++ F WD +RQM+T +D+ W+ +IK     + +    K++
Sbjct  231   LRHRYKKLWNYYSDATLLLQEDGFSWDKTRQMITADDDVWNAHIKANPHARTYRT--KVL  288

Query  1369  AHY  1361
              +Y
Sbjct  289   PNY  291


 Score = 72.0 bits (175),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 64/124 (52%), Gaps = 1/124 (1%)
 Frame = -1

Query  1780  SSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWL  1601
             S  +  L     + D     +E+    WT  MD YF +LL++    GN+  ++    AW+
Sbjct  479   SCEIPILMTGDELNDLYSPRNESSLVEWTEQMDRYFTDLLIEMTHGGNKNGSTLDDVAWV  538

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDD  1424
             +MI  F+ ++  +     L++RY  L KQY   +K+L    F WD+ ++MV  + E W+ 
Sbjct  539   QMITSFNKQFGLQCGRSDLESRYIFLMKQYDEISKLLSHGGFAWDEMQKMVIADGEVWEA  598

Query  1423  YIKV  1412
             Y+KV
Sbjct  599   YMKV  602



>ref|XP_007011690.1| Uncharacterized protein TCM_036890 [Theobroma cacao]
 gb|EOY29309.1| Uncharacterized protein TCM_036890 [Theobroma cacao]
Length=771

 Score =   157 bits (397),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 77/188 (41%), Positives = 117/188 (62%), Gaps = 6/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPT  1171
             AHP+   Y+TK +  +++L +I+G+T ADGRYS S  D+DF++EV+ +       +   T
Sbjct  112   AHPDARSYKTKAMLNFSDLCLIYGYTTADGRYSRSSHDLDFDDEVQGVNMGDGMCNLPST  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + +W+  M+Q+FI+LML+QV  GNK++ TF  +AW  M+  FN  FG Q+GK VL
Sbjct  172   NNERPRTEWNADMDQYFIELMLDQVGRGNKVDNTFNKQAWTDMLALFNAKFGPQHGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+  L + Y  V  +L Q+GF W E   MI A++ VW   IKA  + R YR K+L  Y
Sbjct  232   RHRYKKLWKYYGDVTVILKQNGFSWDETQLMITADNDVWDAYIKAHPHARTYRMKTLPNY  291

Query  810   KDMSIICG  787
              D+ +I G
Sbjct  292   NDLVLIYG  299


 Score =   105 bits (261),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
              +++  R+ WT  M+ YFI+L+L+Q+ +GNR   +FSKQAW +M+ +F+ K+  ++D DV
Sbjct  7     GTNDRTRTYWTPTMERYFIDLMLEQMHRGNRIGHTFSKQAWTDMLTVFNAKFGSQYDKDV  66

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             LK+RY +L KQ++  K +L Q+ F WD+SRQMV  +D  W+ YIK  
Sbjct  67    LKSRYTNLWKQFNGVKNLLGQSGFSWDESRQMVVADDYVWNAYIKAH  113


 Score =   144 bits (363),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/336 (32%), Positives = 160/336 (48%), Gaps = 22/336 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------EDKI  1177
             +HP+   YR K VP Y++L +IFG    DGRY+    ++  + +V +L         D  
Sbjct  435   SHPDARSYRVKTVPSYHKLCVIFGQESCDGRYNRLAQNVGTDGDVTVLMTGYGNEENDHF  494

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P+      I+W+  M++ FI L+LEQV EGNK++R F  +AWIHM+ +FN  F     K 
Sbjct  495   PSSIHHHGIEWTAPMDRFFIDLLLEQVHEGNKIDRAFNEQAWIHMVESFNENFALLLNKN  554

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              L+ ++  L +QY  +  LL+  GF+W E  QM+VA + VW+  IK       Y++K L 
Sbjct  555   ELENQYICLMKQYDDISDLLNHSGFVWDEAKQMVVANNDVWEVYIKEHPDAVSYKDKFLG  614

Query  816   FYKDMSIICGNETPTFQ-YGYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKK  640
              Y D+  I  +E    +  G       +   P +      GNL+         D+  ++ 
Sbjct  615   SYSDLCKIFKDEVLDGRPSGQVLGVETDHSAPEVILDRAPGNLQTQGGDFHLFDQHRKRS  674

Query  639   CRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVI  460
                 T +     K P    E       M+  +  M  AVT L    +K  KN  +IE  +
Sbjct  675   TA--TPDIGRASKAPKTDQE-------MQKMVSRMAGAVTRLA--SQKGNKNYSIIESAV  723

Query  459   YILQAMPEMdddddllldacdfledDNKAKVFLALD  352
               LQA+P++DD+  L        E   KAK FLALD
Sbjct  724   DALQALPDIDDELLLDACDLLEDEK--KAKTFLALD  757


 Score =   115 bits (288),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 85/134 (63%), Gaps = 5/134 (4%)
 Frame = -1

Query  1813  GLIPRLPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNR  1634
             G +  +P  Y  SR +A + + ++      + +  R+ WT  MD Y I+LLLDQ+ +GN+
Sbjct  305   GNVNNVPQEYDISRATAGEGKKSVN----PAGDRTRTFWTPPMDRYLIDLLLDQVSRGNK  360

Query  1633  TSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQ  1457
                +F  QAW++M+  F+ K+   +D DVLKNRYKHLR+ Y++ KI LEQ+ F WD++R 
Sbjct  361   LGQTFITQAWIDMVTSFNVKFGSHYDKDVLKNRYKHLRRLYNDIKILLEQSGFSWDEARD  420

Query  1456  MVTGNDEKWDDYIK  1415
             MV+  D  WD YIK
Sbjct  421   MVSAEDSVWDAYIK  434


 Score =   139 bits (350),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 105/192 (55%), Gaps = 3/192 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILEDKIPTKDDA  1159
             AHP    YR K +P YN+L +I+G  + +G  +     +DI      +  +   P  D  
Sbjct  276   AHPHARTYRMKTLPNYNDLVLIYGEAIDEGNVNNVPQEYDISRATAGEGKKSVNPAGDRT  335

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
             +   W+  M+++ I L+L+QV  GNKL +TF  +AWI M+T+FN  FG  Y K VLK R+
Sbjct  336   RTF-WTPPMDRYLIDLLLDQVSRGNKLGQTFITQAWIDMVTSFNVKFGSHYDKDVLKNRY  394

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               LRR Y  +K LL Q GF W E   M+ AED VW   IK+    R YR K++  Y  + 
Sbjct  395   KHLRRLYNDIKILLEQSGFSWDEARDMVSAEDSVWDAYIKSHPDARSYRVKTVPSYHKLC  454

Query  798   IICGNETPTFQY  763
             +I G E+   +Y
Sbjct  455   VIFGQESCDGRY  466


 Score =   106 bits (264),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 52/117 (44%), Positives = 78/117 (67%), Gaps = 5/117 (4%)
 Frame = -1

Query  1744  MEDDSC----SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             M D  C    +++E  R+ W   MD YFIEL+LDQ+ +GN+   +F+KQAW +M+ALF+ 
Sbjct  161   MGDGMCNLPSTNNERPRTEWNADMDQYFIELMLDQVGRGNKVDNTFNKQAWTDMLALFNA  220

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             K+  +H   VL++RYK L K Y + T IL+QN F WD+++ M+T +++ WD YIK  
Sbjct  221   KFGPQHGKRVLRHRYKKLWKYYGDVTVILKQNGFSWDETQLMITADNDVWDAYIKAH  277


 Score =   130 bits (327),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 86/140 (61%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             +IP  +D  +  W+ TME++FI LMLEQ+  GN++  TF  +AW  M+T FN  FG QY 
Sbjct  4     QIPGTNDRTRTYWTPTMERYFIDLMLEQMHRGNRIGHTFSKQAWTDMLTVFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K VLK+R+  L +Q+  VK LL Q GF W E  QM+VA+D VW   IKA    R Y+ K+
Sbjct  64    KDVLKSRYTNLWKQFNGVKNLLGQSGFSWDESRQMVVADDYVWNAYIKAHPDARSYKTKA  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             +  + D+ +I G  T   +Y
Sbjct  124   MLNFSDLCLIYGYTTADGRY  143


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +FI+LLL+Q+ +GN+   +F++QAW+ M+  F+  +    + + L+N+Y  L 
Sbjct  505   WTAPMDRFFIDLLLEQVHEGNKIDRAFNEQAWIHMVESFNENFALLLNKNELENQYICLM  564

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQY + + +L  + F+WD+++QMV  N++ W+ YIK
Sbjct  565   KQYDDISDLLNHSGFVWDEAKQMVVANNDVWEVYIK  600



>gb|KCW82661.1| hypothetical protein EUGRSUZ_C04039 [Eucalyptus grandis]
Length=601

 Score =   160 bits (404),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 79/188 (42%), Positives = 115/188 (61%), Gaps = 6/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPTK  1168
             HPE+  Y+TK V  +N+L +I+G+T ADGRYS S  D+DF++E++ +         + + 
Sbjct  113   HPEVRTYKTKSVLNFNDLCLIYGYTSADGRYSRSSHDVDFDDEIQRVNMGDGVGSHVLSN  172

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + DW+ +M+Q+F++LML+QV  GNK   TF  +AW  M+  FN  FG QYGK VL+
Sbjct  173   NERPRTDWTPSMDQYFLELMLDQVGRGNKSGDTFTKQAWTDMLHLFNEKFGPQYGKRVLR  232

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L   Y     LL +DGF W +  QMI A+D VW   IKA  + R YR K L  Y 
Sbjct  233   HRYKKLWNYYSDATLLLQEDGFSWDKTRQMITADDDVWNAHIKANPHARTYRTKVLPNYD  292

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  293   DLVLIYGS  300


 Score =   101 bits (252),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             S++  R+ WT  M+ YFI+L+++ + +GNR   +F+KQAW +M+A+F+ K+  ++D D L
Sbjct  8     SNDRSRTYWTPTMERYFIDLMIEHMHRGNRIGHTFNKQAWTDMLAVFNAKFGSQYDKDAL  67

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             K RY +L +Q+++ K +L QN F WD++RQMV  +D  WD Y+KV 
Sbjct  68    KLRYTNLWRQFNDVKNLLGQNGFSWDETRQMVIADDYVWDAYLKVH  113


 Score =   121 bits (303),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 58/163 (36%), Positives = 92/163 (56%), Gaps = 6/163 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPTK  1168
             HP+   YR + VP Y++L +IFG    DGRY+      D   E+ IL       D    +
Sbjct  439   HPDARSYRVRTVPSYHKLCVIFGEESFDGRYNHVTHSTDPSCEIPILMTGDELNDLYSPR  498

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +++  ++W+E M+++F  L++E    GNK   T  + AW+ MIT+FN  FG Q G+  L+
Sbjct  499   NESSLVEWTEQMDRYFTDLLIEMTHGGNKNGSTLDDVAWVQMITSFNKQFGLQCGRSDLE  558

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIK  859
             +R+  L +QY  +  LLS  GF W E  +M++A+  VW+  +K
Sbjct  559   SRYIFLMKQYDEISKLLSHGGFAWDEMQKMVIADGEVWEAYMK  601


 Score =   114 bits (285),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 85/133 (64%), Gaps = 11/133 (8%)
 Frame = -1

Query  1783  TSSRLSALKNR---------GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRT  1631
             T SRL   KN          G   D SC+S  T R+ WT  MD Y I+LLLDQ  KGN+ 
Sbjct  306   TQSRLDQQKNSEDDNIGRKSGKARDKSCTSDRT-RTYWTPPMDRYLIDLLLDQALKGNKL  364

Query  1630  STSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQM  1454
               +F  QAW  M+A F+  ++  ++ D+LKNRYK+LRKQ++  + IL+Q+ F+WD++R+M
Sbjct  365   GQTFITQAWTIMVAHFNANFQSNYEKDILKNRYKYLRKQFNEIRNILKQDGFLWDEAREM  424

Query  1453  VTGNDEKWDDYIK  1415
             +T +D+ WD YIK
Sbjct  425   ITADDQLWDAYIK  437


 Score =   129 bits (323),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 73/218 (33%), Positives = 114/218 (52%), Gaps = 6/218 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSL-----SCFDIDFENEVKILEDKIPTK  1168
             A+P    YRTKV+P Y++L +I+G    +G  S      +  D +   +     DK  T 
Sbjct  276   ANPHARTYRTKVLPNYDDLVLIYGSAFDNGTQSRLDQQKNSEDDNIGRKSGKARDKSCTS  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  +   W+  M+++ I L+L+Q  +GNKL +TF  +AW  M+  FN  F   Y K +LK
Sbjct  336   DRTRTY-WTPPMDRYLIDLLLDQALKGNKLGQTFITQAWTIMVAHFNANFQSNYEKDILK  394

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LR+Q+  ++ +L QDGF+W E  +MI A+D++W   IK     R YR +++  Y 
Sbjct  395   NRYKYLRKQFNEIRNILKQDGFLWDEAREMITADDQLWDAYIKEHPDARSYRVRTVPSYH  454

Query  807   DMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGN  694
              + +I G E+   +Y +        C   I  TG E N
Sbjct  455   KLCVIFGEESFDGRYNHVTHSTDPSCEIPILMTGDELN  492


 Score = 99.8 bits (247),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 76/106 (72%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             S++E  R++WT  MD YF+EL+LDQ+ +GN++  +F+KQAW +M+ LF+ K+  ++   V
Sbjct  171   SNNERPRTDWTPSMDQYFLELMLDQVGRGNKSGDTFTKQAWTDMLHLFNEKFGPQYGKRV  230

Query  1546  LKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             L++RYK L   Y + T +L+++ F WD +RQM+T +D+ W+ +IK 
Sbjct  231   LRHRYKKLWNYYSDATLLLQEDGFSWDKTRQMITADDDVWNAHIKA  276


 Score =   120 bits (301),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 82/140 (59%), Gaps = 0/140 (0%)
 Frame = -2

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
             +IP  +D  +  W+ TME++FI LM+E +  GN++  TF  +AW  M+  FN  FG QY 
Sbjct  4     QIPVSNDRSRTYWTPTMERYFIDLMIEHMHRGNRIGHTFNKQAWTDMLAVFNAKFGSQYD  63

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             K  LK R+  L RQ+  VK LL Q+GF W E  QM++A+D VW   +K     R Y+ KS
Sbjct  64    KDALKLRYTNLWRQFNDVKNLLGQNGFSWDETRQMVIADDYVWDAYLKVHPEVRTYKTKS  123

Query  822   LSFYKDMSIICGNETPTFQY  763
             +  + D+ +I G  +   +Y
Sbjct  124   VLNFNDLCLIYGYTSADGRY  143


 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/123 (30%), Positives = 63/123 (51%), Gaps = 1/123 (1%)
 Frame = -1

Query  1780  SSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWL  1601
             S  +  L     + D     +E+    WT  MD YF +LL++    GN+  ++    AW+
Sbjct  479   SCEIPILMTGDELNDLYSPRNESSLVEWTEQMDRYFTDLLIEMTHGGNKNGSTLDDVAWV  538

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDD  1424
             +MI  F+ ++  +     L++RY  L KQY   +K+L    F WD+ ++MV  + E W+ 
Sbjct  539   QMITSFNKQFGLQCGRSDLESRYIFLMKQYDEISKLLSHGGFAWDEMQKMVIADGEVWEA  598

Query  1423  YIK  1415
             Y+K
Sbjct  599   YMK  601



>ref|XP_004145581.1| PREDICTED: uncharacterized protein LOC101212813 [Cucumis sativus]
 ref|XP_004164578.1| PREDICTED: uncharacterized LOC101212813 [Cucumis sativus]
Length=767

 Score =   152 bits (385),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 112/187 (60%), Gaps = 12/187 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+   Y+TK V  +++L +I+G+T ADGRYS S  DIDF++EV+ +        +A K
Sbjct  112   AHPDARSYKTKAVLNFSDLCLIYGYTNADGRYSRSSHDIDFDDEVQAV--------NAGK  163

Query  1152  I----DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                  DW+  M+++FI+LML Q+  GNK + TF   AW  M+  FN  FG Q+GK VL+ 
Sbjct  164   TFLLTDWTLEMDRYFIELMLGQIGRGNKTSNTFNKHAWTDMLALFNAKFGPQHGKRVLRH  223

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  L + Y  +  LL Q+GF W E  QM+VA D +W   +K   + R YR K L  Y D
Sbjct  224   RYKKLWKYYSDIMNLLQQNGFCWDEVQQMVVAADDIWDAYVKTHPFARSYRMKPLPNYYD  283

Query  804   MSIICGN  784
             + +I GN
Sbjct  284   LVLIYGN  290


 Score =   106 bits (264),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 77/112 (69%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   +  S E  R+ WT VM+ YFI+L+L+Q+ +GNR+  +F+KQAW +M+ +F+ K+  
Sbjct  1     MGSQTIPSHERSRTYWTPVMERYFIDLMLEQLHRGNRSGHTFNKQAWTDMLTMFNTKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK+RY +L KQ+++ K +L  + F WD+ RQMV  +D  WD YIK 
Sbjct  61    QYDKDVLKSRYTNLWKQFNDVKNLLGHSGFSWDEGRQMVIADDYVWDIYIKA  112


 Score =   136 bits (342),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 106/335 (32%), Positives = 158/335 (47%), Gaps = 27/335 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK-  1153
             HP+   YR K VP Y++L  IFG   +D RYS    D    N   +L       ++    
Sbjct  431   HPDARSYRVKTVPSYHKLCFIFGEESSDRRYSRLAHDTHPSNGAPVLMTDEKKNNEVSAG  490

Query  1152  ----IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                 IDW+  M++ FI LMLEQ+QEGN   + F  +AW HMI +FN  F  Q  + VL+ 
Sbjct  491   PLPMIDWTPQMDRSFIDLMLEQLQEGNTFGQAFSEQAWTHMIVSFNERFKLQCDRYVLED  550

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+    +QY  +  LL  +GF+W+E  Q+I AED +W+   K       Y++K L +Y D
Sbjct  551   RYFWWMKQYSDIYNLLDHNGFVWNESQQLITAEDNLWEAYAKEHPDTLLYKDKFLGYYTD  610

Query  804   MSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGK--EGNLreveeivedddereEK-KCR  634
             +  I GN       G              Q TG+   GNL    +  E    +  + +  
Sbjct  611   LCKIFGNILDRGVNG--------------QCTGETNNGNLEIKVDGNEHLLLKSRETQIS  656

Query  633   YDTKEPKEPCKGPSEINEETE-IEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIY  457
                K P +      E++++ +  E  ++ A+ EM   V+ L     K++ N   +E  I 
Sbjct  657   QQRKRPADIISLDRELSKKVDRTENDVQKAISEMAGVVSKLV--NMKQQHNYKAVEGAID  714

Query  456   ILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              LQA+P++DD+  L        E   KAK F+ALD
Sbjct  715   ALQAIPDIDDELMLDACDLLEDER--KAKTFVALD  747


 Score =   113 bits (282),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 79/120 (66%), Gaps = 1/120 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +S +K   + E+   + S+  R+ WT  MD Y I+LLL+Q+ +GN+   +F   AW++M+
Sbjct  310   ISEVKGGESNENQMATVSDRTRTYWTPPMDRYLIDLLLEQVHRGNKIGQTFVSHAWIDMV  369

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               F+ +++  HD DVLKNRYKHLR+ Y+  KI LEQ  F WD++R++VT +D  WD Y K
Sbjct  370   TAFNAQFRAHHDKDVLKNRYKHLRRLYNEIKILLEQRGFSWDENREIVTADDHVWDAYTK  429


 Score =   126 bits (316),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 116/227 (51%), Gaps = 17/227 (7%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKI  1177
             V  HP    YR K +P Y +L +I+G+ + +   +    D + ++ +  +      E+++
Sbjct  264   VKTHPFARSYRMKPLPNYYDLVLIYGNVIDNENQNHLQLDKNIQDHISEVKGGESNENQM  323

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              T  D  +  W+  M+++ I L+LEQV  GNK+ +TF + AWI M+TAFN  F   + K 
Sbjct  324   ATVSDRTRTYWTPPMDRYLIDLLLEQVHRGNKIGQTFVSHAWIDMVTAFNAQFRAHHDKD  383

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R+  LRR Y  +K LL Q GF W E  +++ A+D VW    K     R YR K++ 
Sbjct  384   VLKNRYKHLRRLYNEIKILLEQRGFSWDENREIVTADDHVWDAYTKDHPDARSYRVKTVP  443

Query  816   FYKDMSIICGNETPTFQYG------YPFVKAGEFCVPIIQTTGKEGN  694
              Y  +  I G E+   +Y       +P   A     P++ T  K+ N
Sbjct  444   SYHKLCFIFGEESSDRRYSRLAHDTHPSNGA-----PVLMTDEKKNN  485


 Score =   115 bits (289),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/131 (44%), Positives = 81/131 (62%), Gaps = 1/131 (1%)
 Frame = -2

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
             IP+ + ++   W+  ME++FI LMLEQ+  GN+   TF  +AW  M+T FNT FG QY K
Sbjct  6     IPSHERSRTY-WTPVMERYFIDLMLEQLHRGNRSGHTFNKQAWTDMLTMFNTKFGSQYDK  64

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
              VLK+R+  L +Q+  VK LL   GF W E  QM++A+D VW   IKA    R Y+ K++
Sbjct  65    DVLKSRYTNLWKQFNDVKNLLGHSGFSWDEGRQMVIADDYVWDIYIKAHPDARSYKTKAV  124

Query  819   SFYKDMSIICG  787
               + D+ +I G
Sbjct  125   LNFSDLCLIYG  135


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -1

Query  1711  LRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             L ++WT  MD YFIEL+L QI +GN+TS +F+K AW +M+ALF+ K+  +H   VL++RY
Sbjct  166   LLTDWTLEMDRYFIELMLGQIGRGNKTSNTFNKHAWTDMLALFNAKFGPQHGKRVLRHRY  225

Query  1531  KHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             K L K Y +   +L+QN F WD+ +QMV   D+ WD Y+K   F + +
Sbjct  226   KKLWKYYSDIMNLLQQNGFCWDEVQQMVVAADDIWDAYVKTHPFARSY  273


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             +++  S+      +WT  MD  FI+L+L+Q+Q+GN    +FS+QAW  MI  F+ ++K +
Sbjct  483   KNNEVSAGPLPMIDWTPQMDRSFIDLMLEQLQEGNTFGQAFSEQAWTHMIVSFNERFKLQ  542

Query  1561  HDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              D  VL++RY    KQY +   +L+ N F+W++S+Q++T  D  W+ Y K
Sbjct  543   CDRYVLEDRYFWWMKQYSDIYNLLDHNGFVWNESQQLITAEDNLWEAYAK  592



>gb|KDP33499.1| hypothetical protein JCGZ_07070 [Jatropha curcas]
Length=428

 Score =   162 bits (410),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 119/190 (63%), Gaps = 6/190 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI------LEDKIPTK  1168
             HP+  PYRTK V  +N+L  I+G+T ADGRYS S  DIDF++E++       +    P+ 
Sbjct  94    HPDARPYRTKTVLNFNDLCFIYGYTTADGRYSRSSHDIDFDDEIQAANMGDAMGSSAPSH  153

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             ++  + +W+ +M+Q+F++L+L+Q+ +GNK   TF  +AW  M+++FN  FG Q+GK VL+
Sbjct  154   NERPRTEWTASMDQYFVELLLDQIIKGNKTENTFNKQAWTDMLSSFNAKFGPQHGKRVLR  213

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +    +K +L Q+GF W E  QMIV ++ VW   IK     R YR K+L  Y 
Sbjct  214   HRYKKLLKYCSEMKVILKQNGFSWDEPQQMIVGDNDVWDAYIKVHPQARAYRMKTLPNYN  273

Query  807   DMSIICGNET  778
             D+ +I G+ T
Sbjct  274   DLVLIFGDAT  283


 Score = 95.1 bits (235),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 69/94 (73%), Gaps = 1/94 (1%)
 Frame = -1

Query  1687  MDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYH  1508
             M+ YFI+L+L+ + +GNR   +F+KQAW +M+ +F+ K+  ++D DVLK+RY +L KQ++
Sbjct  1     MERYFIDLMLEHMHRGNRIGHTFNKQAWTDMLTVFNAKFGSQYDKDVLKSRYTNLWKQFN  60

Query  1507  NTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             + K +L Q+ F WD+SR+M+  +D  WD Y+KV 
Sbjct  61    DVKNLLSQSGFSWDESREMIVADDYVWDAYLKVH  94


 Score =   120 bits (302),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +S +K        + +SS+  R+ WT  MD Y I+LLLDQ+ +GN+   +F  QAW++M+
Sbjct  301   ISGIKTGEGKGSQTLASSDRTRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFISQAWIDMV  360

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             A F+ K++  HD DVLKNRYKHLR+ Y++ K +LE N F WD++R+M+T  D  WD Y K
Sbjct  361   ASFNVKFQSLHDKDVLKNRYKHLRRMYNDIKSLLENNGFSWDETREMITAEDHVWDAYTK  420

Query  1414  V  1412
             V
Sbjct  421   V  421


 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 88/164 (54%), Gaps = 8/164 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADG----RYSLSCFDIDFENEVKILEDK---IPT  1171
             HP+   YR K +P YN+L +IFG    DG     +     ++D    +K  E K      
Sbjct  258   HPQARAYRMKTLPNYNDLVLIFGDATEDGVDTNLHQAKDHEVDISG-IKTGEGKGSQTLA  316

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D  +  W+  M+++ I L+L+QV  GNKL +TF ++AWI M+ +FN  F   + K VL
Sbjct  317   SSDRTRTYWTPPMDRYLIDLLLDQVHRGNKLGQTFISQAWIDMVASFNVKFQSLHDKDVL  376

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIK  859
             K R+  LRR Y  +K LL  +GF W E  +MI AED VW    K
Sbjct  377   KNRYKHLRRMYNDIKSLLENNGFSWDETREMITAEDHVWDAYTK  420


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 0/125 (0%)
 Frame = -2

Query  1134  MEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYF  955
             ME++FI LMLE +  GN++  TF  +AW  M+T FN  FG QY K VLK+R+  L +Q+ 
Sbjct  1     MERYFIDLMLEHMHRGNRIGHTFNKQAWTDMLTVFNAKFGSQYDKDVLKSRYTNLWKQFN  60

Query  954   AVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETP  775
              VK LLSQ GF W E  +MIVA+D VW   +K     R YR K++  + D+  I G  T 
Sbjct  61    DVKNLLSQSGFSWDESREMIVADDYVWDAYLKVHPDARPYRTKTVLNFNDLCFIYGYTTA  120

Query  774   TFQYG  760
               +Y 
Sbjct  121   DGRYS  125


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 84/130 (65%), Gaps = 3/130 (2%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
             AM   + S +E  R+ WT  MD YF+ELLLDQI KGN+T  +F+KQAW +M++ F+ K+ 
Sbjct  145   AMGSSAPSHNERPRTEWTASMDQYFVELLLDQIIKGNKTENTFNKQAWTDMLSSFNAKFG  204

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +H   VL++RYK L K     K IL+QN F WD+ +QM+ G+++ WD YIKV    Q  
Sbjct  205   PQHGKRVLRHRYKKLLKYCSEMKVILKQNGFSWDEPQQMIVGDNDVWDAYIKVH--PQAR  262

Query  1390  SNHLKIIAHY  1361
             +  +K + +Y
Sbjct  263   AYRMKTLPNY  272



>ref|XP_011081984.1| PREDICTED: uncharacterized protein LOC105164875 isoform X1 [Sesamum 
indicum]
Length=828

 Score =   152 bits (384),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 115/188 (61%), Gaps = 4/188 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILE-DKIPTKDD  1162
             +PE  PYRTK V  +++L +I+G+TVADGRYS S  D+DFE+E     + E +       
Sbjct  179   NPEARPYRTKSVLNFDDLCLIYGYTVADGRYSRSSHDVDFEDENPGAHLGERNSNLASST  238

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
             + + DW+  M+Q+FI+LML+Q + GNKL+ TF  +AW  M+  FN  F  +Y K VL+ R
Sbjct  239   SSRTDWTPDMDQYFIELMLKQQERGNKLDSTFTKQAWTEMLALFNAKFSSEYNKRVLRHR  298

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
             +  L + Y  +  L+ Q GF+W E+ +M+VA + VW   +KA  + R YR K    Y ++
Sbjct  299   YKKLWKYYCDLMTLVKQKGFVWDEKQEMVVAHNNVWDAYMKAHPHARSYRAKVFPGYNNL  358

Query  801   SIICGNET  778
             ++I G  T
Sbjct  359   ALIFGEMT  366


 Score =   104 bits (259),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + SS+   R+ WT  M+ YF++L+L+ I +GNR   +F+KQAW +M+A+F+ K+  
Sbjct  67    MSGQNLSSNHCSRTYWTPTMERYFVDLMLEHIHRGNRIGHTFNKQAWTDMLAVFNAKFGS  126

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK RY +L K +++ K +L Q  F WD++RQMV  +D  W+ YIK+
Sbjct  127   QYDKDVLKGRYTNLWKLFNDVKNLLGQKGFSWDETRQMVVADDYVWEAYIKI  178


 Score =   122 bits (307),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 99/189 (52%), Gaps = 9/189 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI------PT  1171
             AHP+   YR K VP Y++L +I+G    DG YS  C     +  V     KI       +
Sbjct  494   AHPDARSYRVKTVPCYHKLCVIYGQDKFDGSYS--CLVGSTDPAVGTFCMKIGNGKREES  551

Query  1170  KDDAKKI-DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                A  I DWS  MEQ+F+ LMLEQV  GNK++  F  +AW HM  +F   FG QY + +
Sbjct  552   HAGADPITDWSYPMEQYFVDLMLEQVLHGNKIDNEFGEQAWAHMTLSFKEKFGLQYEQHI  611

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+  L +QY  +  LL+++GF+W E    IV +   W+   K       Y++K + +
Sbjct  612   LENRYLSLMKQYIEISNLLNEEGFLWDEASHTIVGDSDTWESYAKEHPEAVSYKDKVVRY  671

Query  813   YKDMSIICG  787
             Y ++  I G
Sbjct  672   YSELCAIFG  680


 Score =   112 bits (279),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE  R+ WT  MD +FI+L+LDQ+  GNR   SF  QAW +M+  F+  +   HD +V
Sbjct  389   AGSERSRTYWTPPMDRFFIDLMLDQVHGGNRIGPSFITQAWNDMVESFNANFNSHHDREV  448

Query  1546  LKNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKVQ  1409
             LKNRYKH RKQY++ +IL Q++ F WD+ R+M+T  D  WD YIK  
Sbjct  449   LKNRYKHFRKQYNDVRILLQHKGFSWDEGREMLTAEDHVWDAYIKAH  495


 Score =   126 bits (316),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 104/209 (50%), Gaps = 10/209 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCF-DIDFENEVKILEDKIPTKDDAK  1156
             AHP    YR KV P YN L +IFG   +     + C  D D ++E  + +       +  
Sbjct  340   AHPHARSYRAKVFPGYNNLALIFGEMTSK-ESQIDCHQDKDIKSEAVVAK----AGSERS  394

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             +  W+  M++ FI LML+QV  GN++  +F  +AW  M+ +FN  F   + + VLK R+ 
Sbjct  395   RTYWTPPMDRFFIDLMLDQVHGGNRIGPSFITQAWNDMVESFNANFNSHHDREVLKNRYK  454

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
               R+QY  V+ LL   GF W E  +M+ AED VW   IKA    R YR K++  Y  + +
Sbjct  455   HFRKQYNDVRILLQHKGFSWDEGREMLTAEDHVWDAYIKAHPDARSYRVKTVPCYHKLCV  514

Query  795   ICGNETPTFQY----GYPFVKAGEFCVPI  721
             I G +     Y    G      G FC+ I
Sbjct  515   IYGQDKFDGSYSCLVGSTDPAVGTFCMKI  543


 Score = 97.8 bits (242),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +SS + R++WT  MD YFIEL+L Q ++GN+  ++F+KQAW EM+ALF+ K+  +++  V
Sbjct  235   ASSTSSRTDWTPDMDQYFIELMLKQQERGNKLDSTFTKQAWTEMLALFNAKFSSEYNKRV  294

Query  1546  LKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             L++RYK L K Y +   +++Q  F+WD+ ++MV  ++  WD Y+K  
Sbjct  295   LRHRYKKLWKYYCDLMTLVKQKGFVWDEKQEMVVAHNNVWDAYMKAH  341


 Score =   113 bits (283),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+ TME++F+ LMLE +  GN++  TF  +AW  M+  FN  FG QY K VLK R+  L 
Sbjct  82    WTPTMERYFVDLMLEHIHRGNRIGHTFNKQAWTDMLAVFNAKFGSQYDKDVLKGRYTNLW  141

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             + +  VK LL Q GF W E  QM+VA+D VW+  IK     R YR KS+  + D+ +I G
Sbjct  142   KLFNDVKNLLGQKGFSWDETRQMVVADDYVWEAYIKINPEARPYRTKSVLNFDDLCLIYG  201


 Score = 79.3 bits (194),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++W++ M+ YF++L+L+Q+  GN+    F +QAW  M   F  K+  +++  +L+NRY  
Sbjct  559   TDWSYPMEQYFVDLMLEQVLHGNKIDNEFGEQAWAHMTLSFKEKFGLQYEQHILENRYLS  618

Query  1525  LRKQY-HNTKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L KQY   + +L +  F+WD++   + G+ + W+ Y K
Sbjct  619   LMKQYIEISNLLNEEGFLWDEASHTIVGDSDTWESYAK  656



>ref|XP_011081985.1| PREDICTED: uncharacterized protein LOC105164875 isoform X2 [Sesamum 
indicum]
 ref|XP_011081986.1| PREDICTED: uncharacterized protein LOC105164875 isoform X2 [Sesamum 
indicum]
 ref|XP_011081987.1| PREDICTED: uncharacterized protein LOC105164875 isoform X2 [Sesamum 
indicum]
Length=762

 Score =   152 bits (385),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 115/188 (61%), Gaps = 4/188 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILE-DKIPTKDD  1162
             +PE  PYRTK V  +++L +I+G+TVADGRYS S  D+DFE+E     + E +       
Sbjct  113   NPEARPYRTKSVLNFDDLCLIYGYTVADGRYSRSSHDVDFEDENPGAHLGERNSNLASST  172

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
             + + DW+  M+Q+FI+LML+Q + GNKL+ TF  +AW  M+  FN  F  +Y K VL+ R
Sbjct  173   SSRTDWTPDMDQYFIELMLKQQERGNKLDSTFTKQAWTEMLALFNAKFSSEYNKRVLRHR  232

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
             +  L + Y  +  L+ Q GF+W E+ +M+VA + VW   +KA  + R YR K    Y ++
Sbjct  233   YKKLWKYYCDLMTLVKQKGFVWDEKQEMVVAHNNVWDAYMKAHPHARSYRAKVFPGYNNL  292

Query  801   SIICGNET  778
             ++I G  T
Sbjct  293   ALIFGEMT  300


 Score =   103 bits (258),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + SS+   R+ WT  M+ YF++L+L+ I +GNR   +F+KQAW +M+A+F+ K+  
Sbjct  1     MSGQNLSSNHCSRTYWTPTMERYFVDLMLEHIHRGNRIGHTFNKQAWTDMLAVFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++D DVLK RY +L K +++ K +L Q  F WD++RQMV  +D  W+ YIK+
Sbjct  61    QYDKDVLKGRYTNLWKLFNDVKNLLGQKGFSWDETRQMVVADDYVWEAYIKI  112


 Score =   122 bits (307),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 97/189 (51%), Gaps = 9/189 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+   YR K VP Y++L +I+G    DG YS  C     +  V     KI      + 
Sbjct  428   AHPDARSYRVKTVPCYHKLCVIYGQDKFDGSYS--CLVGSTDPAVGTFCMKIGNGKREES  485

Query  1152  -------IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                     DWS  MEQ+F+ LMLEQV  GNK++  F  +AW HM  +F   FG QY + +
Sbjct  486   HAGADPITDWSYPMEQYFVDLMLEQVLHGNKIDNEFGEQAWAHMTLSFKEKFGLQYEQHI  545

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+  L +QY  +  LL+++GF+W E    IV +   W+   K       Y++K + +
Sbjct  546   LENRYLSLMKQYIEISNLLNEEGFLWDEASHTIVGDSDTWESYAKEHPEAVSYKDKVVRY  605

Query  813   YKDMSIICG  787
             Y ++  I G
Sbjct  606   YSELCAIFG  614


 Score =   112 bits (279),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE  R+ WT  MD +FI+L+LDQ+  GNR   SF  QAW +M+  F+  +   HD +V
Sbjct  323   AGSERSRTYWTPPMDRFFIDLMLDQVHGGNRIGPSFITQAWNDMVESFNANFNSHHDREV  382

Query  1546  LKNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKVQ  1409
             LKNRYKH RKQY++ +IL Q++ F WD+ R+M+T  D  WD YIK  
Sbjct  383   LKNRYKHFRKQYNDVRILLQHKGFSWDEGREMLTAEDHVWDAYIKAH  429


 Score =   126 bits (317),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 104/209 (50%), Gaps = 10/209 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCF-DIDFENEVKILEDKIPTKDDAK  1156
             AHP    YR KV P YN L +IFG   +     + C  D D ++E  + +       +  
Sbjct  274   AHPHARSYRAKVFPGYNNLALIFGEMTSK-ESQIDCHQDKDIKSEAVVAK----AGSERS  328

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             +  W+  M++ FI LML+QV  GN++  +F  +AW  M+ +FN  F   + + VLK R+ 
Sbjct  329   RTYWTPPMDRFFIDLMLDQVHGGNRIGPSFITQAWNDMVESFNANFNSHHDREVLKNRYK  388

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
               R+QY  V+ LL   GF W E  +M+ AED VW   IKA    R YR K++  Y  + +
Sbjct  389   HFRKQYNDVRILLQHKGFSWDEGREMLTAEDHVWDAYIKAHPDARSYRVKTVPCYHKLCV  448

Query  795   ICGNETPTFQY----GYPFVKAGEFCVPI  721
             I G +     Y    G      G FC+ I
Sbjct  449   IYGQDKFDGSYSCLVGSTDPAVGTFCMKI  477


 Score = 97.8 bits (242),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +SS + R++WT  MD YFIEL+L Q ++GN+  ++F+KQAW EM+ALF+ K+  +++  V
Sbjct  169   ASSTSSRTDWTPDMDQYFIELMLKQQERGNKLDSTFTKQAWTEMLALFNAKFSSEYNKRV  228

Query  1546  LKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             L++RYK L K Y +   +++Q  F+WD+ ++MV  ++  WD Y+K  
Sbjct  229   LRHRYKKLWKYYCDLMTLVKQKGFVWDEKQEMVVAHNNVWDAYMKAH  275


 Score =   113 bits (283),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 73/120 (61%), Gaps = 0/120 (0%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+ TME++F+ LMLE +  GN++  TF  +AW  M+  FN  FG QY K VLK R+  L 
Sbjct  16    WTPTMERYFVDLMLEHIHRGNRIGHTFNKQAWTDMLAVFNAKFGSQYDKDVLKGRYTNLW  75

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             + +  VK LL Q GF W E  QM+VA+D VW+  IK     R YR KS+  + D+ +I G
Sbjct  76    KLFNDVKNLLGQKGFSWDETRQMVVADDYVWEAYIKINPEARPYRTKSVLNFDDLCLIYG  135


 Score = 79.0 bits (193),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 60/98 (61%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++W++ M+ YF++L+L+Q+  GN+    F +QAW  M   F  K+  +++  +L+NRY  
Sbjct  493   TDWSYPMEQYFVDLMLEQVLHGNKIDNEFGEQAWAHMTLSFKEKFGLQYEQHILENRYLS  552

Query  1525  LRKQY-HNTKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L KQY   + +L +  F+WD++   + G+ + W+ Y K
Sbjct  553   LMKQYIEISNLLNEEGFLWDEASHTIVGDSDTWESYAK  590



>gb|KHN29638.1| Hypothetical protein glysoja_016260 [Glycine soja]
Length=816

 Score =   161 bits (408),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 122/190 (64%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI--LED-----KIP  1174
             AHP+   YRTK V  +++L +I+GHTVADGRYSLS  D++ +++V+   L D      +P
Sbjct  118   AHPDARCYRTKPVLNFDDLCVIYGHTVADGRYSLSSHDVNLDDQVQGQHLGDGMGSIAVP  177

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + + AK  DW+ +M+Q FI+L+L+Q+  GN+++  F   AW  M+  FN  FG Q+G+ V
Sbjct  178   SSERAK-TDWTASMDQFFIELLLDQLGRGNQVDNGFNKNAWTDMLALFNAKFGCQHGRRV  236

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF  L + Y  +  L+ Q GF W E+ QM++A+D VW   +KA  + R YR+K+L  
Sbjct  237   LKNRFKKLLKYYRDITNLIKQ-GFSWDEQQQMLLADDDVWNAYVKAHPHARTYRSKTLPN  295

Query  813   YKDMSIICGN  784
             Y+D+ +I  N
Sbjct  296   YRDLELIFRN  305


 Score = 94.7 bits (234),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             S + +E  R++WT +++ YFI+L+L+ +Q+GNR   +F+KQAW +M+  F+  +  ++D 
Sbjct  9     SSNGTERSRTHWTPLLERYFIDLMLEHLQRGNRVGHTFNKQAWTDMLTSFNDNFGSQYDK  68

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEK--WDDYIKV  1412
             DVLK RY +L KQ+++ K +L    F WD +RQMV   D+   WD Y+K 
Sbjct  69    DVLKTRYTNLWKQFNDVKSLLSHFGFSWDAARQMVVAADDDSVWDAYLKA  118


 Score =   124 bits (310),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 102/191 (53%), Gaps = 7/191 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL---EDK---IPT  1171
             AHPE    R K +P Y +L +IFG   +D RY     + D  +E+ +    E K    P 
Sbjct  388   AHPEARSLRVKTLPDYWKLCVIFGAESSDARYVHLAHNADLSSELPMYITGEQKNGFFPN  447

Query  1170  KDDA-KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               DA   I+W+E+ME + + LM+EQV  GN++   F  +AW+HM+ AFN  +G Q  K V
Sbjct  448   VYDAGSTIEWTESMEHYIVDLMIEQVNRGNRIGHLFNEQAWMHMVQAFNARWGLQSDKQV  507

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L  ++  L +++  +  +LS   F W+E  Q + AED VW   IK       Y+NK L  
Sbjct  508   LMDQYFCLMKKHDDISNILSHSEFTWNETLQTLNAEDDVWDAYIKDHPDAISYKNKCLYL  567

Query  813   YKDMSIICGNE  781
             + D+  I GN+
Sbjct  568   FHDLCKIFGNK  578


 Score = 36.6 bits (83),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 14/29 (48%), Positives = 18/29 (62%), Gaps = 0/29 (0%)
 Frame = -1

Query  1498  ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +LEQ  F WDD+R+M+   D  WD Y K 
Sbjct  360   LLEQGGFSWDDTREMIDAEDHVWDAYTKA  388


 Score =   112 bits (279),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 2/130 (2%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+  +E++FI LMLE +Q GN++  TF  +AW  M+T+FN  FG QY K VLKTR+  L 
Sbjct  20    WTPLLERYFIDLMLEHLQRGNRVGHTFNKQAWTDMLTSFNDNFGSQYDKDVLKTRYTNLW  79

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVA--EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             +Q+  VK LLS  GF W    QM+VA  +D VW   +KA    R YR K +  + D+ +I
Sbjct  80    KQFNDVKSLLSHFGFSWDAARQMVVAADDDSVWDAYLKAHPDARCYRTKPVLNFDDLCVI  139

Query  792   CGNETPTFQY  763
              G+     +Y
Sbjct  140   YGHTVADGRY  149


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  SSE  +++WT  MD +FIELLLDQ+ +GN+    F+K AW +M+ALF+ K+ 
Sbjct  170   GMGSIAVPSSERAKTDWTASMDQFFIELLLDQLGRGNQVDNGFNKNAWTDMLALFNAKFG  229

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             C+H   VLKNR+K L K Y +   L +  F WD+ +QM+  +D+ W+ Y+K 
Sbjct  230   CQHGRRVLKNRFKKLLKYYRDITNLIKQGFSWDEQQQMLLADDDVWNAYVKA  281


 Score = 75.9 bits (185),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  M+ Y ++L+++Q+ +GNR    F++QAW+ M+  F+ ++  + D  VL ++Y  L 
Sbjct  457   WTESMEHYIVDLMIEQVNRGNRIGHLFNEQAWMHMVQAFNARWGLQSDKQVLMDQYFCLM  516

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K++ + + IL  +EF W+++ Q +   D+ WD YIK
Sbjct  517   KKHDDISNILSHSEFTWNETLQTLNAEDDVWDAYIK  552


 Score = 22.7 bits (47),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (9%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT---VADGRYS  1234
             HP+   Y+ K +  +++L  IFG+    V+D R S
Sbjct  554   HPDAISYKNKCLYLFHDLCKIFGNKLMEVSDVRVS  588



>ref|XP_006578110.1| PREDICTED: uncharacterized protein LOC100813264 isoform X1 [Glycine 
max]
 ref|XP_006578111.1| PREDICTED: uncharacterized protein LOC100813264 isoform X2 [Glycine 
max]
Length=872

 Score =   160 bits (406),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 122/190 (64%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI--LED-----KIP  1174
             AHP+   YRTK V  +++L +I+GHTVADGRYSLS  D++ +++V+   L D      +P
Sbjct  118   AHPDARCYRTKPVLNFDDLCVIYGHTVADGRYSLSSHDVNLDDQVQGQHLGDGMGSIAVP  177

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + + AK  DW+ +M+Q FI+L+L+Q+  GN+++  F   AW  M+  FN  FG Q+G+ V
Sbjct  178   SSERAK-TDWTASMDQFFIELLLDQLGRGNQVDNGFNKNAWTDMLALFNAKFGCQHGRRV  236

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF  L + Y  +  L+ Q GF W E+ QM++A+D VW   +KA  + R YR+K+L  
Sbjct  237   LKNRFKKLLKYYRDITNLIKQ-GFSWDEQQQMLLADDDVWNAYVKAHPHARTYRSKTLPN  295

Query  813   YKDMSIICGN  784
             Y+D+ +I  N
Sbjct  296   YRDLELIFRN  305


 Score = 94.7 bits (234),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             S + +E  R++WT +++ YFI+L+L+ +Q+GNR   +F+KQAW +M+  F+  +  ++D 
Sbjct  9     SSNGTERSRTHWTPLLERYFIDLMLEHLQRGNRVGHTFNKQAWTDMLTSFNDNFGSQYDK  68

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEK--WDDYIKV  1412
             DVLK RY +L KQ+++ K +L    F WD +RQMV   D+   WD Y+K 
Sbjct  69    DVLKTRYTNLWKQFNDVKSLLSHFGFSWDAARQMVVAADDDSVWDAYLKA  118


 Score =   125 bits (315),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/198 (39%), Positives = 106/198 (54%), Gaps = 7/198 (4%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN---EVKILEDK---I  1177
             V AHP    YR+K +P Y +L +IF   VA+   S    + + E+   E K  E K    
Sbjct  279   VKAHPHARTYRSKTLPNYRDLELIF-RNVAENEISNLQQEKNHEDVISETKAGETKGSRN  337

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P+  D  +  W+  M++  I L+LEQV+ GN+L +TF  +AW  MIT FN  F  QY K 
Sbjct  338   PSGTDRTRTYWTPPMDRCLIDLLLEQVKHGNRLGQTFIAQAWNDMITTFNERFKSQYDKD  397

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R+   R+Q+  V +LL Q GF W +  +MI AED VW    KA    R  R K+L 
Sbjct  398   VLKNRYKHFRKQFNDVDHLLQQGGFSWDDTREMIDAEDHVWDAYTKAHPEARSLRVKTLP  457

Query  816   FYKDMSIICGNETPTFQY  763
              Y  + +I G E+   +Y
Sbjct  458   DYWKLCVIFGAESSDARY  475


 Score =   106 bits (264),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 72/112 (64%), Gaps = 0/112 (0%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  SSE  +++WT  MD +FIELLLDQ+ +GN+    F+K AW +M+ALF+ K+ 
Sbjct  170   GMGSIAVPSSERAKTDWTASMDQFFIELLLDQLGRGNQVDNGFNKNAWTDMLALFNAKFG  229

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             C+H   VLKNR+K L K Y +   L +  F WD+ +QM+  +D+ W+ Y+K 
Sbjct  230   CQHGRRVLKNRFKKLLKYYRDITNLIKQGFSWDEQQQMLLADDDVWNAYVKA  281


 Score =   123 bits (309),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 102/191 (53%), Gaps = 7/191 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL---EDK---IPT  1171
             AHPE    R K +P Y +L +IFG   +D RY     + D  +E+ +    E K    P 
Sbjct  444   AHPEARSLRVKTLPDYWKLCVIFGAESSDARYVHLAHNADLSSELPMYITGEQKNGFFPN  503

Query  1170  KDDA-KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               DA   I+W+E+ME + + LM+EQV  GN++   F  +AW+HM+ AFN  +G Q  K V
Sbjct  504   VYDAGSTIEWTESMEHYIVDLMIEQVNRGNRIGHLFNEQAWMHMVQAFNARWGLQSDKQV  563

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L  ++  L +++  +  +LS   F W+E  Q + AED VW   IK       Y+NK L  
Sbjct  564   LMDQYFCLMKKHDDISNILSHSEFTWNETLQTLNAEDDVWDAYIKDHPDAISYKNKCLYL  623

Query  813   YKDMSIICGNE  781
             + D+  I GN+
Sbjct  624   FHDLCKIFGNK  634


 Score =   105 bits (261),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 70/106 (66%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             S ++  R+ WT  MD   I+LLL+Q++ GNR   +F  QAW +MI  F+ ++K ++D DV
Sbjct  339   SGTDRTRTYWTPPMDRCLIDLLLEQVKHGNRLGQTFIAQAWNDMITTFNERFKSQYDKDV  398

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LKNRYKH RKQ+++   +L+Q  F WDD+R+M+   D  WD Y K 
Sbjct  399   LKNRYKHFRKQFNDVDHLLQQGGFSWDDTREMIDAEDHVWDAYTKA  444


 Score =   111 bits (278),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 2/130 (2%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+  +E++FI LMLE +Q GN++  TF  +AW  M+T+FN  FG QY K VLKTR+  L 
Sbjct  20    WTPLLERYFIDLMLEHLQRGNRVGHTFNKQAWTDMLTSFNDNFGSQYDKDVLKTRYTNLW  79

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVA--EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             +Q+  VK LLS  GF W    QM+VA  +D VW   +KA    R YR K +  + D+ +I
Sbjct  80    KQFNDVKSLLSHFGFSWDAARQMVVAADDDSVWDAYLKAHPDARCYRTKPVLNFDDLCVI  139

Query  792   CGNETPTFQY  763
              G+     +Y
Sbjct  140   YGHTVADGRY  149


 Score = 75.9 bits (185),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 61/96 (64%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  M+ Y ++L+++Q+ +GNR    F++QAW+ M+  F+ ++  + D  VL ++Y  L 
Sbjct  513   WTESMEHYIVDLMIEQVNRGNRIGHLFNEQAWMHMVQAFNARWGLQSDKQVLMDQYFCLM  572

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K++ + + IL  +EF W+++ Q +   D+ WD YIK
Sbjct  573   KKHDDISNILSHSEFTWNETLQTLNAEDDVWDAYIK  608


 Score = 22.7 bits (47),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 12/35 (34%), Positives = 20/35 (57%), Gaps = 3/35 (9%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT---VADGRYS  1234
             HP+   Y+ K +  +++L  IFG+    V+D R S
Sbjct  610   HPDAISYKNKCLYLFHDLCKIFGNKLMEVSDVRVS  644



>ref|XP_010278767.1| PREDICTED: uncharacterized protein LOC104612854 isoform X2 [Nelumbo 
nucifera]
Length=692

 Score =   144 bits (362),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 173/370 (47%), Gaps = 51/370 (14%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKI-----------  1192
             HPE   YRTK VP Y ++ +I+G+  A   Y  S  D +  ++   VKI           
Sbjct  316   HPEARSYRTKTVPNYKDMSVIYGNETA---YHGSVDDANLADDTPKVKISGVSGASQSPA  372

Query  1191  -------------------LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT  1069
                                ++++ P   D  K +W+  M+++F+ +MLEQ+  G K+   
Sbjct  373   VSVVPGDPGVVRTSLFVGGMDNQDPPSIDHLKTNWTPPMDRYFMDIMLEQISSGCKIGSA  432

Query  1068  FKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA  889
             F+ +AW  M+  FN+ FG +  K  LK R   LR QY A+K LL   GF W E  QM+ A
Sbjct  433   FRKEAWTQMLALFNSKFGLELDKDALKNRHRKLRMQYNAMKTLLDHSGFCWDETRQMVTA  492

Query  888   EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYG----------YPFVKAG  739
              D VW   +KA    R YR K+L  Y D+ +I GN +   ++            P VK  
Sbjct  493   ADIVWDDYLKAHPEVRSYRTKTLPNYNDLCVIYGNSSTDGRHSCSGHDADPEDTPGVKI-  551

Query  738   EFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEP-KEPCKGPSEINEETEIEI  562
             E   P   T+   G+     +                 K P   P    +        + 
Sbjct  552   EVEGPQSPTSAAHGDPVIDTQESSSYSAGAVDTLNQQNKRPIVAPLTFANSRKMPRNTDE  611

Query  561   GMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledD  382
              M +A++EM  AVT+L  ++K  +  S L E V+  LQA+P++  D+DL LDACD LED+
Sbjct  612   CMIEALREMAHAVTSLANKKKDNEVPSTL-EKVVNALQAIPDI--DEDLFLDACDLLEDE  668

Query  381   NKAKVFLALD  352
              KAK+FLALD
Sbjct  669   QKAKMFLALD  678


 Score =   111 bits (277),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M++   SSSE  R+NWT  MD YFI+++++Q+ KG++    F K+AW EM+  F+ K+ 
Sbjct  203   GMDNQVPSSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNIFRKKAWEEMVVSFNEKFG  262

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
                D +VLKNR+K LR QY+  KI L    F WD++RQMVT ++  WDDY+KV
Sbjct  263   FHLDKEVLKNRHKKLRLQYNAMKILLSHGGFHWDETRQMVTADNSVWDDYLKV  315


 Score =   157 bits (398),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 114/217 (53%), Gaps = 33/217 (15%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------------  1186
             HPE + YRTK VP YN+L II+G    DG    S  ++  +N +  +E            
Sbjct  125   HPEAQTYRTKTVPNYNDLCIIYGKEAVDGATDCSDHNVKLDNGISGMEIVAVTADPQSPA  184

Query  1185  ---------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT  1069
                                  +++P+  +  + +W+ TM+++FI +M+EQV +G+K    
Sbjct  185   VPTGREDLCLVRCPERIEGMDNQVPSSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNI  244

Query  1068  FKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA  889
             F+ KAW  M+ +FN  FGF   K VLK R   LR QY A+K LLS  GF W E  QM+ A
Sbjct  245   FRKKAWEEMVVSFNEKFGFHLDKEVLKNRHKKLRLQYNAMKILLSHGGFHWDETRQMVTA  304

Query  888   EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             ++ VW   +K     R YR K++  YKDMS+I GNET
Sbjct  305   DNSVWDDYLKVHPEARSYRTKTVPNYKDMSVIYGNET  341


 Score =   111 bits (277),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKY  1571
             G M++    S + L++NWT  MD YF++++L+QI  G +  ++F K+AW +M+ALF+ K+
Sbjct  390   GGMDNQDPPSIDHLKTNWTPPMDRYFMDIMLEQISSGCKIGSAFRKEAWTQMLALFNSKF  449

Query  1570  KCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
               + D D LKNR++ LR QY+  K +L+ + F WD++RQMVT  D  WDDY+K 
Sbjct  450   GLELDKDALKNRHRKLRMQYNAMKTLLDHSGFCWDETRQMVTAADIVWDDYLKA  503


 Score = 53.9 bits (128),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN  1204
             AHPE+  YRTK +P YN+L +I+G++  DGR+S S  D D E+
Sbjct  503   AHPEVRSYRTKTLPNYNDLCVIYGNSSTDGRHSCSGHDADPED  545


 Score =   122 bits (305),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+ TM+++FI +M+EQV +GNK+  TF+ KAW  M+  FN  FG Q  K +L+ 
Sbjct  22    DRPRTKWTSTMDRYFIDIMIEQVHKGNKIRNTFRKKAWEDMVVLFNAKFGSQLDKEILRN  81

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R   LR +Y AVK LL Q+GF W E  +M++A+D VW   +K     + YR K++  Y D
Sbjct  82    RSKKLRLKYNAVKVLLDQNGFHWDETRKMVIADDHVWDDYLKVHPEAQTYRTKTVPNYND  141

Query  804   MSIICGNE  781
             + II G E
Sbjct  142   LCIIYGKE  149


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  S +  R+ WT  MD YFI+++++Q+ KGN+   +F K+AW +M+ LF+ K+  + D 
Sbjct  17    TMPSGDRPRTKWTSTMDRYFIDIMIEQVHKGNKIRNTFRKKAWEDMVVLFNAKFGSQLDK  76

Query  1552  DVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLK  1376
             ++L+NR K LR +Y+  K+ L+QN F WD++R+MV  +D  WDDY+KV    Q +    K
Sbjct  77    EILRNRSKKLRLKYNAVKVLLDQNGFHWDETRKMVIADDHVWDDYLKVHPEAQTY--RTK  134

Query  1375  IIAHY  1361
              + +Y
Sbjct  135   TVPNY  139



>ref|XP_008246500.1| PREDICTED: uncharacterized protein LOC103344665 isoform X2 [Prunus 
mume]
Length=875

 Score =   146 bits (369),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 116/199 (58%), Gaps = 16/199 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP+ + YR K +  +N+L +I+ HT ADGRYSLS  DIDF+++++ + D +         
Sbjct  118   HPDAQLYRNKALMTFNDLCLIYAHTKADGRYSLSSHDIDFDDDIQGMTDGVGMNSPTLAP  177

Query  1176  -------PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAF  1018
                    P        DW   M++ F++LML+Q+ +G+K N +FK +AW  M+T FN  F
Sbjct  178   GPGCVPPPASKVQTNTDWKPPMDRFFLKLMLDQLGKGSKTNNSFKKQAWKDMVTLFNAKF  237

Query  1017  GFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRR  838
             G QY K  LK  +  L + Y  V+ +L+  GF W E+ QMIVA+D VW   IKA    R 
Sbjct  238   GSQYRKSFLKQLYKKLLKYYTDVRSILAIKGFYWDEKEQMIVADDDVWDNYIKALPDARL  297

Query  837   YRNKSLSFYKDMSIICGNE  781
             YR K L  Y+D+++I GNE
Sbjct  298   YRKKPLLNYQDLNLIYGNE  316


 Score =   108 bits (269),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -1

Query  1753  RGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             R  M   + ++SE LR++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+  
Sbjct  3     REGMGSQNPTNSERLRTSWTLPMERYFIDLMLDQVHRGNRMGHTFNKQAWNDMLVMFNAN  62

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQ  1397
             +   +D ++LK+ Y  L KQ+++ K +L+QN F WD++RQMV  +   WD Y+KV    Q
Sbjct  63    FGSPYDVNILKSHYTSLWKQFNDIKNLLDQNGFSWDNTRQMVIADRYAWDAYVKVHPDAQ  122

Query  1396  KFSN  1385
              + N
Sbjct  123   LYRN  126


 Score =   133 bits (334),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 68/182 (37%), Positives = 101/182 (55%), Gaps = 6/182 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ E YRTK  PYYN+L +I+G + +  R + S   +    + K             + 
Sbjct  488   HPDAESYRTKSKPYYNDLCLIYGKSKSGERCNQSGQAMGCNGDAKY------NHSYHCRT  541

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV+ G+ +N  F   AW  M++ F   FG Q+ K VLK+ F  L
Sbjct  542   DWTPPMDRYFIDLMLEQVRNGSMVNSKFSRLAWTEMVSKFRAEFGSQHDKDVLKSPFFNL  601

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+Q+  +K LL Q GF W E   M+ A+D +W   +K     R YRN++L  + D+ +I 
Sbjct  602   RKQFNGMKALLDQSGFAWDEMQHMVTADDHLWDAYVKEHPDARSYRNRTLPNFNDLYLIY  661

Query  789   GN  784
             GN
Sbjct  662   GN  663


 Score =   104 bits (260),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD + I+L+L Q+QK N+   SF  QAW++++ LF  ++  + D D+L+ RYK
Sbjct  388   RTDWTPPMDRFLIDLMLKQLQKVNKIDYSFDDQAWIDVLVLFKERFGLQQDKDLLRRRYK  447

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L KQYH+TK +L+Q  F WDD++QMVT  D+ WD YIK
Sbjct  448   SLEKQYHDTKDLLDQRGFWWDDTQQMVTAYDDIWDAYIK  486


 Score =   114 bits (284),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 98/196 (50%), Gaps = 17/196 (9%)
 Frame = -2

Query  1263  GHTVADGRYSLSCFDIDFENEVKILED------KIPTKDDAKKIDWSETMEQHFIQLMLE  1102
             GH+V    +  S  D+D E +  ++E       +I   DD  + DW+  M++  I LML+
Sbjct  346   GHSVYGNGHLASFEDLDSEGQDLMIEGEESEDTQIHGNDDFSRTDWTPPMDRFLIDLMLK  405

Query  1101  QVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGF  922
             Q+Q+ NK++ +F ++AWI ++  F   FG Q  K +L+ R+  L +QY   K LL Q GF
Sbjct  406   QLQKVNKIDYSFDDQAWIDVLVLFKERFGLQQDKDLLRRRYKSLEKQYHDTKDLLDQRGF  465

Query  921   MWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVKA  742
              W +  QM+ A D +W   IK       YR KS  +Y D+ +I G             K+
Sbjct  466   WWDDTQQMVTAYDDIWDAYIKEHPDAESYRTKSKPYYNDLCLIYGKS-----------KS  514

Query  741   GEFCVPIIQTTGKEGN  694
             GE C    Q  G  G+
Sbjct  515   GERCNQSGQAMGCNGD  530


 Score = 97.8 bits (242),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q++ G+  ++ FS+ AW EM++ F  ++  +HD DVLK+ + 
Sbjct  540   RTDWTPPMDRYFIDLMLEQVRNGSMVNSKFSRLAWTEMVSKFRAEFGSQHDKDVLKSPFF  599

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +LRKQ++  K +L+Q+ F WD+ + MVT +D  WD Y+K
Sbjct  600   NLRKQFNGMKALLDQSGFAWDEMQHMVTADDHLWDAYVK  638


 Score = 32.3 bits (72),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDID  1213
             HP+   YR + +P +N+L +I+G+     R S S   +D
Sbjct  640   HPDARSYRNRTLPNFNDLYLIYGNGGIFKRESTSSHTMD  678


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 76/138 (55%), Gaps = 0/138 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT  +  +  W+  ME++FI LML+QV  GN++  TF  +AW  M+  FN  FG  Y   
Sbjct  11    PTNSERLRTSWTLPMERYFIDLMLDQVHRGNRMGHTFNKQAWNDMLVMFNANFGSPYDVN  70

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             +LK+ +  L +Q+  +K LL Q+GF W    QM++A+   W   +K     + YRNK+L 
Sbjct  71    ILKSHYTSLWKQFNDIKNLLDQNGFSWDNTRQMVIADRYAWDAYVKVHPDAQLYRNKALM  130

Query  816   FYKDMSIICGNETPTFQY  763
              + D+ +I  +     +Y
Sbjct  131   TFNDLCLIYAHTKADGRY  148


 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++W   MD +F++L+LDQ+ KG++T+ SF KQAW +M+ LF+ K+  ++    LK  YK 
Sbjct  193   TDWKPPMDRFFLKLMLDQLGKGSKTNNSFKKQAWKDMVTLFNAKFGSQYRKSFLKQLYKK  252

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             L K Y + + IL    F WD+  QM+  +D+ WD+YIK 
Sbjct  253   LLKYYTDVRSILAIKGFYWDEKEQMIVADDDVWDNYIKA  291



>ref|XP_010278768.1| PREDICTED: uncharacterized protein LOC104612854 isoform X3 [Nelumbo 
nucifera]
Length=686

 Score =   143 bits (361),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 173/370 (47%), Gaps = 51/370 (14%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKI-----------  1192
             HPE   YRTK VP Y ++ +I+G+  A   Y  S  D +  ++   VKI           
Sbjct  310   HPEARSYRTKTVPNYKDMSVIYGNETA---YHGSVDDANLADDTPKVKISGVSGASQSPA  366

Query  1191  -------------------LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT  1069
                                ++++ P   D  K +W+  M+++F+ +MLEQ+  G K+   
Sbjct  367   VSVVPGDPGVVRTSLFVGGMDNQDPPSIDHLKTNWTPPMDRYFMDIMLEQISSGCKIGSA  426

Query  1068  FKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA  889
             F+ +AW  M+  FN+ FG +  K  LK R   LR QY A+K LL   GF W E  QM+ A
Sbjct  427   FRKEAWTQMLALFNSKFGLELDKDALKNRHRKLRMQYNAMKTLLDHSGFCWDETRQMVTA  486

Query  888   EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYG----------YPFVKAG  739
              D VW   +KA    R YR K+L  Y D+ +I GN +   ++            P VK  
Sbjct  487   ADIVWDDYLKAHPEVRSYRTKTLPNYNDLCVIYGNSSTDGRHSCSGHDADPEDTPGVKI-  545

Query  738   EFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEP-KEPCKGPSEINEETEIEI  562
             E   P   T+   G+     +                 K P   P    +        + 
Sbjct  546   EVEGPQSPTSAAHGDPVIDTQESSSYSAGAVDTLNQQNKRPIVAPLTFANSRKMPRNTDE  605

Query  561   GMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledD  382
              M +A++EM  AVT+L  ++K  +  S L E V+  LQA+P++  D+DL LDACD LED+
Sbjct  606   CMIEALREMAHAVTSLANKKKDNEVPSTL-EKVVNALQAIPDI--DEDLFLDACDLLEDE  662

Query  381   NKAKVFLALD  352
              KAK+FLALD
Sbjct  663   QKAKMFLALD  672


 Score =   111 bits (278),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M++   SSSE  R+NWT  MD YFI+++++Q+ KG++    F K+AW EM+  F+ K+ 
Sbjct  197   GMDNQVPSSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNIFRKKAWEEMVVSFNEKFG  256

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
                D +VLKNR+K LR QY+  KI L    F WD++RQMVT ++  WDDY+KV
Sbjct  257   FHLDKEVLKNRHKKLRLQYNAMKILLSHGGFHWDETRQMVTADNSVWDDYLKV  309


 Score =   157 bits (397),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 114/217 (53%), Gaps = 33/217 (15%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------------  1186
             HPE + YRTK VP YN+L II+G    DG    S  ++  +N +  +E            
Sbjct  119   HPEAQTYRTKTVPNYNDLCIIYGKEAVDGATDCSDHNVKLDNGISGMEIVAVTADPQSPA  178

Query  1185  ---------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT  1069
                                  +++P+  +  + +W+ TM+++FI +M+EQV +G+K    
Sbjct  179   VPTGREDLCLVRCPERIEGMDNQVPSSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNI  238

Query  1068  FKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA  889
             F+ KAW  M+ +FN  FGF   K VLK R   LR QY A+K LLS  GF W E  QM+ A
Sbjct  239   FRKKAWEEMVVSFNEKFGFHLDKEVLKNRHKKLRLQYNAMKILLSHGGFHWDETRQMVTA  298

Query  888   EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             ++ VW   +K     R YR K++  YKDMS+I GNET
Sbjct  299   DNSVWDDYLKVHPEARSYRTKTVPNYKDMSVIYGNET  335


 Score =   111 bits (277),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKY  1571
             G M++    S + L++NWT  MD YF++++L+QI  G +  ++F K+AW +M+ALF+ K+
Sbjct  384   GGMDNQDPPSIDHLKTNWTPPMDRYFMDIMLEQISSGCKIGSAFRKEAWTQMLALFNSKF  443

Query  1570  KCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
               + D D LKNR++ LR QY+  K +L+ + F WD++RQMVT  D  WDDY+K 
Sbjct  444   GLELDKDALKNRHRKLRMQYNAMKTLLDHSGFCWDETRQMVTAADIVWDDYLKA  497


 Score = 53.9 bits (128),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN  1204
             AHPE+  YRTK +P YN+L +I+G++  DGR+S S  D D E+
Sbjct  497   AHPEVRSYRTKTLPNYNDLCVIYGNSSTDGRHSCSGHDADPED  539


 Score =   122 bits (305),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 79/128 (62%), Gaps = 0/128 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+ TM+++FI +M+EQV +GNK+  TF+ KAW  M+  FN  FG Q  K +L+ 
Sbjct  16    DRPRTKWTSTMDRYFIDIMIEQVHKGNKIRNTFRKKAWEDMVVLFNAKFGSQLDKEILRN  75

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R   LR +Y AVK LL Q+GF W E  +M++A+D VW   +K     + YR K++  Y D
Sbjct  76    RSKKLRLKYNAVKVLLDQNGFHWDETRKMVIADDHVWDDYLKVHPEAQTYRTKTVPNYND  135

Query  804   MSIICGNE  781
             + II G E
Sbjct  136   LCIIYGKE  143


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  S +  R+ WT  MD YFI+++++Q+ KGN+   +F K+AW +M+ LF+ K+  + D 
Sbjct  11    TMPSGDRPRTKWTSTMDRYFIDIMIEQVHKGNKIRNTFRKKAWEDMVVLFNAKFGSQLDK  70

Query  1552  DVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLK  1376
             ++L+NR K LR +Y+  K+ L+QN F WD++R+MV  +D  WDDY+KV    Q +    K
Sbjct  71    EILRNRSKKLRLKYNAVKVLLDQNGFHWDETRKMVIADDHVWDDYLKVHPEAQTY--RTK  128

Query  1375  IIAHY  1361
              + +Y
Sbjct  129   TVPNY  133



>ref|XP_010278766.1| PREDICTED: uncharacterized protein LOC104612854 isoform X1 [Nelumbo 
nucifera]
Length=693

 Score =   143 bits (361),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/370 (32%), Positives = 173/370 (47%), Gaps = 51/370 (14%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKI-----------  1192
             HPE   YRTK VP Y ++ +I+G+  A   Y  S  D +  ++   VKI           
Sbjct  317   HPEARSYRTKTVPNYKDMSVIYGNETA---YHGSVDDANLADDTPKVKISGVSGASQSPA  373

Query  1191  -------------------LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT  1069
                                ++++ P   D  K +W+  M+++F+ +MLEQ+  G K+   
Sbjct  374   VSVVPGDPGVVRTSLFVGGMDNQDPPSIDHLKTNWTPPMDRYFMDIMLEQISSGCKIGSA  433

Query  1068  FKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA  889
             F+ +AW  M+  FN+ FG +  K  LK R   LR QY A+K LL   GF W E  QM+ A
Sbjct  434   FRKEAWTQMLALFNSKFGLELDKDALKNRHRKLRMQYNAMKTLLDHSGFCWDETRQMVTA  493

Query  888   EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYG----------YPFVKAG  739
              D VW   +KA    R YR K+L  Y D+ +I GN +   ++            P VK  
Sbjct  494   ADIVWDDYLKAHPEVRSYRTKTLPNYNDLCVIYGNSSTDGRHSCSGHDADPEDTPGVKI-  552

Query  738   EFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEP-KEPCKGPSEINEETEIEI  562
             E   P   T+   G+     +                 K P   P    +        + 
Sbjct  553   EVEGPQSPTSAAHGDPVIDTQESSSYSAGAVDTLNQQNKRPIVAPLTFANSRKMPRNTDE  612

Query  561   GMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledD  382
              M +A++EM  AVT+L  ++K  +  S L E V+  LQA+P++  D+DL LDACD LED+
Sbjct  613   CMIEALREMAHAVTSLANKKKDNEVPSTL-EKVVNALQAIPDI--DEDLFLDACDLLEDE  669

Query  381   NKAKVFLALD  352
              KAK+FLALD
Sbjct  670   QKAKMFLALD  679


 Score =   111 bits (277),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M++   SSSE  R+NWT  MD YFI+++++Q+ KG++    F K+AW EM+  F+ K+ 
Sbjct  204   GMDNQVPSSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNIFRKKAWEEMVVSFNEKFG  263

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
                D +VLKNR+K LR QY+  KI L    F WD++RQMVT ++  WDDY+KV
Sbjct  264   FHLDKEVLKNRHKKLRLQYNAMKILLSHGGFHWDETRQMVTADNSVWDDYLKV  316


 Score =   157 bits (398),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/217 (37%), Positives = 114/217 (53%), Gaps = 33/217 (15%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------------  1186
             HPE + YRTK VP YN+L II+G    DG    S  ++  +N +  +E            
Sbjct  126   HPEAQTYRTKTVPNYNDLCIIYGKEAVDGATDCSDHNVKLDNGISGMEIVAVTADPQSPA  185

Query  1185  ---------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT  1069
                                  +++P+  +  + +W+ TM+++FI +M+EQV +G+K    
Sbjct  186   VPTGREDLCLVRCPERIEGMDNQVPSSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNI  245

Query  1068  FKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA  889
             F+ KAW  M+ +FN  FGF   K VLK R   LR QY A+K LLS  GF W E  QM+ A
Sbjct  246   FRKKAWEEMVVSFNEKFGFHLDKEVLKNRHKKLRLQYNAMKILLSHGGFHWDETRQMVTA  305

Query  888   EDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             ++ VW   +K     R YR K++  YKDMS+I GNET
Sbjct  306   DNSVWDDYLKVHPEARSYRTKTVPNYKDMSVIYGNET  342


 Score =   111 bits (277),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKY  1571
             G M++    S + L++NWT  MD YF++++L+QI  G +  ++F K+AW +M+ALF+ K+
Sbjct  391   GGMDNQDPPSIDHLKTNWTPPMDRYFMDIMLEQISSGCKIGSAFRKEAWTQMLALFNSKF  450

Query  1570  KCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
               + D D LKNR++ LR QY+  K +L+ + F WD++RQMVT  D  WDDY+K 
Sbjct  451   GLELDKDALKNRHRKLRMQYNAMKTLLDHSGFCWDETRQMVTAADIVWDDYLKA  504


 Score = 53.9 bits (128),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN  1204
             AHPE+  YRTK +P YN+L +I+G++  DGR+S S  D D E+
Sbjct  504   AHPEVRSYRTKTLPNYNDLCVIYGNSSTDGRHSCSGHDADPED  546


 Score =   122 bits (305),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 79/129 (61%), Gaps = 0/129 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+ TM+++FI +M+EQV +GNK+  TF+ KAW  M+  FN  FG Q  K +L+ 
Sbjct  23    DRPRTKWTSTMDRYFIDIMIEQVHKGNKIRNTFRKKAWEDMVVLFNAKFGSQLDKEILRN  82

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R   LR +Y AVK LL Q+GF W E  +M++A+D VW   +K     + YR K++  Y D
Sbjct  83    RSKKLRLKYNAVKVLLDQNGFHWDETRKMVIADDHVWDDYLKVHPEAQTYRTKTVPNYND  142

Query  804   MSIICGNET  778
             + II G E 
Sbjct  143   LCIIYGKEA  151


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  S +  R+ WT  MD YFI+++++Q+ KGN+   +F K+AW +M+ LF+ K+  + D 
Sbjct  18    TMPSGDRPRTKWTSTMDRYFIDIMIEQVHKGNKIRNTFRKKAWEDMVVLFNAKFGSQLDK  77

Query  1552  DVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLK  1376
             ++L+NR K LR +Y+  K+ L+QN F WD++R+MV  +D  WDDY+KV    Q +    K
Sbjct  78    EILRNRSKKLRLKYNAVKVLLDQNGFHWDETRKMVIADDHVWDDYLKVHPEAQTYRT--K  135

Query  1375  IIAHY  1361
              + +Y
Sbjct  136   TVPNY  140



>ref|XP_008246499.1| PREDICTED: uncharacterized protein LOC103344665 isoform X1 [Prunus 
mume]
Length=876

 Score =   146 bits (369),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 116/199 (58%), Gaps = 16/199 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP+ + YR K +  +N+L +I+ HT ADGRYSLS  DIDF+++++ + D +         
Sbjct  118   HPDAQLYRNKALMTFNDLCLIYAHTKADGRYSLSSHDIDFDDDIQGMTDGVGMNSPTLAP  177

Query  1176  -------PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAF  1018
                    P        DW   M++ F++LML+Q+ +G+K N +FK +AW  M+T FN  F
Sbjct  178   GPGCVPPPASKVQTNTDWKPPMDRFFLKLMLDQLGKGSKTNNSFKKQAWKDMVTLFNAKF  237

Query  1017  GFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRR  838
             G QY K  LK  +  L + Y  V+ +L+  GF W E+ QMIVA+D VW   IKA    R 
Sbjct  238   GSQYRKSFLKQLYKKLLKYYTDVRSILAIKGFYWDEKEQMIVADDDVWDNYIKALPDARL  297

Query  837   YRNKSLSFYKDMSIICGNE  781
             YR K L  Y+D+++I GNE
Sbjct  298   YRKKPLLNYQDLNLIYGNE  316


 Score =   108 bits (269),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 82/124 (66%), Gaps = 1/124 (1%)
 Frame = -1

Query  1753  RGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             R  M   + ++SE LR++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+  
Sbjct  3     REGMGSQNPTNSERLRTSWTLPMERYFIDLMLDQVHRGNRMGHTFNKQAWNDMLVMFNAN  62

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQ  1397
             +   +D ++LK+ Y  L KQ+++ K +L+QN F WD++RQMV  +   WD Y+KV    Q
Sbjct  63    FGSPYDVNILKSHYTSLWKQFNDIKNLLDQNGFSWDNTRQMVIADRYAWDAYVKVHPDAQ  122

Query  1396  KFSN  1385
              + N
Sbjct  123   LYRN  126


 Score =   132 bits (332),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 67/182 (37%), Positives = 100/182 (55%), Gaps = 5/182 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ E YRTK  PYYN+L +I+G + +  R + S   +    +          +      
Sbjct  488   HPDAESYRTKSKPYYNDLCLIYGKSKSGERCNQSGQAMGCNGDAAKYNHSYHCR-----T  542

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV+ G+ +N  F   AW  M++ F   FG Q+ K VLK+ F  L
Sbjct  543   DWTPPMDRYFIDLMLEQVRNGSMVNSKFSRLAWTEMVSKFRAEFGSQHDKDVLKSPFFNL  602

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+Q+  +K LL Q GF W E   M+ A+D +W   +K     R YRN++L  + D+ +I 
Sbjct  603   RKQFNGMKALLDQSGFAWDEMQHMVTADDHLWDAYVKEHPDARSYRNRTLPNFNDLYLIY  662

Query  789   GN  784
             GN
Sbjct  663   GN  664


 Score =   104 bits (260),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD + I+L+L Q+QK N+   SF  QAW++++ LF  ++  + D D+L+ RYK
Sbjct  388   RTDWTPPMDRFLIDLMLKQLQKVNKIDYSFDDQAWIDVLVLFKERFGLQQDKDLLRRRYK  447

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L KQYH+TK +L+Q  F WDD++QMVT  D+ WD YIK
Sbjct  448   SLEKQYHDTKDLLDQRGFWWDDTQQMVTAYDDIWDAYIK  486


 Score =   114 bits (284),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 65/196 (33%), Positives = 98/196 (50%), Gaps = 17/196 (9%)
 Frame = -2

Query  1263  GHTVADGRYSLSCFDIDFENEVKILED------KIPTKDDAKKIDWSETMEQHFIQLMLE  1102
             GH+V    +  S  D+D E +  ++E       +I   DD  + DW+  M++  I LML+
Sbjct  346   GHSVYGNGHLASFEDLDSEGQDLMIEGEESEDTQIHGNDDFSRTDWTPPMDRFLIDLMLK  405

Query  1101  QVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGF  922
             Q+Q+ NK++ +F ++AWI ++  F   FG Q  K +L+ R+  L +QY   K LL Q GF
Sbjct  406   QLQKVNKIDYSFDDQAWIDVLVLFKERFGLQQDKDLLRRRYKSLEKQYHDTKDLLDQRGF  465

Query  921   MWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVKA  742
              W +  QM+ A D +W   IK       YR KS  +Y D+ +I G             K+
Sbjct  466   WWDDTQQMVTAYDDIWDAYIKEHPDAESYRTKSKPYYNDLCLIYGKS-----------KS  514

Query  741   GEFCVPIIQTTGKEGN  694
             GE C    Q  G  G+
Sbjct  515   GERCNQSGQAMGCNGD  530


 Score = 98.2 bits (243),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q++ G+  ++ FS+ AW EM++ F  ++  +HD DVLK+ + 
Sbjct  541   RTDWTPPMDRYFIDLMLEQVRNGSMVNSKFSRLAWTEMVSKFRAEFGSQHDKDVLKSPFF  600

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +LRKQ++  K +L+Q+ F WD+ + MVT +D  WD Y+K
Sbjct  601   NLRKQFNGMKALLDQSGFAWDEMQHMVTADDHLWDAYVK  639


 Score = 32.3 bits (72),  Expect(2) = 7e-21, Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%), Gaps = 0/39 (0%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDID  1213
             HP+   YR + +P +N+L +I+G+     R S S   +D
Sbjct  641   HPDARSYRNRTLPNFNDLYLIYGNGGIFKRESTSSHTMD  679


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 76/138 (55%), Gaps = 0/138 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT  +  +  W+  ME++FI LML+QV  GN++  TF  +AW  M+  FN  FG  Y   
Sbjct  11    PTNSERLRTSWTLPMERYFIDLMLDQVHRGNRMGHTFNKQAWNDMLVMFNANFGSPYDVN  70

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             +LK+ +  L +Q+  +K LL Q+GF W    QM++A+   W   +K     + YRNK+L 
Sbjct  71    ILKSHYTSLWKQFNDIKNLLDQNGFSWDNTRQMVIADRYAWDAYVKVHPDAQLYRNKALM  130

Query  816   FYKDMSIICGNETPTFQY  763
              + D+ +I  +     +Y
Sbjct  131   TFNDLCLIYAHTKADGRY  148


 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++W   MD +F++L+LDQ+ KG++T+ SF KQAW +M+ LF+ K+  ++    LK  YK 
Sbjct  193   TDWKPPMDRFFLKLMLDQLGKGSKTNNSFKKQAWKDMVTLFNAKFGSQYRKSFLKQLYKK  252

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             L K Y + + IL    F WD+  QM+  +D+ WD+YIK 
Sbjct  253   LLKYYTDVRSILAIKGFYWDEKEQMIVADDDVWDNYIKA  291



>ref|XP_010274349.1| PREDICTED: uncharacterized protein LOC104609676 isoform X2 [Nelumbo 
nucifera]
Length=454

 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 129/334 (39%), Positives = 190/334 (57%), Gaps = 13/334 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP+   Y+TK+VPYYN+L II+GH +ADGRYSLS  D+D  +E K  + ++    D  K
Sbjct  112   AHPDSRLYKTKIVPYYNDLCIIYGHAIADGRYSLSSHDMDLGSEGKRTDTQLTISGDCSK  171

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
             IDW+ TM+ +F++LM +QV +GNK+   FK KAW+ MI +FN  FGFQY K VLK R+  
Sbjct  172   IDWTMTMDHYFVELMKDQVHKGNKIGHIFKKKAWVQMIASFNENFGFQYEKDVLKNRYKN  231

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRRQY  +K LL Q GF   E  QM++A++ VW   IKA    R +RN+ + +Y D+ +I
Sbjct  232   LRRQYNNIKILLGQSGFSLDETQQMVIADNCVWDDYIKAHPNARVFRNRVIPYYSDLCMI  291

Query  792   CGNETPTFQYGYPFVKAGEF-CVPIIQTTGKEGNLreveeivedddereEKKCRYDT--K  622
              G+ T   ++ +   + GE   +  +Q+    G        V         +  +DT  +
Sbjct  292   YGDTTTDIKFNH-LDQGGELDNIVNVQSVVTPGGQHSQAMPVAQGGLMHSSR-NFDTLDQ  349

Query  621   EPKEPCKGPSEINEETE----IEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYI  454
             + K   + PS      +    +   M +A+ +M  A+T+LT   KK+  NS   E+VI +
Sbjct  350   QNKRRSEIPSTYQHSRKSRRCLHNDMMEALHKMAMAITSLT--NKKEIDNSFSTENVIGL  407

Query  453   LQAMPEMdddddllldacdfledDNKAKVFLALD  352
             LQA+P+MD++  L        E    AK+FLALD
Sbjct  408   LQAVPDMDEELLLDACDILEDET--NAKIFLALD  439


 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 80/144 (56%), Gaps = 0/144 (0%)
 Frame = -2

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             ++ +  +  D  +  W+  M+++ I L+L+QV+ GNK+   F  +AW  M+  FN  FG 
Sbjct  1     MDGETQSTSDHSRTSWTPPMDRYLIDLLLDQVRRGNKIGHLFNKQAWTDMVGLFNDKFGP  60

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             QY + VLK + N LR+QY  +  LL Q GF W ER Q + A D VW   +KA    R Y+
Sbjct  61    QYDEDVLKNQHNSLRKQYNDIVTLLGQSGFTWDERRQTVAANDYVWDDYLKAHPDSRLYK  120

Query  831   NKSLSFYKDMSIICGNETPTFQYG  760
              K + +Y D+ II G+     +Y 
Sbjct  121   TKIVPYYNDLCIIYGHAIADGRYS  144


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M+ ++ S+S+  R++WT  MD Y I+LLLDQ+++GN+    F+KQAW +M+ LF+ K+  
Sbjct  1     MDGETQSTSDHSRTSWTPPMDRYLIDLLLDQVRRGNKIGHLFNKQAWTDMVGLFNDKFGP  60

Query  1564  KHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             ++D DVLKN++  LRKQY++   +L Q+ F WD+ RQ V  ND  WDDY+K     + + 
Sbjct  61    QYDEDVLKNQHNSLRKQYNDIVTLLGQSGFTWDERRQTVAANDYVWDDYLKAHPDSRLYK  120

Query  1387  NHLKIIAHY  1361
                KI+ +Y
Sbjct  121   T--KIVPYY  127


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             S +  + +WT  MD YF+EL+ DQ+ KGN+    F K+AW++MIA F+  +  +++ DVL
Sbjct  166   SGDCSKIDWTMTMDHYFVELMKDQVHKGNKIGHIFKKKAWVQMIASFNENFGFQYEKDVL  225

Query  1543  KNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNRYK+LR+QY+N KI L Q+ F  D+++QMV  ++  WDDYIK     + F N  ++I 
Sbjct  226   KNRYKNLRRQYNNIKILLGQSGFSLDETQQMVIADNCVWDDYIKAHPNARVFRN--RVIP  283

Query  1366  HY  1361
             +Y
Sbjct  284   YY  285



>emb|CDY66941.1| BnaA04g28320D [Brassica napus]
Length=774

 Score =   154 bits (388),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 110/190 (58%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-------DKIP  1174
             +HPE   Y+TK V  +N+L +++G+TVADGRYS S  D++FE+E+  +          + 
Sbjct  112   SHPEARAYKTKPVLNFNDLCLVYGYTVADGRYSRSSHDVEFEDEINGVNIGESSSGSLVM  171

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             +  +  K +W+  M+Q+FI LML+Q+  GNK    F  +AW  M+  FN  F  QYGK V
Sbjct  172   SSKETSKTEWTPVMDQYFISLMLDQIGRGNKTGNAFSKQAWTDMLALFNARFSGQYGKRV  231

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+N L + +  +  +L QDGF W E  QMI A+D  W   IK     R YR +SL  
Sbjct  232   LRHRYNKLSKYHKDMGAILKQDGFSWDETLQMIAADDVFWNSYIKEHPLARTYRMRSLPS  291

Query  813   YKDMSIICGN  784
             Y D+ +I  N
Sbjct  292   YNDLELIFAN  301


 Score =   100 bits (248),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             SC++  T R+ WT  M+ +FI+L+LD + +GNRT  +F+KQAW EM+++F+ K++ ++D 
Sbjct  6     SCNNDRT-RTYWTPTMERFFIDLMLDHLHRGNRTGHTFNKQAWNEMLSVFNSKFESQYDK  64

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLK RY  L KQY++ K +L+   F WD S +MV G++  W  Y+K
Sbjct  65    DVLKIRYTTLWKQYNDVKSLLDHGGFSWDQSHEMVVGDESLWSCYLK  111


 Score =   128 bits (322),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 69/197 (35%), Positives = 101/197 (51%), Gaps = 26/197 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK------  1168
             HP    YR + +P YN+L +IF                   N V+  +D IP +      
Sbjct  278   HPLARTYRMRSLPSYNDLELIFA------------------NPVQGKDDAIPDETKAGQA  319

Query  1167  --DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                D  +  W+  M+ + I L+ +QV +GN++ +TF   AW  MIT+FNT F  Q+G+ V
Sbjct  320   QSSDRTRTFWTPPMDNYLIDLLYDQVNKGNRVGQTFITSAWNEMITSFNTKFESQHGRDV  379

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK R+  LRR Y  +++LL Q+GF W  R  M+VA+D VW   IK     R YR K++  
Sbjct  380   LKNRYKHLRRLYNDIRFLLEQNGFSWDARRDMVVADDSVWCSYIKGHPEARPYRVKTIPI  439

Query  813   YKDMSIICGNETPTFQY  763
             Y ++  I G E    +Y
Sbjct  440   YPNLCFIFGKEVSDGRY  456


 Score =   102 bits (253),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             ET ++ WT VMD YFI L+LDQI +GN+T  +FSKQAW +M+ALF+ ++  ++   VL++
Sbjct  175   ETSKTEWTPVMDQYFISLMLDQIGRGNKTGNAFSKQAWTDMLALFNARFSGQYGKRVLRH  234

Query  1537  RYKHLRKQYHN--TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             RY  L K YH     IL+Q+ F WD++ QM+  +D  W+ YIK
Sbjct  235   RYNKLSK-YHKDMGAILKQDGFSWDETLQMIAADDVFWNSYIK  276


 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 97/200 (49%), Gaps = 23/200 (12%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKI----LEDKIPT  1171
              HPE  PYR K +P Y  L  IFG  V+DGRY+     FD    N V+I     ED++  
Sbjct  425   GHPEARPYRVKTIPIYPNLCFIFGKEVSDGRYTRLAQAFDPTPANTVRINESESEDRLKD  484

Query  1170  ----------KDD-------AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHM  1042
                       KDD          ++W+  M++  I LMLEQV  GNK+  TF  +AW  M
Sbjct  485   TFQMVQAGEEKDDYLCSSSGPSPVEWTAVMDRCLIDLMLEQVNRGNKVGETFTEQAWGEM  544

Query  1041  ITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVI  862
               +FN  F  Q     L+ R+ L+ ++   V  +L+ DGF+W    Q IVAED  W   I
Sbjct  545   AESFNAKFELQADMFTLENRYILMMKERDDVNNILNLDGFVWDGEKQTIVAEDEHWDAYI  604

Query  861   KAQQYFRRYRNKSLSFYKDM  802
             K       Y+ K+L  Y D+
Sbjct  605   KEHPDATIYKGKTLDSYGDL  624


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
               SS+  R+ WT  MD+Y I+LL DQ+ KGNR   +F   AW EMI  F+ K++ +H  D
Sbjct  319   AQSSDRTRTFWTPPMDNYLIDLLYDQVNKGNRVGQTFITSAWNEMITSFNTKFESQHGRD  378

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNRYKHLR+ Y++ + +LEQN F WD  R MV  +D  W  YIK     + +   +K 
Sbjct  379   VLKNRYKHLRRLYNDIRFLLEQNGFSWDARRDMVVADDSVWCSYIKGHPEARPY--RVKT  436

Query  1372  IAHYILVSFV  1343
             I  Y  + F+
Sbjct  437   IPIYPNLCFI  446


 Score =   104 bits (260),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +  W+ TME+ FI LML+ +  GN+   TF  +AW  M++ FN+ F  QY K VLK
Sbjct  9     NDRTRTYWTPTMERFFIDLMLDHLHRGNRTGHTFNKQAWNEMLSVFNSKFESQYDKDVLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +QY  VK LL   GF W + H+M+V ++ +W   +K+    R Y+ K +  + 
Sbjct  69    IRYTTLWKQYNDVKSLLDHGGFSWDQSHEMVVGDESLWSCYLKSHPEARAYKTKPVLNFN  128

Query  807   DMSIICG  787
             D+ ++ G
Sbjct  129   DLCLVYG  135


 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 67/114 (59%), Gaps = 2/114 (2%)
 Frame = -1

Query  1750  GAMEDDS-CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             G  +DD  CSSS      WT VMD   I+L+L+Q+ +GN+   +F++QAW EM   F+ K
Sbjct  492   GEEKDDYLCSSSGPSPVEWTAVMDRCLIDLMLEQVNRGNKVGETFTEQAWGEMAESFNAK  551

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             ++ + D   L+NRY  + K+  +   IL  + F+WD  +Q +   DE WD YIK
Sbjct  552   FELQADMFTLENRYILMMKERDDVNNILNLDGFVWDGEKQTIVAEDEHWDAYIK  605



>emb|CDY36147.1| BnaC04g37470D [Brassica napus]
Length=776

 Score =   154 bits (390),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 112/191 (59%), Gaps = 7/191 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-------DKIP  1174
             +HPE   Y+TK V  +N+L +I+G+TVADGRYS S  D++FE+E+  +          + 
Sbjct  112   SHPEARVYKTKPVLNFNDLCLIYGYTVADGRYSRSSHDVEFEDEINGVNIGESSSGSLVM  171

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             +  +  K +W+  M+Q+FI LML+Q+   NK    F  +AW  M+  FN+ F  QYGK V
Sbjct  172   SSKETSKTEWTPVMDQYFISLMLDQIGRSNKTGNAFSKQAWTDMLALFNSRFSGQYGKRV  231

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+N L + +  +  +L QDGF W E  QMI A+D VW   IK     R YR +SL  
Sbjct  232   LRHRYNKLSKYHKDMGAILKQDGFSWDETLQMIAADDAVWNSYIKEHPLGRTYRMRSLPS  291

Query  813   YKDMSIICGNE  781
             Y D+ +I  N+
Sbjct  292   YNDLELIFANQ  302


 Score = 99.4 bits (246),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             SC++  T R+ WT  M+ +FI+L+LD + +GNRT  +F+KQAW EM+++F+ K++ ++D 
Sbjct  6     SCNNDRT-RTYWTPTMERFFIDLMLDHLHRGNRTGHTFNKQAWNEMLSVFNSKFESQYDK  64

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLK RY  L KQY++ K +L+   F WD + +MV G++  W  Y+K
Sbjct  65    DVLKIRYTTLWKQYNDVKSLLDHGGFSWDQTHEMVVGDESLWSCYLK  111


 Score =   130 bits (328),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 105/197 (53%), Gaps = 26/197 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK-  1153
             HP    YR + +P YN+L +IF                   N+V+  +D +P + +A + 
Sbjct  278   HPLGRTYRMRSLPSYNDLELIFA------------------NQVQGKDDAVPDETNASQP  319

Query  1152  --ID-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               +D     W+  M+ + I L+ +QV +GN++ +TF   AW  MIT+FNT F  Q+GK V
Sbjct  320   QSVDRTRTFWTPPMDNYLIDLLYDQVNKGNRVGQTFITSAWNEMITSFNTKFESQHGKDV  379

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK R+  LRR Y  +++LL QDGF W  R  M+VA+D VW   IK     R YR K++  
Sbjct  380   LKNRYKHLRRLYNDIRFLLEQDGFSWDARRDMVVADDSVWYPYIKGHPEARPYRVKTIPI  439

Query  813   YKDMSIICGNETPTFQY  763
             Y ++  I G +    +Y
Sbjct  440   YPNLCFIFGKQMSDGRY  456


 Score =   100 bits (248),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 70/103 (68%), Gaps = 3/103 (3%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             ET ++ WT VMD YFI L+LDQI + N+T  +FSKQAW +M+ALF+ ++  ++   VL++
Sbjct  175   ETSKTEWTPVMDQYFISLMLDQIGRSNKTGNAFSKQAWTDMLALFNSRFSGQYGKRVLRH  234

Query  1537  RYKHLRKQYHN--TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             RY  L K YH     IL+Q+ F WD++ QM+  +D  W+ YIK
Sbjct  235   RYNKLSK-YHKDMGAILKQDGFSWDETLQMIAADDAVWNSYIK  276


 Score =   111 bits (277),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/202 (32%), Positives = 94/202 (47%), Gaps = 25/202 (12%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILE---------  1186
              HPE  PYR K +P Y  L  IFG  ++DGRY+     FD      V+I E         
Sbjct  425   GHPEARPYRVKTIPIYPNLCFIFGKQMSDGRYTRLAQAFDPTPAETVRINESESEDGFKE  484

Query  1185  --------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWI  1048
                           D + +      ++W+  M++  + LMLEQV  GNK+  TF  +AW 
Sbjct  485   TFQMVVHAAGEEKDDYLCSSSGPSPVEWTAVMDRCLVDLMLEQVNRGNKVGETFTEQAWA  544

Query  1047  HMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKK  868
              M  +FN  FG Q     L+ R+ L+ ++      +L+ DGF+     Q+IVAED  W+ 
Sbjct  545   EMAESFNAKFGLQADMFTLENRYILMMKERDDFNNILNLDGFVLDGEKQIIVAEDEHWEA  604

Query  867   VIKAQQYFRRYRNKSLSFYKDM  802
              IK       Y+ K+L  Y D+
Sbjct  605   YIKEHPDATIYKGKTLEGYGDL  626


 Score =   105 bits (261),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             S +  R+ WT  MD+Y I+LL DQ+ KGNR   +F   AW EMI  F+ K++ +H  DVL
Sbjct  321   SVDRTRTFWTPPMDNYLIDLLYDQVNKGNRVGQTFITSAWNEMITSFNTKFESQHGKDVL  380

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNRYKHLR+ Y++ + +LEQ+ F WD  R MV  +D  W  YIK     + +   +K I 
Sbjct  381   KNRYKHLRRLYNDIRFLLEQDGFSWDARRDMVVADDSVWYPYIKGHPEARPY--RVKTIP  438

Query  1366  HYILVSFV  1343
              Y  + F+
Sbjct  439   IYPNLCFI  446


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +  W+ TME+ FI LML+ +  GN+   TF  +AW  M++ FN+ F  QY K VLK
Sbjct  9     NDRTRTYWTPTMERFFIDLMLDHLHRGNRTGHTFNKQAWNEMLSVFNSKFESQYDKDVLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +QY  VK LL   GF W + H+M+V ++ +W   +K+    R Y+ K +  + 
Sbjct  69    IRYTTLWKQYNDVKSLLDHGGFSWDQTHEMVVGDESLWSCYLKSHPEARVYKTKPVLNFN  128

Query  807   DMSIICG  787
             D+ +I G
Sbjct  129   DLCLIYG  135


 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 66/114 (58%), Gaps = 2/114 (2%)
 Frame = -1

Query  1750  GAMEDDS-CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHK  1574
             G  +DD  CSSS      WT VMD   ++L+L+Q+ +GN+   +F++QAW EM   F+ K
Sbjct  494   GEEKDDYLCSSSGPSPVEWTAVMDRCLVDLMLEQVNRGNKVGETFTEQAWAEMAESFNAK  553

Query  1573  YKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +  + D   L+NRY  + K+  +   IL  + F+ D  +Q++   DE W+ YIK
Sbjct  554   FGLQADMFTLENRYILMMKERDDFNNILNLDGFVLDGEKQIIVAEDEHWEAYIK  607



>ref|NP_180068.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD23017.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07643.1| uncharacterized protein AT2G24960 [Arabidopsis thaliana]
Length=797

 Score =   154 bits (389),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 112/180 (62%), Gaps = 1/180 (1%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE   Y+TK V  +++L +I+G+TVADGRYS+S  D++ E+E+   E  + +  ++ K
Sbjct  111   AHPEARVYKTKPVLNFSDLCLIYGYTVADGRYSMSSHDLEIEDEING-ESVVLSGKESSK  169

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
              +W+  M+Q+F+++M++Q+  GNK    F  +AWI M+  FN  F  QYGK VL+ R+N 
Sbjct  170   TEWTLEMDQYFVEIMVDQIGRGNKTGNAFSKQAWIDMLVLFNARFSGQYGKRVLRHRYNK  229

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L + Y  ++ +L +DGF W E   MI A+D VW   IK     R YR KSL  Y D+  I
Sbjct  230   LLKYYKDMEAILKEDGFSWDETRLMISADDAVWDSYIKDHPLARTYRMKSLPSYNDLDTI  289


 Score = 99.0 bits (245),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  M+ +FI+L+L+ + +GNRT  +F+KQAW EM+ +F+ K+  ++D DVLK+RY 
Sbjct  12    RTYWTPTMERFFIDLMLEHLHRGNRTGHTFNKQAWNEMLTVFNSKFGSQYDKDVLKSRYT  71

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +L KQY++ K +L+   F+WD + Q V G+D  W  Y+K 
Sbjct  72    NLWKQYNDVKCLLDHGGFVWDQTHQTVIGDDSLWSLYLKA  111


 Score =   124 bits (312),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 101/212 (48%), Gaps = 26/212 (12%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    YR K +P YN+L  IF      G            +E K  +++     D  +I
Sbjct  269   HPLARTYRMKSLPSYNDLDTIFACQAEQGTDHRDDGSAAQTSETKASQEQ---NSDRTRI  325

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
              W+  M+ H I L++EQV  GN++ +TF   AW  M+TAFN  FG Q+ K VLK R+  L
Sbjct  326   FWTPPMDYHLIDLLVEQVNNGNRVGQTFITSAWNEMVTAFNAKFGSQHNKDVLKNRYKHL  385

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYF------------------  844
             RR Y  +K+LL Q+GF W  R  M++A+D +W   I+A                      
Sbjct  386   RRLYNDIKFLLEQNGFSWDARRDMVIADDDIWNTYIQACHILFLFKISVICLCLQMKHVQ  445

Query  843   -----RRYRNKSLSFYKDMSIICGNETPTFQY  763
                  R YR K++  Y ++  I G ET   +Y
Sbjct  446   AHPEARSYRVKTIPSYPNLCFIFGKETSDGRY  477


 Score =   100 bits (250),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             S  E+ ++ WT  MD YF+E+++DQI +GN+T  +FSKQAW++M+ LF+ ++  ++   V
Sbjct  163   SGKESSKTEWTLEMDQYFVEIMVDQIGRGNKTGNAFSKQAWIDMLVLFNARFSGQYGKRV  222

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L K Y + + IL+++ F WD++R M++ +D  WD YIK
Sbjct  223   LRHRYNKLLKYYKDMEAILKEDGFSWDETRLMISADDAVWDSYIK  267


 Score =   112 bits (279),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 69/205 (34%), Positives = 95/205 (46%), Gaps = 26/205 (13%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILED------  1183
             V AHPE   YR K +P Y  L  IFG   +DGRY+     FD      V++ E       
Sbjct  444   VQAHPEARSYRVKTIPSYPNLCFIFGKETSDGRYTRLAQAFDPSPAETVRMNESGSTDGF  503

Query  1182  -------KIPTKDDAKK-----------IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNK  1057
                    K+    + K            I+W+  M+   I LMLEQV  GNK+  TF  +
Sbjct  504   KDTRSFQKVVYTSNEKNDYPCSNIGPPCIEWTRVMDHCLIDLMLEQVSRGNKIGETFTEQ  563

Query  1056  AWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRV  877
             AW  M  +FN  FG Q    +L+ R+ LL ++   +  +L+ DGF W    Q IVAED  
Sbjct  564   AWADMAESFNAKFGLQTDMFMLENRYILLMKERDDINNILNLDGFTWDVEKQTIVAEDEY  623

Query  876   WKKVIKAQQYFRRYRNKSLSFYKDM  802
             W+  IK       Y+ K+L  Y ++
Sbjct  624   WEAYIKEHPDATIYKGKTLDSYGNL  648


 Score =   101 bits (252),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 69/105 (66%), Gaps = 1/105 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S+  R  WT  MD + I+LL++Q+  GNR   +F   AW EM+  F+ K+  +H+ DVL
Sbjct  319   NSDRTRIFWTPPMDYHLIDLLVEQVNNGNRVGQTFITSAWNEMVTAFNAKFGSQHNKDVL  378

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KNRYKHLR+ Y++ K +LEQN F WD  R MV  +D+ W+ YI+ 
Sbjct  379   KNRYKHLRRLYNDIKFLLEQNGFSWDARRDMVIADDDIWNTYIQA  423


 Score =   114 bits (284),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T +D  +  W+ TME+ FI LMLE +  GN+   TF  +AW  M+T FN+ FG QY K V
Sbjct  6     TCNDRTRTYWTPTMERFFIDLMLEHLHRGNRTGHTFNKQAWNEMLTVFNSKFGSQYDKDV  65

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY  VK LL   GF+W + HQ ++ +D +W   +KA    R Y+ K +  
Sbjct  66    LKSRYTNLWKQYNDVKCLLDHGGFVWDQTHQTVIGDDSLWSLYLKAHPEARVYKTKPVLN  125

Query  813   YKDMSIICG  787
             + D+ +I G
Sbjct  126   FSDLCLIYG  134


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = -1

Query  1738  DDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKH  1559
             D  CS+       WT VMD   I+L+L+Q+ +GN+   +F++QAW +M   F+ K+  + 
Sbjct  521   DYPCSNIGPPCIEWTRVMDHCLIDLMLEQVSRGNKIGETFTEQAWADMAESFNAKFGLQT  580

Query  1558  DTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             D  +L+NRY  L K+  +   IL  + F WD  +Q +   DE W+ YIK
Sbjct  581   DMFMLENRYILLMKERDDINNILNLDGFTWDVEKQTIVAEDEYWEAYIK  629



>ref|NP_001118381.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC07644.1| uncharacterized protein AT2G24960 [Arabidopsis thaliana]
Length=774

 Score =   154 bits (389),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 112/180 (62%), Gaps = 1/180 (1%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE   Y+TK V  +++L +I+G+TVADGRYS+S  D++ E+E+   E  + +  ++ K
Sbjct  111   AHPEARVYKTKPVLNFSDLCLIYGYTVADGRYSMSSHDLEIEDEING-ESVVLSGKESSK  169

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
              +W+  M+Q+F+++M++Q+  GNK    F  +AWI M+  FN  F  QYGK VL+ R+N 
Sbjct  170   TEWTLEMDQYFVEIMVDQIGRGNKTGNAFSKQAWIDMLVLFNARFSGQYGKRVLRHRYNK  229

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L + Y  ++ +L +DGF W E   MI A+D VW   IK     R YR KSL  Y D+  I
Sbjct  230   LLKYYKDMEAILKEDGFSWDETRLMISADDAVWDSYIKDHPLARTYRMKSLPSYNDLDTI  289


 Score = 99.0 bits (245),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 70/100 (70%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  M+ +FI+L+L+ + +GNRT  +F+KQAW EM+ +F+ K+  ++D DVLK+RY 
Sbjct  12    RTYWTPTMERFFIDLMLEHLHRGNRTGHTFNKQAWNEMLTVFNSKFGSQYDKDVLKSRYT  71

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +L KQY++ K +L+   F+WD + Q V G+D  W  Y+K 
Sbjct  72    NLWKQYNDVKCLLDHGGFVWDQTHQTVIGDDSLWSLYLKA  111


 Score =   136 bits (343),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 101/189 (53%), Gaps = 3/189 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    YR K +P YN+L  IF      G            +E K  +++     D  +I
Sbjct  269   HPLARTYRMKSLPSYNDLDTIFACQAEQGTDHRDDGSAAQTSETKASQEQ---NSDRTRI  325

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
              W+  M+ H I L++EQV  GN++ +TF   AW  M+TAFN  FG Q+ K VLK R+  L
Sbjct  326   FWTPPMDYHLIDLLVEQVNNGNRVGQTFITSAWNEMVTAFNAKFGSQHNKDVLKNRYKHL  385

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             RR Y  +K+LL Q+GF W  R  M++A+D +W   I+A    R YR K++  Y ++  I 
Sbjct  386   RRLYNDIKFLLEQNGFSWDARRDMVIADDDIWNTYIQAHPEARSYRVKTIPSYPNLCFIF  445

Query  789   GNETPTFQY  763
             G ET   +Y
Sbjct  446   GKETSDGRY  454


 Score =   100 bits (250),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             S  E+ ++ WT  MD YF+E+++DQI +GN+T  +FSKQAW++M+ LF+ ++  ++   V
Sbjct  163   SGKESSKTEWTLEMDQYFVEIMVDQIGRGNKTGNAFSKQAWIDMLVLFNARFSGQYGKRV  222

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L++RY  L K Y + + IL+++ F WD++R M++ +D  WD YIK
Sbjct  223   LRHRYNKLLKYYKDMEAILKEDGFSWDETRLMISADDAVWDSYIK  267


 Score =   114 bits (284),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T +D  +  W+ TME+ FI LMLE +  GN+   TF  +AW  M+T FN+ FG QY K V
Sbjct  6     TCNDRTRTYWTPTMERFFIDLMLEHLHRGNRTGHTFNKQAWNEMLTVFNSKFGSQYDKDV  65

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY  VK LL   GF+W + HQ ++ +D +W   +KA    R Y+ K +  
Sbjct  66    LKSRYTNLWKQYNDVKCLLDHGGFVWDQTHQTVIGDDSLWSLYLKAHPEARVYKTKPVLN  125

Query  813   YKDMSIICG  787
             + D+ +I G
Sbjct  126   FSDLCLIYG  134


 Score =   112 bits (279),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 94/203 (46%), Gaps = 26/203 (13%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILED--------  1183
             AHPE   YR K +P Y  L  IFG   +DGRY+     FD      V++ E         
Sbjct  423   AHPEARSYRVKTIPSYPNLCFIFGKETSDGRYTRLAQAFDPSPAETVRMNESGSTDGFKD  482

Query  1182  -----KIPTKDDAKK-----------IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAW  1051
                  K+    + K            I+W+  M+   I LMLEQV  GNK+  TF  +AW
Sbjct  483   TRSFQKVVYTSNEKNDYPCSNIGPPCIEWTRVMDHCLIDLMLEQVSRGNKIGETFTEQAW  542

Query  1050  IHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWK  871
               M  +FN  FG Q    +L+ R+ LL ++   +  +L+ DGF W    Q IVAED  W+
Sbjct  543   ADMAESFNAKFGLQTDMFMLENRYILLMKERDDINNILNLDGFTWDVEKQTIVAEDEYWE  602

Query  870   KVIKAQQYFRRYRNKSLSFYKDM  802
               IK       Y+ K+L  Y ++
Sbjct  603   AYIKEHPDATIYKGKTLDSYGNL  625


 Score =   104 bits (259),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (61%), Gaps = 3/128 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S+  R  WT  MD + I+LL++Q+  GNR   +F   AW EM+  F+ K+  +H+ DVL
Sbjct  319   NSDRTRIFWTPPMDYHLIDLLVEQVNNGNRVGQTFITSAWNEMVTAFNAKFGSQHNKDVL  378

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNRYKHLR+ Y++ K +LEQN F WD  R MV  +D+ W+ YI  Q   +  S  +K I 
Sbjct  379   KNRYKHLRRLYNDIKFLLEQNGFSWDARRDMVIADDDIWNTYI--QAHPEARSYRVKTIP  436

Query  1366  HYILVSFV  1343
              Y  + F+
Sbjct  437   SYPNLCFI  444


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 62/109 (57%), Gaps = 1/109 (1%)
 Frame = -1

Query  1738  DDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKH  1559
             D  CS+       WT VMD   I+L+L+Q+ +GN+   +F++QAW +M   F+ K+  + 
Sbjct  498   DYPCSNIGPPCIEWTRVMDHCLIDLMLEQVSRGNKIGETFTEQAWADMAESFNAKFGLQT  557

Query  1558  DTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             D  +L+NRY  L K+  +   IL  + F WD  +Q +   DE W+ YIK
Sbjct  558   DMFMLENRYILLMKERDDINNILNLDGFTWDVEKQTIVAEDEYWEAYIK  606



>ref|XP_006295713.1| hypothetical protein CARUB_v10024832mg [Capsella rubella]
 gb|EOA28611.1| hypothetical protein CARUB_v10024832mg [Capsella rubella]
Length=774

 Score =   151 bits (381),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 107/181 (59%), Gaps = 1/181 (1%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKD-DAK  1156
             AHPE   Y+TK V  YN+L +I+G+TVADGRYS S  D + E+E+      +     ++ 
Sbjct  113   AHPEARVYKTKPVLNYNDLCLIYGYTVADGRYSRSSHDFEVEDEINGSSGSVVLSSKESS  172

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             K +W+  M+Q+F+++ML+Q+ +GNK    F  +AW  M+  FN  F  QYGK VL+ R+N
Sbjct  173   KTEWTPVMDQYFVEVMLDQISKGNKTGNGFSKQAWTDMLALFNAKFSGQYGKRVLRHRYN  232

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
              L + Y  ++ +L +DGF W     MI A+D VW   IK     R YR KSL  Y D+  
Sbjct  233   KLLKYYKDMEAILKEDGFSWDGTRLMIAADDAVWDSYIKEHPLARTYRMKSLPSYNDLDT  292

Query  795   I  793
             I
Sbjct  293   I  293


 Score =   101 bits (252),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 72/101 (71%), Gaps = 1/101 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  M+ +FI+L+L+ + +GNRT  +FSKQAW +M+ +F+ K+  ++D DVLK+RY 
Sbjct  14    RTYWTPTMERFFIDLMLEHLNRGNRTGHTFSKQAWTDMVCVFNSKFGSQYDKDVLKSRYT  73

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +L KQY++ K +L+   F+WD + Q+VTG++  W  Y+K  
Sbjct  74    NLWKQYNDVKSLLDHGGFVWDQTHQIVTGDESLWSLYLKAH  114


 Score =   108 bits (271),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 94/206 (46%), Gaps = 29/206 (14%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILE---------  1186
             AHPE   YR K +P Y  L  IFG   +DGRY+     FD      V+++E         
Sbjct  422   AHPEARSYRVKTIPSYPNLCFIFGKETSDGRYTRLAQSFDPSPAENVRMIESGSTDGFKD  481

Query  1185  ------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKN  1060
                               +     +    I+W+  M++  I LMLEQV  GNK+  TF  
Sbjct  482   TLGETQSFQMVIYASNEKNDYLCSNTGPCIEWTHFMDRCLIDLMLEQVDRGNKIGETFTE  541

Query  1059  KAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDR  880
             +AW  M  +FN  FG +    VL+ R  L+ ++   +  +L+ +GF W E  Q IVAED 
Sbjct  542   QAWAVMAESFNAKFGIETDMFVLENRLILMMKECDDINNILNVEGFTWDEEKQTIVAEDE  601

Query  879   VWKKVIKAQQYFRRYRNKSLSFYKDM  802
              W+  IK       Y+ K+L  Y ++
Sbjct  602   YWEAYIKDHPDATIYKGKTLDSYGNL  627


 Score = 96.3 bits (238),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +SE  R+ WT  MD Y I+LL+DQ++ GNR   +F   AW EM+  F+ K+  +H  DVL
Sbjct  331   NSERTRTFWTPPMDYYLIDLLVDQVKNGNRVGQTFISSAWNEMVTAFNAKFMSQHSKDVL  390

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMV  1451
             KNRYKHLR+ Y++ K +LEQN F WD  R M 
Sbjct  391   KNRYKHLRRLYNDIKFLLEQNGFSWDTKRDMA  422


 Score =   105 bits (261),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E+ ++ WT VMD YF+E++LDQI KGN+T   FSKQAW +M+ALF+ K+  ++   VL++
Sbjct  170   ESSKTEWTPVMDQYFVEVMLDQISKGNKTGNGFSKQAWTDMLALFNAKFSGQYGKRVLRH  229

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             RY  L K Y + + IL+++ F WD +R M+  +D  WD YIK
Sbjct  230   RYNKLLKYYKDMEAILKEDGFSWDGTRLMIAADDAVWDSYIK  271


 Score = 99.0 bits (245),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 89/194 (46%), Gaps = 18/194 (9%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    YR K +P YN+L  IF      G         D  ++    +            
Sbjct  273   HPLARTYRMKSLPSYNDLDTIFACPAEQGVIPHPVQGKDHRDDGSAAQTSGTKASQVHNS  332

Query  1149  D-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +     W+  M+ + I L+++QV+ GN++ +TF + AW  M+TAFN  F  Q+ K VLK 
Sbjct  333   ERTRTFWTPPMDYYLIDLLVDQVKNGNRVGQTFISSAWNEMVTAFNAKFMSQHSKDVLKN  392

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LRR Y  +K+LL Q+GF W  +  M             A    R YR K++  Y +
Sbjct  393   RYKHLRRLYNDIKFLLEQNGFSWDTKRDM-------------AHPEARSYRVKTIPSYPN  439

Query  804   MSIICGNETPTFQY  763
             +  I G ET   +Y
Sbjct  440   LCFIFGKETSDGRY  453


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (59%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T +D  +  W+ TME+ FI LMLE +  GN+   TF  +AW  M+  FN+ FG QY K V
Sbjct  8     TCNDRTRTYWTPTMERFFIDLMLEHLNRGNRTGHTFSKQAWTDMVCVFNSKFGSQYDKDV  67

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY  VK LL   GF+W + HQ++  ++ +W   +KA    R Y+ K +  
Sbjct  68    LKSRYTNLWKQYNDVKSLLDHGGFVWDQTHQIVTGDESLWSLYLKAHPEARVYKTKPVLN  127

Query  813   YKDMSIICG  787
             Y D+ +I G
Sbjct  128   YNDLCLIYG  136


 Score = 75.5 bits (184),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/96 (38%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WTH MD   I+L+L+Q+ +GN+   +F++QAW  M   F+ K+  + D  VL+NR   + 
Sbjct  513   WTHFMDRCLIDLMLEQVDRGNKIGETFTEQAWAVMAESFNAKFGIETDMFVLENRLILMM  572

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K+  +   IL    F WD+ +Q +   DE W+ YIK
Sbjct  573   KECDDINNILNVEGFTWDEEKQTIVAEDEYWEAYIK  608



>ref|XP_009140602.1| PREDICTED: uncharacterized protein LOC103864591 [Brassica rapa]
Length=777

 Score =   152 bits (383),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 110/190 (58%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-------DKIP  1174
             +HPE   Y+TK V  +++L +++G+TVADGRYS S  D++FE+E+  +          + 
Sbjct  112   SHPEARAYKTKPVLNFDDLCLVYGYTVADGRYSRSSHDVEFEDEINGVNIGESSSGSLVM  171

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             +  +  K +W+  M+Q+FI LML+Q+  GNK    F  +AW  M+  FN  F  QYGK V
Sbjct  172   SSKETSKTEWTPVMDQYFISLMLDQIGRGNKTGNAFSKQAWTDMLALFNARFSGQYGKRV  231

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+N L + +  +  +L QDGF W E  QMI A+D  W   IK     R YR +SL  
Sbjct  232   LRHRYNKLSKYHKDMGAILKQDGFSWDETLQMIAADDVFWNSYIKEHPLARTYRMRSLPS  291

Query  813   YKDMSIICGN  784
             Y D+ +I  N
Sbjct  292   YNDLELIFAN  301


 Score =   100 bits (248),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 75/107 (70%), Gaps = 2/107 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             SC++  T R+ WT  M+ +FI+L+LD + +GNRT  +F+KQAW EM+++F+ K++ ++D 
Sbjct  6     SCNNDRT-RTYWTPTMERFFIDLMLDHLHRGNRTGHTFNKQAWNEMLSVFNSKFESQYDK  64

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             DVLK RY  L KQY++ K +L+   F WD S +MV G++  W  Y+K
Sbjct  65    DVLKIRYTTLWKQYNDVKSLLDHGGFSWDQSHEMVVGDESLWSCYLK  111


 Score =   128 bits (321),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 102/197 (52%), Gaps = 26/197 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    YR + +P YN+L +IF                   N V+  +D +P ++ A + 
Sbjct  278   HPLARTYRMRSLPSYNDLELIFA------------------NPVQGKDDAVPDENKASQA  319

Query  1149  D--------WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                      W+  M+ + I L+ +QV +GN++ +TF   AW  MIT+FNT F  Q+G+ V
Sbjct  320   QSSDRTRTFWTPPMDNYLIDLLYDQVNKGNRVGQTFITSAWNEMITSFNTKFESQHGRDV  379

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK R+  LRR Y  ++++L Q+GF W  R  M+VA+D VW   IK     R YR K++  
Sbjct  380   LKNRYKHLRRLYNDIRFILEQNGFSWDARRDMVVADDSVWCSYIKGHPEARPYRVKTIPI  439

Query  813   YKDMSIICGNETPTFQY  763
             Y ++  I G E    +Y
Sbjct  440   YPNLCFIFGKEVSDGRY  456


 Score =   102 bits (253),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 71/103 (69%), Gaps = 3/103 (3%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             ET ++ WT VMD YFI L+LDQI +GN+T  +FSKQAW +M+ALF+ ++  ++   VL++
Sbjct  175   ETSKTEWTPVMDQYFISLMLDQIGRGNKTGNAFSKQAWTDMLALFNARFSGQYGKRVLRH  234

Query  1537  RYKHLRKQYHN--TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             RY  L K YH     IL+Q+ F WD++ QM+  +D  W+ YIK
Sbjct  235   RYNKLSK-YHKDMGAILKQDGFSWDETLQMIAADDVFWNSYIK  276


 Score =   118 bits (296),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 67/202 (33%), Positives = 96/202 (48%), Gaps = 25/202 (12%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDID-----------------FEN  1204
              HPE  PYR K +P Y  L  IFG  V+DGRY+    D D                 F+ 
Sbjct  425   GHPEARPYRVKTIPIYPNLCFIFGKEVSDGRYTRLAQDFDPTPAETVRINESESEDGFKE  484

Query  1203  EVKIL--------EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWI  1048
               +++        +D + +      ++W+  M++  I LMLEQV  GNK+  TF  +AW 
Sbjct  485   TFQMVVHAAGEEKDDYLCSSSGPSPVEWTAVMDRCLIDLMLEQVNRGNKVGETFTEQAWG  544

Query  1047  HMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKK  868
              M  +FN  FG Q     L+ R+ L+ ++   V  +L+ DGF+W    Q IVAED  W  
Sbjct  545   EMAESFNAKFGLQADMFTLENRYILMMKERDDVNNILNLDGFVWDGEKQTIVAEDEHWDA  604

Query  867   VIKAQQYFRRYRNKSLSFYKDM  802
              IK       Y+ K+L  Y D+
Sbjct  605   YIKEHPDATIYKGKTLDSYGDL  626


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
               SS+  R+ WT  MD+Y I+LL DQ+ KGNR   +F   AW EMI  F+ K++ +H  D
Sbjct  319   AQSSDRTRTFWTPPMDNYLIDLLYDQVNKGNRVGQTFITSAWNEMITSFNTKFESQHGRD  378

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNRYKHLR+ Y++ + ILEQN F WD  R MV  +D  W  YIK     + +   +K 
Sbjct  379   VLKNRYKHLRRLYNDIRFILEQNGFSWDARRDMVVADDSVWCSYIKGHPEARPY--RVKT  436

Query  1372  IAHYILVSFV  1343
             I  Y  + F+
Sbjct  437   IPIYPNLCFI  446


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +  W+ TME+ FI LML+ +  GN+   TF  +AW  M++ FN+ F  QY K VLK
Sbjct  9     NDRTRTYWTPTMERFFIDLMLDHLHRGNRTGHTFNKQAWNEMLSVFNSKFESQYDKDVLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +QY  VK LL   GF W + H+M+V ++ +W   +K+    R Y+ K +  + 
Sbjct  69    IRYTTLWKQYNDVKSLLDHGGFSWDQSHEMVVGDESLWSCYLKSHPEARAYKTKPVLNFD  128

Query  807   DMSIICG  787
             D+ ++ G
Sbjct  129   DLCLVYG  135


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             CSSS      WT VMD   I+L+L+Q+ +GN+   +F++QAW EM   F+ K+  + D  
Sbjct  502   CSSSGPSPVEWTAVMDRCLIDLMLEQVNRGNKVGETFTEQAWGEMAESFNAKFGLQADMF  561

Query  1549  VLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L+NRY  + K+  +   IL  + F+WD  +Q +   DE WD YIK
Sbjct  562   TLENRYILMMKERDDVNNILNLDGFVWDGEKQTIVAEDEHWDAYIK  607



>ref|XP_010274346.1| PREDICTED: uncharacterized protein LOC104609676 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274347.1| PREDICTED: uncharacterized protein LOC104609676 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010274348.1| PREDICTED: uncharacterized protein LOC104609676 isoform X1 [Nelumbo 
nucifera]
Length=456

 Score =   210 bits (535),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 130/336 (39%), Positives = 191/336 (57%), Gaps = 15/336 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV--KILEDKIPTKDDA  1159
             AHP+   Y+TK+VPYYN+L II+GH +ADGRYSLS  D+D  +EV  K  + ++    D 
Sbjct  112   AHPDSRLYKTKIVPYYNDLCIIYGHAIADGRYSLSSHDMDLGSEVAGKRTDTQLTISGDC  171

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              KIDW+ TM+ +F++LM +QV +GNK+   FK KAW+ MI +FN  FGFQY K VLK R+
Sbjct  172   SKIDWTMTMDHYFVELMKDQVHKGNKIGHIFKKKAWVQMIASFNENFGFQYEKDVLKNRY  231

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               LRRQY  +K LL Q GF   E  QM++A++ VW   IKA    R +RN+ + +Y D+ 
Sbjct  232   KNLRRQYNNIKILLGQSGFSLDETQQMVIADNCVWDDYIKAHPNARVFRNRVIPYYSDLC  291

Query  798   IICGNETPTFQYGYPFVKAGEF-CVPIIQTTGKEGNLreveeivedddereEKKCRYDT-  625
             +I G+ T   ++ +   + GE   +  +Q+    G        V         +  +DT 
Sbjct  292   MIYGDTTTDIKFNH-LDQGGELDNIVNVQSVVTPGGQHSQAMPVAQGGLMHSSR-NFDTL  349

Query  624   -KEPKEPCKGPSEINEETE----IEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVI  460
              ++ K   + PS      +    +   M +A+ +M  A+T+LT   KK+  NS   E+VI
Sbjct  350   DQQNKRRSEIPSTYQHSRKSRRCLHNDMMEALHKMAMAITSLT--NKKEIDNSFSTENVI  407

Query  459   YILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              +LQA+P+MD++  L        E    AK+FLALD
Sbjct  408   GLLQAVPDMDEELLLDACDILEDET--NAKIFLALD  441


 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 80/144 (56%), Gaps = 0/144 (0%)
 Frame = -2

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             ++ +  +  D  +  W+  M+++ I L+L+QV+ GNK+   F  +AW  M+  FN  FG 
Sbjct  1     MDGETQSTSDHSRTSWTPPMDRYLIDLLLDQVRRGNKIGHLFNKQAWTDMVGLFNDKFGP  60

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             QY + VLK + N LR+QY  +  LL Q GF W ER Q + A D VW   +KA    R Y+
Sbjct  61    QYDEDVLKNQHNSLRKQYNDIVTLLGQSGFTWDERRQTVAANDYVWDDYLKAHPDSRLYK  120

Query  831   NKSLSFYKDMSIICGNETPTFQYG  760
              K + +Y D+ II G+     +Y 
Sbjct  121   TKIVPYYNDLCIIYGHAIADGRYS  144


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 86/129 (67%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M+ ++ S+S+  R++WT  MD Y I+LLLDQ+++GN+    F+KQAW +M+ LF+ K+  
Sbjct  1     MDGETQSTSDHSRTSWTPPMDRYLIDLLLDQVRRGNKIGHLFNKQAWTDMVGLFNDKFGP  60

Query  1564  KHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             ++D DVLKN++  LRKQY++   +L Q+ F WD+ RQ V  ND  WDDY+K     + + 
Sbjct  61    QYDEDVLKNQHNSLRKQYNDIVTLLGQSGFTWDERRQTVAANDYVWDDYLKAHPDSRLYK  120

Query  1387  NHLKIIAHY  1361
                KI+ +Y
Sbjct  121   T--KIVPYY  127


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             S +  + +WT  MD YF+EL+ DQ+ KGN+    F K+AW++MIA F+  +  +++ DVL
Sbjct  168   SGDCSKIDWTMTMDHYFVELMKDQVHKGNKIGHIFKKKAWVQMIASFNENFGFQYEKDVL  227

Query  1543  KNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNRYK+LR+QY+N KI L Q+ F  D+++QMV  ++  WDDYIK     + F N  ++I 
Sbjct  228   KNRYKNLRRQYNNIKILLGQSGFSLDETQQMVIADNCVWDDYIKAHPNARVFRN--RVIP  285

Query  1366  HY  1361
             +Y
Sbjct  286   YY  287



>ref|XP_010548576.1| PREDICTED: uncharacterized protein LOC104819951 isoform X2 [Tarenaya 
hassleriana]
Length=589

 Score =   146 bits (368),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 83/217 (38%), Positives = 116/217 (53%), Gaps = 5/217 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYS---LSCFDIDFENEVKILEDK-IPTKD-  1165
             HP    YR + +P YN+L IIFG+    G      LS   ID  +  K  E K I TK+ 
Sbjct  113   HPHARTYRMRTLPNYNDLEIIFGNPTDQGILPHPVLSKELIDDSSAAKTDERKTIQTKNS  172

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+  M+++ I L+++QV +GNK+ +TF    WI M+TAFN  FG  + K VLK 
Sbjct  173   DRTRTFWTPPMDRYLIDLLVDQVHKGNKVGQTFITSGWIEMVTAFNAKFGSLHNKDVLKN  232

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             RF  LRR Y  + +LL Q+GF+W  R  M++AED +W   I+A    R YR K +  Y+ 
Sbjct  233   RFKHLRRLYNDITFLLQQNGFLWDARRDMVIAEDSIWDTYIQAHPEARSYRVKMVPSYQK  292

Query  804   MSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGN  694
             M +I G E P  +Y +            +  TG E N
Sbjct  293   MCLIFGKEMPDRRYTHLAQAFEPNIAEAVTMTGDEKN  329


 Score =   104 bits (259),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 76/111 (68%), Gaps = 1/111 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M + S ++++  R+ WT VMD YFIEL+LDQI + N+T  +FSKQAW +M+ LF+ ++  
Sbjct  1     MGESSINTNDCPRTEWTPVMDQYFIELMLDQIGRRNKTGDAFSKQAWTDMLVLFNARFGA  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             ++   VL++RY  L K Y + K I+ ++ F WD++ QM+  +D+ WD YIK
Sbjct  61    QYGKRVLRHRYNKLLKYYKDMKVIVSKDGFSWDETLQMIAADDDVWDSYIK  111


 Score =   122 bits (306),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 0/140 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  + +W+  M+Q+FI+LML+Q+   NK    F  +AW  M+  FN  FG QYGK VL+
Sbjct  9     NDCPRTEWTPVMDQYFIELMLDQIGRRNKTGDAFSKQAWTDMLVLFNARFGAQYGKRVLR  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+N L + Y  +K ++S+DGF W E  QMI A+D VW   IK   + R YR ++L  Y 
Sbjct  69    HRYNKLLKYYKDMKVIVSKDGFSWDETLQMIAADDDVWDSYIKEHPHARTYRMRTLPNYN  128

Query  807   DMSIICGNETPTFQYGYPFV  748
             D+ II GN T      +P +
Sbjct  129   DLEIIFGNPTDQGILPHPVL  148


 Score =   107 bits (267),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 76/122 (62%), Gaps = 3/122 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S+  R+ WT  MD Y I+LL+DQ+ KGN+   +F    W+EM+  F+ K+   H+ DVL
Sbjct  171   NSDRTRTFWTPPMDRYLIDLLVDQVHKGNKVGQTFITSGWIEMVTAFNAKFGSLHNKDVL  230

Query  1543  KNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNR+KHLR+ Y++ T +L+QN F+WD  R MV   D  WD YI  Q   +  S  +K++ 
Sbjct  231   KNRFKHLRRLYNDITFLLQQNGFLWDARRDMVIAEDSIWDTYI--QAHPEARSYRVKMVP  288

Query  1366  HY  1361
              Y
Sbjct  289   SY  290


 Score =   105 bits (262),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 96/188 (51%), Gaps = 8/188 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILEDK----IPT  1171
             AHPE   YR K+VP Y ++ +IFG  + D RY+     F+ +    V +  D+    +  
Sbjct  275   AHPEARSYRVKMVPSYQKMCLIFGKEMPDRRYTHLAQAFEPNIAEAVTMTGDEKNDYLCG  334

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D    +W++ M++  I LMLEQV  GNK+  TF  +AW  M+ +F+  FG Q    +L
Sbjct  335   SMDPPCTEWTQVMDRCLIDLMLEQVNSGNKIGETFTEQAWADMVESFSKKFGIQTDIYIL  394

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAE-DRVWKKVIKAQQYFRRYRNKSLS-  817
             + R+  L ++   +  +LS   F W E  Q IVA+ D  W+  IK       YR K L  
Sbjct  395   ENRYIYLMKERDDINNILSHCDFSWDENKQTIVADGDESWESYIKEHPDAIMYRGKLLGD  454

Query  816   FYKDMSII  793
              Y+D+  I
Sbjct  455   CYRDLCKI  462


 Score = 85.1 bits (209),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             C S +   + WT VMD   I+L+L+Q+  GN+   +F++QAW +M+  FS K+  + D  
Sbjct  333   CGSMDPPCTEWTQVMDRCLIDLMLEQVNSGNKIGETFTEQAWADMVESFSKKFGIQTDIY  392

Query  1549  VLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQ-MVTGNDEKWDDYIK  1415
             +L+NRY +L K+  +   IL   +F WD+++Q +V   DE W+ YIK
Sbjct  393   ILENRYIYLMKERDDINNILSHCDFSWDENKQTIVADGDESWESYIK  439



>ref|XP_006588882.1| PREDICTED: uncharacterized protein LOC100798302 isoform X6 [Glycine 
max]
Length=436

 Score =   209 bits (531),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 136/198 (69%), Gaps = 11/198 (6%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK--  1168
             C+ AHP+ +P++ +V+PYY++L II+GH VADGRYSLSCFD+DFE E K L+DK  T   
Sbjct  29    CIKAHPDAQPFKKRVIPYYDDLCIIYGHAVADGRYSLSCFDVDFEYEEKDLDDKTMTSKG  88

Query  1167  -DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
              DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  +FN  F 
Sbjct  89    VDDQTPPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFL  148

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               YG++VL+ RFN+LRR Y ++  LL ++GF+W +    +VA+++VW+K I+    FR Y
Sbjct  149   CHYGRIVLRNRFNVLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRVHHNFRLY  208

Query  834   RNKSLSFYKDMSIICGNE  781
             + KS+ FY  M I+C N+
Sbjct  209   KIKSMPFYSGMCIVCRND  226


 Score = 85.5 bits (210),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  102   RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRIVLRNRFN  161

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  +L   E FIWD ++  V  +++ W   I+V
Sbjct  162   VLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRV  201



>ref|XP_006588880.1| PREDICTED: uncharacterized protein LOC100798302 isoform X4 [Glycine 
max]
Length=458

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 136/198 (69%), Gaps = 11/198 (6%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK--  1168
             C+ AHP+ +P++ +V+PYY++L II+GH VADGRYSLSCFD+DFE E K L+DK  T   
Sbjct  51    CIKAHPDAQPFKKRVIPYYDDLCIIYGHAVADGRYSLSCFDVDFEYEEKDLDDKTMTSKG  110

Query  1167  -DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
              DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  +FN  F 
Sbjct  111   VDDQTPPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFL  170

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               YG++VL+ RFN+LRR Y ++  LL ++GF+W +    +VA+++VW+K I+    FR Y
Sbjct  171   CHYGRIVLRNRFNVLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRVHHNFRLY  230

Query  834   RNKSLSFYKDMSIICGNE  781
             + KS+ FY  M I+C N+
Sbjct  231   KIKSMPFYSGMCIVCRND  248


 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  124   RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRIVLRNRFN  183

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  +L   E FIWD ++  V  +++ W   I+V
Sbjct  184   VLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRV  223


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = -2

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
             +Y   VLK R    R+QY  +K ++ Q GF W     MIVA+D+ W + IKA    + ++
Sbjct  3     KYDVEVLKNRHKRFRKQYNDMKMIVGQKGFQWDGTQNMIVADDKAWDECIKAHPDAQPFK  62

Query  831   NKSLSFYKDMSIICGNETPTFQY  763
              + + +Y D+ II G+     +Y
Sbjct  63    KRVIPYYDDLCIIYGHAVADGRY  85


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -1

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D +VLKNR+K  RKQY++ K I+ Q  F WD ++ M+  +D+ WD+ IK     Q F 
Sbjct  3     KYDVEVLKNRHKRFRKQYNDMKMIVGQKGFQWDGTQNMIVADDKAWDECIKAHPDAQPFK  62

Query  1387  NHLKIIAHY  1361
                ++I +Y
Sbjct  63    K--RVIPYY  69



>ref|XP_006405068.1| hypothetical protein EUTSA_v10000052mg [Eutrema salsugineum]
 gb|ESQ46521.1| hypothetical protein EUTSA_v10000052mg [Eutrema salsugineum]
Length=789

 Score =   150 bits (379),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 110/187 (59%), Gaps = 7/187 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-------DKIP  1174
             AHPE   Y+TK V  +N+L +I+G+TVADGRYS S  D++ E+E+  +          + 
Sbjct  111   AHPEARVYKTKPVLNFNDLCLIYGYTVADGRYSRSSHDLESEDEINGVNIGESSSGSLVL  170

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             +  +  K  W++ M+Q+FI+LML+Q+  GN+    F  +AW  M+  FN  F  QYGK V
Sbjct  171   SSKENSKTKWTQVMDQYFIELMLDQIGRGNRTGNAFSKQAWTDMLGLFNARFSAQYGKRV  230

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+N L + Y  ++ +L +DGF W E  Q I A D VW   +K     R YR ++L  
Sbjct  231   LRHRYNKLSKYYKDMEAILKEDGFSWDETRQTIAANDTVWDAYVKEHPLARTYRVRTLPN  290

Query  813   YKDMSII  793
             YKD+ II
Sbjct  291   YKDLEII  297


 Score = 98.2 bits (243),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 73/106 (69%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             SS++  R+ WT  M+ +FI+L+++ + +GNRT  +F+KQAW EM+ +F+ K+  ++D DV
Sbjct  6     SSNDRTRTYWTQTMERFFIDLMIEHLHRGNRTGHTFNKQAWNEMLVVFNSKFGSQYDKDV  65

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LK+RY +L KQY++ K +L+   F WD + QMV  ++  W  Y+K 
Sbjct  66    LKSRYTNLWKQYNDVKSLLDHGGFSWDQTNQMVLADESLWSSYLKA  111


 Score =   134 bits (337),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 106/192 (55%), Gaps = 6/192 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDI-DFENEVKILEDKIPT--KDDA  1159
             HP    YR + +P Y +L IIF      G   +   D+ +F++  K+ E K       D 
Sbjct  277   HPLARTYRVRTLPNYKDLEIIFACPAEQG---IQAKDLKEFDSAAKMNETKTSQVHNSDR  333

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              +  W+  M+ + I L+++QV +GN++ +TF   AW  M+TAFN  FG Q+ K VLK R+
Sbjct  334   TRTFWTPPMDHYLIDLLVDQVNKGNRVGQTFITSAWNEMVTAFNAKFGSQHSKDVLKNRY  393

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               L+R Y  +K+LL QDGF W  +  M++A+D +W   I+A    R YR K++S Y ++ 
Sbjct  394   KHLKRSYNDIKFLLEQDGFSWDTKSDMVIADDGIWDTYIQAHPEARSYRVKTISTYPNLC  453

Query  798   IICGNETPTFQY  763
              I G E    +Y
Sbjct  454   FIFGKEMSDGRY  465


 Score =   107 bits (268),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 71/102 (70%), Gaps = 1/102 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E  ++ WT VMD YFIEL+LDQI +GNRT  +FSKQAW +M+ LF+ ++  ++   VL++
Sbjct  174   ENSKTKWTQVMDQYFIELMLDQIGRGNRTGNAFSKQAWTDMLGLFNARFSAQYGKRVLRH  233

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             RY  L K Y + + IL+++ F WD++RQ +  ND  WD Y+K
Sbjct  234   RYNKLSKYYKDMEAILKEDGFSWDETRQTIAANDTVWDAYVK  275


 Score =   110 bits (275),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 78/129 (60%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + +D  +  W++TME+ FI LM+E +  GN+   TF  +AW  M+  FN+ FG QY K V
Sbjct  6     SSNDRTRTYWTQTMERFFIDLMIEHLHRGNRTGHTFNKQAWNEMLVVFNSKFGSQYDKDV  65

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY  VK LL   GF W + +QM++A++ +W   +KA    R Y+ K +  
Sbjct  66    LKSRYTNLWKQYNDVKSLLDHGGFSWDQTNQMVLADESLWSSYLKAHPEARVYKTKPVLN  125

Query  813   YKDMSIICG  787
             + D+ +I G
Sbjct  126   FNDLCLIYG  134


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/206 (33%), Positives = 98/206 (48%), Gaps = 29/206 (14%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFD---------------IDFEN  1204
             AHPE   YR K +  Y  L  IFG  ++DGRY+     FD                DF++
Sbjct  434   AHPEARSYRVKTISTYPNLCFIFGKEMSDGRYTRLAQAFDPSPAETVLMIENSSTDDFKD  493

Query  1203  ---EVKILE---------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKN  1060
                E + L+         D + T   A  I+W+  M++  I LMLEQV  GNK+  TF  
Sbjct  494   ALGETQSLQMVHGSDEKNDYLCTNTGAPCIEWTPVMDRCLIDLMLEQVNRGNKIGETFTE  553

Query  1059  KAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDR  880
             +AW  +  +FN  FG Q    +L+ R+ L+ ++   +  +LS  GF W +  Q I AED 
Sbjct  554   QAWADIAESFNAKFGLQADMFMLENRYILMMKEREDINNILSLPGFAWDDEKQTIAAEDE  613

Query  879   VWKKVIKAQQYFRRYRNKSLSFYKDM  802
              W+  IK       Y+ K+L  Y D+
Sbjct  614   CWEAYIKEHPDATIYKGKTLDSYCDL  639


 Score =   107 bits (267),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 78/128 (61%), Gaps = 3/128 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S+  R+ WT  MD Y I+LL+DQ+ KGNR   +F   AW EM+  F+ K+  +H  DVL
Sbjct  330   NSDRTRTFWTPPMDHYLIDLLVDQVNKGNRVGQTFITSAWNEMVTAFNAKFGSQHSKDVL  389

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNRYKHL++ Y++ K +LEQ+ F WD    MV  +D  WD YI  Q   +  S  +K I+
Sbjct  390   KNRYKHLKRSYNDIKFLLEQDGFSWDTKSDMVIADDGIWDTYI--QAHPEARSYRVKTIS  447

Query  1366  HYILVSFV  1343
              Y  + F+
Sbjct  448   TYPNLCFI  455


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             C+++      WT VMD   I+L+L+Q+ +GN+   +F++QAW ++   F+ K+  + D  
Sbjct  515   CTNTGAPCIEWTPVMDRCLIDLMLEQVNRGNKIGETFTEQAWADIAESFNAKFGLQADMF  574

Query  1549  VLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +L+NRY  + K+  +   IL    F WDD +Q +   DE W+ YIK
Sbjct  575   MLENRYILMMKEREDINNILSLPGFAWDDEKQTIAAEDECWEAYIK  620



>gb|KHN37754.1| hypothetical protein glysoja_043783 [Glycine soja]
Length=467

 Score =   208 bits (529),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 136/198 (69%), Gaps = 11/198 (6%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK--  1168
             C+ AHP+ +P++ +V+PYY++L II+GH VADGRYSLSCFD+DFE E K L+DK  T   
Sbjct  60    CIKAHPDAQPFKKRVIPYYDDLCIIYGHAVADGRYSLSCFDVDFEYEEKDLDDKTMTSKG  119

Query  1167  -DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
              DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  +FN  F 
Sbjct  120   VDDQTPPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFL  179

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               YG++VL+ RFN+LRR Y ++  LL ++GF+W +    +VA+++VW+K I+    FR Y
Sbjct  180   CHYGRIVLRNRFNVLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRVHHNFRLY  239

Query  834   RNKSLSFYKDMSIICGNE  781
             + KS+ FY  M I+C N+
Sbjct  240   KIKSMPFYSGMCIVCRND  257


 Score = 85.1 bits (209),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  133   RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRIVLRNRFN  192

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  +L   E FIWD ++  V  +++ W   I+V
Sbjct  193   VLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRV  232


 Score = 77.0 bits (188),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -2

Query  1044  MITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKV  865
             MI  FNT FGF+Y   VLK R    R+QY  +K ++ Q GF W     MIVA+D+ W + 
Sbjct  1     MIKQFNTKFGFKYDVEVLKNRHKRFRKQYNDMKMIVGQKGFQWDGTQNMIVADDKAWDEC  60

Query  864   IKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQY  763
             IKA    + ++ + + +Y D+ II G+     +Y
Sbjct  61    IKAHPDAQPFKKRVIPYYDDLCIIYGHAVADGRY  94


 Score = 62.4 bits (150),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -1

Query  1597  MIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDY  1421
             MI  F+ K+  K+D +VLKNR+K  RKQY++ K I+ Q  F WD ++ M+  +D+ WD+ 
Sbjct  1     MIKQFNTKFGFKYDVEVLKNRHKRFRKQYNDMKMIVGQKGFQWDGTQNMIVADDKAWDEC  60

Query  1420  IKVQMFDQKFSNHLKIIAHY  1361
             IK     Q F    ++I +Y
Sbjct  61    IKAHPDAQPFKK--RVIPYY  78



>ref|XP_002280955.3| PREDICTED: uncharacterized protein LOC100245953 [Vitis vinifera]
Length=956

 Score =   140 bits (354),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 105/182 (58%), Gaps = 5/182 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ + YR K  P YN+L +I+G  +ADG+ + S   IDF  + + L +   ++      
Sbjct  600   HPDAKSYRAKPKPNYNDLCLIYGSPIADGQCNQSYHGIDFNGDGRELNNSSHSR-----T  654

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLE VQ+G+ ++  F  +AW  M   FN  FG  + K VLK+RF   
Sbjct  655   DWTPLMDRYFIDLMLEHVQKGSMVDHKFNKQAWSDMAARFNAEFGSYHDKDVLKSRFKHW  714

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+ +  ++ LL Q+GF W ER QM+ A + +W   IK     R YR +SL  Y D+ +I 
Sbjct  715   RKLFNGMRTLLEQNGFAWDERRQMVTAANELWDSYIKENPDARSYRTRSLPNYNDLFLIY  774

Query  789   GN  784
             GN
Sbjct  775   GN  776


 Score =   106 bits (265),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++S+  R++W   MD Y I+L+L+Q++KGNR   +F+KQAW +M+ALF+ +++ +H+  V
Sbjct  494   ANSDHSRTDWIPPMDRYLIDLMLEQVRKGNRKVHTFNKQAWADMVALFNERFRTQHEKSV  553

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK+R+K LRKQYH+ K +L+   F WD+ RQMVT  D  W  Y+K
Sbjct  554   LKSRHKSLRKQYHHIKNLLDHRGFSWDEMRQMVTAYDAVWAAYLK  598


 Score =   128 bits (321),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 104/192 (54%), Gaps = 8/192 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL-----EDKIPTK  1168
             AHP  + YR K++  + +L +++G TV +G  S    D D E ++  +     E + P  
Sbjct  276   AHPHAQAYRKKILLNFQDLSLLYGKTVNNGIRSHLHPDKDLEYDIVQIKAGEGEYQTPIS  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D     W+  M+ +FI L+L+QV  GNK+ + F  +AWI M+T FN  FG  Y K VLK
Sbjct  336   GDGY---WTLPMDHYFIDLLLDQVLRGNKIGQGFITQAWIEMVTLFNMKFGSHYDKDVLK  392

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LRRQY  +  LL   GF W +  +M+ AE  VW   I+A    + YRNK++  Y 
Sbjct  393   NRYRHLRRQYNDITALLEHSGFSWDDTREMVTAEGFVWDSYIQAIPDAQSYRNKTVPNYH  452

Query  807   DMSIICGNETPT  772
              + +I G E+  
Sbjct  453   KLCVIYGQESSN  464


 Score =   111 bits (277),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   + +S+E  R +WT  MD YF EL+LDQ+ KGN+ + +F++QAW  M++LF+ K+ 
Sbjct  164   GMGSVAPASNEHSRRDWTPAMDQYFTELMLDQLGKGNKITNTFNEQAWTVMLSLFNSKFC  223

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +H    LK RYK L K Y + K +LEQN F+WDD +QM+  +D+ WD+YIK     Q +
Sbjct  224   TQHGKRFLKRRYKKLEKYYSDIKTLLEQNGFLWDDRQQMIAADDDVWDNYIKAHPHAQAY  283


 Score =   158 bits (400),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 118/188 (63%), Gaps = 6/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI------LEDKIPT  1171
             AHP+ + Y+ K V  +N+L +I+ +T ADGRYS S  DIDF+++ +       +    P 
Sbjct  112   AHPDAQCYKNKAVMNFNDLCLIYAYTTADGRYSRSSHDIDFDDDFQGVTIAYGMGSVAPA  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + DW+  M+Q+F +LML+Q+ +GNK+  TF  +AW  M++ FN+ F  Q+GK  L
Sbjct  172   SNEHSRRDWTPAMDQYFTELMLDQLGKGNKITNTFNEQAWTVMLSLFNSKFCTQHGKRFL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L + Y  +K LL Q+GF+W +R QMI A+D VW   IKA  + + YR K L  +
Sbjct  232   KRRYKKLEKYYSDIKTLLEQNGFLWDDRQQMIAADDDVWDNYIKAHPHAQAYRKKILLNF  291

Query  810   KDMSIICG  787
             +D+S++ G
Sbjct  292   QDLSLLYG  299


 Score =   127 bits (319),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 104/188 (55%), Gaps = 5/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG-RYSLSC-FDIDFENEVKILED---KIPTK  1168
             A P+ + YR K VP Y++L +I+G   ++G   SL+C  DID  + V ++E    +    
Sbjct  436   AIPDAQSYRNKTVPNYHKLCVIYGQESSNGGDNSLACNGDIDGVDPVWMIEGTDIQCNAN  495

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D  + DW   M+++ I LMLEQV++GN+   TF  +AW  M+  FN  F  Q+ K VLK
Sbjct  496   SDHSRTDWIPPMDRYLIDLMLEQVRKGNRKVHTFNKQAWADMVALFNERFRTQHEKSVLK  555

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R   LR+QY  +K LL   GF W E  QM+ A D VW   +K     + YR K    Y 
Sbjct  556   SRHKSLRKQYHHIKNLLDHRGFSWDEMRQMVTAYDAVWAAYLKEHPDAKSYRAKPKPNYN  615

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  616   DLCLIYGS  623


 Score =   107 bits (268),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT +MD YFI+L+L+ +QKG+     F+KQAW +M A F+ ++   HD DVLK+R+K
Sbjct  653   RTDWTPLMDRYFIDLMLEHVQKGSMVDHKFNKQAWSDMAARFNAEFGSYHDKDVLKSRFK  712

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H RK ++  + +LEQN F WD+ RQMVT  +E WD YIK
Sbjct  713   HWRKLFNGMRTLLEQNGFAWDERRQMVTAANELWDSYIK  751


 Score = 38.9 bits (89),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 7/85 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILE--DKIPTKD  1165
             +P+   YRT+ +P YN+L +I+G+ +     + S F ID  ++   V I E  D+     
Sbjct  753   NPDARSYRTRSLPNYNDLFLIYGNAINKDTQNQSSFCIDDNDDDLGVGIGEEDDQFLASS  812

Query  1164  DAKKIDWSETM--EQHFIQLMLEQV  1096
             D+  +DW   M  + H ++L ++++
Sbjct  813   DSLDVDWMIPMDIDPHALELDMDEM  837


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W++TME++FI LML+QV  GN++  TF  +AW  M   FN  FG QY K VLK+
Sbjct  10    DRSRTHWTQTMERYFIDLMLDQVHRGNRMGHTFNKQAWADMHAMFNGKFGSQYEKDVLKS  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+ +L +Q+  +K LL Q GF W +  +M+VA+D VW   IKA    + Y+NK++  + D
Sbjct  70    RYTVLWKQFNDMKNLLDQSGFSWDDTRKMVVADDCVWDAYIKAHPDAQCYKNKAVMNFND  129

Query  804   MSIICGNETPTFQYG  760
             + +I    T   +Y 
Sbjct  130   LCLIYAYTTADGRYS  144


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD YFI+LLLDQ+ +GN+    F  QAW+EM+ LF+ K+   +D DVLKNRY+HLR
Sbjct  340   WTLPMDHYFIDLLLDQVLRGNKIGQGFITQAWIEMVTLFNMKFGSHYDKDVLKNRYRHLR  399

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             +QY++ T +LE + F WDD+R+MVT     WD YI+     Q + N  K + +Y
Sbjct  400   RQYNDITALLEHSGFSWDDTREMVTAEGFVWDSYIQAIPDAQSYRN--KTVPNY  451


 Score =   107 bits (267),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   +  +S+  R++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M A+F+ K+  
Sbjct  1     MASQALVNSDRSRTHWTQTMERYFIDLMLDQVHRGNRMGHTFNKQAWADMHAMFNGKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             +++ DVLK+RY  L KQ+++ K +L+Q+ F WDD+R+MV  +D  WD YIK     Q + 
Sbjct  61    QYEKDVLKSRYTVLWKQFNDMKNLLDQSGFSWDDTRKMVVADDCVWDAYIKAHPDAQCYK  120

Query  1387  N  1385
             N
Sbjct  121   N  121



>emb|CBI36750.3| unnamed protein product [Vitis vinifera]
Length=950

 Score =   140 bits (354),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 105/182 (58%), Gaps = 5/182 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ + YR K  P YN+L +I+G  +ADG+ + S   IDF  + + L +   ++      
Sbjct  600   HPDAKSYRAKPKPNYNDLCLIYGSPIADGQCNQSYHGIDFNGDGRELNNSSHSR-----T  654

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLE VQ+G+ ++  F  +AW  M   FN  FG  + K VLK+RF   
Sbjct  655   DWTPLMDRYFIDLMLEHVQKGSMVDHKFNKQAWSDMAARFNAEFGSYHDKDVLKSRFKHW  714

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+ +  ++ LL Q+GF W ER QM+ A + +W   IK     R YR +SL  Y D+ +I 
Sbjct  715   RKLFNGMRTLLEQNGFAWDERRQMVTAANELWDSYIKENPDARSYRTRSLPNYNDLFLIY  774

Query  789   GN  784
             GN
Sbjct  775   GN  776


 Score =   106 bits (265),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++S+  R++W   MD Y I+L+L+Q++KGNR   +F+KQAW +M+ALF+ +++ +H+  V
Sbjct  494   ANSDHSRTDWIPPMDRYLIDLMLEQVRKGNRKVHTFNKQAWADMVALFNERFRTQHEKSV  553

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK+R+K LRKQYH+ K +L+   F WD+ RQMVT  D  W  Y+K
Sbjct  554   LKSRHKSLRKQYHHIKNLLDHRGFSWDEMRQMVTAYDAVWAAYLK  598


 Score =   128 bits (321),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 104/192 (54%), Gaps = 8/192 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL-----EDKIPTK  1168
             AHP  + YR K++  + +L +++G TV +G  S    D D E ++  +     E + P  
Sbjct  276   AHPHAQAYRKKILLNFQDLSLLYGKTVNNGIRSHLHPDKDLEYDIVQIKAGEGEYQTPIS  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D     W+  M+ +FI L+L+QV  GNK+ + F  +AWI M+T FN  FG  Y K VLK
Sbjct  336   GDGY---WTLPMDHYFIDLLLDQVLRGNKIGQGFITQAWIEMVTLFNMKFGSHYDKDVLK  392

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LRRQY  +  LL   GF W +  +M+ AE  VW   I+A    + YRNK++  Y 
Sbjct  393   NRYRHLRRQYNDITALLEHSGFSWDDTREMVTAEGFVWDSYIQAIPDAQSYRNKTVPNYH  452

Query  807   DMSIICGNETPT  772
              + +I G E+  
Sbjct  453   KLCVIYGQESSN  464


 Score =   111 bits (277),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   + +S+E  R +WT  MD YF EL+LDQ+ KGN+ + +F++QAW  M++LF+ K+ 
Sbjct  164   GMGSVAPASNEHSRRDWTPAMDQYFTELMLDQLGKGNKITNTFNEQAWTVMLSLFNSKFC  223

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +H    LK RYK L K Y + K +LEQN F+WDD +QM+  +D+ WD+YIK     Q +
Sbjct  224   TQHGKRFLKRRYKKLEKYYSDIKTLLEQNGFLWDDRQQMIAADDDVWDNYIKAHPHAQAY  283


 Score =   158 bits (399),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 118/188 (63%), Gaps = 6/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI------LEDKIPT  1171
             AHP+ + Y+ K V  +N+L +I+ +T ADGRYS S  DIDF+++ +       +    P 
Sbjct  112   AHPDAQCYKNKAVMNFNDLCLIYAYTTADGRYSRSSHDIDFDDDFQGVTIAYGMGSVAPA  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + DW+  M+Q+F +LML+Q+ +GNK+  TF  +AW  M++ FN+ F  Q+GK  L
Sbjct  172   SNEHSRRDWTPAMDQYFTELMLDQLGKGNKITNTFNEQAWTVMLSLFNSKFCTQHGKRFL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L + Y  +K LL Q+GF+W +R QMI A+D VW   IKA  + + YR K L  +
Sbjct  232   KRRYKKLEKYYSDIKTLLEQNGFLWDDRQQMIAADDDVWDNYIKAHPHAQAYRKKILLNF  291

Query  810   KDMSIICG  787
             +D+S++ G
Sbjct  292   QDLSLLYG  299


 Score =   127 bits (318),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 104/188 (55%), Gaps = 5/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG-RYSLSC-FDIDFENEVKILED---KIPTK  1168
             A P+ + YR K VP Y++L +I+G   ++G   SL+C  DID  + V ++E    +    
Sbjct  436   AIPDAQSYRNKTVPNYHKLCVIYGQESSNGGDNSLACNGDIDGVDPVWMIEGTDIQCNAN  495

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D  + DW   M+++ I LMLEQV++GN+   TF  +AW  M+  FN  F  Q+ K VLK
Sbjct  496   SDHSRTDWIPPMDRYLIDLMLEQVRKGNRKVHTFNKQAWADMVALFNERFRTQHEKSVLK  555

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R   LR+QY  +K LL   GF W E  QM+ A D VW   +K     + YR K    Y 
Sbjct  556   SRHKSLRKQYHHIKNLLDHRGFSWDEMRQMVTAYDAVWAAYLKEHPDAKSYRAKPKPNYN  615

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  616   DLCLIYGS  623


 Score =   107 bits (267),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT +MD YFI+L+L+ +QKG+     F+KQAW +M A F+ ++   HD DVLK+R+K
Sbjct  653   RTDWTPLMDRYFIDLMLEHVQKGSMVDHKFNKQAWSDMAARFNAEFGSYHDKDVLKSRFK  712

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H RK ++  + +LEQN F WD+ RQMVT  +E WD YIK
Sbjct  713   HWRKLFNGMRTLLEQNGFAWDERRQMVTAANELWDSYIK  751


 Score = 38.9 bits (89),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 46/85 (54%), Gaps = 7/85 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILE--DKIPTKD  1165
             +P+   YRT+ +P YN+L +I+G+ +     + S F ID  ++   V I E  D+     
Sbjct  753   NPDARSYRTRSLPNYNDLFLIYGNAINKDTQNQSSFCIDDNDDDLGVGIGEEDDQFLASS  812

Query  1164  DAKKIDWSETM--EQHFIQLMLEQV  1096
             D+  +DW   M  + H ++L ++++
Sbjct  813   DSLDVDWMIPMDIDPHALELDMDEM  837


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W++TME++FI LML+QV  GN++  TF  +AW  M   FN  FG QY K VLK+
Sbjct  10    DRSRTHWTQTMERYFIDLMLDQVHRGNRMGHTFNKQAWADMHAMFNGKFGSQYEKDVLKS  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+ +L +Q+  +K LL Q GF W +  +M+VA+D VW   IKA    + Y+NK++  + D
Sbjct  70    RYTVLWKQFNDMKNLLDQSGFSWDDTRKMVVADDCVWDAYIKAHPDAQCYKNKAVMNFND  129

Query  804   MSIICGNETPTFQYG  760
             + +I    T   +Y 
Sbjct  130   LCLIYAYTTADGRYS  144


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD YFI+LLLDQ+ +GN+    F  QAW+EM+ LF+ K+   +D DVLKNRY+HLR
Sbjct  340   WTLPMDHYFIDLLLDQVLRGNKIGQGFITQAWIEMVTLFNMKFGSHYDKDVLKNRYRHLR  399

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             +QY++ T +LE + F WDD+R+MVT     WD YI+     Q + N  K + +Y
Sbjct  400   RQYNDITALLEHSGFSWDDTREMVTAEGFVWDSYIQAIPDAQSYRN--KTVPNY  451


 Score =   107 bits (267),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   +  +S+  R++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M A+F+ K+  
Sbjct  1     MASQALVNSDRSRTHWTQTMERYFIDLMLDQVHRGNRMGHTFNKQAWADMHAMFNGKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             +++ DVLK+RY  L KQ+++ K +L+Q+ F WDD+R+MV  +D  WD YIK     Q + 
Sbjct  61    QYEKDVLKSRYTVLWKQFNDMKNLLDQSGFSWDDTRKMVVADDCVWDAYIKAHPDAQCYK  120

Query  1387  N  1385
             N
Sbjct  121   N  121



>ref|XP_007136933.1| hypothetical protein PHAVU_009G086300g [Phaseolus vulgaris]
 gb|ESW08927.1| hypothetical protein PHAVU_009G086300g [Phaseolus vulgaris]
Length=821

 Score =   152 bits (383),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 119/190 (63%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-------DKIP  1174
             +HP+   YRTK V  +++L  I+GHTVADGRYSLS  D+  +++++ L          IP
Sbjct  117   SHPDARCYRTKPVLNFDDLCAIYGHTVADGRYSLSSNDVRLDDKLQELHLADGTGAIAIP  176

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + +   + DW+ +M+Q FI+LM++Q+  GN+++  F  KAW  M+  FN  FG Q+G+ V
Sbjct  177   SSE-RTRTDWTASMDQFFIELMVDQLGRGNQVDNGFNKKAWTDMLAIFNAKFGCQHGRRV  235

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF  L + Y  +  L+ Q GF W+E+ QM++A+D  W   +KA  + R YR+K+L  
Sbjct  236   LKNRFKKLLKYYRDITNLVKQ-GFSWNEQQQMLLADDDFWGAYVKAHPHARIYRSKTLPN  294

Query  813   YKDMSIICGN  784
             Y+D+ +I  N
Sbjct  295   YRDLELIFRN  304


 Score = 95.5 bits (236),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 74/110 (67%), Gaps = 4/110 (4%)
 Frame = -1

Query  1732  SCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKH  1559
             SC S+ T RS   WT +M+ YFI+L+L+ +Q+GNR   +F+KQAW +M+  F+  +  + 
Sbjct  7     SCLSNGTERSRMQWTPLMERYFIDLMLEHLQRGNRIGHTFNKQAWTDMLTSFNANFGSQF  66

Query  1558  DTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDE-KWDDYIK  1415
             D DVLK RY +L KQ+++ K +L +  F WD +RQMV  +D+  WD Y+K
Sbjct  67    DKDVLKTRYANLWKQFNDVKSLLSEFGFSWDAARQMVVADDDSAWDIYLK  116


 Score =   125 bits (313),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 105/191 (55%), Gaps = 8/191 (4%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV-------KILEDK  1180
             V AHP    YR+K +P Y +L +IF   V++   S    + + E+ +       +   ++
Sbjct  278   VKAHPHARIYRSKTLPNYRDLELIF-RNVSENEISNLQLEKNHEDVISKRTKAGEAKGNR  336

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
              P   D  +  W+  M++  I L+LEQV++GN+L +TF ++AW  MIT+FN  F  QY K
Sbjct  337   NPNGTDRTRTYWTPLMDRCLINLLLEQVKDGNRLGQTFISQAWNDMITSFNERFNSQYDK  396

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
              VLK R+  LR+Q+  V +LL   GF W +  +MI AED VW    KA    R  R K+L
Sbjct  397   DVLKNRYKHLRKQFNDVNHLLQHGGFSWDDTREMIDAEDHVWDSYTKAHPEARSLRVKTL  456

Query  819   SFYKDMSIICG  787
               Y ++ II G
Sbjct  457   PDYGNLRIIFG  467


 Score =   102 bits (254),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  SSE  R++WT  MD +FIEL++DQ+ +GN+    F+K+AW +M+A+F+ K+ C+H  
Sbjct  174   AIPSSERTRTDWTASMDQFFIELMVDQLGRGNQVDNGFNKKAWTDMLAIFNAKFGCQHGR  233

Query  1552  DVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              VLKNR+K L K Y +   L +  F W++ +QM+  +D+ W  Y+K 
Sbjct  234   RVLKNRFKKLLKYYRDITNLVKQGFSWNEQQQMLLADDDFWGAYVKA  280


 Score =   116 bits (290),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 107/393 (27%), Positives = 163/393 (41%), Gaps = 95/393 (24%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE    R K +P Y  LRIIFG   A G      F                    +  
Sbjct  444   AHPEARSLRVKTLPDYGNLRIIFG---AKGEQKNDVF--------------------SNV  480

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
              D   TME+ F+ LM EQV  GN++   F  +AW+ +  AFN  +G Q  K V+  ++  
Sbjct  481   YDAGSTMERRFVDLMTEQVNNGNRIENLFNEEAWMRVAQAFNARWGLQSDKKVIMDQYLC  540

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L +++  +  +LS + F W+E  Q I+AED VW   IK       Y+NK L F+ D+  I
Sbjct  541   LMKKHDDICNILSHNEFAWNETLQTIIAEDDVWDAYIKDHPDAISYKNKCLYFFHDLCKI  600

Query  792   CGNETPTFQYGYPFVKAGEFCVPI---------------------------IQTTGKEGN  694
              GN+    +     ++  +F + +                             T G  GN
Sbjct  601   FGNKVSDLEQ-LQLIEENDFTIEVGMDETSENLVNISDIDISEQDMGRGRENDTDGSFGN  659

Query  693   LreveeivedddereEKK----------CRYDTKEPKE------------------PC--  604
             L        D+   E                DT+ P+E                  PC  
Sbjct  660   LVVSGSNEVDNVADETNGNLDVTSNNEVSNQDTERPRETDKDITGYAQILFGDKQNPCQK  719

Query  603   ------KGPSEINEETEI---EIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYIL  451
                   K P  ++ ++ +   ++ M++A+ EM +AV AL  + +KKK +    ED + +L
Sbjct  720   RTHHVRKRPGTMSRDSTLPKKKLRMKEALSEMASAVKALINKREKKKSS---FEDALSVL  776

Query  450   QAMPEMdddddllldacdfledDNKAKVFLALD  352
             QAMP++D++  +        E   KAK+FLALD
Sbjct  777   QAMPDIDEELVMDASDLLEDET--KAKIFLALD  807


 Score =   101 bits (252),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + ++  R+ WT +MD   I LLL+Q++ GNR   +F  QAW +MI  F+ ++  ++D DV
Sbjct  339   NGTDRTRTYWTPLMDRCLINLLLEQVKDGNRLGQTFISQAWNDMITSFNERFNSQYDKDV  398

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LKNRYKHLRKQ+++   +L+   F WDD+R+M+   D  WD Y K 
Sbjct  399   LKNRYKHLRKQFNDVNHLLQHGGFSWDDTREMIDAEDHVWDSYTKA  444


 Score =   107 bits (266),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 79/133 (59%), Gaps = 1/133 (1%)
 Frame = -2

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             ++ W+  ME++FI LMLE +Q GN++  TF  +AW  M+T+FN  FG Q+ K VLKTR+ 
Sbjct  17    RMQWTPLMERYFIDLMLEHLQRGNRIGHTFNKQAWTDMLTSFNANFGSQFDKDVLKTRYA  76

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVA-EDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
              L +Q+  VK LLS+ GF W    QM+VA +D  W   +K+    R YR K +  + D+ 
Sbjct  77    NLWKQFNDVKSLLSEFGFSWDAARQMVVADDDSAWDIYLKSHPDARCYRTKPVLNFDDLC  136

Query  798   IICGNETPTFQYG  760
              I G+     +Y 
Sbjct  137   AIYGHTVADGRYS  149


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = -1

Query  1690  VMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQY  1511
              M+  F++L+ +Q+  GNR    F+++AW+ +   F+ ++  + D  V+ ++Y  L K++
Sbjct  486   TMERRFVDLMTEQVNNGNRIENLFNEEAWMRVAQAFNARWGLQSDKKVIMDQYLCLMKKH  545

Query  1510  HNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +   IL  NEF W+++ Q +   D+ WD YIK
Sbjct  546   DDICNILSHNEFAWNETLQTIIAEDDVWDAYIK  578



>ref|XP_006588878.1| PREDICTED: uncharacterized protein LOC100798302 isoform X2 [Glycine 
max]
 ref|XP_003537125.2| PREDICTED: uncharacterized protein LOC100798302 isoform X1 [Glycine 
max]
 ref|XP_006588879.1| PREDICTED: uncharacterized protein LOC100798302 isoform X3 [Glycine 
max]
Length=516

 Score =   208 bits (529),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 136/198 (69%), Gaps = 11/198 (6%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK--  1168
             C+ AHP+ +P++ +V+PYY++L II+GH VADGRYSLSCFD+DFE E K L+DK  T   
Sbjct  109   CIKAHPDAQPFKKRVIPYYDDLCIIYGHAVADGRYSLSCFDVDFEYEEKDLDDKTMTSKG  168

Query  1167  -DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
              DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  +FN  F 
Sbjct  169   VDDQTPPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFL  228

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               YG++VL+ RFN+LRR Y ++  LL ++GF+W +    +VA+++VW+K I+    FR Y
Sbjct  229   CHYGRIVLRNRFNVLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRVHHNFRLY  288

Query  834   RNKSLSFYKDMSIICGNE  781
             + KS+ FY  M I+C N+
Sbjct  289   KIKSMPFYSGMCIVCRND  306


 Score =   119 bits (298),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 83/129 (64%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DDS  S E LR+NWT   D YF+ELLL  + KGN+T   FS+QAW++MI  F+ K+  
Sbjct  1     MGDDSSPSLEKLRANWTPSQDRYFLELLLSHVHKGNKTGKVFSRQAWVDMIKQFNTKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D +VLKNR+K  RKQY++ K I+ Q  F WD ++ M+  +D+ WD+ IK     Q F 
Sbjct  61    KYDVEVLKNRHKRFRKQYNDMKMIVGQKGFQWDGTQNMIVADDKAWDECIKAHPDAQPFK  120

Query  1387  NHLKIIAHY  1361
                ++I +Y
Sbjct  121   K--RVIPYY  127


 Score =   109 bits (273),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 78/131 (60%), Gaps = 0/131 (0%)
 Frame = -2

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             + +W+ + +++F++L+L  V +GNK  + F  +AW+ MI  FNT FGF+Y   VLK R  
Sbjct  13    RANWTPSQDRYFLELLLSHVHKGNKTGKVFSRQAWVDMIKQFNTKFGFKYDVEVLKNRHK  72

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
               R+QY  +K ++ Q GF W     MIVA+D+ W + IKA    + ++ + + +Y D+ I
Sbjct  73    RFRKQYNDMKMIVGQKGFQWDGTQNMIVADDKAWDECIKAHPDAQPFKKRVIPYYDDLCI  132

Query  795   ICGNETPTFQY  763
             I G+     +Y
Sbjct  133   IYGHAVADGRY  143


 Score = 84.7 bits (208),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  182   RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRIVLRNRFN  241

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  +L   E FIWD ++  V  +++ W   I+V
Sbjct  242   VLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRV  281



>gb|KHG06400.1| hypothetical protein F383_09497 [Gossypium arboreum]
Length=945

 Score =   139 bits (349),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 113/192 (59%), Gaps = 5/192 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE----DKIPT-K  1168
               P+ + YR + +  +++L +I+ +T ADGRYS S  DIDF+++   +       +P   
Sbjct  105   GQPDAQVYRNRTLTNFSDLCLIYAYTQADGRYSRSSHDIDFDDDALGVNFGVGSSVPVVS  164

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D+   I+W+  M+Q+FI++MLE +++GNK   TF  +AW  M+ +FN  F FQ+ K  L+
Sbjct  165   DENPNIEWTPAMDQYFIEIMLENLRKGNKSKSTFSKQAWNDMLGSFNAKFCFQFSKSFLR  224

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  L +    V+ LL Q GF W ++ +MIVA+D VW   IKA      +RNK +  Y+
Sbjct  225   RRYRKLLKHCSDVQSLLLQKGFSWDDKQKMIVADDLVWDNYIKAHPDAHTFRNKKMLNYR  284

Query  807   DMSIICGNETPT  772
             D+ +I  N + +
Sbjct  285   DLRLIYENASNS  296


 Score =   107 bits (267),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 75/101 (74%), Gaps = 1/101 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M  ++ SSS+  R+NWT  M+ +FI+L+LDQ+ +GNR   +F+KQAW +M+++F+ K+ C
Sbjct  1     MGSNAPSSSDRTRTNWTPTMERFFIDLMLDQMHRGNRLGHTFNKQAWTDMLSIFNAKFGC  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTG  1445
             K+D D LK+ Y +L KQY++ K +LEQN F WDD+R++V  
Sbjct  61    KYDRDTLKSHYTNLWKQYNDVKNLLEQNGFSWDDTRKLVVA  101


 Score =   133 bits (334),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 109/182 (60%), Gaps = 6/182 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+++ YR K  P YN+L +I+G++  D +   S  D        IL++         + 
Sbjct  599   YPDVDSYRHKRKPNYNDLCLIYGNST-DRKDRRSGRDARCNGYGTILKNGY-----YGRT  652

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW  +M+++FI LMLE V++G+ +++ F   AW  M+  F+  FG+QY K VLK+RF  L
Sbjct  653   DWIPSMDRYFIDLMLEHVRQGSMIDKKFCKLAWGDMVAKFSAEFGYQYDKDVLKSRFMNL  712

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +KYLL  DGF W E+ QMI+A+D +W   +K     R YRN++L  Y D+ +I 
Sbjct  713   RKRFNDMKYLLDHDGFTWDEKRQMIIADDHLWAIYLKEHPDARSYRNRTLPSYNDLFLIY  772

Query  789   GN  784
             GN
Sbjct  773   GN  774


 Score = 78.2 bits (191),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +WT  M+ + I+LLL Q+ +GN  S +   + WL+M   F   +  + D + LK+ +K
Sbjct  499   RIDWTPSMERHLIDLLLKQVHRGNMMSGALDTEVWLDMSLSFMESFGLQPDEESLKDHHK  558

Query  1528  HLRKQYHNTKIL-EQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L KQY + +IL +Q  F WD++RQM+T  D+ W+ Y K
Sbjct  559   SLGKQYRDMRILIDQRVFSWDETRQMLTARDDVWEAYTK  597


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 63/192 (33%), Positives = 98/192 (51%), Gaps = 8/192 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK--  1156
             HP  + YR K+VP Y++L +IFG   ++G  SL+        +  ++  K    DD++  
Sbjct  433   HPNTQSYRLKIVPDYHKLCVIFGQESSNGMCSLAQRVYPENEDPDLMIGKYIVGDDSQFH  492

Query  1155  ------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
                   +IDW+ +ME+H I L+L+QV  GN ++     + W+ M  +F  +FG Q  +  
Sbjct  493   AGNGYSRIDWTPSMERHLIDLLLKQVHRGNMMSGALDTEVWLDMSLSFMESFGLQPDEES  552

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK     L +QY  ++ L+ Q  F W E  QM+ A D VW+   K       YR+K    
Sbjct  553   LKDHHKSLGKQYRDMRILIDQRVFSWDETRQMLTARDDVWEAYTKEYPDVDSYRHKRKPN  612

Query  813   YKDMSIICGNET  778
             Y D+ +I GN T
Sbjct  613   YNDLCLIYGNST  624


 Score = 89.7 bits (221),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 77/123 (63%), Gaps = 8/123 (7%)
 Frame = -1

Query  1759  KNRGAMEDDSCSSSETL-------RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWL  1601
             K+R +  D  C+   T+       R++W   MD YFI+L+L+ +++G+     F K AW 
Sbjct  627   KDRRSGRDARCNGYGTILKNGYYGRTDWIPSMDRYFIDLMLEHVRQGSMIDKKFCKLAWG  686

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDD  1424
             +M+A FS ++  ++D DVLK+R+ +LRK++++ K +L+ + F WD+ RQM+  +D  W  
Sbjct  687   DMVAKFSAEFGYQYDKDVLKSRFMNLRKRFNDMKYLLDHDGFTWDEKRQMIIADDHLWAI  746

Query  1423  YIK  1415
             Y+K
Sbjct  747   YLK  749


 Score = 35.4 bits (80),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 17/60 (28%), Positives = 31/60 (52%), Gaps = 6/60 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+   YR + +P YN+L +I+G+   +G      ++++ EN     ED+ P      +I
Sbjct  751   HPDARSYRNRTLPSYNDLFLIYGNANING------WNLEAENSSGEEEDESPFSSSPTRI  804


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 96/197 (49%), Gaps = 18/197 (9%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIF------------GHTVADGRYSLSCFDIDFENEVKIL  1189
             AHP+   +R K +  Y +LR+I+             H    G  +L  +  + EN   +L
Sbjct  268   AHPDAHTFRNKKMLNYRDLRLIYENASNSVVSSHMRHERYTGPKTLPVWTGE-ENRGHLL  326

Query  1188  EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
             +     +D+     W+  M +H I L+L Q   GNK+   F  +AW  ++  FN  FG  
Sbjct  327   D-----RDEMLGPHWTPAMNRHLIDLLLNQALGGNKIGHAFVPEAWNKIVAMFNVKFGCH  381

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             Y +  LK++   LRRQY  +K LL Q+GF W ++ + ++A D VW   +K     + YR 
Sbjct  382   YDEEALKSQARNLRRQYNNIKILLEQNGFSWDDKREKVIAADHVWDAYMKEHPNTQSYRL  441

Query  828   KSLSFYKDMSIICGNET  778
             K +  Y  + +I G E+
Sbjct  442   KIVPDYHKLCVIFGQES  458


 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 81/134 (60%), Gaps = 7/134 (5%)
 Frame = -1

Query  1759  KNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFS  1580
             +NRG + D      E L  +WT  M+ + I+LLL+Q   GN+   +F  +AW +++A+F+
Sbjct  320   ENRGHLLD----RDEMLGPHWTPAMNRHLIDLLLNQALGGNKIGHAFVPEAWNKIVAMFN  375

Query  1579  HKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMF  1403
              K+ C +D + LK++ ++LR+QY+N KI LEQN F WDD R+ V   D  WD Y+K    
Sbjct  376   VKFGCHYDEEALKSQARNLRRQYNNIKILLEQNGFSWDDKREKVIAADHVWDAYMKEHPN  435

Query  1402  DQKFSNHLKIIAHY  1361
              Q +   LKI+  Y
Sbjct  436   TQSY--RLKIVPDY  447


 Score = 98.2 bits (243),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 75/128 (59%), Gaps = 7/128 (5%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P+  D  + +W+ TME+ FI LML+Q+  GN+L  TF  +AW  M++ FN  FG +Y + 
Sbjct  6     PSSSDRTRTNWTPTMERFFIDLMLDQMHRGNRLGHTFNKQAWTDMLSIFNAKFGCKYDRD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK+ +  L +QY  VK LL Q+GF W +  +++VA           Q   + YRN++L+
Sbjct  66    TLKSHYTNLWKQYNDVKNLLEQNGFSWDDTRKLVVAPPH-------GQPDAQVYRNRTLT  118

Query  816   FYKDMSII  793
              + D+ +I
Sbjct  119   NFSDLCLI  126


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 69/125 (55%), Gaps = 1/125 (1%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G        S E     WT  MD YFIE++L+ ++KGN++ ++FSKQAW +M+  F+ 
Sbjct  153   NFGVGSSVPVVSDENPNIEWTPAMDQYFIEIMLENLRKGNKSKSTFSKQAWNDMLGSFNA  212

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             K+  +     L+ RY+ L K   + + +L Q  F WDD ++M+  +D  WD+YIK     
Sbjct  213   KFCFQFSKSFLRRRYRKLLKHCSDVQSLLLQKGFSWDDKQKMIVADDLVWDNYIKAHPDA  272

Query  1399  QKFSN  1385
               F N
Sbjct  273   HTFRN  277



>ref|XP_010243132.1| PREDICTED: uncharacterized protein LOC104587285 isoform X3 [Nelumbo 
nucifera]
Length=699

 Score =   142 bits (358),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 110/218 (50%), Gaps = 33/218 (15%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE------VKILED----  1183
             AHPE + YRTK V  YN+L +I+G    DG    S  +I   +       V + ED    
Sbjct  210   AHPEAQSYRTKTVLNYNDLCVIYGKEATDGTNDSSGHNIKAADNISGMEIVALSEDPQPL  269

Query  1182  -----------------------KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNR  1072
                                    ++PT  +  + +W+ TM+++FI +M+EQV +G+K   
Sbjct  270   ALSAGHEDLCLVRCPEKIEGTDIQVPTSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGN  329

Query  1071  TFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIV  892
              F+ +AW  M+ +FN  FG    K VLK R   LR QY A+K LL   GF W E  QM+ 
Sbjct  330   IFRKRAWEEMVASFNAKFGLNLDKEVLKNRHKKLRLQYNAMKILLGHGGFHWDETRQMVT  389

Query  891   AEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             A++ VW   +KA    R YR K++  YKDM +I  NET
Sbjct  390   ADNNVWDDHLKAYPEARSYRTKTVPNYKDMCVIYRNET  427


 Score =   103 bits (258),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              ME+ +  + +  R+ WT VMD YFI+++++++ KGN+   +F K+AW +M++LF+ K+ 
Sbjct  98    GMENQATPNGDRPRTKWTSVMDRYFIDIMIEEVHKGNKIRNTFRKKAWEDMVSLFNTKFG  157

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              + D ++L+NR K LR + +  K +L  N F WDDSR+MV  +D  WD+Y+K     Q +
Sbjct  158   LQLDKEILRNRSKKLRLKCNAVKTLLAHNGFHWDDSRKMVKADDHVWDEYLKAHPEAQSY  217


 Score =   118 bits (295),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 96/169 (57%), Gaps = 7/169 (4%)
 Frame = -2

Query  1266  FGHT------VADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLML  1105
             FG T      VA GR+     +  +  E + +E++     D  +  W+  M+++FI +M+
Sbjct  69    FGRTHNPRFKVAIGRFKALNLEA-WTPETEGMENQATPNGDRPRTKWTSVMDRYFIDIMI  127

Query  1104  EQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDG  925
             E+V +GNK+  TF+ KAW  M++ FNT FG Q  K +L+ R   LR +  AVK LL+ +G
Sbjct  128   EEVHKGNKIRNTFRKKAWEDMVSLFNTKFGLQLDKEILRNRSKKLRLKCNAVKTLLAHNG  187

Query  924   FMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             F W +  +M+ A+D VW + +KA    + YR K++  Y D+ +I G E 
Sbjct  188   FHWDDSRKMVKADDHVWDEYLKAHPEAQSYRTKTVLNYNDLCVIYGKEA  236


 Score =   107 bits (268),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 3/123 (2%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +SSE  R+NWT  MD YFI+++++Q+ KG++    F K+AW EM+A F+ K+    D +V
Sbjct  296   TSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNIFRKRAWEEMVASFNAKFGLNLDKEV  355

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKII  1370
             LKNR+K LR QY+  KI L    F WD++RQMVT ++  WDD++K   + +  S   K +
Sbjct  356   LKNRHKKLRLQYNAMKILLGHGGFHWDETRQMVTADNNVWDDHLKA--YPEARSYRTKTV  413

Query  1369  AHY  1361
              +Y
Sbjct  414   PNY  416



>ref|XP_010417250.1| PREDICTED: uncharacterized protein LOC104703022 isoform X1 [Camelina 
sativa]
Length=797

 Score =   146 bits (369),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 110/186 (59%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPT  1171
             AHPE   Y+TK V  Y++L +I+G+TVADGRYS S  D + E+EV  +         + +
Sbjct  112   AHPEARVYKTKPVLNYSDLCLIYGYTVADGRYSRSSHDFELEDEVNGVNIGESSGSVVVS  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               ++ K +W+  M+Q+FI++ML+Q+  GNK    F  +AW  M+  FN  F  QYGK VL
Sbjct  172   SKESSKTEWTPVMDQYFIEIMLDQIGRGNKNGNAFSKQAWTDMLALFNARFSGQYGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+N L + Y  ++ +L +DGF W E   MI A+D VW   IK     + YR KSL  Y
Sbjct  232   RHRYNKLLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIKEHPLAKTYRMKSLPSY  291

Query  810   KDMSII  793
             KD+  I
Sbjct  292   KDLDTI  297


 Score = 99.8 bits (247),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     + ++  R  WT  M+ +FI+L+L+ + +GNRT  +F+KQAW EM+ +F+ K+  
Sbjct  1     MSGVQVTCNDRTRMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGIFNSKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             ++D DVLK+RY +L KQY++ K +L+   F+WD + Q VTG++  W  Y+K  
Sbjct  61    QYDKDVLKSRYTNLWKQYNDVKSLLDHGGFVWDQTHQTVTGDESLWSLYLKAH  113


 Score =   124 bits (310),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (51%), Gaps = 5/194 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YR K +P Y +L  IF  +   G         D  ++    +         +  
Sbjct  277   HPLAKTYRMKSLPSYKDLDTIFACSAEQGIIPHLVQGKDHRDDGSAAQTSGTKASQVQHS  336

Query  1149  D-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D     W+  M+ + I L++EQV  GN++ +TF   AW  M+TAFN  FG Q+ K VLK 
Sbjct  337   DRTRTFWTPPMDYYLIDLLVEQVNNGNRVGQTFIASAWNEMVTAFNAKFGSQHSKDVLKN  396

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LRR Y  +K+LL Q+GF W  R  M++A+D +W   I+A    R YR K++  Y +
Sbjct  397   RYKHLRRLYNDIKFLLEQNGFSWDTRRDMVIADDGIWNTYIQAHPEARSYRVKTIPSYPN  456

Query  804   MSIICGNETPTFQY  763
             +  I G E    +Y
Sbjct  457   LCFIFGKEMSDGRY  470


 Score =   100 bits (250),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             + WT VMD YFIE++LDQI +GN+   +FSKQAW +M+ALF+ ++  ++   VL++RY  
Sbjct  178   TEWTPVMDQYFIEIMLDQIGRGNKNGNAFSKQAWTDMLALFNARFSGQYGKRVLRHRYNK  237

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L K Y + + IL+++ F WD++R M+  +D  WD YIK
Sbjct  238   LLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIK  275


 Score =   109 bits (273),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (59%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T +D  ++ W+ TME+ FI LMLE +  GN+   TF  +AW  M+  FN+ FG QY K V
Sbjct  7     TCNDRTRMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGIFNSKFGSQYDKDV  66

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY  VK LL   GF+W + HQ +  ++ +W   +KA    R Y+ K +  
Sbjct  67    LKSRYTNLWKQYNDVKSLLDHGGFVWDQTHQTVTGDESLWSLYLKAHPEARVYKTKPVLN  126

Query  813   YKDMSIICG  787
             Y D+ +I G
Sbjct  127   YSDLCLIYG  135


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 62/189 (33%), Positives = 87/189 (46%), Gaps = 30/189 (16%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILE---------  1186
             AHPE   YR K +P Y  L  IFG  ++DGRY+     FD        ++E         
Sbjct  439   AHPEARSYRVKTIPSYPNLCFIFGKEMSDGRYTRLAQAFDPSPAETALLIENGSTDGFKD  498

Query  1185  -------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFK  1063
                                D + +      I+W++ M+   I LM+EQV  GNK+  TF 
Sbjct  499   TLGETHSFQMVVYTSNEKNDYLCSNTGPPCIEWTQVMDHCLIDLMIEQVNRGNKIGETFT  558

Query  1062  NKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAED  883
              +AW  M  +FN  FG Q    +L+ R+ L+ ++   +  +L+ DGF W E  Q IVAED
Sbjct  559   EQAWADMAESFNAKFGLQTDMFMLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAED  618

Query  882   RVWKKVIKA  856
               WK  IK 
Sbjct  619   EYWKAYIKC  627


 Score =   107 bits (268),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 83/158 (53%), Gaps = 3/158 (2%)
 Frame = -1

Query  1813  GLIPRLPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNR  1634
             G+IP L          +       +      S+  R+ WT  MD Y I+LL++Q+  GNR
Sbjct  305   GIIPHLVQGKDHRDDGSAAQTSGTKASQVQHSDRTRTFWTPPMDYYLIDLLVEQVNNGNR  364

Query  1633  TSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQ  1457
                +F   AW EM+  F+ K+  +H  DVLKNRYKHLR+ Y++ K +LEQN F WD  R 
Sbjct  365   VGQTFIASAWNEMVTAFNAKFGSQHSKDVLKNRYKHLRRLYNDIKFLLEQNGFSWDTRRD  424

Query  1456  MVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILVSFV  1343
             MV  +D  W+ YI  Q   +  S  +K I  Y  + F+
Sbjct  425   MVIADDGIWNTYI--QAHPEARSYRVKTIPSYPNLCFI  460


 Score = 78.6 bits (192),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             CS++      WT VMD   I+L+++Q+ +GN+   +F++QAW +M   F+ K+  + D  
Sbjct  521   CSNTGPPCIEWTQVMDHCLIDLMIEQVNRGNKIGETFTEQAWADMAESFNAKFGLQTDMF  580

Query  1549  VLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +L+NRY  + K+  +   IL  + F WD+ +Q +   DE W  YIK
Sbjct  581   MLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAEDEYWKAYIK  626



>ref|XP_010417251.1| PREDICTED: uncharacterized protein LOC104703022 isoform X2 [Camelina 
sativa]
Length=792

 Score =   146 bits (369),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 110/186 (59%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE------DKIPT  1171
             AHPE   Y+TK V  Y++L +I+G+TVADGRYS S  D + E+EV  +         + +
Sbjct  112   AHPEARVYKTKPVLNYSDLCLIYGYTVADGRYSRSSHDFELEDEVNGVNIGESSGSVVVS  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               ++ K +W+  M+Q+FI++ML+Q+  GNK    F  +AW  M+  FN  F  QYGK VL
Sbjct  172   SKESSKTEWTPVMDQYFIEIMLDQIGRGNKNGNAFSKQAWTDMLALFNARFSGQYGKRVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+N L + Y  ++ +L +DGF W E   MI A+D VW   IK     + YR KSL  Y
Sbjct  232   RHRYNKLLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIKEHPLAKTYRMKSLPSY  291

Query  810   KDMSII  793
             KD+  I
Sbjct  292   KDLDTI  297


 Score = 99.8 bits (247),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M     + ++  R  WT  M+ +FI+L+L+ + +GNRT  +F+KQAW EM+ +F+ K+  
Sbjct  1     MSGVQVTCNDRTRMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGIFNSKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             ++D DVLK+RY +L KQY++ K +L+   F+WD + Q VTG++  W  Y+K  
Sbjct  61    QYDKDVLKSRYTNLWKQYNDVKSLLDHGGFVWDQTHQTVTGDESLWSLYLKAH  113


 Score =   124 bits (310),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 98/194 (51%), Gaps = 5/194 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YR K +P Y +L  IF  +   G         D  ++    +         +  
Sbjct  277   HPLAKTYRMKSLPSYKDLDTIFACSAEQGIIPHLVQGKDHRDDGSAAQTSGTKASQVQHS  336

Query  1149  D-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D     W+  M+ + I L++EQV  GN++ +TF   AW  M+TAFN  FG Q+ K VLK 
Sbjct  337   DRTRTFWTPPMDYYLIDLLVEQVNNGNRVGQTFIASAWNEMVTAFNAKFGSQHSKDVLKN  396

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LRR Y  +K+LL Q+GF W  R  M++A+D +W   I+A    R YR K++  Y +
Sbjct  397   RYKHLRRLYNDIKFLLEQNGFSWDTRRDMVIADDGIWNTYIQAHPEARSYRVKTIPSYPN  456

Query  804   MSIICGNETPTFQY  763
             +  I G E    +Y
Sbjct  457   LCFIFGKEMSDGRY  470


 Score =   100 bits (250),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             + WT VMD YFIE++LDQI +GN+   +FSKQAW +M+ALF+ ++  ++   VL++RY  
Sbjct  178   TEWTPVMDQYFIEIMLDQIGRGNKNGNAFSKQAWTDMLALFNARFSGQYGKRVLRHRYNK  237

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L K Y + + IL+++ F WD++R M+  +D  WD YIK
Sbjct  238   LLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIK  275


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/210 (32%), Positives = 95/210 (45%), Gaps = 30/210 (14%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILE---------  1186
             AHPE   YR K +P Y  L  IFG  ++DGRY+     FD        ++E         
Sbjct  439   AHPEARSYRVKTIPSYPNLCFIFGKEMSDGRYTRLAQAFDPSPAETALLIENGSTDGFKD  498

Query  1185  -------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFK  1063
                                D + +      I+W++ M+   I LM+EQV  GNK+  TF 
Sbjct  499   TLGETHSFQMVVYTSNEKNDYLCSNTGPPCIEWTQVMDHCLIDLMIEQVNRGNKIGETFT  558

Query  1062  NKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAED  883
              +AW  M  +FN  FG Q    +L+ R+ L+ ++   +  +L+ DGF W E  Q IVAED
Sbjct  559   EQAWADMAESFNAKFGLQTDMFMLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAED  618

Query  882   RVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
               WK  IK       Y+ K L  Y ++  I
Sbjct  619   EYWKAYIKDHPDATIYKGKILDSYGNLCKI  648


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 76/129 (59%), Gaps = 0/129 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T +D  ++ W+ TME+ FI LMLE +  GN+   TF  +AW  M+  FN+ FG QY K V
Sbjct  7     TCNDRTRMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGIFNSKFGSQYDKDV  66

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +QY  VK LL   GF+W + HQ +  ++ +W   +KA    R Y+ K +  
Sbjct  67    LKSRYTNLWKQYNDVKSLLDHGGFVWDQTHQTVTGDESLWSLYLKAHPEARVYKTKPVLN  126

Query  813   YKDMSIICG  787
             Y D+ +I G
Sbjct  127   YSDLCLIYG  135


 Score =   107 bits (268),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 83/158 (53%), Gaps = 3/158 (2%)
 Frame = -1

Query  1813  GLIPRLPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNR  1634
             G+IP L          +       +      S+  R+ WT  MD Y I+LL++Q+  GNR
Sbjct  305   GIIPHLVQGKDHRDDGSAAQTSGTKASQVQHSDRTRTFWTPPMDYYLIDLLVEQVNNGNR  364

Query  1633  TSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQ  1457
                +F   AW EM+  F+ K+  +H  DVLKNRYKHLR+ Y++ K +LEQN F WD  R 
Sbjct  365   VGQTFIASAWNEMVTAFNAKFGSQHSKDVLKNRYKHLRRLYNDIKFLLEQNGFSWDTRRD  424

Query  1456  MVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILVSFV  1343
             MV  +D  W+ YI  Q   +  S  +K I  Y  + F+
Sbjct  425   MVIADDGIWNTYI--QAHPEARSYRVKTIPSYPNLCFI  460


 Score = 78.6 bits (192),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             CS++      WT VMD   I+L+++Q+ +GN+   +F++QAW +M   F+ K+  + D  
Sbjct  521   CSNTGPPCIEWTQVMDHCLIDLMIEQVNRGNKIGETFTEQAWADMAESFNAKFGLQTDMF  580

Query  1549  VLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +L+NRY  + K+  +   IL  + F WD+ +Q +   DE W  YIK
Sbjct  581   MLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAEDEYWKAYIK  626



>ref|XP_010243130.1| PREDICTED: uncharacterized protein LOC104587285 isoform X1 [Nelumbo 
nucifera]
Length=779

 Score =   141 bits (356),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 78/218 (36%), Positives = 110/218 (50%), Gaps = 33/218 (15%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE------VKILED----  1183
             AHPE + YRTK V  YN+L +I+G    DG    S  +I   +       V + ED    
Sbjct  210   AHPEAQSYRTKTVLNYNDLCVIYGKEATDGTNDSSGHNIKAADNISGMEIVALSEDPQPL  269

Query  1182  -----------------------KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNR  1072
                                    ++PT  +  + +W+ TM+++FI +M+EQV +G+K   
Sbjct  270   ALSAGHEDLCLVRCPEKIEGTDIQVPTSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGN  329

Query  1071  TFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIV  892
              F+ +AW  M+ +FN  FG    K VLK R   LR QY A+K LL   GF W E  QM+ 
Sbjct  330   IFRKRAWEEMVASFNAKFGLNLDKEVLKNRHKKLRLQYNAMKILLGHGGFHWDETRQMVT  389

Query  891   AEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             A++ VW   +KA    R YR K++  YKDM +I  NET
Sbjct  390   ADNNVWDDHLKAYPEARSYRTKTVPNYKDMCVIYRNET  427


 Score =   103 bits (257),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              ME+ +  + +  R+ WT VMD YFI+++++++ KGN+   +F K+AW +M++LF+ K+ 
Sbjct  98    GMENQATPNGDRPRTKWTSVMDRYFIDIMIEEVHKGNKIRNTFRKKAWEDMVSLFNTKFG  157

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              + D ++L+NR K LR + +  K +L  N F WDDSR+MV  +D  WD+Y+K     Q +
Sbjct  158   LQLDKEILRNRSKKLRLKCNAVKTLLAHNGFHWDDSRKMVKADDHVWDEYLKAHPEAQSY  217


 Score =   122 bits (307),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 111/375 (30%), Positives = 175/375 (47%), Gaps = 58/375 (15%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE----------------  1201
             A+PE   YRTK VP Y ++ +I+ +  A   Y+ S  D++                    
Sbjct  401   AYPEARSYRTKTVPNYKDMCVIYRNETA---YNGSADDVNLAGNTPKTKITGVSGASQSL  457

Query  1200  -----------------VKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNR  1072
                              V+ ++++ P   D  K  W+  M+++F+ +MLEQV    K+  
Sbjct  458   SVSAVPGDPGVLRSSQFVEGMDNQDPPNIDHSKT-WTPPMDRYFMDIMLEQVNNRFKVGN  516

Query  1071  TFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIV  892
              F  +AW +M+  FN+ FG +  K  L+ +   LR QY A+K LL  +GF W E  QM+ 
Sbjct  517   AFCKEAWTNMLALFNSKFGLELDKEALRNQHRKLRMQYNAMKTLLDNNGFYWDETRQMVA  576

Query  891   AEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYG----------YPFVKA  742
             A D +W   +K     R YR K++  Y D+ +I GN     +Y            P VK 
Sbjct  577   AADNIWDDYLKVHPEARLYRAKAMPNYNDLCVIYGNPIVDGRYSCSGHDVVLEDTPEVKI  636

Query  741   GEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGPSEINEETE---  571
              E   P   T+   G+        ++             ++ K P   PS      +   
Sbjct  637   -EVEGPHSPTSAAHGD---PIIATQESSSHSAGDVDTSNQQSKRPFAAPSTFEHSRKRLR  692

Query  570   -IEIGMEDAMQEMVAAVTALTkeekkkkKNS-LLIEDVIYILQAMPEMdddddllldacd  397
              I+  M +A+++M  AVT+L  ++K+ +  +   +E V+  LQA+P++  D+DL LDACD
Sbjct  693   TIDECMVEALRQMALAVTSLANKKKENENETPATLEKVVNALQAIPDI--DEDLFLDACD  750

Query  396   fledDNKAKVFLALD  352
              LED+ KAK+FLALD
Sbjct  751   LLEDEQKAKMFLALD  765


 Score =   117 bits (293),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/169 (36%), Positives = 96/169 (57%), Gaps = 7/169 (4%)
 Frame = -2

Query  1266  FGHT------VADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLML  1105
             FG T      VA GR+     +  +  E + +E++     D  +  W+  M+++FI +M+
Sbjct  69    FGRTHNPRFKVAIGRFKALNLEA-WTPETEGMENQATPNGDRPRTKWTSVMDRYFIDIMI  127

Query  1104  EQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDG  925
             E+V +GNK+  TF+ KAW  M++ FNT FG Q  K +L+ R   LR +  AVK LL+ +G
Sbjct  128   EEVHKGNKIRNTFRKKAWEDMVSLFNTKFGLQLDKEILRNRSKKLRLKCNAVKTLLAHNG  187

Query  924   FMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             F W +  +M+ A+D VW + +KA    + YR K++  Y D+ +I G E 
Sbjct  188   FHWDDSRKMVKADDHVWDEYLKAHPEAQSYRTKTVLNYNDLCVIYGKEA  236


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 3/123 (2%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +SSE  R+NWT  MD YFI+++++Q+ KG++    F K+AW EM+A F+ K+    D +V
Sbjct  296   TSSERSRTNWTPTMDRYFIDIMIEQVHKGHKNGNIFRKRAWEEMVASFNAKFGLNLDKEV  355

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKII  1370
             LKNR+K LR QY+  KI L    F WD++RQMVT ++  WDD++K   + +  S   K +
Sbjct  356   LKNRHKKLRLQYNAMKILLGHGGFHWDETRQMVTADNNVWDDHLKA--YPEARSYRTKTV  413

Query  1369  AHY  1361
              +Y
Sbjct  414   PNY  416


 Score = 94.4 bits (233),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 65/97 (67%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD YF++++L+Q+    +   +F K+AW  M+ALF+ K+  + D + L+N+++ LR
Sbjct  492   WTPPMDRYFMDIMLEQVNNRFKVGNAFCKEAWTNMLALFNSKFGLELDKEALRNQHRKLR  551

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              QY+  K +L+ N F WD++RQMV   D  WDDY+KV
Sbjct  552   MQYNAMKTLLDNNGFYWDETRQMVAAADNIWDDYLKV  588



>gb|EYU22000.1| hypothetical protein MIMGU_mgv1a001545mg [Erythranthe guttata]
Length=798

 Score =   140 bits (352),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 108/181 (60%), Gaps = 6/181 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HPE  PY+TK V  +++L +I+G+TVADGRYS S  D+D + +++             + 
Sbjct  113   HPEARPYKTKPVLNFDDLCLIYGYTVADGRYSRSSHDVDADYDIQ------GASFGVSRT  166

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             +W+  M+Q+F++LML+Q + GNKL  TF  +AW  M+  FN  FG    K VL+ R+  L
Sbjct  167   EWTPDMDQYFMELMLQQKERGNKLENTFTRQAWTDMLAFFNAKFGSDCNKRVLRHRYRKL  226

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
              + Y  +  L+ Q+GF W E+ +M++A+  VW   +KA  + R YR+K    Y  ++++ 
Sbjct  227   WKYYSDLMTLVKQEGFCWDEKREMVMADGDVWDSYLKAHAHARFYRDKVFRSYNKLALVF  286

Query  789   G  787
             G
Sbjct  287   G  287


 Score =   105 bits (261),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 72/100 (72%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  M+ YFI+L+L+ + +GNR   +F+KQAW +M+A+F+ K+  ++D DVLK RY 
Sbjct  13    RTYWTPTMERYFIDLMLEHVHRGNRIGHTFNKQAWTDMLAVFNSKFGSQYDKDVLKGRYT  72

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +L K +++ K IL QN F WD+++QMV  +D  WD YIK+
Sbjct  73    NLWKLFNDIKNILSQNGFSWDETKQMVVADDYVWDTYIKI  112


 Score =   124 bits (310),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 72/196 (37%), Positives = 100/196 (51%), Gaps = 23/196 (12%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRY-----------SLSCFDIDFENEVKILE  1186
             AHP+   YR K VP Y++LR+I+G    DG Y             SC +I   NE     
Sbjct  411   AHPDARSYRVKTVPCYHKLRVIYGQDKFDGSYVRLVDSMDPAVGSSCVEIGNGNE-----  465

Query  1185  DKIPTKDDAKK---IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
                  + DA     IDW+  ME++F+ LMLEQVQ GNK++  F  +AW H+  +F   FG
Sbjct  466   ----EEADAGANFVIDWTPQMERYFLDLMLEQVQNGNKIDNEFSEQAWFHITLSFKENFG  521

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
              QY +  L+TR   L +QY  +  +L+Q GFMW E  Q I A    W+   K       Y
Sbjct  522   PQYEQNFLETRRLSLMKQYIEITNILNQQGFMWDESTQTITAGIETWESYTKENPEAISY  581

Query  834   RNKSLSFYKDMSIICG  787
             R+K + +Y ++  I G
Sbjct  582   RDKVIGYYGELCSIFG  597


 Score =   110 bits (275),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
              +E  R+ WT  MD + IEL+L+Q+ +GNR   SF  QAW EM+  F+  ++  HD +VL
Sbjct  307   GNERSRTYWTPPMDRFLIELMLEQVHRGNRIGLSFITQAWKEMVESFNANFESSHDKEVL  366

Query  1543  KNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
             KNRYKH +KQY++  IL Q+  F+WD+SR+MVT  +  WD YIK 
Sbjct  367   KNRYKHFKKQYNDVSILLQHSGFLWDESREMVTAENHVWDAYIKA  411


 Score =   113 bits (282),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 63/184 (34%), Positives = 96/184 (52%), Gaps = 11/184 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AH     YR KV   YN+L ++FG  V     S      D ++EV + +      ++  +
Sbjct  264   AHAHARFYRDKVFRSYNKLALVFGEMVCKESRS------DAKSEVVVAK-----GNERSR  312

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W+  M++  I+LMLEQV  GN++  +F  +AW  M+ +FN  F   + K VLK R+  
Sbjct  313   TYWTPPMDRFLIELMLEQVHRGNRIGLSFITQAWKEMVESFNANFESSHDKEVLKNRYKH  372

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
              ++QY  V  LL   GF+W E  +M+ AE+ VW   IKA    R YR K++  Y  + +I
Sbjct  373   FKKQYNDVSILLQHSGFLWDESREMVTAENHVWDAYIKAHPDARSYRVKTVPCYHKLRVI  432

Query  792   CGNE  781
              G +
Sbjct  433   YGQD  436


 Score = 87.4 bits (215),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  MD YF+EL+L Q ++GN+   +F++QAW +M+A F+ K+    +  VL++RY+
Sbjct  165   RTEWTPDMDQYFMELMLQQKERGNKLENTFTRQAWTDMLAFFNAKFGSDCNKRVLRHRYR  224

Query  1528  HLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              L K Y +   +++Q  F WD+ R+MV  + + WD Y+K 
Sbjct  225   KLWKYYSDLMTLVKQEGFCWDEKREMVMADGDVWDSYLKA  264


 Score =   111 bits (277),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 0/120 (0%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+ TME++FI LMLE V  GN++  TF  +AW  M+  FN+ FG QY K VLK R+  L 
Sbjct  16    WTPTMERYFIDLMLEHVHRGNRIGHTFNKQAWTDMLAVFNSKFGSQYDKDVLKGRYTNLW  75

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             + +  +K +LSQ+GF W E  QM+VA+D VW   IK     R Y+ K +  + D+ +I G
Sbjct  76    KLFNDIKNILSQNGFSWDETKQMVVADDYVWDTYIKIHPEARPYKTKPVLNFDDLCLIYG  135


 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/152 (31%), Positives = 75/152 (49%), Gaps = 3/152 (2%)
 Frame = -1

Query  1813  GLIPRLPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNR  1634
             G   RL  S   +  S+    G   ++   +      +WT  M+ YF++L+L+Q+Q GN+
Sbjct  440   GSYVRLVDSMDPAVGSSCVEIGNGNEEEADAGANFVIDWTPQMERYFLDLMLEQVQNGNK  499

Query  1633  TSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQY-HNTKILEQNEFIWDDSRQ  1457
                 FS+QAW  +   F   +  +++ + L+ R   L KQY   T IL Q  F+WD+S Q
Sbjct  500   IDNEFSEQAWFHITLSFKENFGPQYEQNFLETRRLSLMKQYIEITNILNQQGFMWDESTQ  559

Query  1456  MVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
              +T   E W+ Y K     +  S   K+I +Y
Sbjct  560   TITAGIETWESYTKEN--PEAISYRDKVIGYY  589



>ref|XP_010429484.1| PREDICTED: uncharacterized protein LOC104713954 isoform X2 [Camelina 
sativa]
Length=793

 Score =   148 bits (374),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 109/186 (59%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK---ILEDK---IPT  1171
             AHP+   Y+TK V  Y++L +I+G+TVADGRYS S  D +FE+EV    I E     + +
Sbjct  113   AHPQARVYKTKPVLNYSDLCLIYGYTVADGRYSRSSHDFEFEDEVNGVNIGESSGGVVLS  172

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
                + K +W+  M+Q+FI++ML+Q+  GNK    F  +AW  M+  FN  F   Y K VL
Sbjct  173   SKKSSKTEWTPVMDQYFIEIMLDQIGRGNKTGNAFSKQAWTDMLALFNVRFSSHYVKRVL  232

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+N L + Y  ++ +L +DGF W E   MI A+D VW   IK     + YR KSL  Y
Sbjct  233   RQRYNKLLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIKEHPLAKTYRMKSLPSY  292

Query  810   KDMSII  793
             KD+  I
Sbjct  293   KDLDTI  298


 Score = 95.9 bits (237),  Expect(2) = 6e-55, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +C +  T R  WT  M+ +FI+L+L+ + +GNRT  +F+KQAW EM+ +F+ K+  ++D 
Sbjct  7     TCCNDRT-RMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGVFNSKFGSQYDK  65

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             DVLK+RY +L KQY++ K +L+   F+ D + Q VTG++  W  Y+K 
Sbjct  66    DVLKSRYTNLWKQYNDVKSLLDHGGFVLDQTHQTVTGDESLWSLYLKA  113


 Score =   125 bits (315),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 67/194 (35%), Positives = 99/194 (51%), Gaps = 5/194 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YR K +P Y +L  IF      G         D  ++   ++         +  
Sbjct  278   HPLAKTYRMKSLPSYKDLDTIFACPDDQGTIPQPDQGKDLRDDGSAVQTSGTKASQVQSS  337

Query  1149  D-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D     W+  M+ + I L+++QV  GN++ +TF   AW  MITAFN  FG Q+ K VLK 
Sbjct  338   DRTRTFWTPPMDYYLIDLLVDQVNNGNRVGQTFITSAWNEMITAFNAKFGSQHCKDVLKN  397

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+  LRR Y  +K+LL Q+GF W  R  M++A+D +W   I+A    R YR K++  Y +
Sbjct  398   RYKHLRRLYNDIKFLLEQNGFSWDTRRDMVIADDGIWNTYIQAHPEARSYRVKTIPSYPN  457

Query  804   MSIICGNETPTFQY  763
             +  I G ET   +Y
Sbjct  458   LCFIFGKETSDGRY  471


 Score =   103 bits (257),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             SS ++ ++ WT VMD YFIE++LDQI +GN+T  +FSKQAW +M+ALF+ ++   +   V
Sbjct  172   SSKKSSKTEWTPVMDQYFIEIMLDQIGRGNKTGNAFSKQAWTDMLALFNVRFSSHYVKRV  231

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L+ RY  L K Y + + IL+++ F WD++R M+  +D  WD YIK
Sbjct  232   LRQRYNKLLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIK  276


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 94/210 (45%), Gaps = 30/210 (14%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILE---------  1186
             AHPE   YR K +P Y  L  IFG   +DGRY+     FD        ++E         
Sbjct  440   AHPEARSYRVKTIPSYPNLCFIFGKETSDGRYTRLAQAFDPSPAETALMIENGSTDGFKD  499

Query  1185  -------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFK  1063
                                D + +      I+W++ M+   I LMLEQV  GNK+  TF 
Sbjct  500   TLGETHSFQMVVYASNEKNDYLCSNTGPPCIEWTQVMDHCLIDLMLEQVNRGNKIGETFT  559

Query  1062  NKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAED  883
              +AW  M   FN  FG Q    +L+ R+ L+ ++   +  +L+ DGF W E  Q IVAED
Sbjct  560   EQAWADMAECFNAKFGLQTDMFMLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAED  619

Query  882   RVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
               WK  IK       Y+ K+L  Y ++  I
Sbjct  620   EYWKAYIKDHPDATIYKGKTLDSYGNLCKI  649


 Score =   109 bits (273),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 83/143 (58%), Gaps = 4/143 (3%)
 Frame = -1

Query  1768  SALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIA  1589
             SA++  G  +     SS+  R+ WT  MD Y I+LL+DQ+  GNR   +F   AW EMI 
Sbjct  322   SAVQTSGT-KASQVQSSDRTRTFWTPPMDYYLIDLLVDQVNNGNRVGQTFITSAWNEMIT  380

Query  1588  LFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              F+ K+  +H  DVLKNRYKHLR+ Y++ K +LEQN F WD  R MV  +D  W+ YI  
Sbjct  381   AFNAKFGSQHCKDVLKNRYKHLRRLYNDIKFLLEQNGFSWDTRRDMVIADDGIWNTYI--  438

Query  1411  QMFDQKFSNHLKIIAHYILVSFV  1343
             Q   +  S  +K I  Y  + F+
Sbjct  439   QAHPEARSYRVKTIPSYPNLCFI  461


 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  ++ W+ TME+ FI LMLE +  GN+   TF  +AW  M+  FN+ FG QY K VLK
Sbjct  10    NDRTRMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGVFNSKFGSQYDKDVLK  69

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L +QY  VK LL   GF+  + HQ +  ++ +W   +KA    R Y+ K +  Y 
Sbjct  70    SRYTNLWKQYNDVKSLLDHGGFVLDQTHQTVTGDESLWSLYLKAHPQARVYKTKPVLNYS  129

Query  807   DMSIICG  787
             D+ +I G
Sbjct  130   DLCLIYG  136


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             CS++      WT VMD   I+L+L+Q+ +GN+   +F++QAW +M   F+ K+  + D  
Sbjct  522   CSNTGPPCIEWTQVMDHCLIDLMLEQVNRGNKIGETFTEQAWADMAECFNAKFGLQTDMF  581

Query  1549  VLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +L+NRY  + K+  +   IL  + F WD+ +Q +   DE W  YIK
Sbjct  582   MLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAEDEYWKAYIK  627



>ref|XP_010429483.1| PREDICTED: uncharacterized protein LOC104713954 isoform X1 [Camelina 
sativa]
Length=817

 Score =   148 bits (373),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 109/186 (59%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK---ILEDK---IPT  1171
             AHP+   Y+TK V  Y++L +I+G+TVADGRYS S  D +FE+EV    I E     + +
Sbjct  113   AHPQARVYKTKPVLNYSDLCLIYGYTVADGRYSRSSHDFEFEDEVNGVNIGESSGGVVLS  172

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
                + K +W+  M+Q+FI++ML+Q+  GNK    F  +AW  M+  FN  F   Y K VL
Sbjct  173   SKKSSKTEWTPVMDQYFIEIMLDQIGRGNKTGNAFSKQAWTDMLALFNVRFSSHYVKRVL  232

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             + R+N L + Y  ++ +L +DGF W E   MI A+D VW   IK     + YR KSL  Y
Sbjct  233   RQRYNKLLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIKEHPLAKTYRMKSLPSY  292

Query  810   KDMSII  793
             KD+  I
Sbjct  293   KDLDTI  298


 Score = 95.9 bits (237),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 73/108 (68%), Gaps = 2/108 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +C +  T R  WT  M+ +FI+L+L+ + +GNRT  +F+KQAW EM+ +F+ K+  ++D 
Sbjct  7     TCCNDRT-RMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGVFNSKFGSQYDK  65

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             DVLK+RY +L KQY++ K +L+   F+ D + Q VTG++  W  Y+K 
Sbjct  66    DVLKSRYTNLWKQYNDVKSLLDHGGFVLDQTHQTVTGDESLWSLYLKA  113


 Score =   114 bits (286),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 94/210 (45%), Gaps = 30/210 (14%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDFENEVKILE---------  1186
             AHPE   YR K +P Y  L  IFG   +DGRY+     FD        ++E         
Sbjct  464   AHPEARSYRVKTIPSYPNLCFIFGKETSDGRYTRLAQAFDPSPAETALMIENGSTDGFKD  523

Query  1185  -------------------DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFK  1063
                                D + +      I+W++ M+   I LMLEQV  GNK+  TF 
Sbjct  524   TLGETHSFQMVVYASNEKNDYLCSNTGPPCIEWTQVMDHCLIDLMLEQVNRGNKIGETFT  583

Query  1062  NKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAED  883
              +AW  M   FN  FG Q    +L+ R+ L+ ++   +  +L+ DGF W E  Q IVAED
Sbjct  584   EQAWADMAECFNAKFGLQTDMFMLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAED  643

Query  882   RVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
               WK  IK       Y+ K+L  Y ++  I
Sbjct  644   EYWKAYIKDHPDATIYKGKTLDSYGNLCKI  673


 Score =   106 bits (265),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 55/120 (46%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = -1

Query  1768  SALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIA  1589
             SA++  G  +     SS+  R+ WT  MD Y I+LL+DQ+  GNR   +F   AW EMI 
Sbjct  322   SAVQTSGT-KASQVQSSDRTRTFWTPPMDYYLIDLLVDQVNNGNRVGQTFITSAWNEMIT  380

Query  1588  LFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              F+ K+  +H  DVLKNRYKHLR+ Y++ K +LEQN F WD  R MV  +D  W+ YI+ 
Sbjct  381   AFNAKFGSQHCKDVLKNRYKHLRRLYNDIKFLLEQNGFSWDTRRDMVIADDGIWNTYIQA  440


 Score =   112 bits (281),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 100/218 (46%), Gaps = 29/218 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YR K +P Y +L  IF      G         D  ++   ++         +  
Sbjct  278   HPLAKTYRMKSLPSYKDLDTIFACPDDQGTIPQPDQGKDLRDDGSAVQTSGTKASQVQSS  337

Query  1149  D-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D     W+  M+ + I L+++QV  GN++ +TF   AW  MITAFN  FG Q+ K VLK 
Sbjct  338   DRTRTFWTPPMDYYLIDLLVDQVNNGNRVGQTFITSAWNEMITAFNAKFGSQHCKDVLKN  397

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWK----------------------  871
             R+  LRR Y  +K+LL Q+GF W  R  M++A+D +W                       
Sbjct  398   RYKHLRRLYNDIKFLLEQNGFSWDTRRDMVIADDGIWNTYIQACYILFILLKILVIWLCL  457

Query  870   --KVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQY  763
               K ++A    R YR K++  Y ++  I G ET   +Y
Sbjct  458   QMKHVQAHPEARSYRVKTIPSYPNLCFIFGKETSDGRY  495


 Score =   103 bits (257),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 73/105 (70%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             SS ++ ++ WT VMD YFIE++LDQI +GN+T  +FSKQAW +M+ALF+ ++   +   V
Sbjct  172   SSKKSSKTEWTPVMDQYFIEIMLDQIGRGNKTGNAFSKQAWTDMLALFNVRFSSHYVKRV  231

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             L+ RY  L K Y + + IL+++ F WD++R M+  +D  WD YIK
Sbjct  232   LRQRYNKLLKYYKDMEAILKEDGFSWDETRLMIAADDAVWDSYIK  276


 Score =   105 bits (261),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 74/127 (58%), Gaps = 0/127 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  ++ W+ TME+ FI LMLE +  GN+   TF  +AW  M+  FN+ FG QY K VLK
Sbjct  10    NDRTRMYWTPTMERFFIDLMLEHLNRGNRTGHTFTKQAWNEMLGVFNSKFGSQYDKDVLK  69

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R+  L +QY  VK LL   GF+  + HQ +  ++ +W   +KA    R Y+ K +  Y 
Sbjct  70    SRYTNLWKQYNDVKSLLDHGGFVLDQTHQTVTGDESLWSLYLKAHPQARVYKTKPVLNYS  129

Query  807   DMSIICG  787
             D+ +I G
Sbjct  130   DLCLIYG  136


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 62/106 (58%), Gaps = 1/106 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             CS++      WT VMD   I+L+L+Q+ +GN+   +F++QAW +M   F+ K+  + D  
Sbjct  546   CSNTGPPCIEWTQVMDHCLIDLMLEQVNRGNKIGETFTEQAWADMAECFNAKFGLQTDMF  605

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +L+NRY  + K+  +   IL  + F WD+ +Q +   DE W  YIK
Sbjct  606   MLENRYILMMKERDDINSILNLDGFTWDEEKQTIVAEDEYWKAYIK  651



>emb|CAN61085.1| hypothetical protein VITISV_041918 [Vitis vinifera]
Length=956

 Score =   137 bits (345),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 104/182 (57%), Gaps = 5/182 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ + YR K  P YN+L +I+G  +ADG+ + S   IDF  + + L +   ++      
Sbjct  600   HPDAKSYRAKPKPNYNDLCLIYGSPIADGQCNQSYHGIDFNGDGRELNNSSHSR-----T  654

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLE VQ+G+ ++  F  +AW  M   FN  FG  + K VLK+RF   
Sbjct  655   DWTPLMDRYFIDLMLEHVQKGSMVDHKFNKQAWSDMAARFNAEFGSYHDKDVLKSRFKHW  714

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+ +  ++ LL Q+GF W ER QM+ A + +W   IK     R YR +SL  Y D+ +I 
Sbjct  715   RKLFNGMRTLLEQNGFAWDERRQMVTAANELWDSYIKENPDARSYRTRSLPNYNDLFLIY  774

Query  789   GN  784
              N
Sbjct  775   EN  776


 Score =   106 bits (265),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 76/105 (72%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++S+  R++W   MD Y I+L+L+Q++KGNR   +F+KQAW +M+ALF+ +++ +H+  V
Sbjct  494   ANSDHSRTDWIPPMDRYLIDLMLEQVRKGNRKVHTFNKQAWADMVALFNERFRTQHEKSV  553

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK+R+K LRKQYH+ K +L+   F WD+ RQMVT  D  W  Y+K
Sbjct  554   LKSRHKSLRKQYHHIKNLLDHRGFSWDEMRQMVTAYDAVWAAYLK  598


 Score =   128 bits (321),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 70/192 (36%), Positives = 104/192 (54%), Gaps = 8/192 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL-----EDKIPTK  1168
             AHP  + YR K++  + +L +++G TV +G  S    D D E ++  +     E + P  
Sbjct  276   AHPHAQAYRKKILLNFQDLSLLYGKTVNNGIRSHLHPDKDLEYDIVQIKAGEGEYQTPIS  335

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D     W+  M+ +FI L+L+QV  GNK+ + F  +AWI M+T FN  FG  Y K VLK
Sbjct  336   GDGY---WTLPMDHYFIDLLLDQVLRGNKIGQGFITQAWIEMVTLFNMKFGSHYDKDVLK  392

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LRRQY  +  LL   GF W +  +M+ AE  VW   I+A    + YRNK++  Y 
Sbjct  393   NRYRHLRRQYNDITALLEHSGFSWDDTREMVTAEGFVWDSYIQAIPDAQSYRNKTVPNYH  452

Query  807   DMSIICGNETPT  772
              + +I G E+  
Sbjct  453   KLCVIYGQESSN  464


 Score =   111 bits (277),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 78/120 (65%), Gaps = 1/120 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   + +S+E  R +WT  MD YF EL+LDQ+ KGN+ + +F++QAW  M++LF+ K+ 
Sbjct  164   GMGSVAPASNEHSRRDWTPAMDQYFTELMLDQLGKGNKITNTFNEQAWTVMLSLFNSKFC  223

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +H    LK RYK L K Y + K +LEQN F+WDD +QM+  +D+ WD+YIK     Q +
Sbjct  224   TQHGKRFLKRRYKKLEKYYSDIKTLLEQNGFLWDDRQQMIAADDDVWDNYIKAHPHAQAY  283


 Score =   158 bits (400),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 118/188 (63%), Gaps = 6/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI------LEDKIPT  1171
             AHP+ + Y+ K V  +N+L +I+ +T ADGRYS S  DIDF+++ +       +    P 
Sbjct  112   AHPDAQCYKNKAVMNFNDLCLIYAYTTADGRYSRSSHDIDFDDDFQGVTIAYGMGSVAPA  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              ++  + DW+  M+Q+F +LML+Q+ +GNK+  TF  +AW  M++ FN+ F  Q+GK  L
Sbjct  172   SNEHSRRDWTPAMDQYFTELMLDQLGKGNKITNTFNEQAWTVMLSLFNSKFCTQHGKRFL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L + Y  +K LL Q+GF+W +R QMI A+D VW   IKA  + + YR K L  +
Sbjct  232   KRRYKKLEKYYSDIKTLLEQNGFLWDDRQQMIAADDDVWDNYIKAHPHAQAYRKKILLNF  291

Query  810   KDMSIICG  787
             +D+S++ G
Sbjct  292   QDLSLLYG  299


 Score =   126 bits (316),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/188 (38%), Positives = 104/188 (55%), Gaps = 5/188 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG-RYSLSC-FDIDFENEVKILED---KIPTK  1168
             A P+ + YR K VP Y++L +I+G   ++G   SL+C  D+D  + V ++E    +    
Sbjct  436   AIPDAQSYRNKTVPNYHKLCVIYGQESSNGGDNSLACNGDLDGVDPVWMIEGTDIQCNAN  495

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              D  + DW   M+++ I LMLEQV++GN+   TF  +AW  M+  FN  F  Q+ K VLK
Sbjct  496   SDHSRTDWIPPMDRYLIDLMLEQVRKGNRKVHTFNKQAWADMVALFNERFRTQHEKSVLK  555

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R   LR+QY  +K LL   GF W E  QM+ A D VW   +K     + YR K    Y 
Sbjct  556   SRHKSLRKQYHHIKNLLDHRGFSWDEMRQMVTAYDAVWAAYLKEHPDAKSYRAKPKPNYN  615

Query  807   DMSIICGN  784
             D+ +I G+
Sbjct  616   DLCLIYGS  623


 Score =   107 bits (268),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT +MD YFI+L+L+ +QKG+     F+KQAW +M A F+ ++   HD DVLK+R+K
Sbjct  653   RTDWTPLMDRYFIDLMLEHVQKGSMVDHKFNKQAWSDMAARFNAEFGSYHDKDVLKSRFK  712

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H RK ++  + +LEQN F WD+ RQMVT  +E WD YIK
Sbjct  713   HWRKLFNGMRTLLEQNGFAWDERRQMVTAANELWDSYIK  751


 Score = 36.2 bits (82),  Expect(2) = 6e-25, Method: Compositional matrix adjust.
 Identities = 23/85 (27%), Positives = 45/85 (53%), Gaps = 7/85 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCF---DIDFENEVKILE--DKIPTKD  1165
             +P+   YRT+ +P YN+L +I+ + +     + S F   D D++  V I E  D+     
Sbjct  753   NPDARSYRTRSLPNYNDLFLIYENAINKDTQNQSSFCIDDNDYDLGVGIGEEDDQFLASS  812

Query  1164  DAKKIDWSETM--EQHFIQLMLEQV  1096
             D+  +DW   M  + H ++L ++++
Sbjct  813   DSLDVDWMIPMDIDPHALELDMDEM  837


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 82/135 (61%), Gaps = 0/135 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W++TME++FI LML+QV  GN++  TF  +AW  M   FN  FG QY K VLK+
Sbjct  10    DRSRTHWTQTMERYFIDLMLDQVHRGNRMGHTFNKQAWADMHAMFNGKFGSQYEKDVLKS  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+ +L +Q+  +K LL Q GF W +  +M+VA+D VW   IKA    + Y+NK++  + D
Sbjct  70    RYTVLWKQFNDMKNLLDQSGFSWDDTRKMVVADDCVWDAYIKAHPDAQCYKNKAVMNFND  129

Query  804   MSIICGNETPTFQYG  760
             + +I    T   +Y 
Sbjct  130   LCLIYAYTTADGRYS  144


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 76/114 (67%), Gaps = 3/114 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD YFI+LLLDQ+ +GN+    F  QAW+EM+ LF+ K+   +D DVLKNRY+HLR
Sbjct  340   WTLPMDHYFIDLLLDQVLRGNKIGQGFITQAWIEMVTLFNMKFGSHYDKDVLKNRYRHLR  399

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             +QY++ T +LE + F WDD+R+MVT     WD YI+     Q + N  K + +Y
Sbjct  400   RQYNDITALLEHSGFSWDDTREMVTAEGFVWDSYIQAIPDAQSYRN--KTVPNY  451


 Score =   107 bits (267),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   +  +S+  R++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M A+F+ K+  
Sbjct  1     MASQALVNSDRSRTHWTQTMERYFIDLMLDQVHRGNRMGHTFNKQAWADMHAMFNGKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             +++ DVLK+RY  L KQ+++ K +L+Q+ F WDD+R+MV  +D  WD YIK     Q + 
Sbjct  61    QYEKDVLKSRYTVLWKQFNDMKNLLDQSGFSWDDTRKMVVADDCVWDAYIKAHPDAQCYK  120

Query  1387  N  1385
             N
Sbjct  121   N  121



>ref|XP_010549953.1| PREDICTED: uncharacterized protein LOC104820967 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549961.1| PREDICTED: uncharacterized protein LOC104820967 isoform X2 [Tarenaya 
hassleriana]
Length=1115

 Score =   129 bits (323),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 108/190 (57%), Gaps = 6/190 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
               P+   YR K +P++++L +I+ +T ADGRYS S  D++F++EV+ L      +D    
Sbjct  166   GQPDAAIYRGKSMPHFDDLCLIYAYTKADGRYSRSSHDLEFDDEVQGLIASSVDDDIALV  225

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K +  + +W+  M+++FI+LM++Q + GN+ N TF   AW  M    N+ F   Y    L
Sbjct  226   KMEHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYL  285

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R   L   Y  ++ LL Q+GF W E  Q+I+AE+ VW   IK     +  RN++L  Y
Sbjct  286   KLRHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRNETLLGY  345

Query  810   KDMSIICGNE  781
             +D+ +I  N+
Sbjct  346   RDLCLIYDNK  355


 Score =   112 bits (280),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             C++ E  R NW   M+ YFI+L+LDQ+ KG R   +FS+QAW EM A+F+ K++CK+  D
Sbjct  60    CNNGERERVNWNPTMEQYFIDLMLDQMNKGTRLGHTFSRQAWTEMSAMFNAKFRCKYHRD  119

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +LK  Y  L KQYH+ K +L ++ F+WDD+ +MV  +   WDDYIK Q
Sbjct  120   MLKTHYSVLWKQYHDVKELLVRDGFMWDDAHKMVVSDSCSWDDYIKGQ  167


 Score =   101 bits (252),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTKD  1165
             +PE +  R + +  Y +L +I+ +   +G  +L   D  F  +V + E            
Sbjct  331   NPEAQSLRNETLLGYRDLCLIYDNKKNNGPRNLVQHD-KFAEDVFLPERSDIVGHFSAGS  389

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  K+ W+ +M+++ I L+L+Q   GN++  TF ++AW  M T F   FG  Y  V LK 
Sbjct  390   EILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVSLKQ  449

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             +  +L RQY  +  LL Q  F W +  + +VAED +W   IK       YRNKS+S Y  
Sbjct  450   QLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIKEHPEAAVYRNKSISSYHK  509

Query  804   MSIICGNET  778
             + +I  +E 
Sbjct  510   LGVIFFDEN  518


 Score = 86.7 bits (213),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E     WT  MD YFIEL++DQ + GNR + +F K AW +M  + + K+   +    LK 
Sbjct  228   EHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKL  287

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             R+K L + Y + + +L+QN F WD+ RQ++   ++ WD YIKV    Q   N
Sbjct  288   RHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRN  339


 Score = 92.0 bits (227),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE L+ +WT  MD Y I+LLLDQ  +GN+   +F+ +AW EM  +F+ ++   +D   
Sbjct  387   AGSEILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVS  446

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK + K L +QY++  I LEQ+ F WDD+R+ V   D  W +YIK
Sbjct  447   LKQQLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIK  491


 Score = 91.3 bits (225),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE----NEVKILEDKIPTKDD  1162
             HPE   YR K +  Y++L +IF    +  R S    D D E    +++     + P++  
Sbjct  493   HPEAAVYRNKSISSYHKLGVIFFDENSHRRCS-ELGDADLEYGEPDQINRESSECPSQSY  551

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
                  W+  M++H I LML+QV  GN++  +F +++W  M  +F   FG    K  LKTR
Sbjct  552   RFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGLPQRKAPLKTR  611

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                 +R Y  ++ LLS+ GF W E+ Q + A + VW  + K     + YR +    Y + 
Sbjct  612   HKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFKDYPDAKCYRGRRYPNYNEF  671

Query  801   SIICGNET  778
              +I G+  
Sbjct  672   FLIYGDSA  679


 Score =   115 bits (289),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 18/182 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+ + YR +  P YNE  +I+G + +                           D AK+ 
Sbjct  654   YPDAKCYRGRRYPNYNEFFLIYGDSASHAIAPRH------------------KNDYAKRT  695

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV++GNKL++ F   AW  M T F + FG ++ + +LK+RF +L
Sbjct  696   DWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFLIL  755

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL Q GF W E  QM++A+  +W   IK     R Y  +S   + D+ +I 
Sbjct  756   RKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIKEHPNARSYHKRSFPSFNDLFLIF  815

Query  789   GN  784
             G+
Sbjct  816   GD  817


 Score = 66.2 bits (160),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSCSS-SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E   C S S     +WT  MD + I+L+L Q+  GNR  +SF  ++W EM   F  ++  
Sbjct  542   ESSECPSQSYRFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGL  601

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                   LK R+KH ++ Y + + +L +  F WD+  Q V  N+  WD   K
Sbjct  602   PQRKAPLKTRHKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFK  652


 Score = 91.7 bits (226),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 21/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    Y  +  P +N+L +IFG    DG  +LSC   +  N        +P     ++ 
Sbjct  794   HPNARSYHKRSFPSFNDLFLIFGDRCTDGLENLSCLSTESGN--------VPDIGFCRRT  845

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
               S                 G K  R F+N A   MI + N  F  Q  K   + ++  L
Sbjct  846   GKSSDF-------------WGKKRTRNFRNGALRCMIDSLNEQFRLQCSKYFSENQYQRL  892

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
               +Y  V YLL QDGF W    QM+VA+D VW+  IK      RYR++SL+ Y+D+ +  
Sbjct  893   MMEYRDVTYLLKQDGFEWDGFLQMVVAKDDVWEAHIKEHPEAARYRDRSLTDYEDLCLTF  952

Query  789   GNETPTF  769
             G+    F
Sbjct  953   GDNASAF  959


 Score = 89.4 bits (220),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q+++GN+    F+K AW  M   F   +  +HD D+LK+R+ 
Sbjct  694   RTDWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFL  753

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK++++ K +L+Q  F WD++RQMV  +   WD YIK
Sbjct  754   ILRKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIK  792


 Score =   111 bits (277),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 78/122 (64%), Gaps = 0/122 (0%)
 Frame = -2

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
             ++++W+ TMEQ+FI LML+Q+ +G +L  TF  +AW  M   FN  F  +Y + +LKT +
Sbjct  66    ERVNWNPTMEQYFIDLMLDQMNKGTRLGHTFSRQAWTEMSAMFNAKFRCKYHRDMLKTHY  125

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
             ++L +QY  VK LL +DGFMW + H+M+V++   W   IK Q     YR KS+  + D+ 
Sbjct  126   SVLWKQYHDVKELLVRDGFMWDDAHKMVVSDSCSWDDYIKGQPDAAIYRGKSMPHFDDLC  185

Query  798   II  793
             +I
Sbjct  186   LI  187



>ref|XP_010549970.1| PREDICTED: uncharacterized protein LOC104820967 isoform X3 [Tarenaya 
hassleriana]
Length=1112

 Score =   128 bits (322),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 108/190 (57%), Gaps = 6/190 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
               P+   YR K +P++++L +I+ +T ADGRYS S  D++F++EV+ L      +D    
Sbjct  166   GQPDAAIYRGKSMPHFDDLCLIYAYTKADGRYSRSSHDLEFDDEVQGLIASSVDDDIALV  225

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K +  + +W+  M+++FI+LM++Q + GN+ N TF   AW  M    N+ F   Y    L
Sbjct  226   KMEHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYL  285

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R   L   Y  ++ LL Q+GF W E  Q+I+AE+ VW   IK     +  RN++L  Y
Sbjct  286   KLRHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRNETLLGY  345

Query  810   KDMSIICGNE  781
             +D+ +I  N+
Sbjct  346   RDLCLIYDNK  355


 Score =   112 bits (280),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             C++ E  R NW   M+ YFI+L+LDQ+ KG R   +FS+QAW EM A+F+ K++CK+  D
Sbjct  60    CNNGERERVNWNPTMEQYFIDLMLDQMNKGTRLGHTFSRQAWTEMSAMFNAKFRCKYHRD  119

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +LK  Y  L KQYH+ K +L ++ F+WDD+ +MV  +   WDDYIK Q
Sbjct  120   MLKTHYSVLWKQYHDVKELLVRDGFMWDDAHKMVVSDSCSWDDYIKGQ  167


 Score =   102 bits (255),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 59/186 (32%), Positives = 95/186 (51%), Gaps = 3/186 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE--DKIPTKDDAK  1156
             +PE +  R + +  Y +L +I+ +   +G  +L   D  F  +V + E         +  
Sbjct  331   NPEAQSLRNETLLGYRDLCLIYDNKKNNGPRNLVQHD-KFAEDVFLPERSGHFSAGSEIL  389

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             K+ W+ +M+++ I L+L+Q   GN++  TF ++AW  M T F   FG  Y  V LK +  
Sbjct  390   KVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVSLKQQLK  449

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
             +L RQY  +  LL Q  F W +  + +VAED +W   IK       YRNKS+S Y  + +
Sbjct  450   VLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIKEHPEAAVYRNKSISSYHKLGV  509

Query  795   ICGNET  778
             I  +E 
Sbjct  510   IFFDEN  515


 Score = 87.0 bits (214),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E     WT  MD YFIEL++DQ + GNR + +F K AW +M  + + K+   +    LK 
Sbjct  228   EHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKL  287

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             R+K L + Y + + +L+QN F WD+ RQ++   ++ WD YIKV    Q   N
Sbjct  288   RHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRN  339


 Score = 92.0 bits (227),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE L+ +WT  MD Y I+LLLDQ  +GN+   +F+ +AW EM  +F+ ++   +D   
Sbjct  384   AGSEILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVS  443

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK + K L +QY++  I LEQ+ F WDD+R+ V   D  W +YIK
Sbjct  444   LKQQLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIK  488


 Score = 91.3 bits (225),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE----NEVKILEDKIPTKDD  1162
             HPE   YR K +  Y++L +IF    +  R S    D D E    +++     + P++  
Sbjct  490   HPEAAVYRNKSISSYHKLGVIFFDENSHRRCS-ELGDADLEYGEPDQINRESSECPSQSY  548

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
                  W+  M++H I LML+QV  GN++  +F +++W  M  +F   FG    K  LKTR
Sbjct  549   RFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGLPQRKAPLKTR  608

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                 +R Y  ++ LLS+ GF W E+ Q + A + VW  + K     + YR +    Y + 
Sbjct  609   HKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFKDYPDAKCYRGRRYPNYNEF  668

Query  801   SIICGNET  778
              +I G+  
Sbjct  669   FLIYGDSA  676


 Score =   115 bits (289),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 18/182 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+ + YR +  P YNE  +I+G + +                           D AK+ 
Sbjct  651   YPDAKCYRGRRYPNYNEFFLIYGDSASHAIAPRH------------------KNDYAKRT  692

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV++GNKL++ F   AW  M T F + FG ++ + +LK+RF +L
Sbjct  693   DWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFLIL  752

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL Q GF W E  QM++A+  +W   IK     R Y  +S   + D+ +I 
Sbjct  753   RKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIKEHPNARSYHKRSFPSFNDLFLIF  812

Query  789   GN  784
             G+
Sbjct  813   GD  814


 Score = 66.2 bits (160),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSCSS-SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E   C S S     +WT  MD + I+L+L Q+  GNR  +SF  ++W EM   F  ++  
Sbjct  539   ESSECPSQSYRFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGL  598

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                   LK R+KH ++ Y + + +L +  F WD+  Q V  N+  WD   K
Sbjct  599   PQRKAPLKTRHKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFK  649


 Score = 91.3 bits (225),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 21/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    Y  +  P +N+L +IFG    DG  +LSC   +  N        +P     ++ 
Sbjct  791   HPNARSYHKRSFPSFNDLFLIFGDRCTDGLENLSCLSTESGN--------VPDIGFCRRT  842

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
               S                 G K  R F+N A   MI + N  F  Q  K   + ++  L
Sbjct  843   GKSSDF-------------WGKKRTRNFRNGALRCMIDSLNEQFRLQCSKYFSENQYQRL  889

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
               +Y  V YLL QDGF W    QM+VA+D VW+  IK      RYR++SL+ Y+D+ +  
Sbjct  890   MMEYRDVTYLLKQDGFEWDGFLQMVVAKDDVWEAHIKEHPEAARYRDRSLTDYEDLCLTF  949

Query  789   GNETPTF  769
             G+    F
Sbjct  950   GDNASAF  956


 Score = 89.4 bits (220),  Expect(2) = 6e-36, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q+++GN+    F+K AW  M   F   +  +HD D+LK+R+ 
Sbjct  691   RTDWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFL  750

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK++++ K +L+Q  F WD++RQMV  +   WD YIK
Sbjct  751   ILRKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIK  789


 Score =   111 bits (277),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 78/122 (64%), Gaps = 0/122 (0%)
 Frame = -2

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
             ++++W+ TMEQ+FI LML+Q+ +G +L  TF  +AW  M   FN  F  +Y + +LKT +
Sbjct  66    ERVNWNPTMEQYFIDLMLDQMNKGTRLGHTFSRQAWTEMSAMFNAKFRCKYHRDMLKTHY  125

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
             ++L +QY  VK LL +DGFMW + H+M+V++   W   IK Q     YR KS+  + D+ 
Sbjct  126   SVLWKQYHDVKELLVRDGFMWDDAHKMVVSDSCSWDDYIKGQPDAAIYRGKSMPHFDDLC  185

Query  798   II  793
             +I
Sbjct  186   LI  187



>ref|XP_010549978.1| PREDICTED: uncharacterized protein LOC104820967 isoform X4 [Tarenaya 
hassleriana]
Length=1103

 Score =   128 bits (322),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 108/190 (57%), Gaps = 6/190 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
               P+   YR K +P++++L +I+ +T ADGRYS S  D++F++EV+ L      +D    
Sbjct  166   GQPDAAIYRGKSMPHFDDLCLIYAYTKADGRYSRSSHDLEFDDEVQGLIASSVDDDIALV  225

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K +  + +W+  M+++FI+LM++Q + GN+ N TF   AW  M    N+ F   Y    L
Sbjct  226   KMEHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYL  285

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R   L   Y  ++ LL Q+GF W E  Q+I+AE+ VW   IK     +  RN++L  Y
Sbjct  286   KLRHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRNETLLGY  345

Query  810   KDMSIICGNE  781
             +D+ +I  N+
Sbjct  346   RDLCLIYDNK  355


 Score =   112 bits (280),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 74/108 (69%), Gaps = 1/108 (1%)
 Frame = -1

Query  1729  CSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTD  1550
             C++ E  R NW   M+ YFI+L+LDQ+ KG R   +FS+QAW EM A+F+ K++CK+  D
Sbjct  60    CNNGERERVNWNPTMEQYFIDLMLDQMNKGTRLGHTFSRQAWTEMSAMFNAKFRCKYHRD  119

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +LK  Y  L KQYH+ K +L ++ F+WDD+ +MV  +   WDDYIK Q
Sbjct  120   MLKTHYSVLWKQYHDVKELLVRDGFMWDDAHKMVVSDSCSWDDYIKGQ  167


 Score =   101 bits (252),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTKD  1165
             +PE +  R + +  Y +L +I+ +   +G  +L   D  F  +V + E            
Sbjct  331   NPEAQSLRNETLLGYRDLCLIYDNKKNNGPRNLVQHD-KFAEDVFLPERSDIVGHFSAGS  389

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  K+ W+ +M+++ I L+L+Q   GN++  TF ++AW  M T F   FG  Y  V LK 
Sbjct  390   EILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVSLKQ  449

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             +  +L RQY  +  LL Q  F W +  + +VAED +W   IK       YRNKS+S Y  
Sbjct  450   QLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIKEHPEAAVYRNKSISSYHK  509

Query  804   MSIICGNET  778
             + +I  +E 
Sbjct  510   LGVIFFDEN  518


 Score = 86.7 bits (213),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E     WT  MD YFIEL++DQ + GNR + +F K AW +M  + + K+   +    LK 
Sbjct  228   EHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKL  287

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             R+K L + Y + + +L+QN F WD+ RQ++   ++ WD YIKV    Q   N
Sbjct  288   RHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRN  339


 Score = 92.4 bits (228),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 69/117 (59%), Gaps = 1/117 (1%)
 Frame = -1

Query  1762  LKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALF  1583
             L  R  +     + SE L+ +WT  MD Y I+LLLDQ  +GN+   +F+ +AW EM  +F
Sbjct  375   LPERSDIVGHFSAGSEILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIF  434

Query  1582  SHKYKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             + ++   +D   LK + K L +QY++  I LEQ+ F WDD+R+ V   D  W +YIK
Sbjct  435   TRQFGAFYDNVSLKQQLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIK  491


 Score = 91.3 bits (225),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE----NEVKILEDKIPTKDD  1162
             HPE   YR K +  Y++L +IF    +  R S    D D E    +++     + P++  
Sbjct  493   HPEAAVYRNKSISSYHKLGVIFFDENSHRRCS-ELGDADLEYGEPDQINRESSECPSQSY  551

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
                  W+  M++H I LML+QV  GN++  +F +++W  M  +F   FG    K  LKTR
Sbjct  552   RFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGLPQRKAPLKTR  611

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                 +R Y  ++ LLS+ GF W E+ Q + A + VW  + K     + YR +    Y + 
Sbjct  612   HKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFKDYPDAKCYRGRRYPNYNEF  671

Query  801   SIICGNET  778
              +I G+  
Sbjct  672   FLIYGDSA  679


 Score =   115 bits (289),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 18/182 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+ + YR +  P YNE  +I+G + +                           D AK+ 
Sbjct  654   YPDAKCYRGRRYPNYNEFFLIYGDSASHAIAPRH------------------KNDYAKRT  695

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV++GNKL++ F   AW  M T F + FG ++ + +LK+RF +L
Sbjct  696   DWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFLIL  755

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL Q GF W E  QM++A+  +W   IK     R Y  +S   + D+ +I 
Sbjct  756   RKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIKEHPNARSYHKRSFPSFNDLFLIF  815

Query  789   GN  784
             G+
Sbjct  816   GD  817


 Score = 66.2 bits (160),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSCSS-SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E   C S S     +WT  MD + I+L+L Q+  GNR  +SF  ++W EM   F  ++  
Sbjct  542   ESSECPSQSYRFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGL  601

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                   LK R+KH ++ Y + + +L +  F WD+  Q V  N+  WD   K
Sbjct  602   PQRKAPLKTRHKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFK  652


 Score = 91.3 bits (225),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 21/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    Y  +  P +N+L +IFG    DG  +LSC   +  N        +P     ++ 
Sbjct  794   HPNARSYHKRSFPSFNDLFLIFGDRCTDGLENLSCLSTESGN--------VPDIGFCRRT  845

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
               S                 G K  R F+N A   MI + N  F  Q  K   + ++  L
Sbjct  846   GKSSDF-------------WGKKRTRNFRNGALRCMIDSLNEQFRLQCSKYFSENQYQRL  892

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
               +Y  V YLL QDGF W    QM+VA+D VW+  IK      RYR++SL+ Y+D+ +  
Sbjct  893   MMEYRDVTYLLKQDGFEWDGFLQMVVAKDDVWEAHIKEHPEAARYRDRSLTDYEDLCLTF  952

Query  789   GNETPTF  769
             G+    F
Sbjct  953   GDNASAF  959


 Score = 89.4 bits (220),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q+++GN+    F+K AW  M   F   +  +HD D+LK+R+ 
Sbjct  694   RTDWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFL  753

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK++++ K +L+Q  F WD++RQMV  +   WD YIK
Sbjct  754   ILRKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIK  792


 Score =   111 bits (277),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 78/122 (64%), Gaps = 0/122 (0%)
 Frame = -2

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
             ++++W+ TMEQ+FI LML+Q+ +G +L  TF  +AW  M   FN  F  +Y + +LKT +
Sbjct  66    ERVNWNPTMEQYFIDLMLDQMNKGTRLGHTFSRQAWTEMSAMFNAKFRCKYHRDMLKTHY  125

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
             ++L +QY  VK LL +DGFMW + H+M+V++   W   IK Q     YR KS+  + D+ 
Sbjct  126   SVLWKQYHDVKELLVRDGFMWDDAHKMVVSDSCSWDDYIKGQPDAAIYRGKSMPHFDDLC  185

Query  798   II  793
             +I
Sbjct  186   LI  187



>ref|XP_007206452.1| hypothetical protein PRUPE_ppa018255mg [Prunus persica]
 gb|EMJ07651.1| hypothetical protein PRUPE_ppa018255mg [Prunus persica]
Length=767

 Score =   134 bits (338),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 72/193 (37%), Positives = 107/193 (55%), Gaps = 19/193 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN--EVKILEDKIPTKDDAK  1156
             HP+ E YRTK  P YN+L +I+G + +  R + S   + F     +KILE  +       
Sbjct  449   HPDAESYRTKSKPNYNDLCLIYGKSKSGERLNQSGQAMGFSPLPSLKILEPSL-------  501

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
               DW+  M+++FI LMLEQV+ G+ +N  F   AW  M++ F   FGFQ+ K VLK+RF 
Sbjct  502   -TDWTPPMDRYFIDLMLEQVRNGSMVNSKFSRLAWTEMVSKFRAEFGFQHDKDVLKSRFF  560

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQY---------FRRYRNKS  823
              LR+Q+  +K LL + GF W E   M+ A+D +W   +KA             R YRN++
Sbjct  561   NLRKQFNGMKSLLDESGFAWDEMQHMVTADDHLWDAYVKANSSHVLVQEHPDVRSYRNRA  620

Query  822   LSFYKDMSIICGN  784
             L  + D+ +I G+
Sbjct  621   LPNFNDLYLIYGD  633


 Score =   105 bits (261),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD + I+L+L Q+QK N+   SF  QAW++++ LF  ++  + D D+L+ RYK
Sbjct  349   RTDWTPPMDRFLIDLMLKQLQKVNKIDYSFDDQAWMDVLVLFKERFGLQQDKDLLRRRYK  408

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L KQYH+TK +L+Q  F WDD++QMVT  D+ WD YIK
Sbjct  409   SLEKQYHDTKDLLDQRGFWWDDTQQMVTAYDDIWDAYIK  447


 Score =   106 bits (265),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 59/190 (31%), Positives = 99/190 (52%), Gaps = 8/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV--------KILEDKI  1177
             A P+   YR K +  Y +L +I+G+ +++   S      + E+++        +  +  I
Sbjct  282   ALPDARLYRKKPLLNYQDLNLIYGNEISNVLRSHLHQGTNSEDDILEYMTEGEESEDTHI  341

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
                +D  + DW+  M++  I LML+Q+Q+ NK++ +F ++AW+ ++  F   FG Q  K 
Sbjct  342   HGNNDFSRTDWTPPMDRFLIDLMLKQLQKVNKIDYSFDDQAWMDVLVLFKERFGLQQDKD  401

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             +L+ R+  L +QY   K LL Q GF W +  QM+ A D +W   IK       YR KS  
Sbjct  402   LLRRRYKSLEKQYHDTKDLLDQRGFWWDDTQQMVTAYDDIWDAYIKEHPDAESYRTKSKP  461

Query  816   FYKDMSIICG  787
              Y D+ +I G
Sbjct  462   NYNDLCLIYG  471


 Score = 75.1 bits (183),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 64/99 (65%), Gaps = 1/99 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++W   MD +F++L+LDQ+ KG++T+ SF KQAW +M+ LF+ K+  ++    LK  YK 
Sbjct  184   TDWKPPMDRFFLKLMLDQLGKGSKTNNSFKKQAWKDMVTLFNAKFGSQYRKSFLKQLYKK  243

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             L K + + + IL    F WD+  QM+  +D+ WD+YIK 
Sbjct  244   LLKYFTDVRSILAIKGFYWDEKEQMIVADDDVWDNYIKA  282


 Score =   128 bits (322),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 118/198 (60%), Gaps = 12/198 (6%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPT----  1171
             V  HP+ + YR K +  +N+L +I+ HT ADGRYSLS  DIDF++++  +    PT    
Sbjct  110   VKVHPDAQFYRNKALMTFNDLCLIYAHTKADGRYSLSSHDIDFDDDIHCVGMNSPTLAPG  169

Query  1170  ----KDDAKKI----DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
                    A K+    DW   M++ F++LML+Q+ +G+K N +FK +AW  M+T FN  FG
Sbjct  170   TGLVPPPASKVQTNTDWKPPMDRFFLKLMLDQLGKGSKTNNSFKKQAWKDMVTLFNAKFG  229

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
              QY K  LK  +  L + +  V+ +L+  GF W E+ QMIVA+D VW   IKA    R Y
Sbjct  230   SQYRKSFLKQLYKKLLKYFTDVRSILAIKGFYWDEKEQMIVADDDVWDNYIKALPDARLY  289

Query  834   RNKSLSFYKDMSIICGNE  781
             R K L  Y+D+++I GNE
Sbjct  290   RKKPLLNYQDLNLIYGNE  307


 Score = 97.4 bits (241),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 78/119 (66%), Gaps = 7/119 (6%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E   ++WT  MD YFI+L+L+Q++ G+  ++ FS+ AW EM++ F  ++  +HD DVLK+
Sbjct  498   EPSLTDWTPPMDRYFIDLMLEQVRNGSMVNSKFSRLAWTEMVSKFRAEFGFQHDKDVLKS  557

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAH  1364
             R+ +LRKQ++  K +L+++ F WD+ + MVT +D  WD Y+K        S+H+ +  H
Sbjct  558   RFFNLRKQFNGMKSLLDESGFAWDEMQHMVTADDHLWDAYVKAN------SSHVLVQEH  610


 Score = 33.5 bits (75),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 43/82 (52%), Gaps = 2/82 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI-LEDKIPTKDDAKK  1153
             HP++  YR + +P +N+L +I+G      R S+S   +D +  V + +E +I  +   +K
Sbjct  610   HPDVRSYRNRALPNFNDLYLIYGDGDIFKRESISSHTMDDDLGVNLAMEYEISDQQKKRK  669

Query  1152  IDWSETMEQHFIQLML-EQVQE  1090
                S T      Q ++ E++QE
Sbjct  670   PAASSTSASKRAQRIIKEEIQE  691


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 81/121 (67%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + ++SE LR++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+  +  
Sbjct  1     MGSQNPTNSERLRTSWTLPMERYFIDLMLDQVHRGNRMGHTFNKQAWNDMLVMFNANFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
              +D ++LK+ Y  L KQ+++ K +L+QN F WD+++QMV  +   WD Y+KV    Q + 
Sbjct  61    PYDVNILKSHYTSLWKQFNDIKNLLDQNGFSWDNTQQMVIADRYAWDAYVKVHPDAQFYR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 76/139 (55%), Gaps = 0/139 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT  +  +  W+  ME++FI LML+QV  GN++  TF  +AW  M+  FN  FG  Y   
Sbjct  6     PTNSERLRTSWTLPMERYFIDLMLDQVHRGNRMGHTFNKQAWNDMLVMFNANFGSPYDVN  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             +LK+ +  L +Q+  +K LL Q+GF W    QM++A+   W   +K     + YRNK+L 
Sbjct  66    ILKSHYTSLWKQFNDIKNLLDQNGFSWDNTQQMVIADRYAWDAYVKVHPDAQFYRNKALM  125

Query  816   FYKDMSIICGNETPTFQYG  760
              + D+ +I  +     +Y 
Sbjct  126   TFNDLCLIYAHTKADGRYS  144



>ref|XP_004497637.1| PREDICTED: uncharacterized protein LOC101498269 isoform X3 [Cicer 
arietinum]
Length=691

 Score =   205 bits (521),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 131/199 (66%), Gaps = 13/199 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE---NEVKILED--------  1183
             HP+ + ++ KVVP YN+L II+GH VADGRYSLSCFD  FE   N  K L+D        
Sbjct  113   HPDAKAFKKKVVPCYNDLCIIYGHAVADGRYSLSCFDEGFEYEENASKELDDPTSTSKGV  172

Query  1182  --KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
               + P      KIDWS  M++ F++LML+QV++GNK++RTF  +AW  M   FN  FG  
Sbjct  173   DGQTPPTISQSKIDWSPMMDRVFVELMLDQVRKGNKIDRTFTRQAWGDMAELFNDRFGCH  232

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             YGKVVLK RFN+LRR Y ++  LL ++GF W ++   +VA+D+VW+K I+A   FR YR 
Sbjct  233   YGKVVLKNRFNVLRRHYGSINVLLGKEGFSWDKKQHKVVADDQVWQKCIRANHKFRLYRT  292

Query  828   KSLSFYKDMSIICGNETPT  772
             KS+ FY  MSI+C +E  T
Sbjct  293   KSMPFYSGMSIVCRDEATT  311


 Score =   109 bits (273),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DD+  + +  R+NWT   D YF+EL+L  + +GNRT   F++ AW +M   F++K+  
Sbjct  1     MADDALINLDNSRANWTPSQDQYFLELMLSHVHRGNRTGKVFTRLAWADMTEQFNNKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K D DVLKNRYK  +K Y+  K I+ QN F WD +  M+T +D+ W++YIKV    + F 
Sbjct  61    KFDVDVLKNRYKRFKKLYYEIKTIVSQNGFKWDGTLNMITADDKTWEEYIKVHPDAKAFK  120

Query  1387  NHLKIIAHY  1361
                K++  Y
Sbjct  121   K--KVVPCY  127


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 75/134 (56%), Gaps = 0/134 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+ + +Q+F++LML  V  GN+  + F   AW  M   FN  FGF++   VLK 
Sbjct  10    DNSRANWTPSQDQYFLELMLSHVHRGNRTGKVFTRLAWADMTEQFNNKFGFKFDVDVLKN  69

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+   ++ Y+ +K ++SQ+GF W     MI A+D+ W++ IK     + ++ K +  Y D
Sbjct  70    RYKRFKKLYYEIKTIVSQNGFKWDGTLNMITADDKTWEEYIKVHPDAKAFKKKVVPCYND  129

Query  804   MSIICGNETPTFQY  763
             + II G+     +Y
Sbjct  130   LCIIYGHAVADGRY  143


 Score = 84.7 bits (208),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = -1

Query  1702  NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             +W+ +MD  F+EL+LDQ++KGN+   +F++QAW +M  LF+ ++ C +   VLKNR+  L
Sbjct  186   DWSPMMDRVFVELMLDQVRKGNKIDRTFTRQAWGDMAELFNDRFGCHYGKVVLKNRFNVL  245

Query  1522  RKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
             R+ Y +  +L   E F WD  +  V  +D+ W   I+ 
Sbjct  246   RRHYGSINVLLGKEGFSWDKKQHKVVADDQVWQKCIRA  283


 Score = 25.8 bits (55),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRII  1267
             C+ A+ +   YRTK +P+Y+ + I+
Sbjct  280   CIRANHKFRLYRTKSMPFYSGMSIV  304



>ref|XP_004497635.1| PREDICTED: uncharacterized protein LOC101498269 isoform X1 [Cicer 
arietinum]
 ref|XP_004497636.1| PREDICTED: uncharacterized protein LOC101498269 isoform X2 [Cicer 
arietinum]
Length=700

 Score =   205 bits (521),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/199 (49%), Positives = 131/199 (66%), Gaps = 13/199 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE---NEVKILED--------  1183
             HP+ + ++ KVVP YN+L II+GH VADGRYSLSCFD  FE   N  K L+D        
Sbjct  122   HPDAKAFKKKVVPCYNDLCIIYGHAVADGRYSLSCFDEGFEYEENASKELDDPTSTSKGV  181

Query  1182  --KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
               + P      KIDWS  M++ F++LML+QV++GNK++RTF  +AW  M   FN  FG  
Sbjct  182   DGQTPPTISQSKIDWSPMMDRVFVELMLDQVRKGNKIDRTFTRQAWGDMAELFNDRFGCH  241

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             YGKVVLK RFN+LRR Y ++  LL ++GF W ++   +VA+D+VW+K I+A   FR YR 
Sbjct  242   YGKVVLKNRFNVLRRHYGSINVLLGKEGFSWDKKQHKVVADDQVWQKCIRANHKFRLYRT  301

Query  828   KSLSFYKDMSIICGNETPT  772
             KS+ FY  MSI+C +E  T
Sbjct  302   KSMPFYSGMSIVCRDEATT  320


 Score =   109 bits (272),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 79/129 (61%), Gaps = 3/129 (2%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DD+  + +  R+NWT   D YF+EL+L  + +GNRT   F++ AW +M   F++K+  
Sbjct  10    MADDALINLDNSRANWTPSQDQYFLELMLSHVHRGNRTGKVFTRLAWADMTEQFNNKFGF  69

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K D DVLKNRYK  +K Y+  K I+ QN F WD +  M+T +D+ W++YIKV    + F 
Sbjct  70    KFDVDVLKNRYKRFKKLYYEIKTIVSQNGFKWDGTLNMITADDKTWEEYIKVHPDAKAFK  129

Query  1387  NHLKIIAHY  1361
                K++  Y
Sbjct  130   K--KVVPCY  136


 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 75/134 (56%), Gaps = 0/134 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+ + +Q+F++LML  V  GN+  + F   AW  M   FN  FGF++   VLK 
Sbjct  19    DNSRANWTPSQDQYFLELMLSHVHRGNRTGKVFTRLAWADMTEQFNNKFGFKFDVDVLKN  78

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+   ++ Y+ +K ++SQ+GF W     MI A+D+ W++ IK     + ++ K +  Y D
Sbjct  79    RYKRFKKLYYEIKTIVSQNGFKWDGTLNMITADDKTWEEYIKVHPDAKAFKKKVVPCYND  138

Query  804   MSIICGNETPTFQY  763
             + II G+     +Y
Sbjct  139   LCIIYGHAVADGRY  152


 Score = 84.7 bits (208),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 61/98 (62%), Gaps = 1/98 (1%)
 Frame = -1

Query  1702  NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             +W+ +MD  F+EL+LDQ++KGN+   +F++QAW +M  LF+ ++ C +   VLKNR+  L
Sbjct  195   DWSPMMDRVFVELMLDQVRKGNKIDRTFTRQAWGDMAELFNDRFGCHYGKVVLKNRFNVL  254

Query  1522  RKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
             R+ Y +  +L   E F WD  +  V  +D+ W   I+ 
Sbjct  255   RRHYGSINVLLGKEGFSWDKKQHKVVADDQVWQKCIRA  292


 Score = 25.8 bits (55),  Expect(2) = 5e-15, Method: Compositional matrix adjust.
 Identities = 9/25 (36%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRII  1267
             C+ A+ +   YRTK +P+Y+ + I+
Sbjct  289   CIRANHKFRLYRTKSMPFYSGMSIV  313



>gb|KHN35917.1| hypothetical protein glysoja_037803 [Glycine soja]
Length=581

 Score =   201 bits (511),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 133/198 (67%), Gaps = 11/198 (6%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK--  1168
             C+ AHP+ +P++ +V  YY++L II+GH VADGRYSLSCFD+DFE E K L+DK  T   
Sbjct  173   CIKAHPDAQPFKKRVGLYYDDLCIIYGHAVADGRYSLSCFDVDFEYEEKDLDDKTITSKG  232

Query  1167  -DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
              DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  +FN  F 
Sbjct  233   VDDQTTPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFL  292

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               YG+VVL+ RFN+LRR Y ++  LL ++GF W +    +VA+++VW+K I+    FR Y
Sbjct  293   CHYGRVVLRNRFNVLRRHYRSINILLGKEGFSWDKTQHKVVADEQVWRKCIRVHHSFRLY  352

Query  834   RNKSLSFYKDMSIICGNE  781
             + KS+ FY  M I+C NE
Sbjct  353   KIKSMPFYLGMCIVCRNE  370


 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DDS  S + LR+NWT   D YF++LLL  + KGN+T   FS+QAW+ MI  F+ K+  
Sbjct  65    MGDDSFPSLDKLRANWTPSQDRYFLQLLLSHVHKGNKTGKVFSRQAWVNMIEQFNTKFGF  124

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D +VLKNR+K  RKQY++ K I+ Q  F WD ++ M+  +D+ WD+ IK     Q F 
Sbjct  125   KYDVEVLKNRHKRFRKQYNDMKMIVGQKGFRWDGTQNMIVADDKAWDECIKAHPDAQPFK  184

Query  1387  NHLKI  1373
               + +
Sbjct  185   KRVGL  189


 Score =   109 bits (273),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 83/143 (58%), Gaps = 1/143 (1%)
 Frame = -2

Query  1188  EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
             +D  P+ D  +  +W+ + +++F+QL+L  V +GNK  + F  +AW++MI  FNT FGF+
Sbjct  67    DDSFPSLDKLR-ANWTPSQDRYFLQLLLSHVHKGNKTGKVFSRQAWVNMIEQFNTKFGFK  125

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             Y   VLK R    R+QY  +K ++ Q GF W     MIVA+D+ W + IKA    + ++ 
Sbjct  126   YDVEVLKNRHKRFRKQYNDMKMIVGQKGFRWDGTQNMIVADDKAWDECIKAHPDAQPFKK  185

Query  828   KSLSFYKDMSIICGNETPTFQYG  760
             +   +Y D+ II G+     +Y 
Sbjct  186   RVGLYYDDLCIIYGHAVADGRYS  208


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 71/118 (60%), Gaps = 1/118 (1%)
 Frame = -1

Query  1762  LKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALF  1583
             + ++G  +  + +     R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F
Sbjct  228   ITSKGVDDQTTPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESF  287

Query  1582  SHKYKCKHDTDVLKNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
             + ++ C +   VL+NR+  LR+ Y +  IL   E F WD ++  V  +++ W   I+V
Sbjct  288   NKRFLCHYGRVVLRNRFNVLRRHYRSINILLGKEGFSWDKTQHKVVADEQVWRKCIRV  345



>ref|XP_006575275.1| PREDICTED: uncharacterized protein LOC100806239 isoform X2 [Glycine 
max]
Length=517

 Score =   199 bits (506),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 133/198 (67%), Gaps = 11/198 (6%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK--  1168
             C+ AHP+ +P++ +V  YY++L II+GH VADGRYSLSCFD+DFE E K L+DK  T   
Sbjct  109   CIKAHPDAQPFKKRVGLYYDDLCIIYGHAVADGRYSLSCFDVDFEYEEKDLDDKTITSKG  168

Query  1167  -DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
              DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  +FN  F 
Sbjct  169   VDDQTTPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFL  228

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               YG+VVL+ RFN+LRR Y ++  LL ++GF W +    +VA+++VW+K I+    FR Y
Sbjct  229   CHYGRVVLRNRFNVLRRHYRSINILLGKEGFSWDKTQHKVVADEQVWQKCIRVHHSFRLY  288

Query  834   RNKSLSFYKDMSIICGNE  781
             + K++ FY  M I+C NE
Sbjct  289   KIKNMPFYLGMCIVCRNE  306


 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DDS  S + LR+NWT   D YF++LLL  + KGN+T   FS+QAW+ MI  F+ K+  
Sbjct  1     MGDDSFPSLDKLRANWTPSQDRYFLQLLLSHVHKGNKTGKVFSRQAWVNMIEQFNTKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D +VLKNR+K  RKQY++ K I+ Q  F WD ++ M+  +D+ WD+ IK     Q F 
Sbjct  61    KYDVEVLKNRHKRFRKQYNDMKMIVGQKGFRWDGTQNMIVADDKAWDECIKAHPDAQPFK  120

Query  1387  NHLKI  1373
               + +
Sbjct  121   KRVGL  125


 Score =   110 bits (274),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 83/143 (58%), Gaps = 1/143 (1%)
 Frame = -2

Query  1188  EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
             +D  P+ D  +  +W+ + +++F+QL+L  V +GNK  + F  +AW++MI  FNT FGF+
Sbjct  3     DDSFPSLDKLR-ANWTPSQDRYFLQLLLSHVHKGNKTGKVFSRQAWVNMIEQFNTKFGFK  61

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             Y   VLK R    R+QY  +K ++ Q GF W     MIVA+D+ W + IKA    + ++ 
Sbjct  62    YDVEVLKNRHKRFRKQYNDMKMIVGQKGFRWDGTQNMIVADDKAWDECIKAHPDAQPFKK  121

Query  828   KSLSFYKDMSIICGNETPTFQYG  760
             +   +Y D+ II G+     +Y 
Sbjct  122   RVGLYYDDLCIIYGHAVADGRYS  144


 Score = 84.3 bits (207),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  182   RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRVVLRNRFN  241

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  IL   E F WD ++  V  +++ W   I+V
Sbjct  242   VLRRHYRSINILLGKEGFSWDKTQHKVVADEQVWQKCIRV  281



>ref|XP_010556713.1| PREDICTED: uncharacterized protein At2g29880 isoform X1 [Tarenaya 
hassleriana]
Length=502

 Score =   128 bits (321),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 112/209 (54%), Gaps = 28/209 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVAD--GRYS--------LSCFDIDFENEVKI----  1192
             HP++   R K VPYY +L +I+   +++  GR+S        ++  + +   E  I    
Sbjct  151   HPDVRSLRIKSVPYYRDLCLIYADGMSEQKGRFSPHRCQGTTMASPEEETSTETLIQGGE  210

Query  1191  ---------LEDKIPTKDDAK-----KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKA  1054
                      ++D      +AK     +  W   M+++FI LML+QV+ GN++   F+ +A
Sbjct  211   GYRVCGSAAIDDSSHLVSNAKGTTRSRTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQA  270

Query  1053  WIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVW  874
             W  M+ +FN  F   Y   VLK R+  LRRQY A+K LL  DGF W +  QM+ A+D +W
Sbjct  271   WTEMVNSFNAKFESNYDVDVLKNRYKTLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLW  330

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             ++ IK  +  R++  + + +YKD+ ++CG
Sbjct  331   QEYIKVHKDARQFMTRPIPYYKDLCLLCG  359


 Score =   106 bits (264),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHK  1574
             G+M+      SE LR+ WT  MD YFI+L+L+Q++KGNR     FSK+AW  M   F+ K
Sbjct  36    GSMDTHRNGGSERLRTVWTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAK  95

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +K  +  DVLKNR+K LR  Y   KI LEQ+ F WD+ +QMV  +++ WD+Y+KV
Sbjct  96    FKSPYGKDVLKNRHKTLRNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKV  150


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+LDQ+++GN+    F KQAW EM+  F+ K++  +D DVLKNRYK
Sbjct  237   RTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQAWTEMVNSFNAKFESNYDVDVLKNRYK  296

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ + F WDD RQMVT +D  W +YIKV    ++F
Sbjct  297   TLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLWQEYIKVHKDARQF  343


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV++GN+ +   F  +AW  M  +F   F   YGK VLK R   L
Sbjct  53    WTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAKFKSPYGKDVLKNRHKTL  112

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  Y  VK LL QDGF W ER QM+VA++ +W + +K     R  R KS+ +Y+D+ +I
Sbjct  113   RNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKVHPDVRSLRIKSVPYYRDLCLI  171



>ref|XP_010556715.1| PREDICTED: uncharacterized protein At2g29880 isoform X3 [Tarenaya 
hassleriana]
Length=479

 Score =   128 bits (321),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 112/209 (54%), Gaps = 28/209 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVAD--GRYS--------LSCFDIDFENEVKI----  1192
             HP++   R K VPYY +L +I+   +++  GR+S        ++  + +   E  I    
Sbjct  128   HPDVRSLRIKSVPYYRDLCLIYADGMSEQKGRFSPHRCQGTTMASPEEETSTETLIQGGE  187

Query  1191  ---------LEDKIPTKDDAK-----KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKA  1054
                      ++D      +AK     +  W   M+++FI LML+QV+ GN++   F+ +A
Sbjct  188   GYRVCGSAAIDDSSHLVSNAKGTTRSRTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQA  247

Query  1053  WIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVW  874
             W  M+ +FN  F   Y   VLK R+  LRRQY A+K LL  DGF W +  QM+ A+D +W
Sbjct  248   WTEMVNSFNAKFESNYDVDVLKNRYKTLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLW  307

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             ++ IK  +  R++  + + +YKD+ ++CG
Sbjct  308   QEYIKVHKDARQFMTRPIPYYKDLCLLCG  336


 Score =   106 bits (264),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHK  1574
             G+M+      SE LR+ WT  MD YFI+L+L+Q++KGNR     FSK+AW  M   F+ K
Sbjct  13    GSMDTHRNGGSERLRTVWTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAK  72

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +K  +  DVLKNR+K LR  Y   KI LEQ+ F WD+ +QMV  +++ WD+Y+KV
Sbjct  73    FKSPYGKDVLKNRHKTLRNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKV  127


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+LDQ+++GN+    F KQAW EM+  F+ K++  +D DVLKNRYK
Sbjct  214   RTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQAWTEMVNSFNAKFESNYDVDVLKNRYK  273

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ + F WDD RQMVT +D  W +YIKV    ++F
Sbjct  274   TLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLWQEYIKVHKDARQF  320


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV++GN+ +   F  +AW  M  +F   F   YGK VLK R   L
Sbjct  30    WTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAKFKSPYGKDVLKNRHKTL  89

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  Y  VK LL QDGF W ER QM+VA++ +W + +K     R  R KS+ +Y+D+ +I
Sbjct  90    RNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKVHPDVRSLRIKSVPYYRDLCLI  148



>gb|KEH41857.1| Myb/SANT-like DNA-binding domain protein [Medicago truncatula]
Length=684

 Score =   199 bits (507),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 126/199 (63%), Gaps = 13/199 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE-------------VKI  1192
             AHP+ + +R K+ P YN+L II+GHTVADGRYSLSCFD  FE E              K 
Sbjct  121   AHPDAQVFRKKLFPCYNDLCIIYGHTVADGRYSLSCFDEGFEYEENASKELDDHTSTSKG  180

Query  1191  LEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGF  1012
             ++D+ P      KIDWS  M++ F++LML+QV++GNK  RTF  +AW  M  +FN  FG 
Sbjct  181   VDDQTPPTPSQSKIDWSPMMDRVFVELMLDQVRKGNKAGRTFTRQAWGDMAESFNNRFGC  240

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
              YGKVVLK RFN+L R Y ++  LL ++GF W +    +VA D+VW+K I+    FR YR
Sbjct  241   HYGKVVLKNRFNVLSRHYSSINELLGKEGFSWDKAQHKVVANDQVWQKCIRVNHKFRLYR  300

Query  831   NKSLSFYKDMSIICGNETP  775
              KS+ FY  M I+C +E P
Sbjct  301   IKSMPFYSGMCIVCRDEAP  319


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             + DDS  + +  R+NWT   D YF+ELLL  + KGN+T   F++ AW +M   F+ K+  
Sbjct  10    IGDDSSINLDNSRANWTPSQDQYFLELLLSHVHKGNKTGKVFTRLAWADMTEQFNSKFGF  69

Query  1564  KHDTDVLKNRYKHLRKQYHNTKIL-EQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D DVLKNRYK  +KQY+  K +  QN F WD     +T ND+ W++YIK     Q F 
Sbjct  70    KYDVDVLKNRYKRFKKQYYEIKAMASQNGFQWDGRLNTITANDKTWEEYIKAHPDAQVFR  129

Query  1387  NHL  1379
               L
Sbjct  130   KKL  132


 Score =   107 bits (268),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 76/134 (57%), Gaps = 0/134 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  + +W+ + +Q+F++L+L  V +GNK  + F   AW  M   FN+ FGF+Y   VLK 
Sbjct  19    DNSRANWTPSQDQYFLELLLSHVHKGNKTGKVFTRLAWADMTEQFNSKFGFKYDVDVLKN  78

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+   ++QY+ +K + SQ+GF W  R   I A D+ W++ IKA    + +R K    Y D
Sbjct  79    RYKRFKKQYYEIKAMASQNGFQWDGRLNTITANDKTWEEYIKAHPDAQVFRKKLFPCYND  138

Query  804   MSIICGNETPTFQY  763
             + II G+     +Y
Sbjct  139   LCIIYGHTVADGRY  152


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 69/113 (61%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              ++D +  +    + +W+ +MD  F+EL+LDQ++KGN+   +F++QAW +M   F++++ 
Sbjct  180   GVDDQTPPTPSQSKIDWSPMMDRVFVELMLDQVRKGNKAGRTFTRQAWGDMAESFNNRFG  239

Query  1567  CKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             C +   VLKNR+  L + Y +  ++L +  F WD ++  V  ND+ W   I+V
Sbjct  240   CHYGKVVLKNRFNVLSRHYSSINELLGKEGFSWDKAQHKVVANDQVWQKCIRV  292



>ref|XP_010556714.1| PREDICTED: uncharacterized protein At2g29880 isoform X2 [Tarenaya 
hassleriana]
Length=501

 Score =   125 bits (315),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 65/210 (31%), Positives = 105/210 (50%), Gaps = 31/210 (15%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIF----------------GHTVADGRYSLS----------  1228
             HP++   R K VPYY +L +I+                G T+A      S          
Sbjct  151   HPDVRSLRIKSVPYYRDLCLIYADGMSEQKGFSPHRCQGTTMASPEEETSTETLIQGGEG  210

Query  1227  ---CFDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNK  1057
                C     ++   ++ +   T     +  W   M+++FI LML+QV+ GN++   F+ +
Sbjct  211   YRVCGSAAIDDSSHLVSNAKGTT--RSRTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQ  268

Query  1056  AWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRV  877
             AW  M+ +FN  F   Y   VLK R+  LRRQY A+K LL  DGF W +  QM+ A+D +
Sbjct  269   AWTEMVNSFNAKFESNYDVDVLKNRYKTLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSL  328

Query  876   WKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             W++ IK  +  R++  + + +YKD+ ++CG
Sbjct  329   WQEYIKVHKDARQFMTRPIPYYKDLCLLCG  358


 Score =   106 bits (264),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 76/115 (66%), Gaps = 2/115 (2%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHK  1574
             G+M+      SE LR+ WT  MD YFI+L+L+Q++KGNR     FSK+AW  M   F+ K
Sbjct  36    GSMDTHRNGGSERLRTVWTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAK  95

Query  1573  YKCKHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +K  +  DVLKNR+K LR  Y   KI LEQ+ F WD+ +QMV  +++ WD+Y+KV
Sbjct  96    FKSPYGKDVLKNRHKTLRNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKV  150


 Score =   113 bits (283),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+LDQ+++GN+    F KQAW EM+  F+ K++  +D DVLKNRYK
Sbjct  236   RTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQAWTEMVNSFNAKFESNYDVDVLKNRYK  295

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ + F WDD RQMVT +D  W +YIKV    ++F
Sbjct  296   TLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLWQEYIKVHKDARQF  342


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV++GN+ +   F  +AW  M  +F   F   YGK VLK R   L
Sbjct  53    WTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAKFKSPYGKDVLKNRHKTL  112

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  Y  VK LL QDGF W ER QM+VA++ +W + +K     R  R KS+ +Y+D+ +I
Sbjct  113   RNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKVHPDVRSLRIKSVPYYRDLCLI  171



>ref|XP_010556717.1| PREDICTED: uncharacterized protein At2g29880 isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010556718.1| PREDICTED: uncharacterized protein At2g29880 isoform X4 [Tarenaya 
hassleriana]
 ref|XP_010556719.1| PREDICTED: uncharacterized protein At2g29880 isoform X4 [Tarenaya 
hassleriana]
Length=465

 Score =   128 bits (321),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 112/209 (54%), Gaps = 28/209 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVAD--GRYS--------LSCFDIDFENEVKI----  1192
             HP++   R K VPYY +L +I+   +++  GR+S        ++  + +   E  I    
Sbjct  114   HPDVRSLRIKSVPYYRDLCLIYADGMSEQKGRFSPHRCQGTTMASPEEETSTETLIQGGE  173

Query  1191  ---------LEDKIPTKDDAK-----KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKA  1054
                      ++D      +AK     +  W   M+++FI LML+QV+ GN++   F+ +A
Sbjct  174   GYRVCGSAAIDDSSHLVSNAKGTTRSRTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQA  233

Query  1053  WIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVW  874
             W  M+ +FN  F   Y   VLK R+  LRRQY A+K LL  DGF W +  QM+ A+D +W
Sbjct  234   WTEMVNSFNAKFESNYDVDVLKNRYKTLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLW  293

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             ++ IK  +  R++  + + +YKD+ ++CG
Sbjct  294   QEYIKVHKDARQFMTRPIPYYKDLCLLCG  322


 Score =   103 bits (257),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 2/107 (2%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
               SE LR+ WT  MD YFI+L+L+Q++KGNR     FSK+AW  M   F+ K+K  +  D
Sbjct  7     GGSERLRTVWTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAKFKSPYGKD  66

Query  1549  VLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             VLKNR+K LR  Y   KI LEQ+ F WD+ +QMV  +++ WD+Y+KV
Sbjct  67    VLKNRHKTLRNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKV  113


 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+LDQ+++GN+    F KQAW EM+  F+ K++  +D DVLKNRYK
Sbjct  200   RTSWHPPMDRYFIDLMLDQVRRGNQIEGVFRKQAWTEMVNSFNAKFESNYDVDVLKNRYK  259

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ + F WDD RQMVT +D  W +YIKV    ++F
Sbjct  260   TLRRQYNAIKSLLQSDGFSWDDCRQMVTADDSLWQEYIKVHKDARQF  306


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 73/119 (61%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV++GN+ +   F  +AW  M  +F   F   YGK VLK R   L
Sbjct  16    WTPEMDRYFIDLMLEQVKKGNRFDDHLFSKRAWKSMSLSFTAKFKSPYGKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  Y  VK LL QDGF W ER QM+VA++ +W + +K     R  R KS+ +Y+D+ +I
Sbjct  76    RNMYKMVKILLEQDGFCWDERKQMVVADNDLWDEYLKVHPDVRSLRIKSVPYYRDLCLI  134



>ref|XP_006575274.1| PREDICTED: uncharacterized protein LOC100806239 isoform X1 [Glycine 
max]
Length=524

 Score =   192 bits (489),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 133/205 (65%), Gaps = 18/205 (9%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV-------KILED  1183
             C+ AHP+ +P++ +V  YY++L II+GH VADGRYSLSCFD+DFE E        K L+D
Sbjct  109   CIKAHPDAQPFKKRVGLYYDDLCIIYGHAVADGRYSLSCFDVDFEYEGGNKYLDEKDLDD  168

Query  1182  KIPTK---DDAK--------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMIT  1036
             K  T    DD          +IDWS  M+Q F++LM++QV +GNK+  TF+ KAW+ M  
Sbjct  169   KTITSKGVDDQTTPAVVNQGRIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTE  228

Query  1035  AFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKA  856
             +FN  F   YG+VVL+ RFN+LRR Y ++  LL ++GF W +    +VA+++VW+K I+ 
Sbjct  229   SFNKRFLCHYGRVVLRNRFNVLRRHYRSINILLGKEGFSWDKTQHKVVADEQVWQKCIRV  288

Query  855   QQYFRRYRNKSLSFYKDMSIICGNE  781
                FR Y+ K++ FY  M I+C NE
Sbjct  289   HHSFRLYKIKNMPFYLGMCIVCRNE  313


 Score =   114 bits (285),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 1/125 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M DDS  S + LR+NWT   D YF++LLL  + KGN+T   FS+QAW+ MI  F+ K+  
Sbjct  1     MGDDSFPSLDKLRANWTPSQDRYFLQLLLSHVHKGNKTGKVFSRQAWVNMIEQFNTKFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D +VLKNR+K  RKQY++ K I+ Q  F WD ++ M+  +D+ WD+ IK     Q F 
Sbjct  61    KYDVEVLKNRHKRFRKQYNDMKMIVGQKGFRWDGTQNMIVADDKAWDECIKAHPDAQPFK  120

Query  1387  NHLKI  1373
               + +
Sbjct  121   KRVGL  125


 Score =   110 bits (274),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 83/142 (58%), Gaps = 1/142 (1%)
 Frame = -2

Query  1188  EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
             +D  P+ D  +  +W+ + +++F+QL+L  V +GNK  + F  +AW++MI  FNT FGF+
Sbjct  3     DDSFPSLDKLR-ANWTPSQDRYFLQLLLSHVHKGNKTGKVFSRQAWVNMIEQFNTKFGFK  61

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             Y   VLK R    R+QY  +K ++ Q GF W     MIVA+D+ W + IKA    + ++ 
Sbjct  62    YDVEVLKNRHKRFRKQYNDMKMIVGQKGFRWDGTQNMIVADDKAWDECIKAHPDAQPFKK  121

Query  828   KSLSFYKDMSIICGNETPTFQY  763
             +   +Y D+ II G+     +Y
Sbjct  122   RVGLYYDDLCIIYGHAVADGRY  143


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 64/100 (64%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  189   RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRVVLRNRFN  248

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  IL   E F WD ++  V  +++ W   I+V
Sbjct  249   VLRRHYRSINILLGKEGFSWDKTQHKVVADEQVWQKCIRV  288



>gb|KDO59524.1| hypothetical protein CISIN_1g002555mg [Citrus sinensis]
Length=599

 Score =   127 bits (320),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 104/190 (55%), Gaps = 5/190 (3%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADG-----RYSLSCFDIDFENEVKILEDKI  1177
             CV  +PE  PYR + +P +N+L +I+G    D       YS+   D  F  ++   +D+ 
Sbjct  266   CVKEYPEARPYRHRTLPNFNDLFLIYGSKSTDTGPNCLSYSMDNGDYPFGVDLGEEDDQS  325

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P   ++  + W+  ME++F+ L+LEQV  GNK+   F ++AW  MI +FN  FG Q  K 
Sbjct  326   PNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKFNDRAWSWMIASFNEKFGLQCDKG  385

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VL+  +  L  +Y  +   LS++GF+W +  Q +VA+D VW+  I+       +R  SL 
Sbjct  386   VLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVADDDVWESYIQEYADAFAFRESSLR  445

Query  816   FYKDMSIICG  787
              Y D+ +I G
Sbjct  446   IYDDLRVIFG  455


 Score = 95.1 bits (235),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ++D CS+++     WT  MD +FI+L+L+Q+++G      FSK AW EM+A F  ++  +
Sbjct  164   KNDCCSTTD-----WTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVAKFRAEFGSQ  218

Query  1561  HDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H+ DVLK+R+ +L+K++++ K +L+Q+ FIWD+ +QM+T + + WD  +K
Sbjct  219   HNKDVLKSRFMNLKKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVK  268


 Score =   126 bits (317),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 102/184 (55%), Gaps = 5/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ E Y+ K  P YN+L +I+G   +DG ++ S      +N         P  D     
Sbjct  117   HPDAESYKNKPTPNYNDLCLIYGTATSDGIHNRS-----IQNHSCNGLGTKPKNDCCSTT  171

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++ FI LMLEQV++G  +++ F   AW  M+  F   FG Q+ K VLK+RF  L
Sbjct  172   DWTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVAKFRAEFGSQHNKDVLKSRFMNL  231

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             ++++  +K LL Q GF+W E  QMI A   +W   +K     R YR+++L  + D+ +I 
Sbjct  232   KKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVKEYPEARPYRHRTLPNFNDLFLIY  291

Query  789   GNET  778
             G+++
Sbjct  292   GSKS  295


 Score = 91.3 bits (225),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 70/105 (67%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
              + + LR+NWT +MD YFI+L+LDQ+++G++T  +FS +AW++M   F  ++  ++D D+
Sbjct  11    GNRDCLRTNWTPLMDRYFIDLMLDQVREGHKTGYTFSNEAWIDMALSFVDRFGLQYDKDL  70

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK ++  L K Y++ K +L Q  F WD+ +QMVT     W  YIK
Sbjct  71    LKIQHNSLGKVYNDLKNLLAQRGFSWDERKQMVTAYGGVWAAYIK  115


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 78/137 (57%), Gaps = 0/137 (0%)
 Frame = -2

Query  1188  EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
             E ++    D  + +W+  M+++FI LML+QV+EG+K   TF N+AWI M  +F   FG Q
Sbjct  6     ERQVDGNRDCLRTNWTPLMDRYFIDLMLDQVREGHKTGYTFSNEAWIDMALSFVDRFGLQ  65

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
             Y K +LK + N L + Y  +K LL+Q GF W ER QM+ A   VW   IK       Y+N
Sbjct  66    YDKDLLKIQHNSLGKVYNDLKNLLAQRGFSWDERKQMVTAYGGVWAAYIKEHPDAESYKN  125

Query  828   KSLSFYKDMSIICGNET  778
             K    Y D+ +I G  T
Sbjct  126   KPTPNYNDLCLIYGTAT  142


 Score = 86.7 bits (213),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L YS  +       + G  +D S ++  +   +WT+ M+ YF++LLL+Q+  GN+    F
Sbjct  303   LSYSMDNGDYPFGVDLGEEDDQSPNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKF  362

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGN  1442
             + +AW  MIA F+ K+  + D  VL+  Y  L ++Y+N T  L +N F+WDD +Q V  +
Sbjct  363   NDRAWSWMIASFNEKFGLQCDKGVLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVAD  422

Query  1441  DEKWDDYIK  1415
             D+ W+ YI+
Sbjct  423   DDVWESYIQ  431


 Score = 28.1 bits (61),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 2/43 (5%)
 Frame = -2

Query  1311  YRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILED  1183
             +R   +  Y++LR+IFG+   +GR  LS      EN+  I  D
Sbjct  439   FRESSLRIYDDLRVIFGYRSFNGR--LSGVGAKVENDDNIFTD  479



>gb|KDO87097.1| hypothetical protein CISIN_1g009421mg [Citrus sinensis]
Length=321

 Score =   122 bits (306),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 69/203 (34%), Positives = 101/203 (50%), Gaps = 46/203 (23%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTV------------------------ADGRYSLSCF  1222
             HPE   YR K VPYYN+L +I+G+                          AD  +  S  
Sbjct  114   HPEARSYRIKTVPYYNDLCLIYGNKASEQKDEQVGGKLLESLQLQEKEKDADTTHPRSAS  173

Query  1221  DIDFEN--EVKILEDKIPTKDDAKKID--------------------WSETMEQHFIQLM  1108
             + + E+  E+++ ED   +       D                    W   M+++FI LM
Sbjct  174   EGEAEDRDEIRVDEDNSVSMSKGDVDDTLQVISNGAESIVANRSRTYWQPPMDRYFIDLM  233

Query  1107  LEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQD  928
             LEQVQ+GN+++  F+ +AWI MI +FN  FGF+Y   +LK R+  LRRQY  +K LL  +
Sbjct  234   LEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYKTLRRQYNVIKNLLDLN  293

Query  927   GFMWHERHQMIVAEDRVWKKVIK  859
             GF+W E  QM+ A+D VW+  +K
Sbjct  294   GFVWDEARQMVTADDYVWQDYVK  316


 Score =   100 bits (249),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             R+ WT  MD YFI+L+L+Q+ KGNR     FSK+AW +M ++FS K+K ++  DVLKNRY
Sbjct  13    RTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLKNRY  72

Query  1531  KHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K LR  Y   K +L+Q  F WD+ RQMVT ++  W++YIK
Sbjct  73    KTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIK  112


 Score =   117 bits (294),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+L+Q+QKGNR    F K+AW+EMI  F+ K+  K+D ++LKNRYK
Sbjct  218   RTYWQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYK  277

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+QY+  K +L+ N F+WD++RQMVT +D  W DY+KV
Sbjct  278   TLRRQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKV  317


 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT-FKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  +  W+  M+++FI LMLEQ+ +GN+ +   F  +AW  M + F+  F FQY K VLK
Sbjct  10    DRNRTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLK  69

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LR  Y AVK LL Q GF W E  QM+ A++ +W++ IK     R YR K++ +Y 
Sbjct  70    NRYKTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIKEHPEARSYRIKTVPYYN  129

Query  807   DMSIICGNET  778
             D+ +I GN+ 
Sbjct  130   DLCLIYGNKA  139



>gb|KDO59523.1| hypothetical protein CISIN_1g002555mg [Citrus sinensis]
Length=725

 Score =   127 bits (318),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 104/190 (55%), Gaps = 5/190 (3%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADG-----RYSLSCFDIDFENEVKILEDKI  1177
             CV  +PE  PYR + +P +N+L +I+G    D       YS+   D  F  ++   +D+ 
Sbjct  392   CVKEYPEARPYRHRTLPNFNDLFLIYGSKSTDTGPNCLSYSMDNGDYPFGVDLGEEDDQS  451

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P   ++  + W+  ME++F+ L+LEQV  GNK+   F ++AW  MI +FN  FG Q  K 
Sbjct  452   PNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKFNDRAWSWMIASFNEKFGLQCDKG  511

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VL+  +  L  +Y  +   LS++GF+W +  Q +VA+D VW+  I+       +R  SL 
Sbjct  512   VLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVADDDVWESYIQEYADAFAFRESSLR  571

Query  816   FYKDMSIICG  787
              Y D+ +I G
Sbjct  572   IYDDLRVIFG  581


 Score = 94.7 bits (234),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ++D CS+++     WT  MD +FI+L+L+Q+++G      FSK AW EM+A F  ++  +
Sbjct  290   KNDCCSTTD-----WTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVAKFRAEFGSQ  344

Query  1561  HDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H+ DVLK+R+ +L+K++++ K +L+Q+ FIWD+ +QM+T + + WD  +K
Sbjct  345   HNKDVLKSRFMNLKKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVK  394


 Score =   125 bits (315),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 102/184 (55%), Gaps = 5/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ E Y+ K  P YN+L +I+G   +DG ++ S      +N         P  D     
Sbjct  243   HPDAESYKNKPTPNYNDLCLIYGTATSDGIHNRS-----IQNHSCNGLGTKPKNDCCSTT  297

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++ FI LMLEQV++G  +++ F   AW  M+  F   FG Q+ K VLK+RF  L
Sbjct  298   DWTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVAKFRAEFGSQHNKDVLKSRFMNL  357

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             ++++  +K LL Q GF+W E  QMI A   +W   +K     R YR+++L  + D+ +I 
Sbjct  358   KKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVKEYPEARPYRHRTLPNFNDLFLIY  417

Query  789   GNET  778
             G+++
Sbjct  418   GSKS  421


 Score = 95.1 bits (235),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L Y+  S+R  ++  R   E     + + LR+NWT +MD YFI+L+LDQ+++G++T  +F
Sbjct  113   LIYANESNRGLSVGMRQGEERQVDGNRDCLRTNWTPLMDRYFIDLMLDQVREGHKTGYTF  172

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGN  1442
             S +AW++M   F  ++  ++D D+LK ++  L K Y++ K +L Q  F WD+ +QMVT  
Sbjct  173   SNEAWIDMALSFVDRFGLQYDKDLLKIQHNSLGKVYNDLKNLLAQRGFSWDERKQMVTAY  232

Query  1441  DEKWDDYIK  1415
                W  YIK
Sbjct  233   GGVWAAYIK  241


 Score =   113 bits (283),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 96/185 (52%), Gaps = 9/185 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP    +R  V+  Y +L +I+ +    G   LS      E      E ++    D  +
Sbjct  93    AHPLAHSFRKTVLLNYRDLDLIYANESNRG---LSVGMRQGE------ERQVDGNRDCLR  143

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
              +W+  M+++FI LML+QV+EG+K   TF N+AWI M  +F   FG QY K +LK + N 
Sbjct  144   TNWTPLMDRYFIDLMLDQVREGHKTGYTFSNEAWIDMALSFVDRFGLQYDKDLLKIQHNS  203

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L + Y  +K LL+Q GF W ER QM+ A   VW   IK       Y+NK    Y D+ +I
Sbjct  204   LGKVYNDLKNLLAQRGFSWDERKQMVTAYGGVWAAYIKEHPDAESYKNKPTPNYNDLCLI  263

Query  792   CGNET  778
              G  T
Sbjct  264   YGTAT  268


 Score = 87.8 bits (216),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1687  MDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYH  1508
             MD YFIEL+LDQ++KGN+   +F+K+AW +M+ LF+ ++  +    +LK RYK L K Y 
Sbjct  1     MDQYFIELMLDQLRKGNKRKNTFTKRAWKDMLFLFNARFCMQQRKRLLKRRYKKLFKYYT  60

Query  1507  NTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             + K +L+Q  F WD+ +QMV  +D+ WD+Y K       F
Sbjct  61    DIKTLLDQRGFSWDEKQQMVVADDDIWDNYNKAHPLAHSF  100


 Score = 99.8 bits (247),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 71/119 (60%), Gaps = 0/119 (0%)
 Frame = -2

Query  1134  MEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYF  955
             M+Q+FI+LML+Q+++GNK   TF  +AW  M+  FN  F  Q  K +LK R+  L + Y 
Sbjct  1     MDQYFIELMLDQLRKGNKRKNTFTKRAWKDMLFLFNARFCMQQRKRLLKRRYKKLFKYYT  60

Query  954   AVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
              +K LL Q GF W E+ QM+VA+D +W    KA      +R   L  Y+D+ +I  NE+
Sbjct  61    DIKTLLDQRGFSWDEKQQMVVADDDIWDNYNKAHPLAHSFRKTVLLNYRDLDLIYANES  119


 Score = 86.3 bits (212),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L YS  +       + G  +D S ++  +   +WT+ M+ YF++LLL+Q+  GN+    F
Sbjct  429   LSYSMDNGDYPFGVDLGEEDDQSPNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKF  488

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGN  1442
             + +AW  MIA F+ K+  + D  VL+  Y  L ++Y+N T  L +N F+WDD +Q V  +
Sbjct  489   NDRAWSWMIASFNEKFGLQCDKGVLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVAD  548

Query  1441  DEKWDDYIK  1415
             D+ W+ YI+
Sbjct  549   DDVWESYIQ  557


 Score = 28.5 bits (62),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 2/43 (5%)
 Frame = -2

Query  1311  YRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILED  1183
             +R   +  Y++LR+IFG+   +GR  LS      EN+  I  D
Sbjct  565   FRESSLRIYDDLRVIFGYRSFNGR--LSGVGAKVENDDNIFTD  605



>gb|KDO59522.1| hypothetical protein CISIN_1g002555mg [Citrus sinensis]
Length=908

 Score =   127 bits (318),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 104/190 (55%), Gaps = 5/190 (3%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADG-----RYSLSCFDIDFENEVKILEDKI  1177
             CV  +PE  PYR + +P +N+L +I+G    D       YS+   D  F  ++   +D+ 
Sbjct  575   CVKEYPEARPYRHRTLPNFNDLFLIYGSKSTDTGPNCLSYSMDNGDYPFGVDLGEEDDQS  634

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P   ++  + W+  ME++F+ L+LEQV  GNK+   F ++AW  MI +FN  FG Q  K 
Sbjct  635   PNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKFNDRAWSWMIASFNEKFGLQCDKG  694

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VL+  +  L  +Y  +   LS++GF+W +  Q +VA+D VW+  I+       +R  SL 
Sbjct  695   VLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVADDDVWESYIQEYADAFAFRESSLR  754

Query  816   FYKDMSIICG  787
              Y D+ +I G
Sbjct  755   IYDDLRVIFG  764


 Score = 94.7 bits (234),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ++D CS+++     WT  MD +FI+L+L+Q+++G      FSK AW EM+A F  ++  +
Sbjct  473   KNDCCSTTD-----WTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVAKFRAEFGSQ  527

Query  1561  HDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H+ DVLK+R+ +L+K++++ K +L+Q+ FIWD+ +QM+T + + WD  +K
Sbjct  528   HNKDVLKSRFMNLKKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVK  577


 Score =   125 bits (314),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 102/184 (55%), Gaps = 5/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ E Y+ K  P YN+L +I+G   +DG ++ S      +N         P  D     
Sbjct  426   HPDAESYKNKPTPNYNDLCLIYGTATSDGIHNRS-----IQNHSCNGLGTKPKNDCCSTT  480

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++ FI LMLEQV++G  +++ F   AW  M+  F   FG Q+ K VLK+RF  L
Sbjct  481   DWTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVAKFRAEFGSQHNKDVLKSRFMNL  540

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             ++++  +K LL Q GF+W E  QMI A   +W   +K     R YR+++L  + D+ +I 
Sbjct  541   KKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVKEYPEARPYRHRTLPNFNDLFLIY  600

Query  789   GNET  778
             G+++
Sbjct  601   GSKS  604


 Score = 95.1 bits (235),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L Y+  S+R  ++  R   E     + + LR+NWT +MD YFI+L+LDQ+++G++T  +F
Sbjct  296   LIYANESNRGLSVGMRQGEERQVDGNRDCLRTNWTPLMDRYFIDLMLDQVREGHKTGYTF  355

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGN  1442
             S +AW++M   F  ++  ++D D+LK ++  L K Y++ K +L Q  F WD+ +QMVT  
Sbjct  356   SNEAWIDMALSFVDRFGLQYDKDLLKIQHNSLGKVYNDLKNLLAQRGFSWDERKQMVTAY  415

Query  1441  DEKWDDYIK  1415
                W  YIK
Sbjct  416   GGVWAAYIK  424


 Score =   113 bits (283),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 96/185 (52%), Gaps = 9/185 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP    +R  V+  Y +L +I+ +    G   LS      E      E ++    D  +
Sbjct  276   AHPLAHSFRKTVLLNYRDLDLIYANESNRG---LSVGMRQGE------ERQVDGNRDCLR  326

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
              +W+  M+++FI LML+QV+EG+K   TF N+AWI M  +F   FG QY K +LK + N 
Sbjct  327   TNWTPLMDRYFIDLMLDQVREGHKTGYTFSNEAWIDMALSFVDRFGLQYDKDLLKIQHNS  386

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L + Y  +K LL+Q GF W ER QM+ A   VW   IK       Y+NK    Y D+ +I
Sbjct  387   LGKVYNDLKNLLAQRGFSWDERKQMVTAYGGVWAAYIKEHPDAESYKNKPTPNYNDLCLI  446

Query  792   CGNET  778
              G  T
Sbjct  447   YGTAT  451


 Score = 96.3 bits (238),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 48/115 (42%), Positives = 73/115 (63%), Gaps = 1/115 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  S E  +S+WT  MD YFIEL+LDQ++KGN+   +F+K+AW +M+ LF+ ++  +   
Sbjct  169   APESLEPAKSDWTPDMDQYFIELMLDQLRKGNKRKNTFTKRAWKDMLFLFNARFCMQQRK  228

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +LK RYK L K Y + K +L+Q  F WD+ +QMV  +D+ WD+Y K       F
Sbjct  229   RLLKRRYKKLFKYYTDIKTLLDQRGFSWDEKQQMVVADDDIWDNYNKAHPLAHSF  283


 Score =   149 bits (375),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 116/191 (61%), Gaps = 6/191 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI------PT  1171
             A+P+ + +R + + Y++++ +I+G+T ADGRYS S  D+DF++EV+++   +      P 
Sbjct  112   ANPDAQAFRNRALTYFDDMCLIYGYTQADGRYSRSSHDVDFDDEVQVVITGVEIGSVAPE  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               +  K DW+  M+Q+FI+LML+Q+++GNK   TF  +AW  M+  FN  F  Q  K +L
Sbjct  172   SLEPAKSDWTPDMDQYFIELMLDQLRKGNKRKNTFTKRAWKDMLFLFNARFCMQQRKRLL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L + Y  +K LL Q GF W E+ QM+VA+D +W    KA      +R   L  Y
Sbjct  232   KRRYKKLFKYYTDIKTLLDQRGFSWDEKQQMVVADDDIWDNYNKAHPLAHSFRKTVLLNY  291

Query  810   KDMSIICGNET  778
             +D+ +I  NE+
Sbjct  292   RDLDLIYANES  302


 Score =   122 bits (307),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT  D  ++ W+  ME++FI LML+Q+  GN+L  TF  +AW  M+T FN  FG ++ + 
Sbjct  6     PTTSDRTRVSWTAAMERYFIDLMLDQLHRGNRLGHTFNKQAWTDMMTLFNLKFGTKFDRD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LKT +++L +QY  VK LL Q+GF W +  +M+VAE   W   IKA    + +RN++L+
Sbjct  66    ALKTHYSVLWKQYNDVKILLEQNGFYWDDSRKMVVAEGSTWDAYIKANPDAQAFRNRALT  125

Query  816   FYKDMSIICG  787
             ++ DM +I G
Sbjct  126   YFDDMCLIYG  135


 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + ++S+  R +WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ LF+ K+  
Sbjct  1     MGSHNPTTSDRTRVSWTAAMERYFIDLMLDQLHRGNRLGHTFNKQAWTDMMTLFNLKFGT  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K D D LK  Y  L KQY++ KI LEQN F WDDSR+MV      WD YIK     Q F 
Sbjct  61    KFDRDALKTHYSVLWKQYNDVKILLEQNGFYWDDSRKMVVAEGSTWDAYIKANPDAQAFR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score = 86.3 bits (212),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L YS  +       + G  +D S ++  +   +WT+ M+ YF++LLL+Q+  GN+    F
Sbjct  612   LSYSMDNGDYPFGVDLGEEDDQSPNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKF  671

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGN  1442
             + +AW  MIA F+ K+  + D  VL+  Y  L ++Y+N T  L +N F+WDD +Q V  +
Sbjct  672   NDRAWSWMIASFNEKFGLQCDKGVLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVAD  731

Query  1441  DEKWDDYIK  1415
             D+ W+ YI+
Sbjct  732   DDVWESYIQ  740


 Score = 28.1 bits (61),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 2/43 (5%)
 Frame = -2

Query  1311  YRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILED  1183
             +R   +  Y++LR+IFG+   +GR  LS      EN+  I  D
Sbjct  748   FRESSLRIYDDLRVIFGYRSFNGR--LSGVGAKVENDDNIFTD  788



>ref|XP_006396427.1| hypothetical protein EUTSA_v10028655mg [Eutrema salsugineum]
 gb|ESQ37880.1| hypothetical protein EUTSA_v10028655mg [Eutrema salsugineum]
Length=443

 Score =   125 bits (313),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 61/197 (31%), Positives = 106/197 (54%), Gaps = 14/197 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRY----------SLSCFDIDFEN----EVK  1195
              HP ++ +R K +PYY +L +I+   +++ +           +L   D  + N       
Sbjct  113   GHPNLKSFRIKSIPYYKDLCLIYTDGMSERKAQEDATEGETNTLLEEDEGYNNRKCESTA  172

Query  1194  ILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
             IL +   +     +  W   M+++FI LML+Q + GN+++  F+ +AW  M+  FN  F 
Sbjct  173   ILSNSKGSSIARFRTTWHPPMDRYFIGLMLDQARSGNQIDGVFRKQAWTEMVNLFNAKFE  232

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               +   VLK R+  LRRQ+ A+  LL  DGF W +  QM+ A+D VW+  IKA +  R++
Sbjct  233   SNFNVDVLKNRYKTLRRQFNAIMSLLRSDGFSWDDERQMVTADDNVWQDYIKAHRDARQF  292

Query  834   RNKSLSFYKDMSIICGN  784
               + + +YKD+ ++CG+
Sbjct  293   MTRPIPYYKDLCVLCGD  309


 Score = 96.3 bits (238),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDV  1547
              +E LR+ WT  MD YFIEL+L+Q++KGNR     FSK+AW  M + F+ K++  +  DV
Sbjct  8     GNERLRTVWTPEMDQYFIELMLEQVRKGNRFEDHFFSKRAWKFMSSSFTAKFRFPYGKDV  67

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKNR+K LR  + + K +L+++ F WD++RQMV  ++  WD+Y+K
Sbjct  68    LKNRHKTLRNLFKSVKNLLKEDGFSWDETRQMVIADNSVWDEYLK  112


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKL-NRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+Q+FI+LMLEQV++GN+  +  F  +AW  M ++F   F F YGK VLK R   L
Sbjct  16    WTPEMDQYFIELMLEQVRKGNRFEDHFFSKRAWKFMSSSFTAKFRFPYGKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  + +VK LL +DGF W E  QM++A++ VW + +K     + +R KS+ +YKD+ +I
Sbjct  76    RNLFKSVKNLLKEDGFSWDETRQMVIADNSVWDEYLKGHPNLKSFRIKSIPYYKDLCLI  134


 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 67/106 (63%), Gaps = 1/106 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             SS    R+ W   MD YFI L+LDQ + GN+    F KQAW EM+ LF+ K++   + DV
Sbjct  180   SSIARFRTTWHPPMDRYFIGLMLDQARSGNQIDGVFRKQAWTEMVNLFNAKFESNFNVDV  239

Query  1546  LKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             LKNRYK LR+Q++    +L  + F WDD RQMVT +D  W DYIK 
Sbjct  240   LKNRYKTLRRQFNAIMSLLRSDGFSWDDERQMVTADDNVWQDYIKA  285



>ref|XP_006433278.1| hypothetical protein CICLE_v10000218mg [Citrus clementina]
 ref|XP_006471991.1| PREDICTED: uncharacterized protein LOC102609944 isoform X1 [Citrus 
sinensis]
 ref|XP_006471992.1| PREDICTED: uncharacterized protein LOC102609944 isoform X2 [Citrus 
sinensis]
 gb|ESR46518.1| hypothetical protein CICLE_v10000218mg [Citrus clementina]
Length=908

 Score =   127 bits (318),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 65/190 (34%), Positives = 104/190 (55%), Gaps = 5/190 (3%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADG-----RYSLSCFDIDFENEVKILEDKI  1177
             CV  +PE  PYR + +P +N+L +I+G    D       YS+   D  F  ++   +D+ 
Sbjct  575   CVKEYPEARPYRHRTLPNFNDLFLIYGSKSTDTGPNCLSYSMDNGDYPFGVDLGEEDDQS  634

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P   ++  + W+  ME++F+ L+LEQV  GNK+   F ++AW  MI +FN  FG Q  K 
Sbjct  635   PNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKFNDRAWSWMIASFNEKFGLQCDKG  694

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VL+  +  L  +Y  +   LS++GF+W +  Q +VA+D VW+  I+       +R  SL 
Sbjct  695   VLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVADDDVWESYIQEYADAFAFRESSLR  754

Query  816   FYKDMSIICG  787
              Y D+ +I G
Sbjct  755   IYDDLRVIFG  764


 Score = 94.4 bits (233),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 77/110 (70%), Gaps = 6/110 (5%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ++D CS+++     WT  MD +FI+L+L+Q+++G      FSK AW EM+A F  ++  +
Sbjct  473   KNDCCSTTD-----WTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVANFRAEFGSQ  527

Query  1561  HDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             H+ DVLK+R+ +L+K++++ K +L+Q+ FIWD+ +QM+T + + WD  +K
Sbjct  528   HNKDVLKSRFMNLKKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVK  577


 Score =   125 bits (314),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 102/184 (55%), Gaps = 5/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+ E Y+ K  P YN+L +I+G   +DG ++ S      +N         P  D     
Sbjct  426   HPDAESYKNKPTPNYNDLCLIYGTATSDGIHNRS-----IQNHSCNGLGTKPKNDCCSTT  480

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++ FI LMLEQV++G  +++ F   AW  M+  F   FG Q+ K VLK+RF  L
Sbjct  481   DWTPPMDRFFIDLMLEQVRQGGMIDQKFSKHAWAEMVANFRAEFGSQHNKDVLKSRFMNL  540

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             ++++  +K LL Q GF+W E  QMI A   +W   +K     R YR+++L  + D+ +I 
Sbjct  541   KKRFNDMKNLLDQSGFIWDEMKQMITAHRDLWDACVKEYPEARPYRHRTLPNFNDLFLIY  600

Query  789   GNET  778
             G+++
Sbjct  601   GSKS  604


 Score = 94.7 bits (234),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 80/129 (62%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L Y+  S+R  ++  R   E     + + LR+NWT +MD YFI+L+LDQ+++G++T  +F
Sbjct  296   LIYANESNRGLSVGMRQGEERQVDGNRDCLRTNWTPLMDRYFIDLMLDQVREGHKTGYTF  355

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGN  1442
             S +AW++M   F  ++  ++D D+LK ++  L K Y++ K +L Q  F WD+ +QMVT  
Sbjct  356   SNEAWIDMALSFVDRFGLQYDKDLLKIQHNSLGKVYNDLKNLLAQRGFSWDERKQMVTAY  415

Query  1441  DEKWDDYIK  1415
                W  YIK
Sbjct  416   GGVWAAYIK  424


 Score =   113 bits (283),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/185 (37%), Positives = 96/185 (52%), Gaps = 9/185 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHP    +R  V+  Y +L +I+ +    G   LS      E      E ++    D  +
Sbjct  276   AHPLAHSFRKTVLLNYRDLDLIYANESNRG---LSVGMRQGE------ERQVDGNRDCLR  326

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
              +W+  M+++FI LML+QV+EG+K   TF N+AWI M  +F   FG QY K +LK + N 
Sbjct  327   TNWTPLMDRYFIDLMLDQVREGHKTGYTFSNEAWIDMALSFVDRFGLQYDKDLLKIQHNS  386

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             L + Y  +K LL+Q GF W ER QM+ A   VW   IK       Y+NK    Y D+ +I
Sbjct  387   LGKVYNDLKNLLAQRGFSWDERKQMVTAYGGVWAAYIKEHPDAESYKNKPTPNYNDLCLI  446

Query  792   CGNET  778
              G  T
Sbjct  447   YGTAT  451


 Score = 98.2 bits (243),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 74/115 (64%), Gaps = 1/115 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  S E  +S+WT  MD YFIEL+LDQ++KGN+   +F+K+AW +M+ LF+ ++  +   
Sbjct  169   APESLEPAKSDWTPDMDQYFIELMLDQLRKGNKRKNTFTKRAWKDMLFLFNARFCMQQRK  228

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +LK RYK L K Y +TK +L+Q  F WD+ +QMV  +D+ WD+Y K       F
Sbjct  229   RLLKRRYKKLFKYYTDTKTLLDQRGFSWDEKQQMVVADDDIWDNYNKAHPLAHSF  283


 Score =   148 bits (373),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/191 (38%), Positives = 115/191 (60%), Gaps = 6/191 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI------PT  1171
             A+P+ + +R + + Y++++ +I+G+T ADGRYS S  D+DF++EV+++   +      P 
Sbjct  112   ANPDAQAFRNRALTYFDDMCLIYGYTQADGRYSRSSHDVDFDDEVQVVITGVEIGSVAPE  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               +  K DW+  M+Q+FI+LML+Q+++GNK   TF  +AW  M+  FN  F  Q  K +L
Sbjct  172   SLEPAKSDWTPDMDQYFIELMLDQLRKGNKRKNTFTKRAWKDMLFLFNARFCMQQRKRLL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L + Y   K LL Q GF W E+ QM+VA+D +W    KA      +R   L  Y
Sbjct  232   KRRYKKLFKYYTDTKTLLDQRGFSWDEKQQMVVADDDIWDNYNKAHPLAHSFRKTVLLNY  291

Query  810   KDMSIICGNET  778
             +D+ +I  NE+
Sbjct  292   RDLDLIYANES  302


 Score =   123 bits (308),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 83/130 (64%), Gaps = 0/130 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT  D  ++ W+  ME++FI LML+Q+  GN+L  TF  +AW  M+T FN  FG ++ + 
Sbjct  6     PTTSDRTRVSWTAAMERYFIDLMLDQLHRGNRLGHTFNKQAWTDMMTLFNLKFGTKFDRD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LKT +++L +QY  VK LL Q+GF W +  +M+VAE   W   IKA    + +RN++L+
Sbjct  66    ALKTHYSVLWKQYNDVKILLEQNGFYWDDSRKMVVAEGSTWDAYIKANPDAQAFRNRALT  125

Query  816   FYKDMSIICG  787
             ++ DM +I G
Sbjct  126   YFDDMCLIYG  135


 Score =   112 bits (281),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 76/121 (63%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   + ++S+  R +WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ LF+ K+  
Sbjct  1     MGSHNPTTSDRTRVSWTAAMERYFIDLMLDQLHRGNRLGHTFNKQAWTDMMTLFNLKFGT  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K D D LK  Y  L KQY++ KI LEQN F WDDSR+MV      WD YIK     Q F 
Sbjct  61    KFDRDALKTHYSVLWKQYNDVKILLEQNGFYWDDSRKMVVAEGSTWDAYIKANPDAQAFR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score = 86.3 bits (212),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 75/129 (58%), Gaps = 1/129 (1%)
 Frame = -1

Query  1798  LPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSF  1619
             L YS  +       + G  +D S ++  +   +WT+ M+ YF++LLL+Q+  GN+    F
Sbjct  612   LSYSMDNGDYPFGVDLGEEDDQSPNNGNSASLHWTYPMERYFLDLLLEQVHMGNKIGHKF  671

Query  1618  SKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGN  1442
             + +AW  MIA F+ K+  + D  VL+  Y  L ++Y+N T  L +N F+WDD +Q V  +
Sbjct  672   NDRAWSWMIASFNEKFGLQCDKGVLEELYFSLMEEYNNITDFLSRNGFVWDDIQQTVVAD  731

Query  1441  DEKWDDYIK  1415
             D+ W+ YI+
Sbjct  732   DDVWESYIQ  740


 Score = 28.1 bits (61),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 15/43 (35%), Positives = 23/43 (53%), Gaps = 2/43 (5%)
 Frame = -2

Query  1311  YRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILED  1183
             +R   +  Y++LR+IFG+   +GR  LS      EN+  I  D
Sbjct  748   FRESSLRIYDDLRVIFGYRSFNGR--LSGVGAKVENDDNIFTD  788



>ref|XP_007030898.1| Uncharacterized protein isoform 7 [Theobroma cacao]
 gb|EOY11400.1| Uncharacterized protein isoform 7 [Theobroma cacao]
Length=658

 Score =   130 bits (328),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (54%), Gaps = 10/197 (5%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------ED  1183
             V AHP+   YR K +  Y +LR+I+G+    G  S  C   +     KIL        ED
Sbjct  283   VKAHPDARIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNED  340

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
              +  + +   I W+  M ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY 
Sbjct  341   HLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYD  400

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             +  LK++   LRRQY  +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS
Sbjct  401   EDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKS  460

Query  822   LSFYKDMSIICGNETPT  772
             +  Y  + +I G E+  
Sbjct  461   VPDYHKLCVIFGQESSN  477


 Score = 87.8 bits (216),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       +S E  + +WT  MD +FIEL+L  ++ GN++  +F+KQAW +M+  F+ 
Sbjct  170   NFGVGTTIPPASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNA  229

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             K+   +    L+ RY+ L K Y + + +L Q  F WD+ +QMV  +D  WD+Y+K  
Sbjct  230   KFGFPYGKSFLRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAH  286


 Score =   166 bits (420),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----P  1174
             V   P+ + YR + +  +N+L +I+ +T ADGRYS S  DIDF+++ + +   +     P
Sbjct  120   VKGQPDAQVYRNRTLMNFNDLCLIYAYTQADGRYSRSSHDIDFDDDAQGMNFGVGTTIPP  179

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               D+  KIDW++ M+QHFI+LML  ++ GNK   TF  +AW  M+ +FN  FGF YGK  
Sbjct  180   ASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSF  239

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+  L + Y  V+ LL Q GF W E+ QM+VA+D VW   +KA    R YRNK +  
Sbjct  240   LRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLN  299

Query  813   YKDMSIICGNET  778
             Y+D+ +I GN +
Sbjct  300   YQDLRLIYGNAS  311


 Score =   124 bits (310),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  449   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  507

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  508   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  567

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  568   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  627

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  628   LCLIYGNST  636


 Score =   115 bits (288),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT +D  + +W+ TME++FI LML+Q+  GN+L  TF  +AW  M+T FN  FG +Y + 
Sbjct  16    PTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFGCKYDRD  75

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK+ +  L +QY  VK LL Q+GF W +  ++IVA   VW   +K Q   + YRN++L 
Sbjct  76    TLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVYRNRTLM  135

Query  816   FYKDMSII  793
              + D+ +I
Sbjct  136   NFNDLCLI  143


 Score =   115 bits (288),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M  ++ +S++  R+NWT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ K+ 
Sbjct  10    GMGSNAPTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFG  69

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             CK+D D LK+ Y +L KQY++ K +LEQN F WDD R+++      WD Y+K Q   Q +
Sbjct  70    CKYDRDTLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVY  129

Query  1390  SN  1385
              N
Sbjct  130   RN  131


 Score =   115 bits (287),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  339   EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  398

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  399   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  458

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  459   KSVPDYHKLCVIF  471


 Score = 83.2 bits (204),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  505   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  564

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  565   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  609



>ref|XP_007030897.1| Uncharacterized protein isoform 6 [Theobroma cacao]
 gb|EOY11399.1| Uncharacterized protein isoform 6 [Theobroma cacao]
Length=779

 Score =   130 bits (327),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (54%), Gaps = 10/197 (5%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------ED  1183
             V AHP+   YR K +  Y +LR+I+G+    G  S  C   +     KIL        ED
Sbjct  283   VKAHPDARIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNED  340

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
              +  + +   I W+  M ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY 
Sbjct  341   HLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYD  400

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             +  LK++   LRRQY  +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS
Sbjct  401   EDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKS  460

Query  822   LSFYKDMSIICGNETPT  772
             +  Y  + +I G E+  
Sbjct  461   VPDYHKLCVIFGQESSN  477


 Score = 87.8 bits (216),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       +S E  + +WT  MD +FIEL+L  ++ GN++  +F+KQAW +M+  F+ 
Sbjct  170   NFGVGTTIPPASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNA  229

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             K+   +    L+ RY+ L K Y + + +L Q  F WD+ +QMV  +D  WD+Y+K  
Sbjct  230   KFGFPYGKSFLRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAH  286


 Score =   166 bits (419),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----P  1174
             V   P+ + YR + +  +N+L +I+ +T ADGRYS S  DIDF+++ + +   +     P
Sbjct  120   VKGQPDAQVYRNRTLMNFNDLCLIYAYTQADGRYSRSSHDIDFDDDAQGMNFGVGTTIPP  179

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               D+  KIDW++ M+QHFI+LML  ++ GNK   TF  +AW  M+ +FN  FGF YGK  
Sbjct  180   ASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSF  239

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+  L + Y  V+ LL Q GF W E+ QM+VA+D VW   +KA    R YRNK +  
Sbjct  240   LRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLN  299

Query  813   YKDMSIICGNET  778
             Y+D+ +I GN +
Sbjct  300   YQDLRLIYGNAS  311


 Score =   105 bits (263),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 92/160 (58%), Gaps = 12/160 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTK---DDA  1159
             +P++E YR    P YN+L +I+G++  DG+        D+ +      +   TK      
Sbjct  611   YPDIESYRNISKPNYNDLCLIYGNST-DGK--------DWRSGRDACSNGYGTKLKNGYC  661

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              + DW  +M+++FI LMLE V++G+ +++ F N AW  M+  F+  +G Q  K VLK+RF
Sbjct  662   GRTDWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRF  721

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIK  859
               LR+++  +K LL  DGF W +  QMI+A+D +W   +K
Sbjct  722   MNLRKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLK  761


 Score = 83.2 bits (204),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  505   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  564

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  565   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  609


 Score =   123 bits (309),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  449   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  507

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  508   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  567

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  568   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  627

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  628   LCLIYGNST  636


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT +D  + +W+ TME++FI LML+Q+  GN+L  TF  +AW  M+T FN  FG +Y + 
Sbjct  16    PTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFGCKYDRD  75

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK+ +  L +QY  VK LL Q+GF W +  ++IVA   VW   +K Q   + YRN++L 
Sbjct  76    TLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVYRNRTLM  135

Query  816   FYKDMSII  793
              + D+ +I
Sbjct  136   NFNDLCLI  143


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 82/122 (67%), Gaps = 1/122 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M  ++ +S++  R+NWT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ K+ 
Sbjct  10    GMGSNAPTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFG  69

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             CK+D D LK+ Y +L KQY++ K +LEQN F WDD R+++      WD Y+K Q   Q +
Sbjct  70    CKYDRDTLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVY  129

Query  1390  SN  1385
              N
Sbjct  130   RN  131


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  339   EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  398

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  399   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  458

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  459   KSVPDYHKLCVIF  471


 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 73/107 (68%), Gaps = 2/107 (2%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+L+ +++G+     F+  AW +M+A FS +Y  + D DVLK+R+ 
Sbjct  663   RTDWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFM  722

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             +LRK++++ K +L+ + F WDD RQM+  +D  W  Y+KV ++DQ F
Sbjct  723   NLRKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLKV-LYDQIF  768



>ref|XP_007030895.1| Uncharacterized protein isoform 4 [Theobroma cacao]
 gb|EOY11397.1| Uncharacterized protein isoform 4 [Theobroma cacao]
Length=774

 Score =   130 bits (327),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 73/197 (37%), Positives = 106/197 (54%), Gaps = 10/197 (5%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------ED  1183
             V AHP+   YR K +  Y +LR+I+G+    G  S  C   +     KIL        ED
Sbjct  273   VKAHPDARIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNED  330

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
              +  + +   I W+  M ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY 
Sbjct  331   HLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYD  390

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             +  LK++   LRRQY  +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS
Sbjct  391   EDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKS  450

Query  822   LSFYKDMSIICGNETPT  772
             +  Y  + +I G E+  
Sbjct  451   VPDYHKLCVIFGQESSN  467


 Score = 87.8 bits (216),  Expect(2) = 3e-47, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       +S E  + +WT  MD +FIEL+L  ++ GN++  +F+KQAW +M+  F+ 
Sbjct  160   NFGVGTTIPPASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNA  219

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             K+   +    L+ RY+ L K Y + + +L Q  F WD+ +QMV  +D  WD+Y+K  
Sbjct  220   KFGFPYGKSFLRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAH  276


 Score =   166 bits (420),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----P  1174
             V   P+ + YR + +  +N+L +I+ +T ADGRYS S  DIDF+++ + +   +     P
Sbjct  110   VKGQPDAQVYRNRTLMNFNDLCLIYAYTQADGRYSRSSHDIDFDDDAQGMNFGVGTTIPP  169

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               D+  KIDW++ M+QHFI+LML  ++ GNK   TF  +AW  M+ +FN  FGF YGK  
Sbjct  170   ASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSF  229

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+  L + Y  V+ LL Q GF W E+ QM+VA+D VW   +KA    R YRNK +  
Sbjct  230   LRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLN  289

Query  813   YKDMSIICGNET  778
             Y+D+ +I GN +
Sbjct  290   YQDLRLIYGNAS  301


 Score =   106 bits (265),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 93/160 (58%), Gaps = 6/160 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P++E YR    P YN+L +I+G++  DG+   S  D         L++         + 
Sbjct  601   YPDIESYRNISKPNYNDLCLIYGNST-DGKDWRSGRDACSNGYGTKLKNGY-----CGRT  654

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW  +M+++FI LMLE V++G+ +++ F N AW  M+  F+  +G Q  K VLK+RF  L
Sbjct  655   DWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFMNL  714

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQ  850
             R+++  +K LL  DGF W +  QMI+A+D +W   +K ++
Sbjct  715   RKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLKVKR  754


 Score = 83.2 bits (204),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  495   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  554

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  555   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  599


 Score =   123 bits (309),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  439   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  497

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  498   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  557

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  558   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  617

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  618   LCLIYGNST  626


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT +D  + +W+ TME++FI LML+Q+  GN+L  TF  +AW  M+T FN  FG +Y + 
Sbjct  6     PTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFGCKYDRD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK+ +  L +QY  VK LL Q+GF W +  ++IVA   VW   +K Q   + YRN++L 
Sbjct  66    TLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVYRNRTLM  125

Query  816   FYKDMSII  793
              + D+ +I
Sbjct  126   NFNDLCLI  133


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  329   EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  388

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  389   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  448

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  449   KSVPDYHKLCVIF  461


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M  ++ +S++  R+NWT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ K+ C
Sbjct  1     MGSNAPTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFGC  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D D LK+ Y +L KQY++ K +LEQN F WDD R+++      WD Y+K Q   Q + 
Sbjct  61    KYDRDTLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVYR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 69/101 (68%), Gaps = 1/101 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+L+ +++G+     F+  AW +M+A FS +Y  + D DVLK+R+ 
Sbjct  653   RTDWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFM  712

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQ  1409
             +LRK++++ K +L+ + F WDD RQM+  +D  W  Y+KV+
Sbjct  713   NLRKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLKVK  753



>ref|XP_011023569.1| PREDICTED: uncharacterized protein LOC105125008 [Populus euphratica]
Length=1053

 Score =   110 bits (274),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 67/197 (34%), Positives = 104/197 (53%), Gaps = 29/197 (15%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTK  1168
             A+P+ + Y  K +  +N+L +IF +T ADGRYS S  DID +++++ L         P++
Sbjct  112   ANPDAQYYWRKFLVNFNDLCLIFAYTTADGRYSRSSHDIDLDDDIQGLNFDAGMGGFPSE  171

Query  1167  D-DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               +  K  W+  M++ F++LML QV++G+K N TF  +AW  M+T FN  F  QYGK VL
Sbjct  172   STNCVKAKWTSAMDRFFLELMLVQVKKGSKNNNTFSKEAWKDMLTLFNAKFCSQYGKNVL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L + Y  ++ LL +                       KA      YR K+L  Y
Sbjct  232   KRRYKKLFKYYCEMRSLLER-----------------------KAHPDMHSYRKKTLLNY  268

Query  810   KDMSIICGNETPTFQYG  760
             +D+S++ GNE  +   G
Sbjct  269   QDLSLVYGNELISGHQG  285


 Score =   104 bits (260),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = -1

Query  1720  SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLK  1541
             ++ +R NWT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ ++  K+D D LK
Sbjct  9     NDRMRINWTSTMERYFIDLMLDQLHRGNRMGHTFNKQAWTDMLTMFNSRFGTKYDRDTLK  68

Query  1540  NRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             + Y +L KQY++ K +LEQ+ F WDD+R+MV  +D+ W   IK 
Sbjct  69    SHYSNLWKQYNDVKNLLEQSGFSWDDNRKMVVASDDAWATIIKA  112


 Score =   117 bits (292),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 61/184 (33%), Positives = 101/184 (55%), Gaps = 12/184 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    YR+   P YN+L +I+G++++D  ++ S    +  N                  
Sbjct  579   HPNARSYRSTPKPDYNDLYLIYGNSISDEGHNQSGQGAENCNR------------GCWNA  626

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+Q FI LMLE V++G+ +++ F  +AW  M++ F+ AFG Q+ + VL+ RF  L
Sbjct  627   DWTPPMDQLFIDLMLEHVRQGSMVDQRFNKQAWSDMVSKFSAAFGSQHDQYVLERRFMNL  686

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+ +  +K LL Q GF W ++  MI+A D +W   +K       YRN++L  Y D+ +I 
Sbjct  687   RKLFGDMKNLLDQSGFAWDDQRHMIIAGDSLWNAYLKDYPDAHPYRNRALPNYNDLFLIY  746

Query  789   GNET  778
             G++ 
Sbjct  747   GDKN  750


 Score = 87.4 bits (215),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 73/111 (66%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSC-SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E+D C ++ +  + +WT  MD YFI+L+LDQ+ +GN++S +   QAW++M  + + ++  
Sbjct  467   EEDQCLANGDCSKPDWTPSMDRYFIDLMLDQVHRGNKSSYTLDDQAWIDMAVMLNERFGS  526

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +H+ D+L+ R++ L K ++  K +L Q  F W++++Q+V   D+ W+ Y K
Sbjct  527   QHEKDMLRQRHESLGKLFNGMKNLLGQKGFSWNETQQLVKAYDDVWEAYTK  577


 Score =   113 bits (283),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 62/201 (31%), Positives = 108/201 (54%), Gaps = 17/201 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------HTVADGRYSLSCFDIDFENEVKILEDK  1180
             +P+  PYR + +P YN+L +I+G          H+V  G   +   ++D E+ +  ++  
Sbjct  725   YPDAHPYRNRALPNYNDLFLIYGDKNNHESNHHHSVV-GNGHVFGSNVDDEDGLSPIDSN  783

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
              P       I+W++ ME +FI+LM EQV EGNK + TF  +AW  ++ AFN  FG    +
Sbjct  784   HPW------INWTKPMEIYFIKLMSEQVLEGNKNHETFNEQAWSWIVAAFNEKFGLLCER  837

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
               +++ +  L ++Y  +  +L+Q+GF W E  QM++A++  W   IK      +Y+++ L
Sbjct  838   DDVESWYLSLMKEYSNITNILNQNGFSWDETEQMVIADNDDWSAYIKEHPGAMKYKDRVL  897

Query  819   SFYKDMSIICGNETPTFQYGY  757
               Y D+ +I GN     +  Y
Sbjct  898   GSYNDLCVIYGNRVAAGRASY  918


 Score = 85.5 bits (210),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 64/98 (65%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++WT  MD  FI+L+L+ +++G+     F+KQAW +M++ FS  +  +HD  VL+ R+ +
Sbjct  626   ADWTPPMDQLFIDLMLEHVRQGSMVDQRFNKQAWSDMVSKFSAAFGSQHDQYVLERRFMN  685

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LRK + + K +L+Q+ F WDD R M+   D  W+ Y+K
Sbjct  686   LRKLFGDMKNLLDQSGFAWDDQRHMIIAGDSLWNAYLK  723


 Score =   125 bits (315),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 104/196 (53%), Gaps = 7/196 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFEN---EVKILEDK---IPT  1171
             AHP+M  YR K +  Y +L +++G+ +  G       D +FE+   +VK   +K      
Sbjct  253   AHPDMHSYRKKTLLNYQDLSLVYGNELISGHQGCMQQDENFEDVTLQVKTDRNKGYHHSV  312

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             + DA    W  +M+++FI L+  Q   GNK+      +AW+ +   F   FG QY   +L
Sbjct  313   RSDAGPC-WKSSMDRYFIDLLQNQALIGNKIGHELTTEAWVELTRLFKAKFGSQYDDNIL  371

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K +FN LR +Y  +++LL Q GF W E   M+ AED VW    K   + R YRNKS++ Y
Sbjct  372   KNQFNHLRTRYNDIRFLLEQSGFSWDETQDMVTAEDCVWDSYTKVYPHVRSYRNKSVASY  431

Query  810   KDMSIICGNETPTFQY  763
               + +I G E+ + +Y
Sbjct  432   YKLCVIYGEESSSGRY  447


 Score =   124 bits (311),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 100/186 (54%), Gaps = 4/186 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL----EDKIPTKDD  1162
             +P +  YR K V  Y +L +I+G   + GRYS      D +++  +L    ED+     D
Sbjct  417   YPHVRSYRNKSVASYYKLCVIYGEESSSGRYSDMAQQADTDSKAPVLMVGEEDQCLANGD  476

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               K DW+ +M+++FI LML+QV  GNK + T  ++AWI M    N  FG Q+ K +L+ R
Sbjct  477   CSKPDWTPSMDRYFIDLMLDQVHRGNKSSYTLDDQAWIDMAVMLNERFGSQHEKDMLRQR  536

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                L + +  +K LL Q GF W+E  Q++ A D VW+   K     R YR+     Y D+
Sbjct  537   HESLGKLFNGMKNLLGQKGFSWNETQQLVKAYDDVWEAYTKEHPNARSYRSTPKPDYNDL  596

Query  801   SIICGN  784
              +I GN
Sbjct  597   YLIYGN  602


 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 81/135 (60%), Gaps = 0/135 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +I+W+ TME++FI LML+Q+  GN++  TF  +AW  M+T FN+ FG +Y +  LK
Sbjct  9     NDRMRINWTSTMERYFIDLMLDQLHRGNRMGHTFNKQAWTDMLTMFNSRFGTKYDRDTLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             + ++ L +QY  VK LL Q GF W +  +M+VA D  W  +IKA    + Y  K L  + 
Sbjct  69    SHYSNLWKQYNDVKNLLEQSGFSWDDNRKMVVASDDAWATIIKANPDAQYYWRKFLVNFN  128

Query  807   DMSIICGNETPTFQY  763
             D+ +I    T   +Y
Sbjct  129   DLCLIFAYTTADGRY  143


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 74/123 (60%), Gaps = 7/123 (6%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W   MD YFI+LL +Q   GN+     + +AW+E+  LF  K+  ++D ++LKN++ HLR
Sbjct  320   WKSSMDRYFIDLLQNQALIGNKIGHELTTEAWVELTRLFKAKFGSQYDDNILKNQFNHLR  379

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILVSFV  1343
              +Y++ + +LEQ+ F WD+++ MVT  D  WD Y KV    + + N  K +A Y    + 
Sbjct  380   TRYNDIRFLLEQSGFSWDETQDMVTAEDCVWDSYTKVYPHVRSYRN--KSVASY----YK  433

Query  1342  VCV  1334
             +CV
Sbjct  434   LCV  436


 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = -1

Query  1702  NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             NWT  M+ YFI+L+ +Q+ +GN+   +F++QAW  ++A F+ K+    + D +++ Y  L
Sbjct  788   NWTKPMEIYFIKLMSEQVLEGNKNHETFNEQAWSWIVAAFNEKFGLLCERDDVESWYLSL  847

Query  1522  RKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              K+Y N T IL QN F WD++ QMV  +++ W  YIK
Sbjct  848   MKEYSNITNILNQNGFSWDETEQMVIADNDDWSAYIK  884


 Score = 70.1 bits (170),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +  L     M      S+  +++ WT  MD +F+EL+L Q++KG++ + +FSK+AW +M+
Sbjct  156   IQGLNFDAGMGGFPSESTNCVKAKWTSAMDRFFLELMLVQVKKGSKNNNTFSKEAWKDML  215

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQY  1511
              LF+ K+  ++  +VLK RYK L K Y
Sbjct  216   TLFNAKFCSQYGKNVLKRRYKKLFKYY  242



>ref|XP_010429383.1| PREDICTED: uncharacterized protein LOC104713855 isoform X2 [Camelina 
sativa]
Length=442

 Score =   116 bits (291),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 104/199 (52%), Gaps = 21/199 (11%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIF--------GHTVADGR--------YSLSCFDIDFENE  1201
              HP++  +R K +P+Y +L +I+         +T  + +        Y+  C     E+ 
Sbjct  113   VHPDLRCFRIKPIPFYKDLCLIYMSEHKAEENNTEGETKILIQEEEGYNRIC-----ESS  167

Query  1200  VKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTA  1021
               +   K  +     +  W   M+++FI LML+Q + GN++   F+ +AW  M+  FN  
Sbjct  168   TVMSNTKGGSIITRSRTTWHPPMDRYFIDLMLDQERRGNQIEGVFRKQAWTEMVNLFNAK  227

Query  1020  FGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFR  841
             F   +   VLK R+  LRRQ+ A+  +L  DGF W +  QM+ A+D VW+  IKA +  R
Sbjct  228   FESYFNVDVLKNRYKTLRRQFNAINCILRSDGFAWDDERQMVTADDIVWQDYIKAHRDAR  287

Query  840   RYRNKSLSFYKDMSIICGN  784
             ++  + + +YKD+ ++CG+
Sbjct  288   QFMTRPIPYYKDLCVLCGD  306


 Score = 95.5 bits (236),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHD  1556
             S + +E LR+ WT  MD+YFIEL+++Q++KGNR     FSK+AW  M   F+ K+K  + 
Sbjct  5     SRNGNERLRTVWTPEMDEYFIELMVEQVRKGNRFEDHLFSKRAWKMMSCSFTAKFKFPYG  64

Query  1555  TDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              DVLKNR+K LR  + + K +L ++ F WD++R MV  ++  WD+Y+KV
Sbjct  65    KDVLKNRHKTLRNLFKSVKSLLREDGFTWDETRLMVVADNCVWDEYLKV  113


 Score =   106 bits (264),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+LDQ ++GN+    F KQAW EM+ LF+ K++   + DVLKNRYK
Sbjct  183   RTTWHPPMDRYFIDLMLDQERRGNQIEGVFRKQAWTEMVNLFNAKFESYFNVDVLKNRYK  242

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+Q++    IL  + F WDD RQMVT +D  W DYIK     ++F
Sbjct  243   TLRRQFNAINCILRSDGFAWDDERQMVTADDIVWQDYIKAHRDARQF  289


 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKL-NRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI+LM+EQV++GN+  +  F  +AW  M  +F   F F YGK VLK R   L
Sbjct  16    WTPEMDEYFIELMVEQVRKGNRFEDHLFSKRAWKMMSCSFTAKFKFPYGKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  + +VK LL +DGF W E   M+VA++ VW + +K     R +R K + FYKD+ +I 
Sbjct  76    RNLFKSVKSLLREDGFTWDETRLMVVADNCVWDEYLKVHPDLRCFRIKPIPFYKDLCLIY  135

Query  789   GNE  781
              +E
Sbjct  136   MSE  138



>ref|XP_010429375.1| PREDICTED: uncharacterized protein LOC104713855 isoform X1 [Camelina 
sativa]
Length=442

 Score =   116 bits (291),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 104/199 (52%), Gaps = 21/199 (11%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIF--------GHTVADGR--------YSLSCFDIDFENE  1201
              HP++  +R K +P+Y +L +I+         +T  + +        Y+  C     E+ 
Sbjct  113   VHPDLRCFRIKPIPFYKDLCLIYMSEHKAEENNTEGETKILIQEEEGYNRIC-----ESS  167

Query  1200  VKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTA  1021
               +   K  +     +  W   M+++FI LML+Q + GN++   F+ +AW  M+  FN  
Sbjct  168   TVMSNTKGGSIITRSRTTWHPPMDRYFIDLMLDQERRGNQIEGVFRKQAWTEMVNLFNAK  227

Query  1020  FGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFR  841
             F   +   VLK R+  LRRQ+ A+  +L  DGF W +  QM+ A+D VW+  IKA +  R
Sbjct  228   FESYFNVDVLKNRYKTLRRQFNAINCILRSDGFAWDDERQMVTADDIVWQDYIKAHRDAR  287

Query  840   RYRNKSLSFYKDMSIICGN  784
             ++  + + +YKD+ ++CG+
Sbjct  288   QFMTRPIPYYKDLCVLCGD  306


 Score = 95.9 bits (237),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 74/109 (68%), Gaps = 2/109 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHD  1556
             S + +E LR+ WT  MD+YFIEL+++Q++KGNR     FSK+AW  M   F+ K+K  + 
Sbjct  5     SRNGNERLRTVWTPEMDEYFIELMVEQVRKGNRFEDHLFSKRAWKMMSCSFTAKFKFPYG  64

Query  1555  TDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              DVLKNR+K LR  + + K +L ++ F WD++R MV  ++  WD+Y+KV
Sbjct  65    KDVLKNRHKTLRNLFKSVKSLLREDGFTWDETRLMVVADNCVWDEYLKV  113


 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 70/107 (65%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+LDQ ++GN+    F KQAW EM+ LF+ K++   + DVLKNRYK
Sbjct  183   RTTWHPPMDRYFIDLMLDQERRGNQIEGVFRKQAWTEMVNLFNAKFESYFNVDVLKNRYK  242

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+Q++    IL  + F WDD RQMVT +D  W DYIK     ++F
Sbjct  243   TLRRQFNAINCILRSDGFAWDDERQMVTADDIVWQDYIKAHRDARQF  289


 Score =   104 bits (260),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (62%), Gaps = 1/123 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKL-NRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI+LM+EQV++GN+  +  F  +AW  M  +F   F F YGK VLK R   L
Sbjct  16    WTPEMDEYFIELMVEQVRKGNRFEDHLFSKRAWKMMSCSFTAKFKFPYGKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  + +VK LL +DGF W E   M+VA++ VW + +K     R +R K + FYKD+ +I 
Sbjct  76    RNLFKSVKSLLREDGFTWDETRLMVVADNCVWDEYLKVHPDLRCFRIKPIPFYKDLCLIY  135

Query  789   GNE  781
              +E
Sbjct  136   MSE  138



>gb|KHN20378.1| hypothetical protein glysoja_039676 [Glycine soja]
Length=491

 Score =   124 bits (312),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/367 (33%), Positives = 177/367 (48%), Gaps = 56/367 (15%)
 Frame = -2

Query  1311  YRTKVVPYYNELRIIFGHTVA------------DGRYS-----LS---CFDID-FENEVK  1195
             YR K +PY+ +L  ++GH +              G Y      LS   C D D    +V+
Sbjct  118   YRVKSIPYFEDLCTVYGHVMEGKGDTAPEESSNSGEYGAITPFLSKDVCEDDDELLCDVR  177

Query  1194  ILED-KIPTKDDAK------------------KIDWSETMEQHFIQLMLEQVQEGNKLNR  1072
               ED  I T ++A                   +  W   M+++FI LML  + +GN+ + 
Sbjct  178   TDEDCGISTVENATDDCEQRAKKTASSSGTRTRTYWQPPMDRYFINLMLAHLHKGNQFDG  237

Query  1071  TFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIV  892
              F  +AW+ MI++FN  FGF+Y   +LK R   LRRQY  +K LL   GF W E  QM++
Sbjct  238   VFNKQAWVEMISSFNKKFGFEYSLEILKNRHKTLRRQYNLIKSLLQLHGFDWDETRQMVI  297

Query  891   AEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVK-----AGEFCV  727
             A+D  W+  IK     R+Y  + L +YKD+   C    P F      ++     A +F  
Sbjct  298   ADDCFWQDYIKVHPDARQYMTRPLPYYKDL---CAIFDPNFDEKESLLQDKLQNAVDFQT  354

Query  726   PIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGP--SEINEETEIEIGME  553
                QT+ K G         E+      +      K+ ++  KG   +   +    E GM 
Sbjct  355   ECPQTS-KTGQSPITPNSNEEQFSSVNELANICQKQKRQLEKGSNFTSPKKSRNDEQGMA  413

Query  552   DAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKA  373
              A+ EM A V+ ++    KK   S+ IE+VI  +QA+P+M  DD+L+LDACDFLED+ KA
Sbjct  414   VALCEMAAVVSTVS---AKKIDTSISIENVIEAVQALPDM--DDELVLDACDFLEDERKA  468

Query  372   KVFLALD  352
             K FLALD
Sbjct  469   KTFLALD  475


 Score = 86.3 bits (212),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = -1

Query  1720  SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +E LR+ WT  MD YFI L+L+Q+ +G +     FSK+AW  M   F+ K+  +++ DVL
Sbjct  7     TERLRTIWTPEMDRYFINLMLEQVAQGRKFEDHLFSKRAWKHMSLKFNAKFNFQYEKDVL  66

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KNR+K LR  Y   K +L Q  F WD+ R MV  ++  WD+Y+ V
Sbjct  67    KNRHKTLRNLYRGIKNLLAQPGFSWDEKRNMVIADNHVWDEYLTV  111


 Score =   108 bits (270),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKL-NRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV +G K  +  F  +AW HM   FN  F FQY K VLK R   L
Sbjct  14    WTPEMDRYFINLMLEQVAQGRKFEDHLFSKRAWKHMSLKFNAKFNFQYEKDVLKNRHKTL  73

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y  +K LL+Q GF W E+  M++A++ VW + +      R YR KS+ +++D+  + 
Sbjct  74    RNLYRGIKNLLAQPGFSWDEKRNMVIADNHVWDEYLTVDANVRSYRVKSIPYFEDLCTVY  133

Query  789   GN  784
             G+
Sbjct  134   GH  135


 Score = 98.2 bits (243),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + SS    R+ W   MD YFI L+L  + KGN+    F+KQAW+EMI+ F+ K+  ++  
Sbjct  202   ASSSGTRTRTYWQPPMDRYFINLMLAHLHKGNQFDGVFNKQAWVEMISSFNKKFGFEYSL  261

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++LKNR+K LR+QY+  K +L+ + F WD++RQMV  +D  W DYIKV
Sbjct  262   EILKNRHKTLRRQYNLIKSLLQLHGFDWDETRQMVIADDCFWQDYIKV  309


 Score = 29.3 bits (64),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 14/51 (27%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI  1177
             HP+   Y T+ +PYY +L  I              FD +F+ +  +L+DK+
Sbjct  310   HPDARQYMTRPLPYYKDLCAI--------------FDPNFDEKESLLQDKL  346



>ref|XP_003520746.1| PREDICTED: uncharacterized protein LOC100787716 isoform X1 [Glycine 
max]
 ref|XP_006577159.1| PREDICTED: uncharacterized protein LOC100787716 isoform X2 [Glycine 
max]
Length=491

 Score =   125 bits (313),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 121/367 (33%), Positives = 177/367 (48%), Gaps = 56/367 (15%)
 Frame = -2

Query  1311  YRTKVVPYYNELRIIFGHTVA------------DGRYS-----LS---CFDID-FENEVK  1195
             YR K +PY+ +L  ++GH +              G Y      LS   C D D    +V+
Sbjct  118   YRVKSIPYFEDLCTVYGHVMEGKGDTAPEESSNSGEYGAITPFLSKDVCEDDDELLCDVR  177

Query  1194  ILED-KIPTKDDAK------------------KIDWSETMEQHFIQLMLEQVQEGNKLNR  1072
               ED  I T ++A                   +  W   M+++FI LML  + +GN+ + 
Sbjct  178   TDEDCGISTVENATDDCEQRAKKTASSSGTRTRTYWQPPMDRYFINLMLAHLHKGNQFDG  237

Query  1071  TFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIV  892
              F  +AW+ MI++FN  FGF+Y   +LK R   LRRQY  +K LL   GF W E  QM++
Sbjct  238   VFSKQAWVEMISSFNKKFGFEYSLEILKNRHKTLRRQYNLIKSLLQLHGFDWDETRQMVI  297

Query  891   AEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVK-----AGEFCV  727
             A+D  W+  IK     R+Y  + L +YKD+   C    P F      ++     A +F  
Sbjct  298   ADDCFWQDYIKVHPDARQYMTRPLPYYKDL---CAIFDPNFDEKESLLQDKLQNAVDFQT  354

Query  726   PIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGP--SEINEETEIEIGME  553
                QT+ K G         E+      +      K+ ++  KG   +   +    E GM 
Sbjct  355   ECPQTS-KTGQSPITPNSNEEQFSSVNELANICQKQKRQLEKGSNFTSPKKSRNDEQGMA  413

Query  552   DAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKA  373
              A+ EM A V+ ++    KK   S+ IE+VI  +QA+P+M  DD+L+LDACDFLED+ KA
Sbjct  414   VALCEMAAVVSTVS---AKKIDTSISIENVIEAVQALPDM--DDELVLDACDFLEDERKA  468

Query  372   KVFLALD  352
             K FLALD
Sbjct  469   KTFLALD  475


 Score = 84.7 bits (208),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 65/105 (62%), Gaps = 2/105 (2%)
 Frame = -1

Query  1720  SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +E LR+ WT  MD +FI L+L+Q+ +G +     FSK+AW  M   F+ K+  +++ DVL
Sbjct  7     TERLRTIWTPEMDRFFINLMLEQVAQGRKFEDHLFSKRAWKHMSLKFNAKFNFQYEKDVL  66

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KNR+K LR  Y   K +L Q  F WD+ R MV  ++  WD+Y+ V
Sbjct  67    KNRHKTLRNLYRGIKNLLAQPGFSWDEKRNMVIADNHVWDEYLTV  111


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/122 (41%), Positives = 72/122 (59%), Gaps = 1/122 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKL-NRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M++ FI LMLEQV +G K  +  F  +AW HM   FN  F FQY K VLK R   L
Sbjct  14    WTPEMDRFFINLMLEQVAQGRKFEDHLFSKRAWKHMSLKFNAKFNFQYEKDVLKNRHKTL  73

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y  +K LL+Q GF W E+  M++A++ VW + +      R YR KS+ +++D+  + 
Sbjct  74    RNLYRGIKNLLAQPGFSWDEKRNMVIADNHVWDEYLTVDANVRSYRVKSIPYFEDLCTVY  133

Query  789   GN  784
             G+
Sbjct  134   GH  135


 Score = 99.4 bits (246),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 72/108 (67%), Gaps = 1/108 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + SS    R+ W   MD YFI L+L  + KGN+    FSKQAW+EMI+ F+ K+  ++  
Sbjct  202   ASSSGTRTRTYWQPPMDRYFINLMLAHLHKGNQFDGVFSKQAWVEMISSFNKKFGFEYSL  261

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             ++LKNR+K LR+QY+  K +L+ + F WD++RQMV  +D  W DYIKV
Sbjct  262   EILKNRHKTLRRQYNLIKSLLQLHGFDWDETRQMVIADDCFWQDYIKV  309


 Score = 29.6 bits (65),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 15/51 (29%), Positives = 25/51 (49%), Gaps = 14/51 (27%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI  1177
             HP+   Y T+ +PYY +L  I              FD +F+ +  +L+DK+
Sbjct  310   HPDARQYMTRPLPYYKDLCAI--------------FDPNFDEKESLLQDKL  346



>ref|XP_007030894.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY11396.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=631

 Score =   125 bits (315),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 106/184 (58%), Gaps = 6/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P++E YR    P YN+L +I+G++  DG+   S  D         L++         + 
Sbjct  315   YPDIESYRNISKPNYNDLCLIYGNST-DGKDWRSGRDACSNGYGTKLKNGY-----CGRT  368

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW  +M+++FI LMLE V++G+ +++ F N AW  M+  F+  +G Q  K VLK+RF  L
Sbjct  369   DWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFMNL  428

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL  DGF W +  QMI+A+D +W   +K     R YRN++L  Y D+ +I 
Sbjct  429   RKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLKEHPDARSYRNRTLPSYNDLFLIY  488

Query  789   GNET  778
             GN +
Sbjct  489   GNAS  492


 Score = 83.6 bits (205),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  209   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  268

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  269   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  313


 Score =   124 bits (312),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  153   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  211

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  212   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  271

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  272   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  331

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  332   LCLIYGNST  340


 Score =   120 bits (301),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/180 (37%), Positives = 97/180 (54%), Gaps = 10/180 (6%)
 Frame = -2

Query  1287  YNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------EDKIPTKDDAKKIDWSETM  1132
             Y +LR+I+G+    G  S  C   +     KIL        ED +  + +   I W+  M
Sbjct  4     YQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNEDHLCDRREMLSIHWTPAM  61

Query  1131  EQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFA  952
              ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY +  LK++   LRRQY  
Sbjct  62    NRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYDEDALKSQARDLRRQYNN  121

Query  951   VKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPT  772
             +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS+  Y  + +I G E+  
Sbjct  122   IKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKSVPDYHKLCVIFGQESSN  181


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  43    EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  102

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  103   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  162

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  163   KSVPDYHKLCVIF  175


 Score = 87.8 bits (216),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+L+ +++G+     F+  AW +M+A FS +Y  + D DVLK+R+ 
Sbjct  367   RTDWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFM  426

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +LRK++++ K +L+ + F WDD RQM+  +D  W  Y+K
Sbjct  427   NLRKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLK  465


 Score = 35.0 bits (79),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (52%), Gaps = 6/64 (9%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+   YR + +P YN+L +I+G+       S++ + ++ EN     E + PT     +I
Sbjct  467   HPDARSYRNRTLPSYNDLFLIYGNA------SINGWHLETENYAGEEEGESPTSSSPTRI  520

Query  1149  DWSE  1138
               +E
Sbjct  521   HGTE  524



>ref|XP_007030893.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11395.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=793

 Score =   125 bits (315),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 106/184 (58%), Gaps = 6/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P++E YR    P YN+L +I+G++  DG+   S  D         L++         + 
Sbjct  477   YPDIESYRNISKPNYNDLCLIYGNST-DGKDWRSGRDACSNGYGTKLKNGY-----CGRT  530

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW  +M+++FI LMLE V++G+ +++ F N AW  M+  F+  +G Q  K VLK+RF  L
Sbjct  531   DWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFMNL  590

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL  DGF W +  QMI+A+D +W   +K     R YRN++L  Y D+ +I 
Sbjct  591   RKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLKEHPDARSYRNRTLPSYNDLFLIY  650

Query  789   GNET  778
             GN +
Sbjct  651   GNAS  654


 Score = 83.6 bits (205),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  371   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  430

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  431   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  475


 Score =   159 bits (402),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 5/175 (3%)
 Frame = -2

Query  1287  YNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----PTKDDAKKIDWSETMEQH  1123
             +N+L +I+ +T ADGRYS S  DIDF+++ + +   +     P  D+  KIDW++ M+QH
Sbjct  3     FNDLCLIYAYTQADGRYSRSSHDIDFDDDAQGMNFGVGTTIPPASDERPKIDWTQAMDQH  62

Query  1122  FIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKY  943
             FI+LML  ++ GNK   TF  +AW  M+ +FN  FGF YGK  L+ R+  L + Y  V+ 
Sbjct  63    FIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSFLRRRYRKLLKHYSDVQS  122

Query  942   LLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             LL Q GF W E+ QM+VA+D VW   +KA    R YRNK +  Y+D+ +I GN +
Sbjct  123   LLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLNYQDLRLIYGNAS  177


 Score =   131 bits (330),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 10/195 (5%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------ED  1183
             V AHP+   YR K +  Y +LR+I+G+    G  S  C   +     KIL        ED
Sbjct  149   VKAHPDARIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNED  206

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
              +  + +   I W+  M ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY 
Sbjct  207   HLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYD  266

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             +  LK++   LRRQY  +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS
Sbjct  267   EDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKS  326

Query  822   LSFYKDMSIICGNET  778
             +  Y  + +I G E+
Sbjct  327   VPDYHKLCVIFGQES  341


 Score =   124 bits (312),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  315   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  373

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  374   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  433

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  434   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  493

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  494   LCLIYGNST  502


 Score =   114 bits (285),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  205   EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  264

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  265   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  324

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  325   KSVPDYHKLCVIF  337


 Score = 87.8 bits (216),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+L+ +++G+     F+  AW +M+A FS +Y  + D DVLK+R+ 
Sbjct  529   RTDWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFM  588

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +LRK++++ K +L+ + F WDD RQM+  +D  W  Y+K
Sbjct  589   NLRKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLK  627


 Score = 35.8 bits (81),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (52%), Gaps = 6/64 (9%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+   YR + +P YN+L +I+G+       S++ + ++ EN     E + PT     +I
Sbjct  629   HPDARSYRNRTLPSYNDLFLIYGNA------SINGWHLETENYAGEEEGESPTSSSPTRI  682

Query  1149  DWSE  1138
               +E
Sbjct  683   HGTE  686


 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 80/143 (56%), Gaps = 11/143 (8%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S E  + +WT  MD +FIEL+L  ++ GN++  +F+KQAW +M+  F+ K+   +    
Sbjct  46    ASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSF  105

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNH----  1382
             L+ RY+ L K Y + + +L Q  F WD+ +QMV  +D  WD+Y+K     + + N     
Sbjct  106   LRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLN  165

Query  1381  ---LKII---AHYILVSFVVCVG  1331
                L++I   A  I VS  +C G
Sbjct  166   YQDLRLIYGNASNIGVSSHMCQG  188



>ref|XP_007030892.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11394.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=917

 Score =   125 bits (314),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 106/184 (58%), Gaps = 6/184 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P++E YR    P YN+L +I+G++  DG+   S  D         L++         + 
Sbjct  601   YPDIESYRNISKPNYNDLCLIYGNST-DGKDWRSGRDACSNGYGTKLKNGY-----CGRT  654

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW  +M+++FI LMLE V++G+ +++ F N AW  M+  F+  +G Q  K VLK+RF  L
Sbjct  655   DWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFMNL  714

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL  DGF W +  QMI+A+D +W   +K     R YRN++L  Y D+ +I 
Sbjct  715   RKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLKEHPDARSYRNRTLPSYNDLFLIY  774

Query  789   GNET  778
             GN +
Sbjct  775   GNAS  778


 Score = 83.6 bits (205),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  495   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  554

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  555   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  599


 Score =   167 bits (422),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 80/192 (42%), Positives = 118/192 (61%), Gaps = 5/192 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----P  1174
             V   P+ + YR + +  +N+L +I+ +T ADGRYS S  DIDF+++ + +   +     P
Sbjct  110   VKGQPDAQVYRNRTLMNFNDLCLIYAYTQADGRYSRSSHDIDFDDDAQGMNFGVGTTIPP  169

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               D+  KIDW++ M+QHFI+LML  ++ GNK   TF  +AW  M+ +FN  FGF YGK  
Sbjct  170   ASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSF  229

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             L+ R+  L + Y  V+ LL Q GF W E+ QM+VA+D VW   +KA    R YRNK +  
Sbjct  230   LRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLN  289

Query  813   YKDMSIICGNET  778
             Y+D+ +I GN +
Sbjct  290   YQDLRLIYGNAS  301


 Score =   131 bits (329),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 10/195 (5%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------ED  1183
             V AHP+   YR K +  Y +LR+I+G+    G  S  C   +     KIL        ED
Sbjct  273   VKAHPDARIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNED  330

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
              +  + +   I W+  M ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY 
Sbjct  331   HLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYD  390

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             +  LK++   LRRQY  +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS
Sbjct  391   EDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKS  450

Query  822   LSFYKDMSIICGNET  778
             +  Y  + +I G E+
Sbjct  451   VPDYHKLCVIFGQES  465


 Score =   124 bits (310),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  439   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  497

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  498   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  557

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  558   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  617

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  618   LCLIYGNST  626


 Score =   115 bits (289),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 80/128 (63%), Gaps = 0/128 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             PT +D  + +W+ TME++FI LML+Q+  GN+L  TF  +AW  M+T FN  FG +Y + 
Sbjct  6     PTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFGCKYDRD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK+ +  L +QY  VK LL Q+GF W +  ++IVA   VW   +K Q   + YRN++L 
Sbjct  66    TLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVYRNRTLM  125

Query  816   FYKDMSII  793
              + D+ +I
Sbjct  126   NFNDLCLI  133


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  329   EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  388

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  389   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  448

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  449   KSVPDYHKLCVIF  461


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 82/121 (68%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M  ++ +S++  R+NWT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ K+ C
Sbjct  1     MGSNAPTSNDRTRTNWTPTMERYFIDLMLDQMHRGNRLGHTFNKQAWTDMLTIFNAKFGC  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+D D LK+ Y +L KQY++ K +LEQN F WDD R+++      WD Y+K Q   Q + 
Sbjct  61    KYDRDTLKSHYTNLWKQYNDVKNLLEQNGFSWDDIRKLIVAPPHVWDAYVKGQPDAQVYR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score = 87.8 bits (216),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++W   MD YFI+L+L+ +++G+     F+  AW +M+A FS +Y  + D DVLK+R+ 
Sbjct  653   RTDWIPSMDRYFIDLMLEHVRQGSMVDKKFNNLAWGDMVAKFSAEYGHQCDKDVLKSRFM  712

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +LRK++++ K +L+ + F WDD RQM+  +D  W  Y+K
Sbjct  713   NLRKRFNDMKNLLDHDGFAWDDMRQMIIADDNLWATYLK  751


 Score = 35.4 bits (80),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 18/64 (28%), Positives = 33/64 (52%), Gaps = 6/64 (9%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP+   YR + +P YN+L +I+G+       S++ + ++ EN     E + PT     +I
Sbjct  753   HPDARSYRNRTLPSYNDLFLIYGNA------SINGWHLETENYAGEEEGESPTSSSPTRI  806

Query  1149  DWSE  1138
               +E
Sbjct  807   HGTE  810


 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 82/153 (54%), Gaps = 11/153 (7%)
 Frame = -1

Query  1756  NRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             N G       +S E  + +WT  MD +FIEL+L  ++ GN++  +F+KQAW +M+  F+ 
Sbjct  160   NFGVGTTIPPASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNA  219

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             K+   +    L+ RY+ L K Y + + +L Q  F WD+ +QMV  +D  WD+Y+K     
Sbjct  220   KFGFPYGKSFLRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDA  279

Query  1399  QKFSNH-------LKII---AHYILVSFVVCVG  1331
             + + N        L++I   A  I VS  +C G
Sbjct  280   RIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQG  312



>ref|XP_002319555.2| hypothetical protein POPTR_0013s02600g [Populus trichocarpa]
 gb|EEE95478.2| hypothetical protein POPTR_0013s02600g [Populus trichocarpa]
Length=604

 Score =   119 bits (298),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 104/190 (55%), Gaps = 24/190 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVAD------GRYSLSCFDIDFENEVKILEDKIPTK  1168
             HP    YR+   P YN+L +I+G++++D      G+ + +C +  F N            
Sbjct  130   HPNARSYRSTPKPDYNDLYLIYGNSISDEGHNQSGQGAKNC-NRGFWN------------  176

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
                   DW+  M+Q FI LMLE V++G+ +++ F  +AW  M++ F+ AFG Q+ + VL+
Sbjct  177   -----ADWTPPMDQLFINLMLEHVRQGSMVDQRFNKQAWSDMVSKFSAAFGSQHDQYVLE  231

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              RF  LR+ +  +K LL Q GF W +R  MI+A D +W   +K       YRN++L  Y 
Sbjct  232   RRFMNLRKLFGDMKNLLDQSGFAWDDRRHMIIAGDSLWNAYLKDYPDAHPYRNRALPNYD  291

Query  807   DMSIICGNET  778
             D+ +I G++ 
Sbjct  292   DLFLIYGDKN  301


 Score = 88.2 bits (217),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 73/111 (66%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSC-SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E+D C ++ +  + +WT  MD YFI+L+LDQ+ +GN++S +   QAW++M  + + ++  
Sbjct  18    EEDQCLANGDCSKPDWTPSMDRYFIDLMLDQVHRGNKSSYTLDDQAWIDMAVMLNERFGS  77

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +H+ D+L+ R++ L K ++  K +L Q  F W++++Q+V   D+ W+ Y K
Sbjct  78    QHEKDILRQRHESLGKLFNGMKNLLGQKGFSWNETQQLVKAYDDVWEAYSK  128


 Score =   114 bits (285),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 106/201 (53%), Gaps = 17/201 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------HTVADGRYSLSCFDIDFENEVKILEDK  1180
             +P+  PYR + +P Y++L +I+G          H+V    + L   ++D E+ +  ++  
Sbjct  276   YPDAHPYRNRALPNYDDLFLIYGDKNNHESNHHHSVVGNGHVLGS-NVDDEDGLSPIDSN  334

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
              P       I+W++ ME +FI+LM EQV EGNK + TF  +AW  ++ AFN  F     +
Sbjct  335   HPW------INWTKPMEIYFIKLMSEQVLEGNKNHETFNEQAWAWIVAAFNEKFRLLCER  388

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
               +++ +  L ++Y  +  +L+Q+GF W E  QM++A+D  W   IK      +Y+ + L
Sbjct  389   EAVESWYLSLMKEYSNITNILNQNGFAWDETEQMVIADDDDWSAYIKEHPGAMKYKGRVL  448

Query  819   SFYKDMSIICGNETPTFQYGY  757
               Y D+ +I GN     +  Y
Sbjct  449   GSYNDLCVIYGNSVAAGRSSY  469


 Score = 85.1 bits (209),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++WT  MD  FI L+L+ +++G+     F+KQAW +M++ FS  +  +HD  VL+ R+ +
Sbjct  177   ADWTPPMDQLFINLMLEHVRQGSMVDQRFNKQAWSDMVSKFSAAFGSQHDQYVLERRFMN  236

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LRK + + K +L+Q+ F WDD R M+   D  W+ Y+K
Sbjct  237   LRKLFGDMKNLLDQSGFAWDDRRHMIIAGDSLWNAYLK  274


 Score =   103 bits (258),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = -2

Query  1221  DIDFENEVKIL--EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWI  1048
             DID +  V ++  ED+     D  K DW+ +M+++FI LML+QV  GNK + T  ++AWI
Sbjct  6     DIDSKPPVLMVGEEDQCLANGDCSKPDWTPSMDRYFIDLMLDQVHRGNKSSYTLDDQAWI  65

Query  1047  HMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKK  868
              M    N  FG Q+ K +L+ R   L + +  +K LL Q GF W+E  Q++ A D VW+ 
Sbjct  66    DMAVMLNERFGSQHEKDILRQRHESLGKLFNGMKNLLGQKGFSWNETQQLVKAYDDVWEA  125

Query  867   VIKAQQYFRRYRNKSLSFYKDMSIICGN  784
               K     R YR+     Y D+ +I GN
Sbjct  126   YSKEHPNARSYRSTPKPDYNDLYLIYGN  153


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -1

Query  1702  NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             NWT  M+ YFI+L+ +Q+ +GN+   +F++QAW  ++A F+ K++   + + +++ Y  L
Sbjct  339   NWTKPMEIYFIKLMSEQVLEGNKNHETFNEQAWAWIVAAFNEKFRLLCEREAVESWYLSL  398

Query  1522  RKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              K+Y N T IL QN F WD++ QMV  +D+ W  YIK
Sbjct  399   MKEYSNITNILNQNGFAWDETEQMVIADDDDWSAYIK  435



>ref|XP_006375772.1| hypothetical protein POPTR_0013s02600g [Populus trichocarpa]
 gb|ERP53569.1| hypothetical protein POPTR_0013s02600g [Populus trichocarpa]
Length=602

 Score =   118 bits (296),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 63/187 (34%), Positives = 102/187 (55%), Gaps = 20/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCF---DIDFENEVKILEDKIPTKDDA  1159
             HP    YR+   P YN+L +I+G++++D  ++ S     +  F N               
Sbjct  130   HPNARSYRSTPKPDYNDLYLIYGNSISDEGHNQSGAKNCNRGFWN---------------  174

Query  1158  KKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
                DW+  M+Q FI LMLE V++G+ +++ F  +AW  M++ F+ AFG Q+ + VL+ RF
Sbjct  175   --ADWTPPMDQLFINLMLEHVRQGSMVDQRFNKQAWSDMVSKFSAAFGSQHDQYVLERRF  232

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
               LR+ +  +K LL Q GF W +R  MI+A D +W   +K       YRN++L  Y D+ 
Sbjct  233   MNLRKLFGDMKNLLDQSGFAWDDRRHMIIAGDSLWNAYLKDYPDAHPYRNRALPNYDDLF  292

Query  798   IICGNET  778
             +I G++ 
Sbjct  293   LIYGDKN  299


 Score = 88.2 bits (217),  Expect(2) = 9e-44, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 73/111 (66%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSC-SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E+D C ++ +  + +WT  MD YFI+L+LDQ+ +GN++S +   QAW++M  + + ++  
Sbjct  18    EEDQCLANGDCSKPDWTPSMDRYFIDLMLDQVHRGNKSSYTLDDQAWIDMAVMLNERFGS  77

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +H+ D+L+ R++ L K ++  K +L Q  F W++++Q+V   D+ W+ Y K
Sbjct  78    QHEKDILRQRHESLGKLFNGMKNLLGQKGFSWNETQQLVKAYDDVWEAYSK  128


 Score =   114 bits (285),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 106/201 (53%), Gaps = 17/201 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------HTVADGRYSLSCFDIDFENEVKILEDK  1180
             +P+  PYR + +P Y++L +I+G          H+V    + L   ++D E+ +  ++  
Sbjct  274   YPDAHPYRNRALPNYDDLFLIYGDKNNHESNHHHSVVGNGHVLGS-NVDDEDGLSPIDSN  332

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
              P       I+W++ ME +FI+LM EQV EGNK + TF  +AW  ++ AFN  F     +
Sbjct  333   HPW------INWTKPMEIYFIKLMSEQVLEGNKNHETFNEQAWAWIVAAFNEKFRLLCER  386

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
               +++ +  L ++Y  +  +L+Q+GF W E  QM++A+D  W   IK      +Y+ + L
Sbjct  387   EAVESWYLSLMKEYSNITNILNQNGFAWDETEQMVIADDDDWSAYIKEHPGAMKYKGRVL  446

Query  819   SFYKDMSIICGNETPTFQYGY  757
               Y D+ +I GN     +  Y
Sbjct  447   GSYNDLCVIYGNSVAAGRSSY  467


 Score = 85.1 bits (209),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 63/98 (64%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             ++WT  MD  FI L+L+ +++G+     F+KQAW +M++ FS  +  +HD  VL+ R+ +
Sbjct  175   ADWTPPMDQLFINLMLEHVRQGSMVDQRFNKQAWSDMVSKFSAAFGSQHDQYVLERRFMN  234

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LRK + + K +L+Q+ F WDD R M+   D  W+ Y+K
Sbjct  235   LRKLFGDMKNLLDQSGFAWDDRRHMIIAGDSLWNAYLK  272


 Score =   103 bits (258),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/148 (38%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = -2

Query  1221  DIDFENEVKIL--EDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWI  1048
             DID +  V ++  ED+     D  K DW+ +M+++FI LML+QV  GNK + T  ++AWI
Sbjct  6     DIDSKPPVLMVGEEDQCLANGDCSKPDWTPSMDRYFIDLMLDQVHRGNKSSYTLDDQAWI  65

Query  1047  HMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKK  868
              M    N  FG Q+ K +L+ R   L + +  +K LL Q GF W+E  Q++ A D VW+ 
Sbjct  66    DMAVMLNERFGSQHEKDILRQRHESLGKLFNGMKNLLGQKGFSWNETQQLVKAYDDVWEA  125

Query  867   VIKAQQYFRRYRNKSLSFYKDMSIICGN  784
               K     R YR+     Y D+ +I GN
Sbjct  126   YSKEHPNARSYRSTPKPDYNDLYLIYGN  153


 Score = 84.0 bits (206),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = -1

Query  1702  NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             NWT  M+ YFI+L+ +Q+ +GN+   +F++QAW  ++A F+ K++   + + +++ Y  L
Sbjct  337   NWTKPMEIYFIKLMSEQVLEGNKNHETFNEQAWAWIVAAFNEKFRLLCEREAVESWYLSL  396

Query  1522  RKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              K+Y N T IL QN F WD++ QMV  +D+ W  YIK
Sbjct  397   MKEYSNITNILNQNGFAWDETEQMVIADDDDWSAYIK  433



>ref|XP_006588881.1| PREDICTED: uncharacterized protein LOC100798302 isoform X5 [Glycine 
max]
Length=382

 Score =   169 bits (429),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 111/169 (66%), Gaps = 11/169 (7%)
 Frame = -2

Query  1254  VADGRYSLSCFDIDFENEVKILEDKI-----------PTKDDAKKIDWSETMEQHFIQLM  1108
             VADGRYSLSCFD+DFE E K L+DK            P   +  +IDWS  M+Q F++LM
Sbjct  4     VADGRYSLSCFDVDFEYEEKDLDDKTMTSKGVDDQTPPAVVNQGRIDWSPMMDQFFVELM  63

Query  1107  LEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQD  928
             ++QV +GNK+  TF+ KAW+ M  +FN  F   YG++VL+ RFN+LRR Y ++  LL ++
Sbjct  64    VDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRIVLRNRFNVLRRHYCSINVLLGKE  123

Query  927   GFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNE  781
             GF+W +    +VA+++VW+K I+    FR Y+ KS+ FY  M I+C N+
Sbjct  124   GFIWDKTQHKVVADEQVWRKCIRVHHNFRLYKIKSMPFYSGMCIVCRND  172


 Score = 85.5 bits (210),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 65/100 (65%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +W+ +MD +F+EL++DQ+ KGN+  T+F ++AW++M   F+ ++ C +   VL+NR+ 
Sbjct  48    RIDWSPMMDQFFVELMVDQVCKGNKIGTTFRRKAWVDMTESFNKRFLCHYGRIVLRNRFN  107

Query  1528  HLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y +  +L   E FIWD ++  V  +++ W   I+V
Sbjct  108   VLRRHYCSINVLLGKEGFIWDKTQHKVVADEQVWRKCIRV  147



>ref|XP_006581328.1| PREDICTED: uncharacterized protein LOC102665707 isoform X3 [Glycine 
max]
Length=298

 Score =   154 bits (388),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 120/190 (63%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILED-----KIP  1174
             +HP+   YRTK V  +++L +I+GHTVADGRYSLS  D++ +++V+   L D      +P
Sbjct  81    SHPDARCYRTKPVLNFDDLCVIYGHTVADGRYSLSSHDVNLDDQVQGQHLGDGMGSIAVP  140

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + + A+  DW+ +MEQ FI+L+L+Q+  GN+++  F   AW  M+  FN  FG Q+G+ V
Sbjct  141   SSERAR-TDWTASMEQFFIELLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFGCQHGRRV  199

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF    + Y  +  L+ Q GF+W E+  M++A+D VW   +KA  +   YR+K+L  
Sbjct  200   LKNRFKKRLKHYCDITNLIKQ-GFLWDEQQLMLLADDDVWNAYVKAHLHAGTYRSKTLPN  258

Query  813   YKDMSIICGN  784
             Y+D+ +I  N
Sbjct  259   YRDLELIFRN  268


 Score = 45.1 bits (105),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -1

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTG---NDEK  1433
             +M+  F+  +  ++D DVLK RY +L KQ+++ K +L    F WD SRQMV     +D  
Sbjct  15    DMLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSV  74

Query  1432  WDDYIK  1415
              D Y+K
Sbjct  75    CDAYLK  80


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  SSE  R++WT  M+ +FIELLLDQ+ +GN+    F+K AW +M+A+F+ K+ 
Sbjct  133   GMGSIAVPSSERARTDWTASMEQFFIELLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFG  192

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQM  1406
             C+H   VLKNR+K   K Y +   L +  F+WD+ + M+  +D+ W+ Y+K  +
Sbjct  193   CQHGRRVLKNRFKKRLKHYCDITNLIKQGFLWDEQQLMLLADDDVWNAYVKAHL  246


 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -2

Query  1044  MITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA---EDRVW  874
             M+T+FN  FG QY K VLKTR+  L +Q+  VK LLS  GF W    QM+VA   +D V 
Sbjct  16    MLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSVC  75

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQY  763
                +K+    R YR K +  + D+ +I G+     +Y
Sbjct  76    DAYLKSHPDARCYRTKPVLNFDDLCVIYGHTVADGRY  112



>ref|XP_006581326.1| PREDICTED: uncharacterized protein LOC102665707 isoform X1 [Glycine 
max]
Length=351

 Score =   153 bits (387),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 120/190 (63%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI--LED-----KIP  1174
             +HP+   YRTK V  +++L +I+GHTVADGRYSLS  D++ +++V+   L D      +P
Sbjct  81    SHPDARCYRTKPVLNFDDLCVIYGHTVADGRYSLSSHDVNLDDQVQGQHLGDGMGSIAVP  140

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + + A+  DW+ +MEQ FI+L+L+Q+  GN+++  F   AW  M+  FN  FG Q+G+ V
Sbjct  141   SSERAR-TDWTASMEQFFIELLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFGCQHGRRV  199

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF    + Y  +  L+ Q GF+W E+  M++A+D VW   +KA  +   YR+K+L  
Sbjct  200   LKNRFKKRLKHYCDITNLIKQ-GFLWDEQQLMLLADDDVWNAYVKAHLHAGTYRSKTLPN  258

Query  813   YKDMSIICGN  784
             Y+D+ +I  N
Sbjct  259   YRDLELIFRN  268


 Score = 45.1 bits (105),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -1

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTG---NDEK  1433
             +M+  F+  +  ++D DVLK RY +L KQ+++ K +L    F WD SRQMV     +D  
Sbjct  15    DMLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSV  74

Query  1432  WDDYIK  1415
              D Y+K
Sbjct  75    CDAYLK  80


 Score =   102 bits (255),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  SSE  R++WT  M+ +FIELLLDQ+ +GN+    F+K AW +M+A+F+ K+ 
Sbjct  133   GMGSIAVPSSERARTDWTASMEQFFIELLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFG  192

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQM  1406
             C+H   VLKNR+K   K Y +   L +  F+WD+ + M+  +D+ W+ Y+K  +
Sbjct  193   CQHGRRVLKNRFKKRLKHYCDITNLIKQGFLWDEQQLMLLADDDVWNAYVKAHL  246


 Score = 61.2 bits (147),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 11/112 (10%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI------  1177
             V AH     YR+K +P Y +L +IF +   +    +S    +  +E  I E K       
Sbjct  242   VKAHLHAGTYRSKTLPNYRDLELIFRNMAEN---EISNLQQEKNHEDVISETKAGEAKGS  298

Query  1176  --PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFN  1027
               P+  D  +  W+  M++  I L+LEQV+ GN+L +TF ++AW  MIT FN
Sbjct  299   RNPSGTDRTRTYWTPPMDRCLIDLLLEQVKHGNRLGQTFISQAWNDMITTFN  350


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -2

Query  1044  MITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA---EDRVW  874
             M+T+FN  FG QY K VLKTR+  L +Q+  VK LLS  GF W    QM+VA   +D V 
Sbjct  16    MLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSVC  75

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQY  763
                +K+    R YR K +  + D+ +I G+     +Y
Sbjct  76    DAYLKSHPDARCYRTKPVLNFDDLCVIYGHTVADGRY  112



>ref|XP_006581327.1| PREDICTED: uncharacterized protein LOC102665707 isoform X2 [Glycine 
max]
Length=308

 Score =   154 bits (388),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 120/190 (63%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILED-----KIP  1174
             +HP+   YRTK V  +++L +I+GHTVADGRYSLS  D++ +++V+   L D      +P
Sbjct  81    SHPDARCYRTKPVLNFDDLCVIYGHTVADGRYSLSSHDVNLDDQVQGQHLGDGMGSIAVP  140

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + + A+  DW+ +MEQ FI+L+L+Q+  GN+++  F   AW  M+  FN  FG Q+G+ V
Sbjct  141   SSERAR-TDWTASMEQFFIELLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFGCQHGRRV  199

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF    + Y  +  L+ Q GF+W E+  M++A+D VW   +KA  +   YR+K+L  
Sbjct  200   LKNRFKKRLKHYCDITNLIKQ-GFLWDEQQLMLLADDDVWNAYVKAHLHAGTYRSKTLPN  258

Query  813   YKDMSIICGN  784
             Y+D+ +I  N
Sbjct  259   YRDLELIFRN  268


 Score = 44.7 bits (104),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -1

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTG---NDEK  1433
             +M+  F+  +  ++D DVLK RY +L KQ+++ K +L    F WD SRQMV     +D  
Sbjct  15    DMLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSV  74

Query  1432  WDDYIK  1415
              D Y+K
Sbjct  75    CDAYLK  80


 Score =   102 bits (254),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 72/114 (63%), Gaps = 0/114 (0%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  SSE  R++WT  M+ +FIELLLDQ+ +GN+    F+K AW +M+A+F+ K+ 
Sbjct  133   GMGSIAVPSSERARTDWTASMEQFFIELLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFG  192

Query  1567  CKHDTDVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQM  1406
             C+H   VLKNR+K   K Y +   L +  F+WD+ + M+  +D+ W+ Y+K  +
Sbjct  193   CQHGRRVLKNRFKKRLKHYCDITNLIKQGFLWDEQQLMLLADDDVWNAYVKAHL  246


 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 54/97 (56%), Gaps = 3/97 (3%)
 Frame = -2

Query  1044  MITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA---EDRVW  874
             M+T+FN  FG QY K VLKTR+  L +Q+  VK LLS  GF W    QM+VA   +D V 
Sbjct  16    MLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSVC  75

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQY  763
                +K+    R YR K +  + D+ +I G+     +Y
Sbjct  76    DAYLKSHPDARCYRTKPVLNFDDLCVIYGHTVADGRY  112



>gb|KHN07011.1| hypothetical protein glysoja_023194 [Glycine soja]
Length=772

 Score =   153 bits (386),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 119/190 (63%), Gaps = 9/190 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVK--ILED-----KIP  1174
             +HP+   YRTK V  +++L +I+GHTVADGRYSLS  D++ +++V+   L+D      +P
Sbjct  69    SHPDARCYRTKPVLNFDDLCVIYGHTVADGRYSLSSHDVNLDDQVQGQHLDDGMGSIAVP  128

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             + + A+  DW+ +MEQ FI+ +L+Q+  GN+++  F   AW  M+  FN  FG Q+G+ V
Sbjct  129   SSERAR-TDWTASMEQFFIEFLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFGCQHGRRV  187

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK RF    + Y  +  L+ Q GF+W E+  M++A+D VW   +KA  +   YR+K+L  
Sbjct  188   LKNRFKKRLKHYCDITNLIKQ-GFLWDEQQLMLLADDDVWNAYVKAHLHAGTYRSKTLPN  246

Query  813   YKDMSIICGN  784
             Y D+ +I  N
Sbjct  247   YCDLELIFRN  256


 Score = 45.1 bits (105),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 39/66 (59%), Gaps = 4/66 (6%)
 Frame = -1

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTG---NDEK  1433
             +M+  F+  +  ++D DVLK RY +L KQ+++ K +L    F WD SRQMV     +D  
Sbjct  3     DMLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSV  62

Query  1432  WDDYIK  1415
              D Y+K
Sbjct  63    CDAYLK  68


 Score =   110 bits (275),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 94/176 (53%), Gaps = 7/176 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL-----EDKIPTK  1168
             AHPE  P R K +P Y +  +IF    +D RY     + D  +E+ +      ++ I + 
Sbjct  347   AHPEAPPLRVKTLPDYWKWSVIFAAESSDTRYVHLAHNEDHSSELPMYITGEQKNGICSN  406

Query  1167  --DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               D    I+W+E+ME +F+ +M+EQV  GN++   F  +AW+HM+ AFN  +G Q  K V
Sbjct  407   VYDAGSTIEWTESMECYFVDIMIEQVNRGNRIENLFNEEAWMHMVQAFNARWGLQSDKQV  466

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNK  826
             L  ++  L +++  +  +LS   F W+E  Q I AED VW   IK     + + NK
Sbjct  467   LMDQYFCLMKKHDDISNILSHSEFAWNETLQTINAEDDVWDAYIKFCDLCKIFGNK  522


 Score = 32.3 bits (72),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 14/37 (38%), Positives = 22/37 (59%), Gaps = 1/37 (3%)
 Frame = -1

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+++   +L+Q  F WDD+ +M+   D  WD Y K 
Sbjct  311   KQFNDVDHLLQQGGFSWDDTIEMIDAEDHVWDAYTKA  347


 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 70/109 (64%), Gaps = 0/109 (0%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             +  SSE  R++WT  M+ +FIE LLDQ+ +GN+    F+K AW +M+A+F+ K+ C+H  
Sbjct  126   AVPSSERARTDWTASMEQFFIEFLLDQLGRGNQVDNGFNKNAWTDMLAIFNAKFGCQHGR  185

Query  1552  DVLKNRYKHLRKQYHNTKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQM  1406
              VLKNR+K   K Y +   L +  F+WD+ + M+  +D+ W+ Y+K  +
Sbjct  186   RVLKNRFKKRLKHYCDITNLIKQGFLWDEQQLMLLADDDVWNAYVKAHL  234


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 66/108 (61%), Gaps = 1/108 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  M+ YF++++++Q+ +GNR    F+++AW+ M+  F+ ++  + D  VL ++Y  L 
Sbjct  416   WTESMECYFVDIMIEQVNRGNRIENLFNEEAWMHMVQAFNARWGLQSDKQVLMDQYFCLM  475

Query  1519  KQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             K++ + + IL  +EF W+++ Q +   D+ WD YIK     + F N L
Sbjct  476   KKHDDISNILSHSEFAWNETLQTINAEDDVWDAYIKFCDLCKIFGNKL  523


 Score = 70.5 bits (171),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -2

Query  1044  MITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVA---EDRVW  874
             M+T+FN  FG QY K VLKTR+  L +Q+  VK LLS  GF W    QM+VA   +D V 
Sbjct  4     MLTSFNADFGSQYDKDVLKTRYTNLWKQFNDVKSLLSHFGFSWDASRQMVVAAADDDSVC  63

Query  873   KKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYG  760
                +K+    R YR K +  + D+ +I G+     +Y 
Sbjct  64    DAYLKSHPDARCYRTKPVLNFDDLCVIYGHTVADGRYS  101



>emb|CAN79665.1| hypothetical protein VITISV_038207 [Vitis vinifera]
Length=618

 Score =   120 bits (300),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 94/180 (52%), Gaps = 10/180 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE E  R K  P Y +L  IF  + ADG+ +LS       N  +++       +D  +
Sbjct  138   AHPEAEAIRKKGCPIYEQLCTIFSDSEADGKCALS-------NSGEMMHQ---MDEDQXR  187

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               WS ++E+ F++LMLEQV +GN+ N +F  KAW ++   FN   G  + K  LK R  +
Sbjct  188   AKWSTSLEKIFVELMLEQVLQGNRSNNSFSKKAWNYICDEFNRQTGLNFHKQQLKNRHGV  247

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRR Y ++K LL QDGF W E     +AED VW K I+        R K    Y+ +  I
Sbjct  248   LRRLYNSLKLLLDQDGFSWDESRGXXIAEDEVWAKYIEEHPEVESIRFKGCLVYEQLHXI  307


 Score = 75.1 bits (183),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT      F  LL++QIQ+GNR +  F+K+AW  +   F+ +   K D   LKN   
Sbjct  39    RAKWTANSTKIFANLLVEQIQQGNRPNNVFNKKAWKHIXEEFNKQTGLKFDRQQLKNHLD  98

Query  1528  HLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LRK+Y+  K+ L+QNEF WD S+ MV   D  W  YI+ 
Sbjct  99    VLRKRYNYVKVLLDQNEFSWDVSQCMVIAEDAVWKKYIEA  138


 Score = 79.0 bits (193),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 91/200 (46%), Gaps = 20/200 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK--  1156
             HPE+E  R K    Y +L  IF    +DG+ + +              D +P++D +K  
Sbjct  287   HPEVESIRFKGCLVYEQLHXIFSDLESDGKSAFA---------ATTQMDDLPSQDQSKLD  337

Query  1155  --KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               +  W  ++++ F+ L++ + Q+    N+    KAW  +   FN   G  + +  L+  
Sbjct  338   QSRAKWMPSLDKIFVDLLVWKNQQNCVSNK----KAWKGIREEFNKQTGLNFEEQQLRNH  393

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
              ++LRR Y  +  LL Q GF W E   M++A+ + W+  IKA       RNK    +K +
Sbjct  394   QSVLRRWYNNINSLLYQAGFSWDESKHMVMADGKTWENHIKAYPECETIRNKECPIFKQL  453

Query  801   SII-CGNETPT--FQYGYPF  751
               +  G E      Q G+ F
Sbjct  454   CJLFSGXEAEGRYVQSGHDF  473


 Score = 74.3 bits (181),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = -1

Query  1765  ALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIAL  1586
             AL N G M        +  R+ W+  ++  F+EL+L+Q+ +GNR++ SFSK+AW  +   
Sbjct  170   ALSNSGEMMHQM--DEDQXRAKWSTSLEKIFVELMLEQVLQGNRSNNSFSKKAWNYICDE  227

Query  1585  FSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             F+ +         LKNR+  LR+ Y++ K +L+Q+ F WD+SR      DE W  YI+
Sbjct  228   FNRQTGLNFHKQQLKNRHGVLRRLYNSLKLLLDQDGFSWDESRGXXIAEDEVWAKYIE  285


 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 0/118 (0%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+    + F  L++EQ+Q+GN+ N  F  KAW H+   FN   G ++ +  LK   ++LR
Sbjct  42    WTANSTKIFANLLVEQIQQGNRPNNVFNKKAWKHIXEEFNKQTGLKFDRQQLKNHLDVLR  101

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             ++Y  VK LL Q+ F W     M++AED VWKK I+A       R K    Y+ +  I
Sbjct  102   KRYNYVKVLLDQNEFSWDVSQCMVIAEDAVWKKYIEAHPEAEAIRKKGCPIYEQLCTI  159


 Score = 47.0 bits (110),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   +D  F++LL+ +    N+ +   +K+AW  +   F+ +     +   L+N   
Sbjct  340   RAKWMPSLDKIFVDLLVWK----NQQNCVSNKKAWKGIREEFNKQTGLNFEEQQLRNHQS  395

Query  1528  HLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y+N   +L Q  F WD+S+ MV  + + W+++IK 
Sbjct  396   VLRRWYNNINSLLYQAGFSWDESKHMVMADGKTWENHIKA  435


 Score = 36.6 bits (83),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 25/45 (56%), Gaps = 0/45 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV  1198
             A+PE E  R K  P + +L  +F    A+GRY  S  D + ++E+
Sbjct  435   AYPECETIRNKECPIFKQLCJLFSGXEAEGRYVQSGHDFEXDHEI  479



>ref|XP_002319557.2| hypothetical protein POPTR_0013s02610g, partial [Populus trichocarpa]
 gb|EEE95480.2| hypothetical protein POPTR_0013s02610g, partial [Populus trichocarpa]
Length=229

 Score =   105 bits (263),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = -1

Query  1720  SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLK  1541
             ++ +R NWT +M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+ ++  K+D D LK
Sbjct  9     NDRMRINWTSMMERYFIDLMLDQLHRGNRMGHTFNKQAWTDMLTMFNSRFGTKYDRDTLK  68

Query  1540  NRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             + Y +L KQY++ K +LEQ+ F WDD+R+MV  +D+ W   IK 
Sbjct  69    SHYSNLWKQYNDVKNLLEQSGFSWDDNRKMVVASDDAWATIIKA  112


 Score = 85.1 bits (209),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 71/117 (61%), Gaps = 6/117 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTK  1168
             A+ + + Y  K +  +N+L +IF +T ADGRYS S  DID +++++ L         P++
Sbjct  112   ANSDAQYYWRKFLVNFNDLCLIFAYTAADGRYSRSSHDIDLDDDIQGLNFDAGMGGFPSE  171

Query  1167  D-DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
               +  K  W+  M++ F++LML +V++G+K N TF  +AW  M+T FN  F  QYGK
Sbjct  172   STNCVKAKWTSAMDRFFLELMLVEVKKGSKNNNTFSKEAWKDMLTLFNAKFCSQYGK  228


 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 77/125 (62%), Gaps = 0/125 (0%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +D  +I+W+  ME++FI LML+Q+  GN++  TF  +AW  M+T FN+ FG +Y +  LK
Sbjct  9     NDRMRINWTSMMERYFIDLMLDQLHRGNRMGHTFNKQAWTDMLTMFNSRFGTKYDRDTLK  68

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             + ++ L +QY  VK LL Q GF W +  +M+VA D  W  +IKA    + Y  K L  + 
Sbjct  69    SHYSNLWKQYNDVKNLLEQSGFSWDDNRKMVVASDDAWATIIKANSDAQYYWRKFLVNFN  128

Query  807   DMSII  793
             D+ +I
Sbjct  129   DLCLI  133


 Score = 54.7 bits (130),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/67 (33%), Positives = 42/67 (63%), Gaps = 0/67 (0%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +  L     M      S+  +++ WT  MD +F+EL+L +++KG++ + +FSK+AW +M+
Sbjct  156   IQGLNFDAGMGGFPSESTNCVKAKWTSAMDRFFLELMLVEVKKGSKNNNTFSKEAWKDML  215

Query  1591  ALFSHKY  1571
              LF+ K+
Sbjct  216   TLFNAKF  222



>ref|XP_010549994.1| PREDICTED: uncharacterized protein LOC104820967 isoform X6 [Tarenaya 
hassleriana]
Length=997

 Score =   102 bits (253),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTKD  1165
             +PE +  R + +  Y +L +I+ +   +G  +L   D  F  +V + E            
Sbjct  213   NPEAQSLRNETLLGYRDLCLIYDNKKNNGPRNLVQHD-KFAEDVFLPERSDIVGHFSAGS  271

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  K+ W+ +M+++ I L+L+Q   GN++  TF ++AW  M T F   FG  Y  V LK 
Sbjct  272   EILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVSLKQ  331

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             +  +L RQY  +  LL Q  F W +  + +VAED +W   IK       YRNKS+S Y  
Sbjct  332   QLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIKEHPEAAVYRNKSISSYHK  391

Query  804   MSIICGNET  778
             + +I  +E 
Sbjct  392   LGVIFFDEN  400


 Score = 87.0 bits (214),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E     WT  MD YFIEL++DQ + GNR + +F K AW +M  + + K+   +    LK 
Sbjct  110   EHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKL  169

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             R+K L + Y + + +L+QN F WD+ RQ++   ++ WD YIKV    Q   N
Sbjct  170   RHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRN  221


 Score = 92.4 bits (228),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE L+ +WT  MD Y I+LLLDQ  +GN+   +F+ +AW EM  +F+ ++   +D   
Sbjct  269   AGSEILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVS  328

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK + K L +QY++  I LEQ+ F WDD+R+ V   D  W +YIK
Sbjct  329   LKQQLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIK  373


 Score = 91.7 bits (226),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE----NEVKILEDKIPTKDD  1162
             HPE   YR K +  Y++L +IF    +  R S    D D E    +++     + P++  
Sbjct  375   HPEAAVYRNKSISSYHKLGVIFFDENSHRRCS-ELGDADLEYGEPDQINRESSECPSQSY  433

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
                  W+  M++H I LML+QV  GN++  +F +++W  M  +F   FG    K  LKTR
Sbjct  434   RFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGLPQRKAPLKTR  493

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                 +R Y  ++ LLS+ GF W E+ Q + A + VW  + K     + YR +    Y + 
Sbjct  494   HKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFKDYPDAKCYRGRRYPNYNEF  553

Query  801   SIICGNET  778
              +I G+  
Sbjct  554   FLIYGDSA  561


 Score =   116 bits (290),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 18/182 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+ + YR +  P YNE  +I+G + +                           D AK+ 
Sbjct  536   YPDAKCYRGRRYPNYNEFFLIYGDSASHAIAPRH------------------KNDYAKRT  577

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV++GNKL++ F   AW  M T F + FG ++ + +LK+RF +L
Sbjct  578   DWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFLIL  637

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL Q GF W E  QM++A+  +W   IK     R Y  +S   + D+ +I 
Sbjct  638   RKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIKEHPNARSYHKRSFPSFNDLFLIF  697

Query  789   GN  784
             G+
Sbjct  698   GD  699


 Score = 66.6 bits (161),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSCSS-SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E   C S S     +WT  MD + I+L+L Q+  GNR  +SF  ++W EM   F  ++  
Sbjct  424   ESSECPSQSYRFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGL  483

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                   LK R+KH ++ Y + + +L +  F WD+  Q V  N+  WD   K
Sbjct  484   PQRKAPLKTRHKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFK  534


 Score = 91.7 bits (226),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 21/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    Y  +  P +N+L +IFG    DG  +LSC   +  N        +P     ++ 
Sbjct  676   HPNARSYHKRSFPSFNDLFLIFGDRCTDGLENLSCLSTESGN--------VPDIGFCRRT  727

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
               S                 G K  R F+N A   MI + N  F  Q  K   + ++  L
Sbjct  728   GKSSDF-------------WGKKRTRNFRNGALRCMIDSLNEQFRLQCSKYFSENQYQRL  774

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
               +Y  V YLL QDGF W    QM+VA+D VW+  IK      RYR++SL+ Y+D+ +  
Sbjct  775   MMEYRDVTYLLKQDGFEWDGFLQMVVAKDDVWEAHIKEHPEAARYRDRSLTDYEDLCLTF  834

Query  789   GNETPTF  769
             G+    F
Sbjct  835   GDNASAF  841


 Score = 89.7 bits (221),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q+++GN+    F+K AW  M   F   +  +HD D+LK+R+ 
Sbjct  576   RTDWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFL  635

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK++++ K +L+Q  F WD++RQMV  +   WD YIK
Sbjct  636   ILRKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIK  674


 Score =   129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 108/190 (57%), Gaps = 6/190 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
               P+   YR K +P++++L +I+ +T ADGRYS S  D++F++EV+ L      +D    
Sbjct  48    GQPDAAIYRGKSMPHFDDLCLIYAYTKADGRYSRSSHDLEFDDEVQGLIASSVDDDIALV  107

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K +  + +W+  M+++FI+LM++Q + GN+ N TF   AW  M    N+ F   Y    L
Sbjct  108   KMEHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYL  167

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R   L   Y  ++ LL Q+GF W E  Q+I+AE+ VW   IK     +  RN++L  Y
Sbjct  168   KLRHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRNETLLGY  227

Query  810   KDMSIICGNE  781
             +D+ +I  N+
Sbjct  228   RDLCLIYDNK  237



>gb|KGN66102.1| hypothetical protein Csa_1G570760 [Cucumis sativus]
Length=924

 Score =   131 bits (330),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 112/193 (58%), Gaps = 3/193 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YRT  +P YN+L +I+G+ V D R      D +  ++ K   D   +       
Sbjct  438   HPHAKSYRTGPIPSYNDLCLIYGNLVPDTRPGPKHLDQEIASDGK---DAKTSHRYHWSS  494

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++ FI LML QV+ GN +++ F  +AW  M++ FN  FG Q+ + VLK+RF  L
Sbjct  495   DWTPQMDRCFIDLMLSQVRTGNMVDKKFNKQAWDDMVSKFNAEFGPQHDENVLKSRFFNL  554

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K+LL+QDGF+W E  QMI+AED +W   I+     + Y++++L  + D+ +I 
Sbjct  555   RKRFHDMKFLLNQDGFVWDELLQMIIAEDDLWDAYIEEYPDAKSYKSRALPNFNDLFLIF  614

Query  789   GNETPTFQYGYPF  751
             G +  +    Y F
Sbjct  615   GKDNTSNHQHYLF  627


 Score = 57.4 bits (137),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 3/111 (3%)
 Frame = -1

Query  1741  EDDSCSSSETLRS-NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             ED  C +     S  W+  MD YFI+L+L+ + K  +   +     W  MI+ F  ++  
Sbjct  327   EDIQCHADRYSSSMQWSFEMDGYFIDLMLESVGKVKKFDYN-DDLTWTNMISSFKERFGL  385

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
               + D  +  +K L K+Y + K IL+Q  F WD+ R  V   D+ W  YIK
Sbjct  386   VFNQDSFRRHFKSLEKKYFDLKNILKQRGFWWDERRHSVNAYDDTWAAYIK  436


 Score = 96.3 bits (238),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/333 (26%), Positives = 153/333 (46%), Gaps = 22/333 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG--HTVADGRYSLSCFDIDFE-NEVKIL----EDKIPT  1171
             +P+ + Y+++ +P +N+L +IFG  +T     Y  +  D D    EV I+    E     
Sbjct  593   YPDAKSYKSRALPNFNDLFLIFGKDNTSNHQHYLFNSVDADDSYPEVNIVNEAEEQFFSD  652

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D   I+W+  M+ H++ LMLEQV+ GNK   TF + AW  M+T+FN  F     +  L
Sbjct  653   NSDETIIEWTNEMDDHYVDLMLEQVRRGNKTGSTFTDHAWAWMVTSFNKTFKLTCDRNFL  712

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             ++RF  L+++Y   ++++ Q        HQ     + V +  IK    +     +S   Y
Sbjct  713   ESRFFTLKKEYKDAQHIVDQKNMARAGIHQSTATNNEVSETHIKELANYSERGGRSFDRY  772

Query  810   KDMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRY  631
              D  +I  ++    + G     +    V +   T K G        +  + +   +KC  
Sbjct  773   DDSCMIYEDQFEDERLG-----SSSMNVQVEDGTQKIG-----RSDLFAECKSHGRKCEV  822

Query  630   DTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYIL  451
               +  +     PS      +++  +++ MQE+ +   +LTK        S  IE+V+  L
Sbjct  823   SYQRKRLKSATPSTFVGNKKVK-RVKEEMQEIGSNKASLTKNVANVIDYS--IENVVSAL  879

Query  450   QAMPEMdddddllldacdfledDNKAKVFLALD  352
             Q++P+M+D+  L        E   KAKVF+A+D
Sbjct  880   QSVPDMNDELFLEACKLLEDER--KAKVFVAMD  910


 Score = 92.4 bits (228),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 69/98 (70%), Gaps = 1/98 (1%)
 Frame = -1

Query  1705  SNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             S+WT  MD  FI+L+L Q++ GN     F+KQAW +M++ F+ ++  +HD +VLK+R+ +
Sbjct  494   SDWTPQMDRCFIDLMLSQVRTGNMVDKKFNKQAWDDMVSKFNAEFGPQHDENVLKSRFFN  553

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LRK++H+ K +L Q+ F+WD+  QM+   D+ WD YI+
Sbjct  554   LRKRFHDMKFLLNQDGFVWDELLQMIIAEDDLWDAYIE  591


 Score = 90.9 bits (224),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 67/103 (65%), Gaps = 1/103 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E+ R+ WT  MD Y ++L++DQ++KG R +  F KQAW +MI LF+ ++  +H    LK+
Sbjct  175   ESSRTGWTLAMDQYLVKLMIDQVRKGCRINGIFKKQAWEDMITLFNAEFGYQHRKSFLKH  234

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             RY+ L+  Y + + +LE   F WD+ +Q++  +D  WDDYIK 
Sbjct  235   RYRKLKTYYIDLRNLLEARGFSWDEKQQILVADDGVWDDYIKA  277


 Score = 90.5 bits (223),  Expect(2) = 4e-36, Method: Compositional matrix adjust.
 Identities = 56/199 (28%), Positives = 94/199 (47%), Gaps = 14/199 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS-------LSCFDIDFENE-VKILEDKI  1177
             A+P+   YR + +  + +L +I+  T+++G            C   D E E ++   D+ 
Sbjct  277   ANPDAHAYRKRTLLNFLDLCLIYDDTMSNGHCDHMQQLERFECAPEDSEEEDIQCHADRY  336

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              +      + WS  M+ +FI LMLE V +  K +    +  W +MI++F   FG  + + 
Sbjct  337   SSS-----MQWSFEMDGYFIDLMLESVGKVKKFDYN-DDLTWTNMISSFKERFGLVFNQD  390

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
               +  F  L ++YF +K +L Q GF W ER   + A D  W   IK   + + YR   + 
Sbjct  391   SFRRHFKSLEKKYFDLKNILKQRGFWWDERRHSVNAYDDTWAAYIKEHPHAKSYRTGPIP  450

Query  816   FYKDMSIICGNETPTFQYG  760
              Y D+ +I GN  P  + G
Sbjct  451   SYNDLCLIYGNLVPDTRPG  469


 Score =   145 bits (367),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 113/186 (61%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP+++ YR + +  +N L +I+ HT ADGRYS+S  D+DF++++  L          P 
Sbjct  113   AHPDIQSYRNRPLINFNNLCLIYAHTAADGRYSMSSHDLDFDDDIMGLCIGVGINGLAPV  172

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               ++ +  W+  M+Q+ ++LM++QV++G ++N  FK +AW  MIT FN  FG+Q+ K  L
Sbjct  173   NKESSRTGWTLAMDQYLVKLMIDQVRKGCRINGIFKKQAWEDMITLFNAEFGYQHRKSFL  232

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L+  Y  ++ LL   GF W E+ Q++VA+D VW   IKA      YR ++L  +
Sbjct  233   KHRYRKLKTYYIDLRNLLEARGFSWDEKQQILVADDGVWDDYIKANPDAHAYRKRTLLNF  292

Query  810   KDMSII  793
              D+ +I
Sbjct  293   LDLCLI  298


 Score =   105 bits (261),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 77/138 (56%), Gaps = 0/138 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             +  D  + +W+  MEQ+FI LML QV  GN++  TF  +AW  M+  FN  FG  Y   +
Sbjct  8     SSSDRWRTNWTPAMEQYFIDLMLNQVHRGNRMGHTFNKQAWNDMLMMFNAKFGSPYDINI  67

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+R+  L +Q+  ++ LL  +GF W    QM++AE+ +W   I+A    + YRN+ L  
Sbjct  68    LKSRYTNLWKQFNDIRNLLDNEGFSWDNARQMVIAENNIWDSFIRAHPDIQSYRNRPLIN  127

Query  813   YKDMSIICGNETPTFQYG  760
             + ++ +I  +     +Y 
Sbjct  128   FNNLCLIYAHTAADGRYS  145


 Score =   103 bits (256),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             + SSS+  R+NWT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+   +D 
Sbjct  6     NISSSDRWRTNWTPAMEQYFIDLMLNQVHRGNRMGHTFNKQAWNDMLMMFNAKFGSPYDI  65

Query  1552  DVLKNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLK  1376
             ++LK+RY +L KQ+++ + L  NE F WD++RQMV   +  WD +I+     Q + N   
Sbjct  66    NILKSRYTNLWKQFNDIRNLLDNEGFSWDNARQMVIAENNIWDSFIRAHPDIQSYRNRPL  125

Query  1375  I  1373
             I
Sbjct  126   I  126


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             S +S ET+   WT+ MDD++++L+L+Q+++GN+T ++F+  AW  M+  F+  +K   D 
Sbjct  651   SDNSDETI-IEWTNEMDDHYVDLMLEQVRRGNKTGSTFTDHAWAWMVTSFNKTFKLTCDR  709

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             + L++R+  L+K+Y + + I++Q         Q    N+E  + +IK
Sbjct  710   NFLESRFFTLKKEYKDAQHIVDQKNMARAGIHQSTATNNEVSETHIK  756



>ref|XP_007030896.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY11398.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=645

 Score =   159 bits (403),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 110/175 (63%), Gaps = 5/175 (3%)
 Frame = -2

Query  1287  YNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI-----PTKDDAKKIDWSETMEQH  1123
             +N+L +I+ +T ADGRYS S  DIDF+++ + +   +     P  D+  KIDW++ M+QH
Sbjct  3     FNDLCLIYAYTQADGRYSRSSHDIDFDDDAQGMNFGVGTTIPPASDERPKIDWTQAMDQH  62

Query  1122  FIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKY  943
             FI+LML  ++ GNK   TF  +AW  M+ +FN  FGF YGK  L+ R+  L + Y  V+ 
Sbjct  63    FIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSFLRRRYRKLLKHYSDVQS  122

Query  942   LLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
             LL Q GF W E+ QM+VA+D VW   +KA    R YRNK +  Y+D+ +I GN +
Sbjct  123   LLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLNYQDLRLIYGNAS  177


 Score =   132 bits (331),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 10/195 (5%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL--------ED  1183
             V AHP+   YR K +  Y +LR+I+G+    G  S  C   +     KIL        ED
Sbjct  149   VKAHPDARIYRNKKMLNYQDLRLIYGNASNIGVSSHMCQGRN--TGPKILPAWTGEQNED  206

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYG  1003
              +  + +   I W+  M ++FI L+L Q   GNK++  F  +AW  M+  FN  FG QY 
Sbjct  207   HLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQYD  266

Query  1002  KVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKS  823
             +  LK++   LRRQY  +K LL Q+GF W +  +M++AED +W   IKA  Y + YRNKS
Sbjct  267   EDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRNKS  326

Query  822   LSFYKDMSIICGNET  778
             +  Y  + +I G E+
Sbjct  327   VPDYHKLCVIFGQES  341


 Score =   125 bits (313),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/189 (37%), Positives = 104/189 (55%), Gaps = 5/189 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE---VKILED-KIPTKD  1165
             AHP ++ YR K VP Y++L +IFG   ++G  S++   +  ENE   + I ED +    +
Sbjct  315   AHPYIQSYRNKSVPDYHKLCVIFGQESSNGWCSMAK-SMYLENEDPDLMIGEDTQYHASN  373

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +IDW+ +M++H I L+LEQV  GN++N    ++ W+ M  +F   FG Q  +  LK 
Sbjct  374   GCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEFLKN  433

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               + L +QY+ ++ LL +  F W E  QM+ A D VW   IK       YRN S   Y D
Sbjct  434   HHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIKEYPDIESYRNISKPNYND  493

Query  804   MSIICGNET  778
             + +I GN T
Sbjct  494   LCLIYGNST  502


 Score =   114 bits (286),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             ED  C   E L  +WT  M+ YFI+LLL+Q   GN+    F  +AW +M+A+F+ K+ C+
Sbjct  205   EDHLCDRREMLSIHWTPAMNRYFIDLLLNQALGGNKIHHMFIPEAWTQMVAMFNVKFGCQ  264

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             +D D LK++ + LR+QY+N KI LEQN F WDD+R+MV   D  WD YIK   + Q + N
Sbjct  265   YDEDALKSQARDLRRQYNNIKILLEQNGFSWDDTREMVIAEDYIWDTYIKAHPYIQSYRN  324

Query  1384  HLKIIAHYILVSF  1346
                   H + V F
Sbjct  325   KSVPDYHKLCVIF  337


 Score = 88.2 bits (217),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 80/143 (56%), Gaps = 11/143 (8%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S E  + +WT  MD +FIEL+L  ++ GN++  +F+KQAW +M+  F+ K+   +    
Sbjct  46    ASDERPKIDWTQAMDQHFIELMLGHLRNGNKSKNTFNKQAWNDMLGSFNAKFGFPYGKSF  105

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNH----  1382
             L+ RY+ L K Y + + +L Q  F WD+ +QMV  +D  WD+Y+K     + + N     
Sbjct  106   LRRRYRKLLKHYSDVQSLLLQKGFSWDEKQQMVVADDLVWDNYVKAHPDARIYRNKKMLN  165

Query  1381  ---LKII---AHYILVSFVVCVG  1331
                L++I   A  I VS  +C G
Sbjct  166   YQDLRLIYGNASNIGVSSHMCQG  188


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             +S+   R +W   MD + I+LLL+Q+ +GNR + + + + W+EM   F   +  + D + 
Sbjct  371   ASNGCSRIDWNPSMDRHLIDLLLEQVHRGNRINGACNSELWMEMAVSFMETFGLQPDEEF  430

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKN +  L KQY+  + +L++  F WD++RQMVT +D+ WD YIK
Sbjct  431   LKNHHDTLGKQYYIMRTLLDRRVFSWDEARQMVTASDDVWDTYIK  475



>ref|XP_010550004.1| PREDICTED: uncharacterized protein LOC104820967 isoform X7 [Tarenaya 
hassleriana]
Length=889

 Score =   101 bits (252),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTKD  1165
             +PE +  R + +  Y +L +I+ +   +G  +L   D  F  +V + E            
Sbjct  105   NPEAQSLRNETLLGYRDLCLIYDNKKNNGPRNLVQHD-KFAEDVFLPERSDIVGHFSAGS  163

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  K+ W+ +M+++ I L+L+Q   GN++  TF ++AW  M T F   FG  Y  V LK 
Sbjct  164   EILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVSLKQ  223

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             +  +L RQY  +  LL Q  F W +  + +VAED +W   IK       YRNKS+S Y  
Sbjct  224   QLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIKEHPEAAVYRNKSISSYHK  283

Query  804   MSIICGNET  778
             + +I  +E 
Sbjct  284   LGVIFFDEN  292


 Score = 87.0 bits (214),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E     WT  MD YFIEL++DQ + GNR + +F K AW +M  + + K+   +    LK 
Sbjct  2     EHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKL  61

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             R+K L + Y + + +L+QN F WD+ RQ++   ++ WD YIKV    Q   N
Sbjct  62    RHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRN  113


 Score = 92.0 bits (227),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE L+ +WT  MD Y I+LLLDQ  +GN+   +F+ +AW EM  +F+ ++   +D   
Sbjct  161   AGSEILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVS  220

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK + K L +QY++  I LEQ+ F WDD+R+ V   D  W +YIK
Sbjct  221   LKQQLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIK  265


 Score = 91.3 bits (225),  Expect(2) = 9e-37, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE----NEVKILEDKIPTKDD  1162
             HPE   YR K +  Y++L +IF    +  R S    D D E    +++     + P++  
Sbjct  267   HPEAAVYRNKSISSYHKLGVIFFDENSHRRCS-ELGDADLEYGEPDQINRESSECPSQSY  325

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
                  W+  M++H I LML+QV  GN++  +F +++W  M  +F   FG    K  LKTR
Sbjct  326   RFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGLPQRKAPLKTR  385

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                 +R Y  ++ LLS+ GF W E+ Q + A + VW  + K     + YR +    Y + 
Sbjct  386   HKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFKDYPDAKCYRGRRYPNYNEF  445

Query  801   SIICGNET  778
              +I G+  
Sbjct  446   FLIYGDSA  453


 Score =   116 bits (290),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 18/182 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+ + YR +  P YNE  +I+G + +                           D AK+ 
Sbjct  428   YPDAKCYRGRRYPNYNEFFLIYGDSASHAIAPRH------------------KNDYAKRT  469

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV++GNKL++ F   AW  M T F + FG ++ + +LK+RF +L
Sbjct  470   DWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFLIL  529

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL Q GF W E  QM++A+  +W   IK     R Y  +S   + D+ +I 
Sbjct  530   RKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIKEHPNARSYHKRSFPSFNDLFLIF  589

Query  789   GN  784
             G+
Sbjct  590   GD  591


 Score = 66.2 bits (160),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSCSS-SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E   C S S     +WT  MD + I+L+L Q+  GNR  +SF  ++W EM   F  ++  
Sbjct  316   ESSECPSQSYRFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGL  375

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                   LK R+KH ++ Y + + +L +  F WD+  Q V  N+  WD   K
Sbjct  376   PQRKAPLKTRHKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFK  426


 Score = 91.7 bits (226),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 21/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    Y  +  P +N+L +IFG    DG  +LSC   +  N        +P     ++ 
Sbjct  568   HPNARSYHKRSFPSFNDLFLIFGDRCTDGLENLSCLSTESGN--------VPDIGFCRRT  619

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
               S                 G K  R F+N A   MI + N  F  Q  K   + ++  L
Sbjct  620   GKSSDF-------------WGKKRTRNFRNGALRCMIDSLNEQFRLQCSKYFSENQYQRL  666

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
               +Y  V YLL QDGF W    QM+VA+D VW+  IK      RYR++SL+ Y+D+ +  
Sbjct  667   MMEYRDVTYLLKQDGFEWDGFLQMVVAKDDVWEAHIKEHPEAARYRDRSLTDYEDLCLTF  726

Query  789   GNETPTF  769
             G+    F
Sbjct  727   GDNASAF  733


 Score = 89.4 bits (220),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q+++GN+    F+K AW  M   F   +  +HD D+LK+R+ 
Sbjct  468   RTDWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFL  527

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK++++ K +L+Q  F WD++RQMV  +   WD YIK
Sbjct  528   ILRKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIK  566


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 0/123 (0%)
 Frame = -2

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             +W+  M+++FI+LM++Q + GN+ N TF   AW  M    N+ F   Y    LK R   L
Sbjct  7     EWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKLRHKEL  66

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
                Y  ++ LL Q+GF W E  Q+I+AE+ VW   IK     +  RN++L  Y+D+ +I 
Sbjct  67    SEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRNETLLGYRDLCLIY  126

Query  789   GNE  781
              N+
Sbjct  127   DNK  129



>ref|XP_010549988.1| PREDICTED: uncharacterized protein LOC104820967 isoform X5 [Tarenaya 
hassleriana]
Length=1031

 Score =   101 bits (252),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/189 (31%), Positives = 95/189 (50%), Gaps = 6/189 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-----DKIPTKD  1165
             +PE +  R + +  Y +L +I+ +   +G  +L   D  F  +V + E            
Sbjct  247   NPEAQSLRNETLLGYRDLCLIYDNKKNNGPRNLVQHD-KFAEDVFLPERSDIVGHFSAGS  305

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             +  K+ W+ +M+++ I L+L+Q   GN++  TF ++AW  M T F   FG  Y  V LK 
Sbjct  306   EILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVSLKQ  365

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             +  +L RQY  +  LL Q  F W +  + +VAED +W   IK       YRNKS+S Y  
Sbjct  366   QLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIKEHPEAAVYRNKSISSYHK  425

Query  804   MSIICGNET  778
             + +I  +E 
Sbjct  426   LGVIFFDEN  434


 Score = 87.0 bits (214),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 64/112 (57%), Gaps = 1/112 (1%)
 Frame = -1

Query  1717  ETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKN  1538
             E     WT  MD YFIEL++DQ + GNR + +F K AW +M  + + K+   +    LK 
Sbjct  144   EHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYLKL  203

Query  1537  RYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSN  1385
             R+K L + Y + + +L+QN F WD+ RQ++   ++ WD YIKV    Q   N
Sbjct  204   RHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRN  255


 Score = 92.4 bits (228),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 44/105 (42%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             + SE L+ +WT  MD Y I+LLLDQ  +GN+   +F+ +AW EM  +F+ ++   +D   
Sbjct  303   AGSEILKVSWTPSMDRYLIDLLLDQALRGNQIGDTFTDEAWTEMTTIFTRQFGAFYDNVS  362

Query  1546  LKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LK + K L +QY++  I LEQ+ F WDD+R+ V   D  W +YIK
Sbjct  363   LKQQLKVLHRQYNDINILLEQSRFYWDDTRETVVAEDHIWGNYIK  407


 Score = 91.7 bits (226),  Expect(2) = 8e-37, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 92/188 (49%), Gaps = 5/188 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFE----NEVKILEDKIPTKDD  1162
             HPE   YR K +  Y++L +IF    +  R S    D D E    +++     + P++  
Sbjct  409   HPEAAVYRNKSISSYHKLGVIFFDENSHRRCS-ELGDADLEYGEPDQINRESSECPSQSY  467

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
                  W+  M++H I LML+QV  GN++  +F +++W  M  +F   FG    K  LKTR
Sbjct  468   RFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGLPQRKAPLKTR  527

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
                 +R Y  ++ LLS+ GF W E+ Q + A + VW  + K     + YR +    Y + 
Sbjct  528   HKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFKDYPDAKCYRGRRYPNYNEF  587

Query  801   SIICGNET  778
              +I G+  
Sbjct  588   FLIYGDSA  595


 Score =   116 bits (290),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/182 (34%), Positives = 98/182 (54%), Gaps = 18/182 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             +P+ + YR +  P YNE  +I+G + +                           D AK+ 
Sbjct  570   YPDAKCYRGRRYPNYNEFFLIYGDSASHAIAPRH------------------KNDYAKRT  611

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M+++FI LMLEQV++GNKL++ F   AW  M T F + FG ++ + +LK+RF +L
Sbjct  612   DWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFLIL  671

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K LL Q GF W E  QM++A+  +W   IK     R Y  +S   + D+ +I 
Sbjct  672   RKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIKEHPNARSYHKRSFPSFNDLFLIF  731

Query  789   GN  784
             G+
Sbjct  732   GD  733


 Score = 66.2 bits (160),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 56/111 (50%), Gaps = 2/111 (2%)
 Frame = -1

Query  1741  EDDSCSS-SETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             E   C S S     +WT  MD + I+L+L Q+  GNR  +SF  ++W EM   F  ++  
Sbjct  458   ESSECPSQSYRFVDHWTPPMDRHLIDLMLQQVYLGNRIGSSFCDESWAEMSLSFVDRFGL  517

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
                   LK R+KH ++ Y + + +L +  F WD+  Q V  N+  WD   K
Sbjct  518   PQRKAPLKTRHKHFKRIYDDLENLLSRKGFSWDEKLQTVKANNYVWDVLFK  568


 Score = 91.7 bits (226),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 83/187 (44%), Gaps = 21/187 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP    Y  +  P +N+L +IFG    DG  +LSC   +  N        +P     ++ 
Sbjct  710   HPNARSYHKRSFPSFNDLFLIFGDRCTDGLENLSCLSTESGN--------VPDIGFCRRT  761

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
               S                 G K  R F+N A   MI + N  F  Q  K   + ++  L
Sbjct  762   GKSSDF-------------WGKKRTRNFRNGALRCMIDSLNEQFRLQCSKYFSENQYQRL  808

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
               +Y  V YLL QDGF W    QM+VA+D VW+  IK      RYR++SL+ Y+D+ +  
Sbjct  809   MMEYRDVTYLLKQDGFEWDGFLQMVVAKDDVWEAHIKEHPEAARYRDRSLTDYEDLCLTF  868

Query  789   GNETPTF  769
             G+    F
Sbjct  869   GDNASAF  875


 Score = 89.4 bits (220),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q+++GN+    F+K AW  M   F   +  +HD D+LK+R+ 
Sbjct  610   RTDWTPPMDRYFIDLMLEQVRQGNKLDKDFNKIAWDTMATKFISLFGHRHDRDMLKSRFL  669

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK++++ K +L+Q  F WD++RQMV  +   WD YIK
Sbjct  670   ILRKRFNDMKTLLKQPGFFWDEARQMVLADHCLWDAYIK  708


 Score =   129 bits (323),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 108/190 (57%), Gaps = 6/190 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
               P+   YR K +P++++L +I+ +T ADGRYS S  D++F++EV+ L      +D    
Sbjct  82    GQPDAAIYRGKSMPHFDDLCLIYAYTKADGRYSRSSHDLEFDDEVQGLIASSVDDDIALV  141

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K +  + +W+  M+++FI+LM++Q + GN+ N TF   AW  M    N+ F   Y    L
Sbjct  142   KMEHAEPEWTAAMDRYFIELMMDQTRSGNRNNDTFHKHAWKDMCEMLNSKFCSHYSIGYL  201

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R   L   Y  ++ LL Q+GF W E  Q+I+AE+ VW   IK     +  RN++L  Y
Sbjct  202   KLRHKELSEYYCDIQNLLKQNGFFWDEERQIILAENDVWDSYIKVNPEAQSLRNETLLGY  261

Query  810   KDMSIICGNE  781
             +D+ +I  N+
Sbjct  262   RDLCLIYDNK  271


 Score = 40.4 bits (93),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 36/70 (51%), Gaps = 8/70 (11%)
 Frame = -1

Query  1615  KQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGND  1439
              Q  L ++A F H  +      +    Y+     YH+ K +L ++ F+WDD+ +MV  + 
Sbjct  21    PQVLLRLVASFDHSRR-----RLFSGDYRFF--MYHDVKELLVRDGFMWDDAHKMVVSDS  73

Query  1438  EKWDDYIKVQ  1409
               WDDYIK Q
Sbjct  74    CSWDDYIKGQ  83



>ref|XP_008370507.1| PREDICTED: uncharacterized protein LOC103433971 [Malus domestica]
Length=516

 Score =   110 bits (275),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/218 (30%), Positives = 106/218 (49%), Gaps = 26/218 (12%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--------------------LSCF  1222
             C+ A P+   YR K +  Y +L  I+   +++G  +                    L+ F
Sbjct  273   CIQALPDARVYRKKPLLNYQDLNSIYASEISNGLLNHLDQDEEEREGQFSFSGNGHLASF  332

Query  1221  -DIDFENEVKILEDKIPTKDDAKKI----DWSETMEQHFIQLMLEQVQEGNKLNRTFKNK  1057
              D+D E  +  + D    +     I    DW+  M+++ I L+LEQ+Q+ NK++ +  ++
Sbjct  333   EDLDSEG-LDFMTDGEDIQSHGNDIFSRKDWTPPMDRYLIDLLLEQLQKANKIDYSLDDQ  391

Query  1056  AWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRV  877
             AW+ ++  F   FG +Y K +L++R+  L +QY   K LL + GF W E  QM+ A D V
Sbjct  392   AWVDVLVLFKERFGLZYNKDLLRSRYKSLEKQYHDTKDLLDRRGFWWDETQQMVTAYDDV  451

Query  876   WKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQY  763
             W   IK +     YR KS   Y D+ +I GN     +Y
Sbjct  452   WDAYIKERPDTEAYRTKSTPNYNDLCLIYGNSNSGERY  489


 Score = 76.6 bits (187),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +  + +   M   + +S     ++W   MD++F+ L+LDQ++KG + + +F+KQAW  M+
Sbjct  156   IQGMIDGAGMISPTPASKVKRNADWKPAMDEFFLNLMLDQLEKGRKMNNTFTKQAWKGMV  215

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LF  K+  ++ T  LK  +K L K Y + + IL +N F WD++RQM+  +D+ W + I+
Sbjct  216   TLFKKKFGSQYQTRFLKQLHKKLLKYYTDVRSILARNGFYWDENRQMIVADDDVWGNCIQ  275

Query  1414  V  1412
              
Sbjct  276   A  276


 Score =   142 bits (357),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 112/192 (58%), Gaps = 6/192 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDK------I  1177
             V  HP+ + YR K +  +N+L +I+ HT ADGRYSLS  DIDF++E++ + D        
Sbjct  110   VKVHPDAQVYRNKALMTFNDLCLIYAHTQADGRYSLSSHDIDFDDEIQGMIDGAGMISPT  169

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P     +  DW   M++ F+ LML+Q+++G K+N TF  +AW  M+T F   FG QY   
Sbjct  170   PASKVKRNADWKPAMDEFFLNLMLDQLEKGRKMNNTFTKQAWKGMVTLFKKKFGSQYQTR  229

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK     L + Y  V+ +L+++GF W E  QMIVA+D VW   I+A    R YR K L 
Sbjct  230   FLKQLHKKLLKYYTDVRSILARNGFYWDENRQMIVADDDVWGNCIQALPDARVYRKKPLL  289

Query  816   FYKDMSIICGNE  781
              Y+D++ I  +E
Sbjct  290   NYQDLNSIYASE  301


 Score =   101 bits (252),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R +WT  MD Y I+LLL+Q+QK N+   S   QAW++++ LF  ++  +++ D+L++RYK
Sbjct  359   RKDWTPPMDRYLIDLLLEQLQKANKIDYSLDDQAWVDVLVLFKERFGLZYNKDLLRSRYK  418

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L KQYH+TK +L++  F WD+++QMVT  D+ WD YIK
Sbjct  419   SLEKQYHDTKDLLDRRGFWWDETQQMVTAYDDVWDAYIK  457


 Score = 37.0 bits (84),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 15/33 (45%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = -2

Query  1326  PEMEPYRTKVVPYYNELRIIFGHTVADGRYSLS  1228
             P+ E YRTK  P YN+L +I+G++ +  RY+ S
Sbjct  460   PDTEAYRTKSTPNYNDLCLIYGNSNSGERYNQS  492


 Score =   105 bits (261),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M + + +S + LR++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+  +  
Sbjct  1     MSNQNLTSGDRLRTSWTPAMERYFIDLMLDQVHRGNRLGHTFNKQAWNDMLMMFNGNFGT  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
              +D + LK+ Y  L +Q+++ K +L+QN F WD++RQMV  +   WD Y+KV    Q + 
Sbjct  61    PYDMNTLKSHYTSLWRQFNDIKNLLDQNGFSWDNTRQMVIADKYAWDAYVKVHPDAQVYR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score =   103 bits (256),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 74/137 (54%), Gaps = 0/137 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T  D  +  W+  ME++FI LML+QV  GN+L  TF  +AW  M+  FN  FG  Y    
Sbjct  7     TSGDRLRTSWTPAMERYFIDLMLDQVHRGNRLGHTFNKQAWNDMLMMFNGNFGTPYDMNT  66

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+ +  L RQ+  +K LL Q+GF W    QM++A+   W   +K     + YRNK+L  
Sbjct  67    LKSHYTSLWRQFNDIKNLLDQNGFSWDNTRQMVIADKYAWDAYVKVHPDAQVYRNKALMT  126

Query  813   YKDMSIICGNETPTFQY  763
             + D+ +I  +     +Y
Sbjct  127   FNDLCLIYAHTQADGRY  143



>ref|XP_007051025.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOX95182.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=505

 Score =   156 bits (394),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 115/383 (30%), Positives = 177/383 (46%), Gaps = 64/383 (17%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------------HTVADGRYSLSCFDIDFENEV  1198
             +P++ PYR K VPYYN+L  I+G                H   D   S +  +   E  +
Sbjct  114   NPDVRPYRVKTVPYYNDLCFIYGDRRAGEKGDNVSETSSHLGEDETGSAAQPECANEGAL  173

Query  1197  KIL------EDKIPTKDDAK------------------KIDWSETMEQHFIQLMLEQVQE  1090
             K +      ED I    + K                  + +W   M++ FI LMLEQV +
Sbjct  174   KAVHEIAADEDCISVSQEVKDTPETMPNVTTTPLYSRTRTNWHPPMDRSFIDLMLEQVHK  233

Query  1089  GNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHE  910
             GN+++  F+ +AW+ MI +FN  FGF Y   +LK R+  LRRQY  +K +L  DGF W +
Sbjct  234   GNQVDGVFRKQAWVEMIASFNAKFGFNYDMDILKNRYKTLRRQYNLIKNILQLDGFAWDD  293

Query  909   RHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETP---------------  775
               QM+ A+D VW+  IK Q+  R++  + + +YKD+ +IC +  P               
Sbjct  294   ARQMVTADDSVWQDYIKGQKDARQFMTRPVPYYKDLCLICNDPDPDESDCFSLHCLEPQN  353

Query  774   TFQYGYPF--VKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCK  601
             T Q   P    K  +     + +  + GN+ E   I       + K  R    +      
Sbjct  354   TVQEVKPRREAKNSQSLAASVSSEDEIGNVLEPAHIGSKTIGTKLKYKRQLENQLNSAHS  413

Query  600   GPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddd  421
               S   +++     M  A++EM  AVT+LT+++     N + IE+VI  +QA+P++D+D 
Sbjct  414   KKSRGEDDS-----MASALREMATAVTSLTEKKDDGSSNPISIENVIIAVQALPDLDEDL  468

Query  420   dllldacdfledDNKAKVFLALD  352
              L        E   KAK FLALD
Sbjct  469   ILDACDFLEDEI--KAKTFLALD  489


 Score =   115 bits (289),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+NW   MD  FI+L+L+Q+ KGN+    F KQAW+EMIA F+ K+   +D D+LKNRYK
Sbjct  212   RTNWHPPMDRSFIDLMLEQVHKGNQVDGVFRKQAWVEMIASFNAKFGFNYDMDILKNRYK  271

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K IL+ + F WDD+RQMVT +D  W DYIK Q   ++F
Sbjct  272   TLRRQYNLIKNILQLDGFAWDDARQMVTADDSVWQDYIKGQKDARQF  318


 Score =   110 bits (276),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV  GN+ +   F   AW +MI+ FN  F F+Y K VLK R   L
Sbjct  16    WTPEMDRYFIDLMLEQVNNGNRFDDHVFSKTAWKNMISMFNERFNFEYDKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y  VK LL+Q GF W    QM++A+ +VW + IK     R YR K++ +Y D+  I 
Sbjct  76    RNLYKGVKNLLNQKGFTWDATRQMVIADGKVWDEYIKVNPDVRPYRVKTVPYYNDLCFIY  135

Query  789   GN  784
             G+
Sbjct  136   GD  137


 Score =   100 bits (250),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  1711  LRSNWTHVMDDYFIELLLDQIQKGNR-TSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNR  1535
             LR+ WT  MD YFI+L+L+Q+  GNR     FSK AW  MI++F+ ++  ++D DVLKNR
Sbjct  12    LRTIWTPEMDRYFIDLMLEQVNNGNRFDDHVFSKTAWKNMISMFNERFNFEYDKDVLKNR  71

Query  1534  YKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYI  1358
             +K LR  Y   K +L Q  F WD +RQMV  + + WD+YIKV    + +   +K + +Y 
Sbjct  72    HKTLRNLYKGVKNLLNQKGFTWDATRQMVIADGKVWDEYIKVNPDVRPY--RVKTVPYYN  129

Query  1357  LVSFV  1343
              + F+
Sbjct  130   DLCFI  134



>ref|XP_008450682.1| PREDICTED: uncharacterized protein LOC103492194 isoform X2 [Cucumis 
melo]
Length=637

 Score =   128 bits (322),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 111/193 (58%), Gaps = 3/193 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YRT  +P YN+L +I+G+ V D R      D +  ++ K   D   +       
Sbjct  437   HPHAKSYRTGPIPSYNDLCLIYGNLVPDSRPGPKHLDQEIASDGK---DAKTSHSYRWSS  493

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++  I LML QV+ GN +++ F  +AW  M++ FN  FG Q+ + VLK+RF  L
Sbjct  494   DWTPQMDRCLIDLMLYQVRTGNMVDQKFNKQAWDDMVSKFNAEFGPQHDEDVLKSRFFNL  553

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K+LL+QDGF+W E  QMI+AED +W   I+     R Y++++L  + D+ +I 
Sbjct  554   RKRFRDMKFLLNQDGFVWDELLQMIIAEDDLWDAYIEEYPDARFYKSRALPNFNDLFLIF  613

Query  789   GNETPTFQYGYPF  751
             G +  +    Y F
Sbjct  614   GKDNTSNHQHYLF  626


 Score = 58.2 bits (139),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+  MD YF++L+L+ + K  +   +     W  MI+ F  ++    + D  +  +K L 
Sbjct  341   WSFEMDGYFMDLMLEAVGKVKKFDYN-DDLMWTSMISSFKERFGLVFNQDSFRRHFKSLE  399

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K+Y++ K IL+Q  F WD+ R +V   D+ W  YIK
Sbjct  400   KKYYDLKNILKQRGFWWDERRHLVIAYDDTWAAYIK  435


 Score = 92.8 bits (229),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  + E+ R+ WT  MD Y ++L++DQ++KG R + +F KQAW +MI LF+ ++ 
Sbjct  164   GMNGLAPVNKESSRTGWTLPMDQYLVKLMIDQVRKGCRINGTFKKQAWEDMITLFNAEFG  223

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              +H    LK+RY+ L+  Y + + +LE   F WD+ +QMV  +D  W+DYIK 
Sbjct  224   YQHRKSFLKHRYRKLKTYYIDLRNLLEGRGFSWDEKQQMVVADDGVWEDYIKA  276


 Score = 89.4 bits (220),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 98/200 (49%), Gaps = 16/200 (8%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG---------RYSLSCFDIDFENEVKILEDK  1180
             A+P+   YR + +  + +L +I+  T+++G         R+  +  D + E E++   D+
Sbjct  276   ANPDAHVYRKRTLLNFLDLCLIYDDTMSNGHCDHMQQLERFECAPEDSE-EEEIQCHADR  334

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
               +      + WS  M+ +F+ LMLE V +  K +    +  W  MI++F   FG  + +
Sbjct  335   YSSS-----MQWSFEMDGYFMDLMLEAVGKVKKFDYN-DDLMWTSMISSFKERFGLVFNQ  388

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
                +  F  L ++Y+ +K +L Q GF W ER  +++A D  W   IK   + + YR   +
Sbjct  389   DSFRRHFKSLEKKYYDLKNILKQRGFWWDERRHLVIAYDDTWAAYIKEHPHAKSYRTGPI  448

Query  819   SFYKDMSIICGNETPTFQYG  760
               Y D+ +I GN  P  + G
Sbjct  449   PSYNDLCLIYGNLVPDSRPG  468


 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 114/186 (61%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP ++ YR + +  +N L +I+ HT ADGRYS+S  D+DF++++  L          P 
Sbjct  112   AHPHIQSYRNRPLINFNNLCLIYAHTAADGRYSMSSHDLDFDDDIMGLCIGVGMNGLAPV  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               ++ +  W+  M+Q+ ++LM++QV++G ++N TFK +AW  MIT FN  FG+Q+ K  L
Sbjct  172   NKESSRTGWTLPMDQYLVKLMIDQVRKGCRINGTFKKQAWEDMITLFNAEFGYQHRKSFL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L+  Y  ++ LL   GF W E+ QM+VA+D VW+  IKA      YR ++L  +
Sbjct  232   KHRYRKLKTYYIDLRNLLEGRGFSWDEKQQMVVADDGVWEDYIKANPDAHVYRKRTLLNF  291

Query  810   KDMSII  793
              D+ +I
Sbjct  292   LDLCLI  297


 Score =   107 bits (267),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 82/149 (55%), Gaps = 7/149 (5%)
 Frame = -2

Query  1206  NEVKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFN  1027
             N+  I  D++ T       +W+  MEQ+FI LML QV  GN++  TF  +AW  M+  FN
Sbjct  3     NQTNISSDRLGT-------NWTPAMEQYFIDLMLNQVHRGNRMGHTFNKQAWNDMLMMFN  55

Query  1026  TAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQY  847
               FG  Y   +LK+R+  L +Q+  ++ LL  +GF W    QM++AE+ +W   I+A  +
Sbjct  56    AKFGSPYDINILKSRYTNLWKQFNDIRNLLDNEGFSWDNARQMVIAENNIWDSFIRAHPH  115

Query  846   FRRYRNKSLSFYKDMSIICGNETPTFQYG  760
              + YRN+ L  + ++ +I  +     +Y 
Sbjct  116   IQSYRNRPLINFNNLCLIYAHTAADGRYS  144


 Score =   103 bits (256),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M + +  SS+ L +NWT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+  
Sbjct  1     MNNQTNISSDRLGTNWTPAMEQYFIDLMLNQVHRGNRMGHTFNKQAWNDMLMMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
              +D ++LK+RY +L KQ+++ + L  NE F WD++RQMV   +  WD +I+     Q + 
Sbjct  61    PYDINILKSRYTNLWKQFNDIRNLLDNEGFSWDNARQMVIAENNIWDSFIRAHPHIQSYR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score = 88.6 bits (218),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             +D   S S    S+WT  MD   I+L+L Q++ GN     F+KQAW +M++ F+ ++  +
Sbjct  481   KDAKTSHSYRWSSDWTPQMDRCLIDLMLYQVRTGNMVDQKFNKQAWDDMVSKFNAEFGPQ  540

Query  1561  HDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             HD DVLK+R+ +LRK++ + K +L Q+ F+WD+  QM+   D+ WD YI+
Sbjct  541   HDEDVLKSRFFNLRKRFRDMKFLLNQDGFVWDELLQMIIAEDDLWDAYIE  590



>ref|XP_008450681.1| PREDICTED: uncharacterized protein LOC103492194 isoform X1 [Cucumis 
melo]
Length=789

 Score =   128 bits (322),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 111/193 (58%), Gaps = 3/193 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             HP  + YRT  +P YN+L +I+G+ V D R      D +  ++ K   D   +       
Sbjct  437   HPHAKSYRTGPIPSYNDLCLIYGNLVPDSRPGPKHLDQEIASDGK---DAKTSHSYRWSS  493

Query  1149  DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             DW+  M++  I LML QV+ GN +++ F  +AW  M++ FN  FG Q+ + VLK+RF  L
Sbjct  494   DWTPQMDRCLIDLMLYQVRTGNMVDQKFNKQAWDDMVSKFNAEFGPQHDEDVLKSRFFNL  553

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R+++  +K+LL+QDGF+W E  QMI+AED +W   I+     R Y++++L  + D+ +I 
Sbjct  554   RKRFRDMKFLLNQDGFVWDELLQMIIAEDDLWDAYIEEYPDARFYKSRALPNFNDLFLIF  613

Query  789   GNETPTFQYGYPF  751
             G +  +    Y F
Sbjct  614   GKDNTSNHQHYLF  626


 Score = 58.2 bits (139),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 52/96 (54%), Gaps = 2/96 (2%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+  MD YF++L+L+ + K  +   +     W  MI+ F  ++    + D  +  +K L 
Sbjct  341   WSFEMDGYFMDLMLEAVGKVKKFDYN-DDLMWTSMISSFKERFGLVFNQDSFRRHFKSLE  399

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K+Y++ K IL+Q  F WD+ R +V   D+ W  YIK
Sbjct  400   KKYYDLKNILKQRGFWWDERRHLVIAYDDTWAAYIK  435


 Score = 92.4 bits (228),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 71/113 (63%), Gaps = 1/113 (1%)
 Frame = -1

Query  1747  AMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYK  1568
              M   +  + E+ R+ WT  MD Y ++L++DQ++KG R + +F KQAW +MI LF+ ++ 
Sbjct  164   GMNGLAPVNKESSRTGWTLPMDQYLVKLMIDQVRKGCRINGTFKKQAWEDMITLFNAEFG  223

Query  1567  CKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              +H    LK+RY+ L+  Y + + +LE   F WD+ +QMV  +D  W+DYIK 
Sbjct  224   YQHRKSFLKHRYRKLKTYYIDLRNLLEGRGFSWDEKQQMVVADDGVWEDYIKA  276


 Score = 89.4 bits (220),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 98/200 (49%), Gaps = 16/200 (8%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADG---------RYSLSCFDIDFENEVKILEDK  1180
             A+P+   YR + +  + +L +I+  T+++G         R+  +  D + E E++   D+
Sbjct  276   ANPDAHVYRKRTLLNFLDLCLIYDDTMSNGHCDHMQQLERFECAPEDSE-EEEIQCHADR  334

Query  1179  IPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGK  1000
               +      + WS  M+ +F+ LMLE V +  K +    +  W  MI++F   FG  + +
Sbjct  335   YSSS-----MQWSFEMDGYFMDLMLEAVGKVKKFDYN-DDLMWTSMISSFKERFGLVFNQ  388

Query  999   VVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSL  820
                +  F  L ++Y+ +K +L Q GF W ER  +++A D  W   IK   + + YR   +
Sbjct  389   DSFRRHFKSLEKKYYDLKNILKQRGFWWDERRHLVIAYDDTWAAYIKEHPHAKSYRTGPI  448

Query  819   SFYKDMSIICGNETPTFQYG  760
               Y D+ +I GN  P  + G
Sbjct  449   PSYNDLCLIYGNLVPDSRPG  468


 Score =   147 bits (372),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 114/186 (61%), Gaps = 6/186 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKIL------EDKIPT  1171
             AHP ++ YR + +  +N L +I+ HT ADGRYS+S  D+DF++++  L          P 
Sbjct  112   AHPHIQSYRNRPLINFNNLCLIYAHTAADGRYSMSSHDLDFDDDIMGLCIGVGMNGLAPV  171

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               ++ +  W+  M+Q+ ++LM++QV++G ++N TFK +AW  MIT FN  FG+Q+ K  L
Sbjct  172   NKESSRTGWTLPMDQYLVKLMIDQVRKGCRINGTFKKQAWEDMITLFNAEFGYQHRKSFL  231

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R+  L+  Y  ++ LL   GF W E+ QM+VA+D VW+  IKA      YR ++L  +
Sbjct  232   KHRYRKLKTYYIDLRNLLEGRGFSWDEKQQMVVADDGVWEDYIKANPDAHVYRKRTLLNF  291

Query  810   KDMSII  793
              D+ +I
Sbjct  292   LDLCLI  297


 Score = 88.6 bits (218),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 71/110 (65%), Gaps = 1/110 (1%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             +D   S S    S+WT  MD   I+L+L Q++ GN     F+KQAW +M++ F+ ++  +
Sbjct  481   KDAKTSHSYRWSSDWTPQMDRCLIDLMLYQVRTGNMVDQKFNKQAWDDMVSKFNAEFGPQ  540

Query  1561  HDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             HD DVLK+R+ +LRK++ + K +L Q+ F+WD+  QM+   D+ WD YI+
Sbjct  541   HDEDVLKSRFFNLRKRFRDMKFLLNQDGFVWDELLQMIIAEDDLWDAYIE  590


 Score = 84.3 bits (207),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 90/186 (48%), Gaps = 7/186 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG--HTVADGRYSLSCFDIDFE-NEVKIL----EDKIPT  1171
             +P+   Y+++ +P +N+L +IFG  +T     Y  +  D D    EV I+    E     
Sbjct  592   YPDARFYKSRALPNFNDLFLIFGKDNTSNHQHYLFNSVDADDSYPEVNIVNEAEEQFFSD  651

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
               D   I+W+  M+ H++ LMLEQV+ GNK    F + AW  M+T+FN  F     +  L
Sbjct  652   NSDETIIEWTNEMDDHYVNLMLEQVRRGNKTGSMFTDHAWAWMVTSFNKTFKLTCDRNFL  711

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             ++RF  L+++Y   ++++ Q        HQ     + V +  IK          +S   Y
Sbjct  712   ESRFFTLKKEYKDAQHMVDQKNMSRARIHQSTATNNEVSETHIKELANDSERGGRSFDRY  771

Query  810   KDMSII  793
             +D+ +I
Sbjct  772   EDLCMI  777


 Score =   107 bits (267),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/149 (34%), Positives = 82/149 (55%), Gaps = 7/149 (5%)
 Frame = -2

Query  1206  NEVKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFN  1027
             N+  I  D++ T       +W+  MEQ+FI LML QV  GN++  TF  +AW  M+  FN
Sbjct  3     NQTNISSDRLGT-------NWTPAMEQYFIDLMLNQVHRGNRMGHTFNKQAWNDMLMMFN  55

Query  1026  TAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQY  847
               FG  Y   +LK+R+  L +Q+  ++ LL  +GF W    QM++AE+ +W   I+A  +
Sbjct  56    AKFGSPYDINILKSRYTNLWKQFNDIRNLLDNEGFSWDNARQMVIAENNIWDSFIRAHPH  115

Query  846   FRRYRNKSLSFYKDMSIICGNETPTFQYG  760
              + YRN+ L  + ++ +I  +     +Y 
Sbjct  116   IQSYRNRPLINFNNLCLIYAHTAADGRYS  144


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M + +  SS+ L +NWT  M+ YFI+L+L+Q+ +GNR   +F+KQAW +M+ +F+ K+  
Sbjct  1     MNNQTNISSDRLGTNWTPAMEQYFIDLMLNQVHRGNRMGHTFNKQAWNDMLMMFNAKFGS  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTKILEQNE-FIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
              +D ++LK+RY +L KQ+++ + L  NE F WD++RQMV   +  WD +I+     Q + 
Sbjct  61    PYDINILKSRYTNLWKQFNDIRNLLDNEGFSWDNARQMVIAENNIWDSFIRAHPHIQSYR  120

Query  1387  N  1385
             N
Sbjct  121   N  121


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
             S +S ET+   WT+ MDD+++ L+L+Q+++GN+T + F+  AW  M+  F+  +K   D 
Sbjct  650   SDNSDETI-IEWTNEMDDHYVNLMLEQVRRGNKTGSMFTDHAWAWMVTSFNKTFKLTCDR  708

Query  1552  DVLKNRYKHLRKQYHNTK  1499
             + L++R+  L+K+Y + +
Sbjct  709   NFLESRFFTLKKEYKDAQ  726



>ref|XP_008359531.1| PREDICTED: uncharacterized protein LOC103423241 [Malus domestica]
Length=245

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D KKIDWS+TM+Q F++LML++V++GNK+ RTFK K+WI MIT FN  FGFQ+G+ VLK 
Sbjct  8     DPKKIDWSQTMDQFFVELMLDEVRKGNKVGRTFKKKSWITMITCFNEKFGFQHGRAVLKN  67

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+N+ R+ Y +V   L Q GF W E  Q +VA+D VW K I+A       RNK +S+Y D
Sbjct  68    RYNVFRKHYSSVNIPLDQKGFTWDETQQKVVADDPVWNKYIQAHPSLHMDRNKVMSYYSD  127

Query  804   MSIICGNET  778
             + II GN+ 
Sbjct  128   LCIIRGNDA  136


 Score = 95.1 bits (235),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 68/111 (61%), Gaps = 4/111 (4%)
 Frame = -1

Query  1741  EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCK  1562
             E + C   +    +W+  MD +F+EL+LD+++KGN+   +F K++W+ MI  F+ K+  +
Sbjct  3     EKERCDPKKI---DWSQTMDQFFVELMLDEVRKGNKVGRTFKKKSWITMITCFNEKFGFQ  59

Query  1561  HDTDVLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             H   VLKNRY   RK Y +  I L+Q  F WD+++Q V  +D  W+ YI+ 
Sbjct  60    HGRAVLKNRYNVFRKHYSSVNIPLDQKGFTWDETQQKVVADDPVWNKYIQA  110



>gb|KHG22508.1| hypothetical protein F383_28776 [Gossypium arboreum]
Length=441

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 187/383 (49%), Gaps = 64/383 (17%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------------HTVADGRYSLS---CFD---I  1216
             +P++ PYR K +PYY++L II+G                H+  D   S +   C +   +
Sbjct  50    NPDVRPYRVKTIPYYDDLGIIYGDNSARKTGFNLPKTLSHSGDDITGSAAQPECGNKGTV  109

Query  1215  DFENEVKILEDKIPTKDDAK------------------KIDWSETMEQHFIQLMLEQVQE  1090
             +  +E+ + +D I    + +                  ++ W   M++ FI LMLEQ+Q 
Sbjct  110   EAVHEIGVGDDCISLPQEVEDTTEVTPNATTNPLFSHSRMYWKPPMDRFFIDLMLEQLQN  169

Query  1089  GNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHE  910
             GN+++  F  +AW  MI +FN  FGF Y   +LK R+  LRRQY  +K LL  DGF W +
Sbjct  170   GNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYKTLRRQYNVIKNLLQLDGFTWDD  229

Query  909   RHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETP------TFQYGYP--  754
               QM++A+D VW+  IK  +  R++  + + +YKD+ +IC +  P      + Q   P  
Sbjct  230   DRQMVIADDSVWQDYIKGHKDARQFMTRPVPYYKDLCLICNSPYPDGSDCFSLQCTDPEN  289

Query  753   ---FVKAGEFC----VPIIQTTGKE--GNLreveeivedddereEKKCRYDTKEPKEPCK  601
                 VK G+       P+   +G++  G++ E      + +     KC+   ++P+    
Sbjct  290   RVQEVKLGQATKCSPSPVTSVSGEDEIGDVLEPAHRDSNTNGSNL-KCK---RQPENRLN  345

Query  600   GPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddd  421
                      E +  M  A++EM + V++L +++     NS+ IE+VI  +QA+P+MD+D 
Sbjct  346   SAHTKKSRGE-DDDMASALREMASVVSSLAEKKDDGNTNSIPIENVITAVQALPDMDEDL  404

Query  420   dllldacdfledDNKAKVFLALD  352
              L        E   KAK F+ALD
Sbjct  405   ILDACDLLEDEI--KAKTFMALD  425


 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R  W   MD +FI+L+L+Q+Q GN+    F KQAW EMIA F+ K+   +D D+LKNRYK
Sbjct  148   RMYWKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYK  207

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+QY+  K +L+ + F WDD RQMV  +D  W DYIK
Sbjct  208   TLRRQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDYIK  246


 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  996  VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
            VLK R+ +LR  Y AVK LL+Q GF W    QM++AE+++W + IK     R YR K++ 
Sbjct  3    VLKNRYKVLRNLYKAVKNLLNQKGFNWDSTRQMVIAENKIWDEYIKVNPDVRPYRVKTIP  62

Query  816  FYKDMSIICGNET  778
            +Y D+ II G+ +
Sbjct  63   YYDDLGIIYGDNS  75


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 39/65 (60%), Gaps = 3/65 (5%)
 Frame = -1

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLK  1376
             DVLKNRYK LR  Y   K +L Q  F WD +RQMV   ++ WD+YIKV    + +   +K
Sbjct  2     DVLKNRYKVLRNLYKAVKNLLNQKGFNWDSTRQMVIAENKIWDEYIKVNPDVRPY--RVK  59

Query  1375  IIAHY  1361
              I +Y
Sbjct  60    TIPYY  64



>ref|XP_008387127.1| PREDICTED: uncharacterized protein LOC103449580 isoform X3 [Malus 
domestica]
Length=173

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D KKI WS+T +Q F++LML++V++GNK+ RTFK K+WI MIT FN  FGFQ+G+ VLK 
Sbjct  8     DPKKIXWSQTXDQFFVELMLDEVRKGNKVGRTFKKKSWITMITCFNEKFGFQHGRAVLKX  67

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+N+ R+ Y +V   L Q GF W E  Q +VA+D VW K I+A       RNK +S+Y D
Sbjct  68    RYNVFRKHYSSVNIPLDQKGFTWDETQQKVVADDPVWNKYIQAHPSLHMDRNKVMSYYSD  127

Query  804   MSIICGNET  778
             + II GN+ 
Sbjct  128   LCIIRGNDA  136


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+   D +F+EL+LD+++KGN+   +F K++W+ MI  F+ K+  +H   VLK RY   R
Sbjct  14    WSQTXDQFFVELMLDEVRKGNKVGRTFKKKSWITMITCFNEKFGFQHGRAVLKXRYNVFR  73

Query  1519  KQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             K Y +  I L+Q  F WD+++Q V  +D  W+ YI+ 
Sbjct  74    KHYSSVNIPLDQKGFTWDETQQKVVADDPVWNKYIQA  110



>gb|KHG08380.1| hypothetical protein F383_35832 [Gossypium arboreum]
Length=367

 Score =   148 bits (374),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 151/282 (54%), Gaps = 24/282 (9%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M++ FI LMLEQ+Q GN+++  F  +AW  MI +FN  FGF Y   +LK R+  LR
Sbjct  75    WQPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYKTLR  134

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             RQY  +K LL  DGF W +  Q+++A+D VW+  IK  +  R++  + + +YKD+ +IC 
Sbjct  135   RQYNVIKNLLQLDGFTWDDDRQLVIADDSVWQDYIKGHKDARQFMTRPVPYYKDLCLICN  194

Query  786   NETP------TFQYGYP-----FVKAGEFC----VPIIQTTGKE--GNLreveeiveddd  658
             +  P      + Q   P      VK G+       P+   +G++  G++ E      + +
Sbjct  195   SPYPDGSDCFSLQCTDPENRVQEVKLGQATKCSPSPVTSVSGEDEIGDVLEPAHRDSNTN  254

Query  657   ereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSL  478
                  KC+   ++P+             E + GM  A++EM +AV++LT+++     NS+
Sbjct  255   GSNL-KCK---RQPENRLNSAHTKKSRGE-DDGMASALREMASAVSSLTEKKDDGNTNSI  309

Query  477   LIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              IE+VI  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  310   PIENVITAVQALPDMDEDLILDACDLLEDEI--KAKTFMALD  349


 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 67/99 (68%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R  W   MD +FI+L+L+Q+Q GN+    F KQAW EMIA F+ K+   +D D+LKNRYK
Sbjct  72    RMYWQPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYK  131

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+QY+  K +L+ + F WDD RQ+V  +D  W DYIK
Sbjct  132   TLRRQYNVIKNLLQLDGFTWDDDRQLVIADDSVWQDYIK  170



>ref|XP_008387125.1| PREDICTED: uncharacterized protein LOC103449580 isoform X1 [Malus 
domestica]
 ref|XP_008387126.1| PREDICTED: uncharacterized protein LOC103449580 isoform X2 [Malus 
domestica]
Length=185

 Score =   143 bits (360),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 89/129 (69%), Gaps = 0/129 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D KKI WS+T +Q F++LML++V++GNK+ RTFK K+WI MIT FN  FGFQ+G+ VLK 
Sbjct  8     DPKKIXWSQTXDQFFVELMLDEVRKGNKVGRTFKKKSWITMITCFNEKFGFQHGRAVLKX  67

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
             R+N+ R+ Y +V   L Q GF W E  Q +VA+D VW K I+A       RNK +S+Y D
Sbjct  68    RYNVFRKHYSSVNIPLDQKGFTWDETQQKVVADDPVWNKYIQAHPSLHMDRNKVMSYYSD  127

Query  804   MSIICGNET  778
             + II GN+ 
Sbjct  128   LCIIRGNDA  136


 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W+   D +F+EL+LD+++KGN+   +F K++W+ MI  F+ K+  +H   VLK RY   R
Sbjct  14    WSQTXDQFFVELMLDEVRKGNKVGRTFKKKSWITMITCFNEKFGFQHGRAVLKXRYNVFR  73

Query  1519  KQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             K Y +  I L+Q  F WD+++Q V  +D  W+ YI+ 
Sbjct  74    KHYSSVNIPLDQKGFTWDETQQKVVADDPVWNKYIQA  110



>ref|XP_007201020.1| hypothetical protein PRUPE_ppa005589mg [Prunus persica]
 gb|EMJ02219.1| hypothetical protein PRUPE_ppa005589mg [Prunus persica]
Length=452

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 114/348 (33%), Positives = 188/348 (54%), Gaps = 46/348 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIP--TKDDAK  1156
             HP+   +R K +PYY++L  I+G T  + R     FD D E+ +      +P  T +   
Sbjct  114   HPDARSFRIKTIPYYHDLCSIYGDTAIEER--TKSFD-DVEHAMT----SVPGITTNSRS  166

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             +  W   M+++FI+LM EQV++G++++  F+ +AW+ MI +FN  FGF Y   VLK R  
Sbjct  167   RTYWQPPMDRYFIELMQEQVRKGSRIDGVFRKQAWMEMIASFNAKFGFNYDMDVLKNRHK  226

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
              L+RQY  +K LL  DGF+W +  QM+ A+D VW+  IK     R++  + + +YK + +
Sbjct  227   TLKRQYNVIKNLLELDGFIWDDARQMVTADDYVWQDYIKEHTDARQFMTRPVPYYKHLCM  286

Query  795   ICGNETPTFQYGYPF----------VKAGEFCVPI---------IQTTGKEGNLreveei  673
             IC    P+      +          V+  + C  +         + T  ++G++      
Sbjct  287   ICD---PSVDDRDSYSGQDVEQENQVEGAKLCGALTSFLSPSTSVSTEDEDGDV------  337

Query  672   vedddereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkk  493
              E     ++K+ R       E C   +      E + GM  A++EM +AV++L+++++  
Sbjct  338   QESTPMCQKKRRRL------EDCSNEAYPKRSREEDGGMASALREMASAVSSLSEKKRND  391

Query  492   kK-NSLLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             +K NS  IE V+  +QA+P+M  D+DL+LDACD LED+ KAK F+ALD
Sbjct  392   EKLNSGSIESVVEAVQALPDM--DEDLVLDACDLLEDEKKAKTFMALD  437


 Score =   112 bits (280),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFIEL+ +Q++KG+R    F KQAW+EMIA F+ K+   +D DVLKNR+K
Sbjct  167   RTYWQPPMDRYFIELMQEQVRKGSRIDGVFRKQAWMEMIASFNAKFGFNYDMDVLKNRHK  226

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L++QY+  K +LE + FIWDD+RQMVT +D  W DYIK
Sbjct  227   TLKRQYNVIKNLLELDGFIWDDARQMVTADDYVWQDYIK  265


 Score =   105 bits (262),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 1/131 (1%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKV  997
             T  D  +  W+  M+++FI LMLEQV +GNK +   F  +AW HM + F+  F F Y K 
Sbjct  7     TDGDRLRTVWTPEMDRYFIDLMLEQVCKGNKFDDHLFSKRAWKHMTSLFDAKFKFPYEKD  66

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R   LR  Y AV+ LL + GF W E  QM+ A++ VW + IK     R +R K++ 
Sbjct  67    VLKNRHKTLRNLYKAVRNLLDERGFSWDEMRQMVTADNNVWDEYIKVHPDARSFRIKTIP  126

Query  816   FYKDMSIICGN  784
             +Y D+  I G+
Sbjct  127   YYHDLCSIYGD  137


 Score =   100 bits (249),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             +  + LR+ WT  MD YFI+L+L+Q+ KGN+     FSK+AW  M +LF  K+K  ++ D
Sbjct  7     TDGDRLRTVWTPEMDRYFIDLMLEQVCKGNKFDDHLFSKRAWKHMTSLFDAKFKFPYEKD  66

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   + +L++  F WD+ RQMVT ++  WD+YIKV    + F   +K 
Sbjct  67    VLKNRHKTLRNLYKAVRNLLDERGFSWDEMRQMVTADNNVWDEYIKVHPDARSF--RIKT  124

Query  1372  IAHY  1361
             I +Y
Sbjct  125   IPYY  128



>ref|XP_006480027.1| PREDICTED: uncharacterized protein LOC102620565 isoform X4 [Citrus 
sinensis]
 gb|KDO87093.1| hypothetical protein CISIN_1g009421mg [Citrus sinensis]
Length=509

 Score =   149 bits (375),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 112/383 (29%), Positives = 176/383 (46%), Gaps = 60/383 (16%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTV--------------------ADGRYSLSCFDIDF  1210
             HPE   YR K VPYYN+L +I+G+                      AD  +  S  + + 
Sbjct  114   HPEARSYRIKTVPYYNDLCLIYGNKASEQKGGKLLESLQLQEKEKDADTTHPRSASEGEA  173

Query  1209  EN--EVKILEDKIPTKDDAKKID--------------------WSETMEQHFIQLMLEQV  1096
             E+  E+++ ED   +       D                    W   M+++FI LMLEQV
Sbjct  174   EDRDEIRVDEDNSVSMSKGDVDDTLQVISNGAESIVANRSRTYWQPPMDRYFIDLMLEQV  233

Query  1095  QEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMW  916
             Q+GN+++  F+ +AWI MI +FN  FGF+Y   +LK R+  LRRQY  +K LL  +GF+W
Sbjct  234   QKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYKTLRRQYNVIKNLLDLNGFVW  293

Query  915   HERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG----NETPTFQYG----  760
              E  QM+ A+D VW+  +K     R++  + + ++KD+ +ICG    +E   F       
Sbjct  294   DEARQMVTADDYVWQDYVKTHTDARQFMTRPVPYFKDLCVICGHPSIDENDCFSIQDLEM  353

Query  759   ------YPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKG  598
                     F  A +     + +   E  L ++ E       +    C  + ++  E C  
Sbjct  354   HNEVQEIKFQGASKSSQHPVASESGEDELGDLLEAAARMGSKPVFSCTKNKRQ-FENCSD  412

Query  597   PSEINEETEIEIGMEDAMQEMVAAVTALTk-eekkkkKNSLLIEDVIYILQAMPEMdddd  421
                + +    + GM   + E V AV++ +  +      NS+ IE VI  +QA+P+MD+D 
Sbjct  413   SEFLKKSRSKDEGMPGTICEAVNAVSSFSDGKSGDLNSNSVAIECVIAAVQALPDMDEDL  472

Query  420   dllldacdfledDNKAKVFLALD  352
              L        E   KAK F+ALD
Sbjct  473   ILDACDFLEDEM--KAKTFMALD  493


 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+L+Q+QKGNR    F K+AW+EMI  F+ K+  K+D ++LKNRYK
Sbjct  214   RTYWQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYK  273

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ N F+WD++RQMVT +D  W DY+K     ++F
Sbjct  274   TLRRQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQF  320


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 81/136 (60%), Gaps = 1/136 (1%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT-FKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  +  W+  M+++FI LMLEQ+ +GN+ +   F  +AW  M + F+  F FQY K VLK
Sbjct  10    DRNRTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLK  69

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LR  Y AVK LL Q GF W E  QM+ A++ +W++ IK     R YR K++ +Y 
Sbjct  70    NRYKTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIKEHPEARSYRIKTVPYYN  129

Query  807   DMSIICGNETPTFQYG  760
             D+ +I GN+    + G
Sbjct  130   DLCLIYGNKASEQKGG  145


 Score =   100 bits (250),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             R+ WT  MD YFI+L+L+Q+ KGNR     FSK+AW +M ++FS K+K ++  DVLKNRY
Sbjct  13    RTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLKNRY  72

Query  1531  KHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             K LR  Y   K +L+Q  F WD+ RQMVT ++  W++YIK     +  S  +K + +Y
Sbjct  73    KTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIKEH--PEARSYRIKTVPYY  128



>emb|CBI36907.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/340 (30%), Positives = 169/340 (50%), Gaps = 56/340 (16%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK-  1156
              HP+   YR K +PYYN+L  I+ +   + + +    D + +N +     K+  +   + 
Sbjct  94    GHPDARSYRIKTIPYYNDLCFIYRNATPEQKGNHFGHDGNLDNSIS--GSKMTNEPGHRT  151

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             +  W   M+++FI LML+QVQ+GN+++  F+ +AW+ MI +FN  FGF+Y   VLK RF 
Sbjct  152   RTYWQPPMDRYFIDLMLDQVQKGNQVDGVFRKQAWMEMIASFNAKFGFKYDMDVLKNRFK  211

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
              LRRQY  ++ LL  +GF+W +  QM+ A+D VW+  IK     R+Y  + + +Y+D+ +
Sbjct  212   TLRRQYNVIRSLLDLNGFIWDDTRQMVTADDCVWQDYIKTHTNARQYMTRPVPYYQDLCV  271

Query  795   ICGNETPTFQYGYPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKE-  619
             IC                       +   G++ +L                   YD  + 
Sbjct  272   ICRE---------------------LSIDGRDTDLG------------------YDEPDD  292

Query  618   -PKEPCKGPSEINEETEIEIGMEDAM---------QEMVAAVTALTkeekkkkKN-SLLI  472
              P+   +G  +I+E        E+ +          EMV AV++++++ K  + + S+ I
Sbjct  293   IPEVKFQGVLKISESPAASFSSEEQLGELKESSHSGEMVTAVSSISEKNKDDENSGSISI  352

Query  471   EDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             E VI  +QA+P+MD++  L        E   KAK FLALD
Sbjct  353   ESVIEAVQALPDMDEELVLDACDFLEDEK--KAKTFLALD  390


 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+LDQ+QKGN+    F KQAW+EMIA F+ K+  K+D DVLKNR+K
Sbjct  152   RTYWQPPMDRYFIDLMLDQVQKGNQVDGVFRKQAWMEMIASFNAKFGFKYDMDVLKNRFK  211

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+QY+  + +L+ N FIWDD+RQMVT +D  W DYIK 
Sbjct  212   TLRRQYNVIRSLLDLNGFIWDDTRQMVTADDCVWQDYIKT  251


 Score =   111 bits (278),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 77/135 (57%), Gaps = 2/135 (1%)
 Frame = -2

Query  1134  MEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQY  958
             M+++FI LMLEQV +GN+++   F  +AW  M   FN  F FQY K VLK R   LR  Y
Sbjct  1     MDRYFIDLMLEQVNKGNRIDDHLFSKRAWKQMTALFNAKFNFQYEKDVLKNRHKTLRNLY  60

Query  957   FAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
              A+K LL Q GF W E+ QM+ A++ VW + IK     R YR K++ +Y D+  I  N T
Sbjct  61    KAIKNLLCQRGFSWDEQRQMVTADNNVWDEYIKGHPDARSYRIKTIPYYNDLCFIYRNAT  120

Query  777   PTFQYGYPFVKAGEF  733
             P  Q G  F   G  
Sbjct  121   PE-QKGNHFGHDGNL  134


 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 75/123 (61%), Gaps = 4/123 (3%)
 Frame = -1

Query  1687  MDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQY  1511
             MD YFI+L+L+Q+ KGNR     FSK+AW +M ALF+ K+  +++ DVLKNR+K LR  Y
Sbjct  1     MDRYFIDLMLEQVNKGNRIDDHLFSKRAWKQMTALFNAKFNFQYEKDVLKNRHKTLRNLY  60

Query  1510  HNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILVSFVVCV  1334
                K +L Q  F WD+ RQMVT ++  WD+YIK        S  +K I +Y  + F+   
Sbjct  61    KAIKNLLCQRGFSWDEQRQMVTADNNVWDEYIKGH--PDARSYRIKTIPYYNDLCFIYRN  118

Query  1333  GPP  1325
               P
Sbjct  119   ATP  121



>ref|XP_010103403.1| hypothetical protein L484_007472 [Morus notabilis]
 gb|EXB95722.1| hypothetical protein L484_007472 [Morus notabilis]
Length=467

 Score =   147 bits (372),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/359 (28%), Positives = 181/359 (50%), Gaps = 54/359 (15%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIF----------------GHTVADGR------------YS  1234
             HP+   +R K +P+YN+L +I+                   V DG             Y 
Sbjct  114   HPDARSFRIKTIPHYNDLCLIYKDAPPEPKGTSEVTQPSDVVGDGETLPLHDIMIDEDYG  173

Query  1233  LSC----FDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTF  1066
             +S      ++DF +   +      T  +  +  W   M+++FI +M++QVQ+G++++  F
Sbjct  174   ISISEKDANVDFASHAALQNASGTTLGNRSRTYWQPPMDRYFIDVMMDQVQKGSRIDGVF  233

Query  1065  KNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAE  886
             + +AW+ MI AFN  FGF Y   VLK R+  LRRQY  +K LL  DGF+W +  QM+ A+
Sbjct  234   RKQAWMEMIAAFNAKFGFSYDMDVLKNRYKTLRRQYNVIKNLLDLDGFVWDDTRQMVTAD  293

Query  885   DRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTG  706
             D VW+  IKA    R++  + + +YK++ +IC   +   +           C     ++G
Sbjct  294   DYVWQDYIKAHTDARQFMTRPVPYYKELCVICDPSSDERE-----------C-----SSG  337

Query  705   KEGNLreveeivedddereEKKCRYDTKEPKEP-CKGPSEINEETEIEIGMEDAMQEMVA  529
             ++ + +  E+             + + ++ +   C   S+ + +   + GM  A++EM +
Sbjct  338   QDLDQQNDEDDARSPATSVSNGSKKNKRQLENLYCLSNSKRSRDN--DDGMASALREMAS  395

Query  528   AVTALTkeekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             AV++L+ +++K  +NS+ IE+V+  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  396   AVSSLS-DKRKNDENSIPIENVMKAVQALPDMDEDLVLDACDLLEDEK--KAKTFMALD  451


 Score =   117 bits (292),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI++++DQ+QKG+R    F KQAW+EMIA F+ K+   +D DVLKNRYK
Sbjct  204   RTYWQPPMDRYFIDVMMDQVQKGSRIDGVFRKQAWMEMIAAFNAKFGFSYDMDVLKNRYK  263

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ + F+WDD+RQMVT +D  W DYIK     ++F
Sbjct  264   TLRRQYNVIKNLLDLDGFVWDDTRQMVTADDYVWQDYIKAHTDARQF  310


 Score = 29.3 bits (64),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 16/44 (36%), Positives = 25/44 (57%), Gaps = 1/44 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE  1201
             AH +   + T+ VPYY EL +I   + +D R   S  D+D +N+
Sbjct  303   AHTDARQFMTRPVPYYKELCVICDPS-SDERECSSGQDLDQQND  345


 Score =   116 bits (291),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 4/138 (3%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHD  1556
             S S S+ LR+ WT  MD YF++L+L+Q+ KGN+     FSK+AW  M +LF+ K+K +++
Sbjct  5     SRSGSDRLRTVWTPEMDRYFVDLMLEQVNKGNKFDDHLFSKRAWKHMTSLFNSKFKFQYE  64

Query  1555  TDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
              DVLKNR+K LR  Y   K +L+Q  F WDD+RQMVT +++ WD+YIKV    + F   +
Sbjct  65    KDVLKNRHKTLRNLYKAVKNLLDQTGFSWDDTRQMVTADNDVWDEYIKVHPDARSF--RI  122

Query  1378  KIIAHYILVSFVVCVGPP  1325
             K I HY  +  +    PP
Sbjct  123   KTIPHYNDLCLIYKDAPP  140


 Score =   112 bits (280),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 75/125 (60%), Gaps = 1/125 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++F+ LMLEQV +GNK +   F  +AW HM + FN+ F FQY K VLK R   L
Sbjct  16    WTPEMDRYFVDLMLEQVNKGNKFDDHLFSKRAWKHMTSLFNSKFKFQYEKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y AVK LL Q GF W +  QM+ A++ VW + IK     R +R K++  Y D+ +I 
Sbjct  76    RNLYKAVKNLLDQTGFSWDDTRQMVTADNDVWDEYIKVHPDARSFRIKTIPHYNDLCLIY  135

Query  789   GNETP  775
              +  P
Sbjct  136   KDAPP  140



>gb|KHG22507.1| hypothetical protein F383_28775 [Gossypium arboreum]
Length=294

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 147/280 (53%), Gaps = 21/280 (8%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M++ FI LMLEQ+Q GN+++  F  +AW  MI +FN  FGF Y   +LK R+  LR
Sbjct  3     WKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYKTLR  62

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC-  790
             RQY  +K LL  DGF W +  QM++A+D VW+  IK  +  R++  + + +YK + +IC 
Sbjct  63    RQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDYIKGHKDARQFMTRPMPYYKYLCLICY  122

Query  789   --GNETPTF-------QYGYPFVKAGEFC----VPIIQTTGK-EGNLreveeiveddder  652
                +E+  F       + G   VK G+       P+   + + E         ++ +   
Sbjct  123   SYPDESDCFSLQCTEPENGVQEVKPGQATKCSQSPVTSVSSEDEIGAVLEPAHLDSNTTG  182

Query  651   eEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLI  472
                KC+   ++P+             E + GM  A++EM +AV++LT+++     NS+ I
Sbjct  183   SNPKCK---RQPENRLNSAHTKKSRGE-DDGMASALREMASAVSSLTEKKDDGNTNSIPI  238

Query  471   EDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             E+VI  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  239   ENVITAVQALPDMDEDLILDACDLLEDEI--KAKTFMALD  276


 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W   MD +FI+L+L+Q+Q GN+    F KQAW EMIA F+ K+   +D D+LKNRYK LR
Sbjct  3     WKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYKTLR  62

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +QY+  K +L+ + F WDD RQMV  +D  W DYIK
Sbjct  63    RQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDYIK  98



>gb|KHG01346.1| hypothetical protein F383_21691 [Gossypium arboreum]
Length=293

 Score =   143 bits (360),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 93/282 (33%), Positives = 148/282 (52%), Gaps = 24/282 (9%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M++ FI LMLEQ+Q GN+++  F  +AW  MI +FN  FGF Y   +LK R+  LR
Sbjct  3     WKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYKTLR  62

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             RQY  +K LL  DGF W +  QM++A+D VW+  IK  +  R++  + + +YKD+ +IC 
Sbjct  63    RQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDYIKGHKDARQFMTRPVPYYKDLCLICN  122

Query  786   NETP------TFQYGYP-----FVKAGEFC----VPIIQTTGKE--GNLreveeiveddd  658
             +  P      + Q   P      VK G+       P+   +G++  G++ E      + +
Sbjct  123   SPYPDGSDCFSLQCTDPENRVQEVKLGQATKCSPSPVTSVSGEDEIGDVLEPAHRDSNTN  182

Query  657   ereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSL  478
                  KC+   ++P+             E +  M  A++EM + V++L +++     NS+
Sbjct  183   GSNL-KCK---RQPENRLNSAHTKKSRGE-DDDMASALREMASVVSSLAEKKDDGNTNSI  237

Query  477   LIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
              IE+VI  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  238   PIENVITAVQALPDMDEDLILDACDLLEDEI--KAKTFMALD  277


 Score =   107 bits (268),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W   MD +FI+L+L+Q+Q GN+    F KQAW EMIA F+ K+   +D D+LKNRYK LR
Sbjct  3     WKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYKTLR  62

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             +QY+  K +L+ + F WDD RQMV  +D  W DYIK
Sbjct  63    RQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDYIK  98



>ref|XP_006444433.1| hypothetical protein CICLE_v10019662mg [Citrus clementina]
 ref|XP_006480026.1| PREDICTED: uncharacterized protein LOC102620565 isoform X3 [Citrus 
sinensis]
 gb|ESR57673.1| hypothetical protein CICLE_v10019662mg [Citrus clementina]
 gb|KDO87094.1| hypothetical protein CISIN_1g009421mg [Citrus sinensis]
Length=513

 Score =   147 bits (371),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 112/387 (29%), Positives = 176/387 (45%), Gaps = 64/387 (17%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTV------------------------ADGRYSLSCF  1222
             HPE   YR K VPYYN+L +I+G+                          AD  +  S  
Sbjct  114   HPEARSYRIKTVPYYNDLCLIYGNKASEQKDEQVGGKLLESLQLQEKEKDADTTHPRSAS  173

Query  1221  DIDFEN--EVKILEDKIPTKDDAKKID--------------------WSETMEQHFIQLM  1108
             + + E+  E+++ ED   +       D                    W   M+++FI LM
Sbjct  174   EGEAEDRDEIRVDEDNSVSMSKGDVDDTLQVISNGAESIVANRSRTYWQPPMDRYFIDLM  233

Query  1107  LEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQD  928
             LEQVQ+GN+++  F+ +AWI MI +FN  FGF+Y   +LK R+  LRRQY  +K LL  +
Sbjct  234   LEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYKTLRRQYNVIKNLLDLN  293

Query  927   GFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG----NETPTFQYG  760
             GF+W E  QM+ A+D VW+  +K     R++  + + ++KD+ +ICG    +E   F   
Sbjct  294   GFVWDEARQMVTADDYVWQDYVKTHTDARQFMTRPVPYFKDLCVICGHPSIDENDCFSIQ  353

Query  759   ----------YPFVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKE  610
                         F  A +     + +   E  L ++ E       +    C  + ++  E
Sbjct  354   DLEMHNEVQEIKFQGASKSSQHPVASESGEDELGDLLEAAARMGSKPVFSCTKNKRQ-FE  412

Query  609   PCKGPSEINEETEIEIGMEDAMQEMVAAVTALTk-eekkkkKNSLLIEDVIYILQAMPEM  433
              C     + +    + GM   + E V AV++ +  +      NS+ IE VI  +QA+P+M
Sbjct  413   NCSDSEFLKKSRSKDEGMPGTICEAVNAVSSFSDGKSGDLNSNSVAIECVIAAVQALPDM  472

Query  432   dddddllldacdfledDNKAKVFLALD  352
             D+D  L        E   KAK F+ALD
Sbjct  473   DEDLILDACDFLEDEM--KAKTFMALD  497


 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+L+Q+QKGNR    F K+AW+EMI  F+ K+  K+D ++LKNRYK
Sbjct  218   RTYWQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYK  277

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ N F+WD++RQMVT +D  W DY+K     ++F
Sbjct  278   TLRRQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQF  324


 Score =   114 bits (284),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT-FKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  +  W+  M+++FI LMLEQ+ +GN+ +   F  +AW  M + F+  F FQY K VLK
Sbjct  10    DRNRTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLK  69

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LR  Y AVK LL Q GF W E  QM+ A++ +W++ IK     R YR K++ +Y 
Sbjct  70    NRYKTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIKEHPEARSYRIKTVPYYN  129

Query  807   DMSIICGNET  778
             D+ +I GN+ 
Sbjct  130   DLCLIYGNKA  139


 Score =   100 bits (250),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/118 (46%), Positives = 77/118 (65%), Gaps = 4/118 (3%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             R+ WT  MD YFI+L+L+Q+ KGNR     FSK+AW +M ++FS K+K ++  DVLKNRY
Sbjct  13    RTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLKNRY  72

Query  1531  KHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             K LR  Y   K +L+Q  F WD+ RQMVT ++  W++YIK     +  S  +K + +Y
Sbjct  73    KTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIKEH--PEARSYRIKTVPYY  128



>ref|XP_002523138.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39323.1| conserved hypothetical protein [Ricinus communis]
Length=466

 Score =   146 bits (369),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 104/352 (30%), Positives = 173/352 (49%), Gaps = 41/352 (12%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKI---------  1177
             HP+   YR K +P+Y +L +I+G    + + +        ++E K L   +         
Sbjct  114   HPDARAYRIKTIPHYKDLCLIYGDAKIEEKVN--------DSESKELMHDVHQATTNVSG  165

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              T  +  +  W   M+++FI LMLE +++GN+++  F+ +AW+ MIT+FN  FGF Y   
Sbjct  166   STASNRTRTYWQPPMDRYFIDLMLEHMRKGNQIDGVFRKQAWMDMITSFNAKFGFNYDVD  225

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R+  LRRQ+  +K LL   GF W +  QM+ A+D VW+  IK +   R++  + + 
Sbjct  226   VLKNRYKTLRRQHNVIKNLLELPGFSWDDTRQMVTADDYVWQDYIKTRTDARQFMTRPVP  285

Query  816   FYKDMSIICGNET-----------PTFQYGYPFVKAGE----FCVPIIQTTGKE--GNLr  688
             +YKD+ +IC ++               Q  +  VKA      F  P +  + +E  G++ 
Sbjct  286   YYKDLCMICNDQNFDESDCCSAQYLELQNDFQDVKAPRPSQCFHSPALSVSTEEEIGDML  345

Query  687   eveeivedddereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTk  508
             E  +         E K     K   E         +    E GM +A++EM  AV++L+ 
Sbjct  346   ESVDTGSKTSVLNENK-----KRQSENQSNSGHFKKARGKEEGMANALREMATAVSSLSD  400

Query  507   eekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             + K +  NS+ IE+V+  +Q + +MD+D  L        E   KAK F+AL+
Sbjct  401   KRKDENTNSISIENVVKAVQDLSDMDEDLILDACDFLEDEM--KAKTFMALE  450


 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 75/122 (61%), Gaps = 1/122 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI L+LEQV +GNK +   F  +AW +M   FNT F F+Y K VLK R   L
Sbjct  16    WTPEMDRYFIGLLLEQVSKGNKFDDHLFSKRAWKNMTLLFNTKFKFRYEKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y AVK LL Q+GF W    QM+ A++ VW + IK     R YR K++  YKD+ +I 
Sbjct  76    RNLYTAVKKLLDQNGFSWDNNRQMVTADNDVWDEYIKMHPDARAYRIKTIPHYKDLCLIY  135

Query  789   GN  784
             G+
Sbjct  136   GD  137


 Score =   107 bits (267),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = -1

Query  1732  SCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDT  1553
               ++S   R+ W   MD YFI+L+L+ ++KGN+    F KQAW++MI  F+ K+   +D 
Sbjct  165   GSTASNRTRTYWQPPMDRYFIDLMLEHMRKGNQIDGVFRKQAWMDMITSFNAKFGFNYDV  224

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             DVLKNRYK LR+Q++  K +LE   F WDD+RQMVT +D  W DYIK +   ++F
Sbjct  225   DVLKNRYKTLRRQHNVIKNLLELPGFSWDDTRQMVTADDYVWQDYIKTRTDARQF  279


 Score =   106 bits (264),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 82/124 (66%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             + ++ LR+ WT  MD YFI LLL+Q+ KGN+     FSK+AW  M  LF+ K+K +++ D
Sbjct  7     NGNDRLRTVWTPEMDRYFIGLLLEQVSKGNKFDDHLFSKRAWKNMTLLFNTKFKFRYEKD  66

Query  1549  VLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y    K+L+QN F WD++RQMVT +++ WD+YIK  M     +  +K 
Sbjct  67    VLKNRHKTLRNLYTAVKKLLDQNGFSWDNNRQMVTADNDVWDEYIK--MHPDARAYRIKT  124

Query  1372  IAHY  1361
             I HY
Sbjct  125   IPHY  128



>gb|KHG01347.1| hypothetical protein F383_21692 [Gossypium arboreum]
Length=261

 Score =   123 bits (308),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 99/182 (54%), Gaps = 24/182 (13%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLS---CFD---IDFENEVKILEDKIPT  1171
              +P++ PYR K +PYY++L II+G   A    S +   C +   ++  +E+ + +D I  
Sbjct  49    VNPDVRPYRVKTIPYYDDLGIIYGDNSARKTGSAAQPECGNKGTVEAVHEIGVGDDCISL  108

Query  1170  KDDAK------------------KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIH  1045
               + +                  ++ W   M++ FI LMLEQ+Q GN+++  F  +AW  
Sbjct  109   PQEVEDTTEVTPNATTNPLFSHSRMYWKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTE  168

Query  1044  MITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKV  865
             MI +FN  FGF Y   +LK R+  LRRQY  +K LL  DGF W +  QM++A+D VW+  
Sbjct  169   MIASFNAKFGFNYDVDILKNRYKTLRRQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDY  228

Query  864   IK  859
             IK
Sbjct  229   IK  230


 Score = 52.8 bits (125),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 1/48 (2%)
 Frame = -1

Query  1552  DVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             DVLKNRYK LR  Y   K +L Q  F WD +RQMV   ++ WD+YIKV
Sbjct  2     DVLKNRYKVLRNLYKAVKNLLNQKGFNWDSTRQMVIAENKIWDEYIKV  49


 Score =   108 bits (270),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 1/102 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R  W   MD +FI+L+L+Q+Q GN+    F KQAW EMIA F+ K+   +D D+LKNRYK
Sbjct  132   RMYWKPPMDRFFIDLMLEQLQNGNQIDGVFCKQAWTEMIASFNAKFGFNYDVDILKNRYK  191

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQM  1406
              LR+QY+  K +L+ + F WDD RQMV  +D  W DYIK+ +
Sbjct  192   TLRRQYNVIKNLLQLDGFTWDDDRQMVIADDSVWQDYIKIDV  233


 Score = 70.5 bits (171),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  996  VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
            VLK R+ +LR  Y AVK LL+Q GF W    QM++AE+++W + IK     R YR K++ 
Sbjct  3    VLKNRYKVLRNLYKAVKNLLNQKGFNWDSTRQMVIAENKIWDEYIKVNPDVRPYRVKTIP  62

Query  816  FYKDMSIICGNET  778
            +Y D+ II G+ +
Sbjct  63   YYDDLGIIYGDNS  75



>ref|XP_007224304.1| hypothetical protein PRUPE_ppa020132mg [Prunus persica]
 gb|EMJ25503.1| hypothetical protein PRUPE_ppa020132mg [Prunus persica]
Length=601

 Score =   101 bits (252),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/193 (32%), Positives = 89/193 (46%), Gaps = 23/193 (12%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE +  R +    Y +L IIF         S S  +ID               +D  +
Sbjct  111   AHPEADTVRKRGCDIYEQLCIIFS--------SDSGTNID---------------EDPPR  147

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W+  +E+ F+ LML+QV + N+ N  F NKAW ++   FN      Y K  LK    +
Sbjct  148   AKWTMPLEKIFVDLMLQQVFQENRSNNAFSNKAWKYIYHEFNRQTKLNYDKQQLKNHHGV  207

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRR Y +VK LL+QDGF W +   M++AE+ VW K I+        R K    Y+ +  I
Sbjct  208   LRRWYHSVKSLLNQDGFSWDKSRCMVIAENDVWAKCIEKHPEVEAIRVKGCPHYEQLDRI  267

Query  792   CGNETPTFQYGYP  754
                   +  Y +P
Sbjct  268   FSESGSSGNYAFP  280


 Score = 73.2 bits (178),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT      F +LL++QI+KGNR+S +FSK AW  +   F+ +   K D   LKN   
Sbjct  12    RAKWTTFCTKIFADLLVEQIRKGNRSSGAFSKLAWKIIRDEFNRQTGLKFDKQQLKNHLD  71

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LRK+Y++ K IL+   F WD S+ M+   D+ W  YI+ 
Sbjct  72    VLRKRYNSVKAILDHPGFTWDASQSMLLAQDDVWQKYIEA  111


 Score = 81.3 bits (199),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/163 (30%), Positives = 82/163 (50%), Gaps = 15/163 (9%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-DKIPTKD  1165
             C+  HPE+E  R K  P+Y +L  IF  + + G Y+        E++    + D  P++D
Sbjct  243   CIEKHPEVEAIRVKGCPHYEQLDRIFSESGSSGNYAFP------ESQTAASKMDSPPSED  296

Query  1164  ----DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
                 D  +  WS  +++  + L++EQ  +    N+    KAW H+   FN   G Q+   
Sbjct  297   QFKQDQSRAKWSAPLDKILLDLLIEQTGQ----NKMSNKKAWKHIREEFNYKTGLQFDGE  352

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKK  868
              L+   N+L+R Y  +K +L Q GF W     M++A+D +W+K
Sbjct  353   QLRNHQNVLKRLYNNIKSVLDQSGFSWDNSRNMVMADDELWEK  395


 Score = 68.2 bits (165),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 59/99 (60%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  ++  F++L+L Q+ + NR++ +FS +AW  +   F+ + K  +D   LKN + 
Sbjct  147   RAKWTMPLEKIFVDLMLQQVFQENRSNNAFSNKAWKYIYHEFNRQTKLNYDKQQLKNHHG  206

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+ YH+ K +L Q+ F WD SR MV   ++ W   I+
Sbjct  207   VLRRWYHSVKSLLNQDGFSWDKSRCMVIAENDVWAKCIE  245


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 69/131 (53%), Gaps = 0/131 (0%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+    + F  L++EQ+++GN+ +  F   AW  +   FN   G ++ K  LK 
Sbjct  9     DQSRAKWTTFCTKIFADLLVEQIRKGNRSSGAFSKLAWKIIRDEFNRQTGLKFDKQQLKN  68

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               ++LR++Y +VK +L   GF W     M++A+D VW+K I+A       R +    Y+ 
Sbjct  69    HLDVLRKRYNSVKAILDHPGFTWDASQSMLLAQDDVWQKYIEAHPEADTVRKRGCDIYEQ  128

Query  804   MSIICGNETPT  772
             + II  +++ T
Sbjct  129   LCIIFSSDSGT  139



>ref|XP_009348752.1| PREDICTED: uncharacterized protein At2g29880 isoform X2 [Pyrus 
x bretschneideri]
Length=405

 Score =   143 bits (361),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 88/128 (69%), Gaps = 0/128 (0%)
 Frame = -2

Query  1143  SETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRR  964
             ++ M+Q F++LML++V +GNK+  TFK K+WI MIT FN  FGF +G+ VLK R+N+LR+
Sbjct  128   TKIMDQFFVELMLDEVCKGNKVGCTFKKKSWITMITCFNEKFGFHHGRAVLKNRYNVLRK  187

Query  963   QYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGN  784
              Y +V  LL Q GF W E  Q +VA+D VW K I+A   F  YRNK++ +Y D+ +ICGN
Sbjct  188   HYSSVNALLDQKGFTWDETQQKVVADDPVWNKYIEAHPSFHMYRNKAMPYYSDLCVICGN  247

Query  783   ETPTFQYG  760
             E    + G
Sbjct  248   EARLLKNG  255


 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   S ++S+ +R+NWT   D +FI+L+L+Q+ KGN+T   F KQAW +MI LF++++  
Sbjct  1     MYAGSSTTSDHVRANWTPSQDSFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+DTD+LKNRYK LRKQY   K +++Q +F WD+++QM+T +D  W++YIK+ M D  F 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQVDFRWDETQQMITADDNVWNNYIKLLMEDTVFH  120

Query  1387  NHLKIIAHYILVSFVV  1340
               +  +   I+  F V
Sbjct  121   VMMWTLRTKIMDQFFV  136


 Score = 91.7 bits (226),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 65/102 (64%), Gaps = 4/102 (4%)
 Frame = -1

Query  1714  TLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNR  1535
             TLR   T +MD +F+EL+LD++ KGN+   +F K++W+ MI  F+ K+   H   VLKNR
Sbjct  125   TLR---TKIMDQFFVELMLDEVCKGNKVGCTFKKKSWITMITCFNEKFGFHHGRAVLKNR  181

Query  1534  YKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             Y  LRK Y +   +L+Q  F WD+++Q V  +D  W+ YI+ 
Sbjct  182   YNVLRKHYSSVNALLDQKGFTWDETQQKVVADDPVWNKYIEA  223


 Score = 33.1 bits (74),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 12/25 (48%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGH  1258
             AHP    YR K +PYY++L +I G+
Sbjct  223   AHPSFHMYRNKAMPYYSDLCVICGN  247


 Score = 99.8 bits (247),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T  D  + +W+ + +  FI LMLEQV +GNK    F+ +AW  MI  FN  FGF+Y   +
Sbjct  7     TTSDHVRANWTPSQDSFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGFKYDTDI  66

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIK  859
             LK R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IK
Sbjct  67    LKNRYKRLRKQYSEMKSLVDQVDFRWDETQQMITADDNVWNNYIK  111



>ref|XP_008345684.1| PREDICTED: uncharacterized protein LOC103408624 [Malus domestica]
Length=395

 Score =   142 bits (359),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 112/192 (58%), Gaps = 6/192 (3%)
 Frame = -2

Query  1338  V*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDK------I  1177
             V  HP+ + YR K +  +N+L +I+ HT ADGRYSLS  DIDF++E++ + D        
Sbjct  154   VKVHPDAQVYRNKALMTFNDLCLIYAHTQADGRYSLSSHDIDFDDEIQGMIDGAGMISPT  213

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P     +  DW   M++ F+ LML+Q+++G K+N TF  +AW  M+T F   FG QY   
Sbjct  214   PASKVKRNADWKPAMDEFFLNLMLDQLEKGRKMNNTFTKQAWKGMVTLFKKKFGSQYQTR  273

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              LK     L + Y  V+ +L+++GF W E  QMIVA+D VW   I+A    R YR K L 
Sbjct  274   FLKQLHKKLLKYYTDVRSILARNGFYWDENRQMIVADDDVWGNCIQALPDARVYRKKPLL  333

Query  816   FYKDMSIICGNE  781
              Y+D++ I  +E
Sbjct  334   NYQDLNSIYASE  345


 Score =   105 bits (262),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 80/121 (66%), Gaps = 1/121 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M + + +S + LR++WT  M+ YFI+L+LDQ+ +GNR   +F+KQAW +M+ +F+  +  
Sbjct  45    MSNQNLTSGDRLRTSWTPAMERYFIDLMLDQVHRGNRLGHTFNKQAWNDMLMMFNGNFGT  104

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
              +D + LK+ Y  L +Q+++ K +L+QN F WD++RQMV  +   WD Y+KV    Q + 
Sbjct  105   PYDMNTLKSHYTSLWRQFNDIKNLLDQNGFSWDNTRQMVIADKYAWDAYVKVHPDAQVYR  164

Query  1387  N  1385
             N
Sbjct  165   N  165


 Score =   103 bits (258),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 71/127 (56%), Gaps = 0/127 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T  D  +  W+  ME++FI LML+QV  GN+L  TF  +AW  M+  FN  FG  Y    
Sbjct  51    TSGDRLRTSWTPAMERYFIDLMLDQVHRGNRLGHTFNKQAWNDMLMMFNGNFGTPYDMNT  110

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             LK+ +  L RQ+  +K LL Q+GF W    QM++A+   W   +K     + YRNK+L  
Sbjct  111   LKSHYTSLWRQFNDIKNLLDQNGFSWDNTRQMVIADKYAWDAYVKVHPDAQVYRNKALMT  170

Query  813   YKDMSII  793
             + D+ +I
Sbjct  171   FNDLCLI  177


 Score = 77.0 bits (188),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 72/121 (60%), Gaps = 1/121 (1%)
 Frame = -1

Query  1771  LSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMI  1592
             +  + +   M   + +S     ++W   MD++F+ L+LDQ++KG + + +F+KQAW  M+
Sbjct  200   IQGMIDGAGMISPTPASKVKRNADWKPAMDEFFLNLMLDQLEKGRKMNNTFTKQAWKGMV  259

Query  1591  ALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LF  K+  ++ T  LK  +K L K Y + + IL +N F WD++RQM+  +D+ W + I+
Sbjct  260   TLFKKKFGSQYQTRFLKQLHKKLLKYYTDVRSILARNGFYWDENRQMIVADDDVWGNCIQ  319

Query  1414  V  1412
              
Sbjct  320   A  320



>ref|XP_008451523.1| PREDICTED: uncharacterized protein LOC103492784 [Cucumis melo]
 ref|XP_008451524.1| PREDICTED: uncharacterized protein LOC103492784 [Cucumis melo]
 ref|XP_008451525.1| PREDICTED: uncharacterized protein LOC103492784 [Cucumis melo]
Length=495

 Score =   144 bits (362),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 112/372 (30%), Positives = 174/372 (47%), Gaps = 50/372 (13%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVA----------------DGRYS-----LSCFDI  1216
             AHPE   +R K +PYYN+L II+G+ +                 D  Y+      S  D+
Sbjct  113   AHPEAGSFRIKSIPYYNDLCIIYGNAMVEQKGVCLQESSHSGENDAMYTKPLGTASEGDV  172

Query  1215  DFENEVKILED-----------KIPTKDD---------AKKIDWSETMEQHFIQLMLEQV  1096
             +   E+ I ED           +IP               +  W   M++ FI LMLEQV
Sbjct  173   ESLQEIMIGEDYKISLPGNVIDEIPQHGSNITATTPICRSRTYWQPPMDRFFIDLMLEQV  232

Query  1095  QEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMW  916
             Q+GN+++  F+ ++W  MI +FNT FGF Y   VLK R+  LRRQY  +  LL  DGF+W
Sbjct  233   QKGNQIDGVFRKQSWADMIASFNTNFGFNYDVDVLKNRYKTLRRQYNVINNLLDLDGFLW  292

Query  915   HERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVKAGE  736
              E  QMI A+D VW+  IK     R++  + + +YKD+ +IC    P++         G 
Sbjct  293   DETRQMITADDYVWQDYIKGHTDARQFMTRPVPYYKDLCVIC---DPSYGGRDCLSGQGT  349

Query  735   FCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGPSEINEETEI---E  565
                   +        +     V  +++   K+  +   + K   +  S  +   ++   +
Sbjct  350   EQHHDAEDEKLSNGFQSPVSPVSVEEQASVKESTHLGSKNKRELESMSSFDYNKKLRGED  409

Query  564   IGMEDAMQEMVAAVTALT-keekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfle  388
               M   ++EMV+ V++L+ K++     +S  IE VI  +QA+P MD+D  L        E
Sbjct  410   ESMASTLREMVSVVSSLSDKKKNDDNSSSFSIETVIEAIQALPNMDEDLVLDACDLLEDE  469

Query  387   dDNKAKVFLALD  352
                KAK F+ALD
Sbjct  470   R--KAKTFIALD  479


 Score =   115 bits (287),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 77/122 (63%), Gaps = 1/122 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV +GNK +   F  +AW +MI+ FN  F F+Y K VLK R   L
Sbjct  16    WTPEMDRYFIDLMLEQVNKGNKFDDHLFSKRAWKNMISLFNAKFRFEYEKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y AVK LL Q GF+W E  QM+ A++ VW + +KA      +R KS+ +Y D+ II 
Sbjct  76    RNLYKAVKNLLDQRGFIWDEVRQMVTADNNVWDEYVKAHPEAGSFRIKSIPYYNDLCIIY  135

Query  789   GN  784
             GN
Sbjct  136   GN  137


 Score =   106 bits (264),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 84/124 (68%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             +S++ LR+ WT  MD YFI+L+L+Q+ KGN+     FSK+AW  MI+LF+ K++ +++ D
Sbjct  7     NSNDRLRTVWTPEMDRYFIDLMLEQVNKGNKFDDHLFSKRAWKNMISLFNAKFRFEYEKD  66

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   K +L+Q  FIWD+ RQMVT ++  WD+Y+K     +  S  +K 
Sbjct  67    VLKNRHKTLRNLYKAVKNLLDQRGFIWDEVRQMVTADNNVWDEYVKAH--PEAGSFRIKS  124

Query  1372  IAHY  1361
             I +Y
Sbjct  125   IPYY  128


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 70/99 (71%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD +FI+L+L+Q+QKGN+    F KQ+W +MIA F+  +   +D DVLKNRYK
Sbjct  213   RTYWQPPMDRFFIDLMLEQVQKGNQIDGVFRKQSWADMIASFNTNFGFNYDVDVLKNRYK  272

Query  1528  HLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+QY+    +L+ + F+WD++RQM+T +D  W DYIK
Sbjct  273   TLRRQYNVINNLLDLDGFLWDETRQMITADDYVWQDYIK  311



>ref|XP_011007802.1| PREDICTED: uncharacterized protein LOC105113349 [Populus euphratica]
 ref|XP_011007803.1| PREDICTED: uncharacterized protein LOC105113349 [Populus euphratica]
 ref|XP_011007804.1| PREDICTED: uncharacterized protein LOC105113349 [Populus euphratica]
 ref|XP_011007805.1| PREDICTED: uncharacterized protein LOC105113349 [Populus euphratica]
Length=517

 Score =   144 bits (362),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 140/277 (51%), Gaps = 14/277 (5%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M+++FI LMLEQ Q+GN+++  F+ +AW+ MI +FN  FGF Y   VLK RF  LR
Sbjct  227   WQPPMDRYFIDLMLEQWQKGNQIDGVFRKQAWMDMIASFNVRFGFNYDVDVLKNRFKTLR  286

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC-  790
             RQ+  +K LL  DGF W +  QM+ A+D VW+  IK     R++  + + +YKD+  IC 
Sbjct  287   RQHNVIKNLLELDGFAWDDTRQMVTADDYVWQDYIKTHTDARQFMTRPIPYYKDLCTICC  346

Query  789   ---GNETPTFQYGYP-----FVKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCR  634
                 +E   F   Y      F  A    +P    +    N    E     D      K  
Sbjct  347   DQDSDERDYFSAQYAELQNDFKIAKSCGMPQGSQSPAASNSSGDEVGGISDTAHTASKSS  406

Query  633   YDTKEPKEPCKGPSEINEETEI---EIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDV  463
               T++ K   +  S      ++   E GM  A++EM  AV++L+ + K +  NS  IE V
Sbjct  407   APTQKNKRRLENQSNSAPLKKLRGDEDGMASALREMATAVSSLSDKRKDENSNSNSIEKV  466

Query  462   IYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             I  +QA+PEMD+D  L        E   KAK F+ALD
Sbjct  467   IEAIQALPEMDEDLVLDACDLLEDEL--KAKTFMALD  501


 Score =   110 bits (276),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 83/130 (64%), Gaps = 3/130 (2%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S   R+ W   MD YFI+L+L+Q QKGN+    F KQAW++MIA F+ ++   +D DVL
Sbjct  219   ASNRTRTYWQPPMDRYFIDLMLEQWQKGNQIDGVFRKQAWMDMIASFNVRFGFNYDVDVL  278

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIA  1367
             KNR+K LR+Q++  K +LE + F WDD+RQMVT +D  W DYIK     ++F    + I 
Sbjct  279   KNRFKTLRRQHNVIKNLLELDGFAWDDTRQMVTADDYVWQDYIKTHTDARQFMT--RPIP  336

Query  1366  HYILVSFVVC  1337
             +Y  +  + C
Sbjct  337   YYKDLCTICC  346


 Score =   104 bits (259),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 70/124 (56%), Gaps = 1/124 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI L+LEQ   GNK +   F  KAW HM   FN  F FQ  K VLK R   L
Sbjct  16    WTPEMDRYFIDLLLEQASNGNKFDDHLFSKKAWKHMTYLFNAKFKFQCEKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y AVK LL   GF W E  QM+ A++  W + IK     R +R K++ +Y D+ +I 
Sbjct  76    RNLYKAVKKLLEYKGFSWDENRQMVTADNNDWDEYIKIHPDARAFRIKTIPYYSDLCLIY  135

Query  789   GNET  778
             G+ T
Sbjct  136   GDPT  139


 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             + ++ LR+ WT  MD YFI+LLL+Q   GN+     FSK+AW  M  LF+ K+K + + D
Sbjct  7     NGNDRLRTIWTPEMDRYFIDLLLEQASNGNKFDDHLFSKKAWKHMTYLFNAKFKFQCEKD  66

Query  1549  VLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y    K+LE   F WD++RQMVT ++  WD+YIK+    + F   +K 
Sbjct  67    VLKNRHKTLRNLYKAVKKLLEYKGFSWDENRQMVTADNNDWDEYIKIHPDARAF--RIKT  124

Query  1372  IAHY  1361
             I +Y
Sbjct  125   IPYY  128



>ref|XP_004136161.1| PREDICTED: uncharacterized protein LOC101220968 [Cucumis sativus]
 ref|XP_004162446.1| PREDICTED: uncharacterized protein LOC101224559 [Cucumis sativus]
Length=553

 Score =   144 bits (362),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 123/367 (34%), Positives = 189/367 (51%), Gaps = 50/367 (14%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVA------DGRYS-----LSCFDIDFENEVKILE  1186
             AHPE   +R K +PYYN+L II+G+  +      +  Y+      S  D +   E+ I E
Sbjct  181   AHPEAGSFRIKTIPYYNDLCIIYGNATSSHSGENEAMYTKPLGTASEGDGESLQEIMIGE  240

Query  1185  D---KIP--TKDD---------------AKKIDWSETMEQHFIQLMLEQVQEGNKLNRTF  1066
             D    +P    DD                 +  W   M++ FI LMLEQVQ+GN+++  F
Sbjct  241   DYKISLPGNVTDDIPQHGSNITATTTICRSRTYWQPPMDRFFIDLMLEQVQKGNQIDGVF  300

Query  1065  KNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAE  886
             + ++W  MI +FN  FGF Y   VLK R+  LRRQY  +  LL  DGF+W E  QMI A+
Sbjct  301   RKQSWADMIASFNAKFGFNYDVDVLKNRYKTLRRQYNVINNLLDLDGFLWDETRQMITAD  360

Query  885   DRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVKAGEFCVPIIQTTG  706
             D VW+  IK     R++  + + +YKD+ +IC    P+  YG     +G+    I Q   
Sbjct  361   DYVWQDYIKGHTDARQFMTRPVPYYKDLCVIC---DPS--YGERDCLSGQ---GIEQHHD  412

Query  705   KE-----GNLreveeivedddereEKKCRYDTKEPKEPCKGPSEINEETEI---EIGMED  550
              E        +     V  +++   K+  +   + K   +  S  +   ++   +  M  
Sbjct  413   AEDEKLSNGFQSPVSPVSVEEQASVKESTHLGSKNKRELESMSSFDYNKKLRGEDESMAS  472

Query  549   AMQEMVAAVTALT-keekkkkKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKA  373
             A++EMV+ V++L+ K++     +S+ IE VI  +Q++P M  D+DL+LDACD LED+ KA
Sbjct  473   ALREMVSVVSSLSDKKKNDDNSSSISIERVIEAIQSLPNM--DEDLVLDACDLLEDERKA  530

Query  372   KVFLALD  352
             K F+ALD
Sbjct  531   KTFIALD  537


 Score =   114 bits (286),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 1/133 (1%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             +D  +  W+  M+++FI LMLEQV +GNK +   F  +AW +MI+ FN  F F+Y K VL
Sbjct  77    NDRLRTVWTPEMDRYFIDLMLEQVNKGNKFDDHLFSKRAWKNMISLFNAKFRFEYEKDVL  136

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R   LR  Y AVK LL Q GF W E  QM+ A++ VW + +KA      +R K++ +Y
Sbjct  137   KNRHKTLRNLYKAVKNLLDQRGFSWDEVRQMVTADNNVWDEYVKAHPEAGSFRIKTIPYY  196

Query  810   KDMSIICGNETPT  772
              D+ II GN T +
Sbjct  197   NDLCIIYGNATSS  209


 Score =   107 bits (268),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD +FI+L+L+Q+QKGN+    F KQ+W +MIA F+ K+   +D DVLKNRYK
Sbjct  271   RTYWQPPMDRFFIDLMLEQVQKGNQIDGVFRKQSWADMIASFNAKFGFNYDVDVLKNRYK  330

Query  1528  HLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+QY+    +L+ + F+WD++RQM+T +D  W DYIK
Sbjct  331   TLRRQYNVINNLLDLDGFLWDETRQMITADDYVWQDYIK  369


 Score =   104 bits (260),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 83/124 (67%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             +S++ LR+ WT  MD YFI+L+L+Q+ KGN+     FSK+AW  MI+LF+ K++ +++ D
Sbjct  75    NSNDRLRTVWTPEMDRYFIDLMLEQVNKGNKFDDHLFSKRAWKNMISLFNAKFRFEYEKD  134

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   K +L+Q  F WD+ RQMVT ++  WD+Y+K     +  S  +K 
Sbjct  135   VLKNRHKTLRNLYKAVKNLLDQRGFSWDEVRQMVTADNNVWDEYVKAH--PEAGSFRIKT  192

Query  1372  IAHY  1361
             I +Y
Sbjct  193   IPYY  196



>ref|XP_004291373.1| PREDICTED: uncharacterized protein LOC101310774 [Fragaria vesca 
subsp. vesca]
Length=606

 Score = 99.4 bits (246),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 87/203 (43%), Gaps = 11/203 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVA-DGRYSLSCFDIDFENEVKILEDKIPTKDDAK  1156
             AHPE +  R +    Y +L  IF      + ++++S                    D+  
Sbjct  111   AHPEADIIRKRGCDIYEQLCFIFSSDSGINEKHAISISGTASHQ----------MNDEQS  160

Query  1155  KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFN  976
             +  WS  +E+ F  LMLEQV +GN+ N  F NKAW ++   FN   G  Y K  LK    
Sbjct  161   RAKWSMPLEKVFADLMLEQVAQGNRSNNAFSNKAWKYIHHEFNRQTGLNYDKQQLKNHHG  220

Query  975   LLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSI  796
             +LRR Y +VK LL QDGF W +   M++A   VW   I+        R K    ++ +  
Sbjct  221   VLRRSYHSVKSLLDQDGFSWDKSRCMVIAASDVWANYIEKHPEIESVRVKGCPLFEQLDS  280

Query  795   ICGNETPTFQYGYPFVKAGEFCV  727
             I          G P V   +  V
Sbjct  281   IFSEPGSAGNCGVPQVPQTQIAV  303


 Score = 72.0 bits (175),  Expect(2) = 4e-33, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 61/109 (56%), Gaps = 1/109 (1%)
 Frame = -1

Query  1735  DSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHD  1556
             +S S  E  R+ WT      F +LL++QI+KGNR S +F+K AW  +   F+ +     D
Sbjct  3     ESVSDQEQSRAKWTTFSTKIFADLLVEQIRKGNRGSGAFTKLAWKIIRDEFNKQTGLNFD  62

Query  1555  TDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
                LKN    LRK+Y++ K IL+   F WD ++ MV   D+ W +YI+ 
Sbjct  63    KQQLKNHLDVLRKRYNSVKAILDHTGFSWDVAQYMVLAEDDVWQEYIEA  111


 Score = 92.8 bits (229),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/184 (29%), Positives = 92/184 (50%), Gaps = 12/184 (7%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-DKIPTKDDAK-  1156
             HPE+E  R K  P + +L  IF    + G   +       + ++ + + D +P++D +K 
Sbjct  261   HPEIESVRVKGCPLFEQLDSIFSEPGSAGNCGVPQVP---QTQIAVFQMDTLPSEDQSKQ  317

Query  1155  ---KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
                +  W+  +++  I L++EQ ++    N+    KAW H+   FN   G ++    L+ 
Sbjct  318   DQSRAKWTVALDRILINLLMEQTRQ----NKMSNKKAWKHIQNEFNHRTGLKFDGEQLRN  373

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               N+LRR Y  +K +L Q  F W E   ++VA+D VW+K I A       RNK    +K+
Sbjct  374   HQNVLRRVYNNIKTVLDQGSFSWDESRHVVVADDEVWEKYIMAHPEAETVRNKDCPIFKE  433

Query  804   MSII  793
             + I+
Sbjct  434   LCIL  437


 Score = 74.3 bits (181),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 77/139 (55%), Gaps = 7/139 (5%)
 Frame = -1

Query  1816  CGLIPRLPYSYTSSRLSALKNRGAMEDDSCSS----SETLRSNWTHVMDDYFIELLLDQI  1649
             C +  +L + ++S   S +  + A+     +S     E  R+ W+  ++  F +L+L+Q+
Sbjct  123   CDIYEQLCFIFSSD--SGINEKHAISISGTASHQMNDEQSRAKWSMPLEKVFADLMLEQV  180

Query  1648  QKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIW  1472
              +GNR++ +FS +AW  +   F+ +    +D   LKN +  LR+ YH+ K +L+Q+ F W
Sbjct  181   AQGNRSNNAFSNKAWKYIHHEFNRQTGLNYDKQQLKNHHGVLRRSYHSVKSLLDQDGFSW  240

Query  1471  DDSRQMVTGNDEKWDDYIK  1415
             D SR MV    + W +YI+
Sbjct  241   DKSRCMVIAASDVWANYIE  259


 Score = 70.5 bits (171),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 73/134 (54%), Gaps = 11/134 (8%)
 Frame = -1

Query  1816  CGLIPRLPYSYTSSRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGN  1637
             CG +P++P +       A+     +  +  S  +  R+ WT  +D   I LL++Q ++ N
Sbjct  291   CG-VPQVPQTQI-----AVFQMDTLPSEDQSKQDQSRAKWTVALDRILINLLMEQTRQ-N  343

Query  1636  RTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSR  1460
             + S   +K+AW  +   F+H+   K D + L+N    LR+ Y+N K +L+Q  F WD+SR
Sbjct  344   KMS---NKKAWKHIQNEFNHRTGLKFDGEQLRNHQNVLRRVYNNIKTVLDQGSFSWDESR  400

Query  1459  QMVTGNDEKWDDYI  1418
              +V  +DE W+ YI
Sbjct  401   HVVVADDEVWEKYI  414


 Score = 34.7 bits (78),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 27/53 (51%), Gaps = 1/53 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIP  1174
             AHPE E  R K  P + EL I+F    ++GR+  S   +  + + K+  D  P
Sbjct  416   AHPEAETVRNKDCPIFKELCILFSDPRSEGRHVQSSHVVKLDQQ-KVEMDGTP  467


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 64/123 (52%), Gaps = 0/123 (0%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+    + F  L++EQ+++GN+ +  F   AW  +   FN   G  + K  LK   ++LR
Sbjct  15    WTTFSTKIFADLLVEQIRKGNRGSGAFTKLAWKIIRDEFNKQTGLNFDKQQLKNHLDVLR  74

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             ++Y +VK +L   GF W     M++AED VW++ I+A       R +    Y+ +  I  
Sbjct  75    KRYNSVKAILDHTGFSWDVAQYMVLAEDDVWQEYIEAHPEADIIRKRGCDIYEQLCFIFS  134

Query  786   NET  778
             +++
Sbjct  135   SDS  137



>ref|XP_002301492.2| hypothetical protein POPTR_0002s20170g [Populus trichocarpa]
 gb|EEE80765.2| hypothetical protein POPTR_0002s20170g [Populus trichocarpa]
Length=443

 Score =   141 bits (355),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 110/198 (56%), Gaps = 15/198 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKI---LEDKI------  1177
             HP+   +R K +PYY++L +I+G    + +   S FD  F++ +     L+D +      
Sbjct  114   HPDARAFRIKTIPYYSDLCLIYGDPTVEKKGKESNFDAVFDSNMSASQGLKDLVLKSVTA  173

Query  1176  ------PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
                       +  +  W   M+++FI LMLEQ Q+GN+++  F+ +AW+ MI +FN  FG
Sbjct  174   APNITGSMASNRTRTYWQPPMDRYFIDLMLEQWQKGNQIDGVFRKQAWMDMIASFNARFG  233

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
             F Y   VLK RF  LRRQ+  +K LL  DGF W +  QM+ A+D VW+  IK     R++
Sbjct  234   FNYDVDVLKNRFKTLRRQHNVIKNLLELDGFTWDDARQMVTADDYVWQDYIKTHTDARQF  293

Query  834   RNKSLSFYKDMSIICGNE  781
               + + +YKD+  IC ++
Sbjct  294   MTRPIPYYKDLCTICSDQ  311


 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 76/112 (68%), Gaps = 1/112 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
             +S   R+ W   MD YFI+L+L+Q QKGN+    F KQAW++MIA F+ ++   +D DVL
Sbjct  182   ASNRTRTYWQPPMDRYFIDLMLEQWQKGNQIDGVFRKQAWMDMIASFNARFGFNYDVDVL  241

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
             KNR+K LR+Q++  K +LE + F WDD+RQMVT +D  W DYIK     ++F
Sbjct  242   KNRFKTLRRQHNVIKNLLELDGFTWDDARQMVTADDYVWQDYIKTHTDARQF  293


 Score =   104 bits (259),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 71/124 (57%), Gaps = 1/124 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI L+LEQV  GNK +   F  KAW HM   FN  F FQ  K VLK R   L
Sbjct  16    WTPEMDRYFIDLLLEQVSNGNKFDDHLFSKKAWKHMTYLFNAKFKFQCEKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y AVK LL   GF W E  QM+ A++  W + IK     R +R K++ +Y D+ +I 
Sbjct  76    RNLYKAVKKLLEYKGFSWDENRQMVTADNNDWDEYIKIHPDARAFRIKTIPYYSDLCLIY  135

Query  789   GNET  778
             G+ T
Sbjct  136   GDPT  139


 Score = 99.4 bits (246),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             + ++ LR+ WT  MD YFI+LLL+Q+  GN+     FSK+AW  M  LF+ K+K + + D
Sbjct  7     NGNDRLRTIWTPEMDRYFIDLLLEQVSNGNKFDDHLFSKKAWKHMTYLFNAKFKFQCEKD  66

Query  1549  VLKNRYKHLRKQYHNT-KILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y    K+LE   F WD++RQMVT ++  WD+YIK+    + F   +K 
Sbjct  67    VLKNRHKTLRNLYKAVKKLLEYKGFSWDENRQMVTADNNDWDEYIKIHPDARAF--RIKT  124

Query  1372  IAHY  1361
             I +Y
Sbjct  125   IPYY  128



>gb|KGN44981.1| hypothetical protein Csa_7G405870 [Cucumis sativus]
Length=476

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 122/377 (32%), Positives = 188/377 (50%), Gaps = 60/377 (16%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRY---------------------SLSCFDI  1216
             AHPE   +R K +PYYN+L II+G+   + +                      + S  D 
Sbjct  94    AHPEAGSFRIKTIPYYNDLCIIYGNATVEQQGICLQESSHSGENEAMYTKPLGTASEGDG  153

Query  1215  DFENEVKILED---KIP--TKDD---------------AKKIDWSETMEQHFIQLMLEQV  1096
             +   E+ I ED    +P    DD                 +  W   M++ FI LMLEQV
Sbjct  154   ESLQEIMIGEDYKISLPGNVTDDIPQHGSNITATTTICRSRTYWQPPMDRFFIDLMLEQV  213

Query  1095  QEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMW  916
             Q+GN+++  F+ ++W  MI +FN  FGF Y   VLK R+  LRRQY  +  LL  DGF+W
Sbjct  214   QKGNQIDGVFRKQSWADMIASFNAKFGFNYDVDVLKNRYKTLRRQYNVINNLLDLDGFLW  273

Query  915   HERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPFVKAGE  736
              E  QMI A+D VW+  IK     R++  + + +YKD+ +IC    P+  YG     +G+
Sbjct  274   DETRQMITADDYVWQDYIKGHTDARQFMTRPVPYYKDLCVIC---DPS--YGERDCLSGQ  328

Query  735   FCVPIIQTTGKE-----GNLreveeivedddereEKKCRYDTKEPKEPCKGPSEINEETE  571
                 I Q    E        +     V  +++   K+  +   + K   +  S  +   +
Sbjct  329   ---GIEQHHDAEDEKLSNGFQSPVSPVSVEEQASVKESTHLGSKNKRELESMSSFDYNKK  385

Query  570   I---EIGMEDAMQEMVAAVTALT-keekkkkKNSLLIEDVIYILQAMPEMdddddlllda  403
             +   +  M  A++EMV+ V++L+ K++     +S+ IE VI  +Q++P M  D+DL+LDA
Sbjct  386   LRGEDESMASALREMVSVVSSLSDKKKNDDNSSSISIERVIEAIQSLPNM--DEDLVLDA  443

Query  402   cdfledDNKAKVFLALD  352
             CD LED+ KAK F+ALD
Sbjct  444   CDLLEDERKAKTFIALD  460


 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 75/120 (63%), Gaps = 1/120 (1%)
 Frame = -2

Query  1134  MEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQY  958
             M+++FI LMLEQV +GNK +   F  +AW +MI+ FN  F F+Y K VLK R   LR  Y
Sbjct  1     MDRYFIDLMLEQVNKGNKFDDHLFSKRAWKNMISLFNAKFRFEYEKDVLKNRHKTLRNLY  60

Query  957   FAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNET  778
              AVK LL Q GF W E  QM+ A++ VW + +KA      +R K++ +Y D+ II GN T
Sbjct  61    KAVKNLLDQRGFSWDEVRQMVTADNNVWDEYVKAHPEAGSFRIKTIPYYNDLCIIYGNAT  120


 Score =   107 bits (266),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD +FI+L+L+Q+QKGN+    F KQ+W +MIA F+ K+   +D DVLKNRYK
Sbjct  194   RTYWQPPMDRFFIDLMLEQVQKGNQIDGVFRKQSWADMIASFNAKFGFNYDVDVLKNRYK  253

Query  1528  HLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+QY+    +L+ + F+WD++RQM+T +D  W DYIK
Sbjct  254   TLRRQYNVINNLLDLDGFLWDETRQMITADDYVWQDYIK  292


 Score = 95.1 bits (235),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 74/111 (67%), Gaps = 4/111 (4%)
 Frame = -1

Query  1687  MDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQY  1511
             MD YFI+L+L+Q+ KGN+     FSK+AW  MI+LF+ K++ +++ DVLKNR+K LR  Y
Sbjct  1     MDRYFIDLMLEQVNKGNKFDDHLFSKRAWKNMISLFNAKFRFEYEKDVLKNRHKTLRNLY  60

Query  1510  HNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
                K +L+Q  F WD+ RQMVT ++  WD+Y+K     +  S  +K I +Y
Sbjct  61    KAVKNLLDQRGFSWDEVRQMVTADNNVWDEYVKAH--PEAGSFRIKTIPYY  109



>ref|XP_008235166.1| PREDICTED: uncharacterized protein LOC103334021 [Prunus mume]
Length=499

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 116/388 (30%), Positives = 193/388 (50%), Gaps = 79/388 (20%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYS----------------------LSCFDI  1216
             HP+   +R K +PYY++L  I+G T  + R                        +S    
Sbjct  114   HPDARSFRIKTIPYYHDLCSIYGDTAMEERSDNIPEESSHSGENGTTAATQPRRVSQGTA  173

Query  1215  DFENEVKILED---KIPTK--DDAK---------------KIDWSETMEQHFIQLMLEQV  1096
             +   ++ + ED    +P K  DD +               +  W   M+++FI+LM EQV
Sbjct  174   ETLQDIMVGEDYGVTVPAKSFDDVEHAMTSVPGITTNSRSRTYWQPPMDRYFIELMQEQV  233

Query  1095  QEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMW  916
             ++G++++  F+ +AW+ MI +FN  FGF Y   VLK R   L+RQY  +K LL  DGF+W
Sbjct  234   RKGSRIDGVFRKQAWMEMIASFNAKFGFNYDMDVLKNRHKTLKRQYNVIKNLLELDGFIW  293

Query  915   HERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPF-----  751
              +  QM+ A+D VW+  IK     R++  + + +YKD+ +IC    P+      +     
Sbjct  294   DDARQMVTADDYVWQDYIKEHTDARQFMTRPVPYYKDLCMICD---PSVDDRDSYSGEDV  350

Query  750   -----VKAGEFCVPI---------IQTTGKEGNLreveeivedddereEKKCRYDTKEPK  613
                  V+  + C  +         + T  ++G++       E     ++K+ R       
Sbjct  351   EQENQVEGAKLCGALTSFLSPSTSVSTEDEDGDV------QESTPMCQKKRRRL------  398

Query  612   EPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkK-NSLLIEDVIYILQAMPE  436
             E C   +      E + GM  A++EM +AV++L+++++  +K NS  IE V+  +QA+P+
Sbjct  399   ENCPNEAHPKRSREEDGGMASALREMASAVSSLSEKKRNDEKLNSGSIESVVEAVQALPD  458

Query  435   MdddddllldacdfledDNKAKVFLALD  352
             M  D+DL+LDACD LED+ KAK F+ALD
Sbjct  459   M--DEDLVLDACDLLEDEKKAKTFMALD  484


 Score =   112 bits (281),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFIEL+ +Q++KG+R    F KQAW+EMIA F+ K+   +D DVLKNR+K
Sbjct  214   RTYWQPPMDRYFIELMQEQVRKGSRIDGVFRKQAWMEMIASFNAKFGFNYDMDVLKNRHK  273

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              L++QY+  K +LE + FIWDD+RQMVT +D  W DYIK
Sbjct  274   TLKRQYNVIKNLLELDGFIWDDARQMVTADDYVWQDYIK  312


 Score =   108 bits (269),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 76/131 (58%), Gaps = 1/131 (1%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKV  997
             T  D  +  W+  M+++FI LMLEQV +GNK +   F  +AW HM + F+  F F Y K 
Sbjct  7     TDGDRLRTVWTPEMDRYFIDLMLEQVCKGNKFDDHLFSKRAWKHMTSLFDAKFKFPYEKD  66

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R   LR  Y AV+ LL Q GF W E  QM+ A++ VW + IK     R +R K++ 
Sbjct  67    VLKNRHKTLRNLYKAVRNLLDQRGFSWDEMRQMVTADNNVWDEYIKVHPDARSFRIKTIP  126

Query  816   FYKDMSIICGN  784
             +Y D+  I G+
Sbjct  127   YYHDLCSIYGD  137


 Score =   102 bits (254),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             +  + LR+ WT  MD YFI+L+L+Q+ KGN+     FSK+AW  M +LF  K+K  ++ D
Sbjct  7     TDGDRLRTVWTPEMDRYFIDLMLEQVCKGNKFDDHLFSKRAWKHMTSLFDAKFKFPYEKD  66

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   + +L+Q  F WD+ RQMVT ++  WD+YIKV    + F   +K 
Sbjct  67    VLKNRHKTLRNLYKAVRNLLDQRGFSWDEMRQMVTADNNVWDEYIKVHPDARSF--RIKT  124

Query  1372  IAHY  1361
             I +Y
Sbjct  125   IPYY  128



>ref|XP_008221408.1| PREDICTED: uncharacterized protein LOC103321390 [Prunus mume]
Length=527

 Score = 95.1 bits (235),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 92/193 (48%), Gaps = 9/193 (5%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE +  R +    Y +L IIF    +D   +++   I     V  +++  P      +
Sbjct  111   AHPEADTVRKRGCDIYEQLCIIFS---SDSGTNVNHAFIVLGTAVHQIDEDPP------R  161

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W+  +E+ F+ LML+QV + N+ N  F NKAW ++   FN      Y K  LK    +
Sbjct  162   AKWTVPLEKIFVDLMLQQVFQENRSNNAFSNKAWKYIHHEFNRQTKLNYDKQQLKNHHGV  221

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LR+ Y +V+ LL+QD F W +   M++AE+ VW K I+        R K    Y+ +  I
Sbjct  222   LRKWYHSVRSLLNQDDFSWDKSRCMVIAENDVWAKCIEKHPEVEAIRVKGCPHYEQLDRI  281

Query  792   CGNETPTFQYGYP  754
                   +  Y +P
Sbjct  282   FSESGSSGNYAFP  294


 Score = 72.8 bits (177),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 58/100 (58%), Gaps = 1/100 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT      F +LL++QI+KGNR+S +FSK AW  +   F+ +   K D   LKN   
Sbjct  12    RAKWTTFCTKMFADLLVEQIRKGNRSSGAFSKLAWKIIRDEFNRQTGLKFDKQQLKNHLD  71

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LRK+Y++ K IL+   F WD S+ M+   D+ W  YI+ 
Sbjct  72    VLRKRYNSVKAILDHPGFTWDASQSMLLAQDDVWQKYIEA  111


 Score = 83.6 bits (205),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 89/188 (47%), Gaps = 15/188 (8%)
 Frame = -2

Query  1341  CV*AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILE-DKIPTKD  1165
             C+  HPE+E  R K  P+Y +L  IF  + + G Y+        E++    + D  P++D
Sbjct  257   CIEKHPEVEAIRVKGCPHYEQLDRIFSESGSSGNYAFP------ESQTAASKMDSPPSED  310

Query  1164  ----DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
                 D  +  WS  +++  + L++EQ  +    N+    KAW H+   FN   G Q+   
Sbjct  311   QFKRDQSRAKWSAPLDKILLDLLIEQTGQ----NKMSNKKAWKHIREEFNYKTGLQFDGE  366

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              L+   N+L+R Y  +K +L   GF W     M++A+D +W+K   A       RNK   
Sbjct  367   QLRNHQNVLKRLYNNIKSVLDHSGFSWDNSRNMVMADDELWEKYTTAHPEAETIRNKECP  426

Query  816   FYKDMSII  793
              +K +  +
Sbjct  427   IFKQLCAL  434


 Score = 67.8 bits (164),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 60/99 (61%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ WT  ++  F++L+L Q+ + NR++ +FS +AW  +   F+ + K  +D   LKN + 
Sbjct  161   RAKWTVPLEKIFVDLMLQQVFQENRSNNAFSNKAWKYIHHEFNRQTKLNYDKQQLKNHHG  220

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LRK YH+ + +L Q++F WD SR MV   ++ W   I+
Sbjct  221   VLRKWYHSVRSLLNQDDFSWDKSRCMVIAENDVWAKCIE  259


 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 73/142 (51%), Gaps = 1/142 (1%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKT  985
             D  +  W+    + F  L++EQ+++GN+ +  F   AW  +   FN   G ++ K  LK 
Sbjct  9     DQSRAKWTTFCTKMFADLLVEQIRKGNRSSGAFSKLAWKIIRDEFNRQTGLKFDKQQLKN  68

Query  984   RFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKD  805
               ++LR++Y +VK +L   GF W     M++A+D VW+K I+A       R +    Y+ 
Sbjct  69    HLDVLRKRYNSVKAILDHPGFTWDASQSMLLAQDDVWQKYIEAHPEADTVRKRGCDIYEQ  128

Query  804   MSIICGNETPTFQYGYPFVKAG  739
             + II  +++ T    + F+  G
Sbjct  129   LCIIFSSDSGT-NVNHAFIVLG  149



>ref|XP_007163153.1| hypothetical protein PHAVU_001G210700g [Phaseolus vulgaris]
 gb|ESW35147.1| hypothetical protein PHAVU_001G210700g [Phaseolus vulgaris]
Length=485

 Score =   139 bits (350),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 114/330 (35%), Positives = 174/330 (53%), Gaps = 17/330 (5%)
 Frame = -2

Query  1308  RTKVVPYYN-----ELRIIFGHTVADGRYSLSCFDIDFEN-EVKILEDKIPTKDDAKKID  1147
             R  +VPY +     +   +     AD    +S  D   ++ E +I ++  P+     +  
Sbjct  148   RGAIVPYVSKDVCEDADELLRDVRADEDCGISTLDKATDDCEQRISKETTPSFGTRTRTY  207

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M+++FI L+L  V++GN+ +  F  +AW+ +I++FN  FGF+Y   +LK R+  LR
Sbjct  208   WQPPMDRYFINLLLAHVRKGNQFDGVFSKQAWMEIISSFNEKFGFEYSLEILKNRYKTLR  267

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             RQY  +K LL  DGF W E  QM++A+D VW+  IK   Y R+Y  + L +YKD+ +IC 
Sbjct  268   RQYNLIKSLLQLDGFAWDEIRQMVIADDYVWQDYIKVHPYARQYMTRPLPYYKDLRVICD  327

Query  786   NETPTFQYGYPFVK---AGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEP  616
                   +Y  P  K   A +F +  + +T K G         E+      +      K+ 
Sbjct  328   PSFDEKEYFLPPDKHQNAVDFRIECL-STSKTGQSPFTPSSNEEQFSGVNELAYIGQKQK  386

Query  615   K--EPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKNSLLIEDVIYILQAM  442
             +  E     +   +    E GM  A+ EM A V+ ++    KK   S+ IE+VI  +QA+
Sbjct  387   RQLENSSSSTSPKKSRNDEQGMAAALHEMAAVVSTVS---AKKDDTSISIENVIEAVQAL  443

Query  441   PEMdddddllldacdfledDNKAKVFLALD  352
             P+M  DDDL+LDACDFLED+ KAK FLALD
Sbjct  444   PDM--DDDLVLDACDFLEDERKAKTFLALD  471


 Score =   102 bits (255),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 73/107 (68%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI LLL  ++KGN+    FSKQAW+E+I+ F+ K+  ++  ++LKNRYK
Sbjct  205   RTYWQPPMDRYFINLLLAHVRKGNQFDGVFSKQAWMEIISSFNEKFGFEYSLEILKNRYK  264

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ + F WD+ RQMV  +D  W DYIKV  + +++
Sbjct  265   TLRRQYNLIKSLLQLDGFAWDEIRQMVIADDYVWQDYIKVHPYARQY  311


 Score = 29.3 bits (64),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 18/33 (55%), Gaps = 0/33 (0%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSL  1231
             HP    Y T+ +PYY +LR+I   +  +  Y L
Sbjct  305   HPYARQYMTRPLPYYKDLRVICDPSFDEKEYFL  337


 Score = 91.7 bits (226),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/153 (34%), Positives = 80/153 (52%), Gaps = 16/153 (10%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKL-NRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV +G ++ +  F  +AW HM + FN  F FQY K VLK R   L
Sbjct  14    WTPEMDRYFIDLMLEQVSQGREVEDHLFSKRAWRHMSSKFNAKFNFQYEKDVLKNRHKTL  73

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y ++K LL Q GF   E+  M++A+D+V    +  +        KSL  +KD+  I 
Sbjct  74    RNLYRSIKNLLGQPGFSLDEKRNMVIADDQVDVNALSCRV------KKSLPNFKDLCTI-  126

Query  789   GNETPTFQYGYPFVKAGEFCVPIIQTTGKEGNL  691
                     YG+     G+  +  +  +G+ G +
Sbjct  127   --------YGHVMEGKGDAALEELSNSGERGAI  151


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/99 (41%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             + +E LR+ WT  MD YFI+L+L+Q+ +G       FSK+AW  M + F+ K+  +++ D
Sbjct  5     NGTERLRTIWTPEMDRYFIDLMLEQVSQGREVEDHLFSKRAWRHMSSKFNAKFNFQYEKD  64

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDE  1436
             VLKNR+K LR  Y + K +L Q  F  D+ R MV  +D+
Sbjct  65    VLKNRHKTLRNLYRSIKNLLGQPGFSLDEKRNMVIADDQ  103



>ref|XP_008369078.1| PREDICTED: uncharacterized protein LOC103432649 isoform X3 [Malus 
domestica]
Length=402

 Score =   136 bits (342),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 110/381 (29%), Positives = 178/381 (47%), Gaps = 67/381 (18%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------------HTVADGRYSLS----------  1228
             HP+   +R K +PYY +L +I+G                H+   G+ + +          
Sbjct  14    HPDARSFRIKTIPYYRDLCLIYGDAAFEEKGDNVPEESSHSSETGKTAATQPTNVNQDKA  73

Query  1227  -------------------CFDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLML  1105
                                CFD+       + E    T  +  +  W   M+ +FI L+ 
Sbjct  74    EALRDIIVGEDYGXAISEKCFDVSQHAITSVPE---ITASNRSRTYWQPPMDCYFIDLLQ  130

Query  1104  EQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDG  925
             EQV++G++++  F+ +AW  MI  FN  FGF Y   VLK R   L+RQY  +K LL  DG
Sbjct  131   EQVRKGSRVDGVFRKQAWKEMIALFNAKFGFNYDMDVLKNRHKTLKRQYNVIKNLLELDG  190

Query  924   FMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPF--  751
             F W ++  M+ A+D VW+  IK     R++  + + +YKD+ +IC    P+      +  
Sbjct  191   FCWDDKRHMVTADDYVWQDYIKEHTDARQFMTRPVPYYKDLCMICD---PSLDDRDCYSG  247

Query  750   --------VKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGP  595
                     V+  +FC  +  T+ +  +     E    + +     C +  +   E C   
Sbjct  248   QDVEQQNQVEGAKFCGAL--TSLQSASTSVSXEDDVVEVQESSLMC-HKKRRQLENCSNQ  304

Query  594   SEINEETEIEIGMEDAMQEMVAAVTALTkeek-kkkKNSLLIEDVIYILQAMPEMddddd  418
             +      E + GM  A++EM +AV+ L+ +++     NS  IE VI  +QA+P+M  D+D
Sbjct  305   AHPKRSREADGGMASALREMASAVSLLSDKKRXDANMNSGSIESVIEAIQALPDM--DED  362

Query  417   llldacdfledDNKAKVFLAL  355
             L+LDACD LED+ KAK F+AL
Sbjct  363   LVLDACDLLEDEKKAKTFMAL  383


 Score =   108 bits (270),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++S   R+ W   MD YFI+LL +Q++KG+R    F KQAW EMIALF+ K+   +D DV
Sbjct  108   TASNRSRTYWQPPMDCYFIDLLQEQVRKGSRVDGVFRKQAWKEMIALFNAKFGFNYDMDV  167

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKNR+K L++QY+  K +LE + F WDD R MVT +D  W DYIK
Sbjct  168   LKNRHKTLKRQYNVIKNLLELDGFCWDDKRHMVTADDYVWQDYIK  212



>ref|XP_004513955.1| PREDICTED: uncharacterized protein LOC101500085 isoform X1 [Cicer 
arietinum]
Length=845

 Score = 95.5 bits (236),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 93/196 (47%), Gaps = 6/196 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH------TVADGRYSLSCFDIDFENEVKILEDKIPTK  1168
             +P+    + +V+  Y EL II GH        +     ++  D   E +         T 
Sbjct  477   NPDARILKGRVIRNYEELCIIIGHLDPPGMNTSRANRGMTTDDNVMEVQETNYHGTDNTT  536

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +  K + W++ M+    +L+++QV  GNKL + FK  A+I  +   N  F        +K
Sbjct  537   EKVKSVTWTDEMDHCLTELLVKQVMLGNKLEKNFKTSAYIATLAVLNERFDLNLTIENIK  596

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R    ++QY  +K +LS+ GF W E  +++VA D  W + IK  +  R  R+K +  Y 
Sbjct  597   SRLRTWKKQYGLLKEMLSRGGFQWDEGRKVVVATDSTWNEYIKKHRDARHLRDKQIENYN  656

Query  807   DMSIICGNETPTFQYG  760
             ++ +I GN+  +  + 
Sbjct  657   ELGLIVGNDEASGNWS  672


 Score = 69.7 bits (169),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 61/106 (58%), Gaps = 3/106 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS-KQAWLEMIAL-FSHKYKCKHDTDVLKNRYKH  1526
             WT  MD    E+L+ QI+ GNR+      K A LE   L  + K+K     D +KNR K 
Sbjct  347   WTSDMDSCLSEILVQQIKLGNRSKFDHKLKPAALEAAVLAINDKFKLYMLKDHIKNRLKT  406

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              +KQY   K +L Q+ F WD++R+MV  +D  W++YIKV + D KF
Sbjct  407   WKKQYDTLKELLRQSGFEWDENRKMVIADDSVWNEYIKVHIIDFKF  452


 Score = 93.2 bits (230),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 95/189 (50%), Gaps = 7/189 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIPT  1171
             HP+ + +R K +  Y++L  + G+  +  R S +  +ID        + ++ IL +    
Sbjct  119   HPDAKIFRAKSIENYDKLCFVLGNDQSIARLSDNVTEIDVNFTVDNGDPDLVILSETQTD  178

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              +  K + W+E M+    +++++QV++G K++  F+ +A+   ++A N  FG    K  +
Sbjct  179   GNLTKNLRWTEEMDHWLGKILVDQVRKGLKIDNVFQTEAYDKAVSAMNAKFGLHLTKFNI  238

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    ++QY   K +L   GF W E  +MI+A D  W + I+     R YR + L  Y
Sbjct  239   KNRLKTWKKQYEIAKEILCHAGFRWDETKKMIIANDSTWIEYIRTHPDARTYRARVLENY  298

Query  810   KDMSIICGN  784
             +    I G+
Sbjct  299   EQFCSIFGH  307


 Score = 61.2 bits (147),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD+   ++L++Q++KGN+         +   +   + K+        +KNR K  R
Sbjct  22    WTAEMDNCLTDVLVEQVEKGNKVDNILKPAVFAAALKALNEKFGMHLTKGHIKNRLKTWR  81

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQ+   K +L    F+W+ +++MV  ND  W+DYI+
Sbjct  82    KQFAVLKELLAHRGFVWNKTQKMVVANDSVWNDYIR  117


 Score = 75.9 bits (185),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 92/200 (46%), Gaps = 16/200 (8%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGH--TVADGRYSLSCFD-IDFENEVKILEDKIPTKDD  1162
              HP+   YR +V+  Y +   IFGH         S+ C +  +FE+   +  D    KD 
Sbjct  283   THPDARTYRARVLENYEQFCSIFGHYNEPLHPSDSIPCDEPSEFESICPVNYDS-NLKDV  341

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              K++ W+  M+    +++++Q++ GN  K +   K  A    + A N  F     K  +K
Sbjct  342   VKQMRWTSDMDSCLSEILVQQIKLGNRSKFDHKLKPAALEAAVLAINDKFKLYMLKDHIK  401

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R    ++QY  +K LL Q GF W E  +M++A+D VW + IK            +  +K
Sbjct  402   NRLKTWKKQYDTLKELLRQSGFEWDENRKMVIADDSVWNEYIKVH----------IIDFK  451

Query  807   DMSIICGNETPTFQYGYPFV  748
              +S IC + T      Y +V
Sbjct  452   FLSGICCSITILLSSLYKYV  471


 Score = 59.7 bits (143),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+ + ++  + K+        +KNR K  +
Sbjct  187   WTEEMDHWLGKILVDQVRKGLKIDNVFQTEAYDKAVSAMNAKFGLHLTKFNIKNRLKTWK  246

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQY   K IL    F WD++++M+  ND  W +YI+
Sbjct  247   KQYEIAKEILCHAGFRWDETKKMIIANDSTWIEYIR  282


 Score = 85.1 bits (209),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 80/167 (48%), Gaps = 8/167 (5%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  K I W+  M+     +++EQV++GNK++   K   +   + A N  FG    K  +K
Sbjct  15    DRGKYIIWTAEMDNCLTDVLVEQVEKGNKVDNILKPAVFAAALKALNEKFGMHLTKGHIK  74

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R    R+Q+  +K LL+  GF+W++  +M+VA D VW   I+     + +R KS+  Y 
Sbjct  75    NRLKTWRKQFAVLKELLAHRGFVWNKTQKMVVANDSVWNDYIREHPDAKIFRAKSIENYD  134

Query  807   DMSIICGNETPTFQYGYPF--------VKAGEFCVPIIQTTGKEGNL  691
              +  + GN+    +             V  G+  + I+  T  +GNL
Sbjct  135   KLCFVLGNDQSIARLSDNVTEIDVNFTVDNGDPDLVILSETQTDGNL  181


 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 75/151 (50%), Gaps = 19/151 (13%)
 Frame = -1

Query  1822  EKCGLIPRL-PYSYTSSRLSALKNRGAMEDDSC------------SSSETLRS-NWTHVM  1685
             E C +I  L P    +SR     NRG   DD+             +++E ++S  WT  M
Sbjct  493   ELCIIIGHLDPPGMNTSR----ANRGMTTDDNVMEVQETNYHGTDNTTEKVKSVTWTDEM  548

Query  1684  DDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN  1505
             D    ELL+ Q+  GN+   +F   A++  +A+ + ++      + +K+R +  +KQY  
Sbjct  549   DHCLTELLVKQVMLGNKLEKNFKTSAYIATLAVLNERFDLNLTIENIKSRLRTWKKQYGL  608

Query  1504  TK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              K +L +  F WD+ R++V   D  W++YIK
Sbjct  609   LKEMLSRGGFQWDEGRKVVVATDSTWNEYIK  639



>ref|XP_006480028.1| PREDICTED: uncharacterized protein LOC102620565 isoform X5 [Citrus 
sinensis]
Length=431

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/283 (33%), Positives = 143/283 (51%), Gaps = 24/283 (8%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M+++FI LMLEQVQ+GN+++  F+ +AWI MI +FN  FGF+Y   +LK R+  LR
Sbjct  139   WQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYKTLR  198

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             RQY  +K LL  +GF+W E  QM+ A+D VW+  +K     R++  + + ++KD+ +ICG
Sbjct  199   RQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQFMTRPVPYFKDLCVICG  258

Query  786   ----NETPTFQYG----------YPFVKAGEFCV-PIIQTTGKE--GNLreveeiveddd  658
                 +E   F               F  A +    P+   +G++  G+L E    +    
Sbjct  259   HPSIDENDCFSIQDLEMHNEVQEIKFQGASKSSQHPVASESGEDELGDLLEAAARMGSKP  318

Query  657   ereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTk-eekkkkKNS  481
                  K     K   E C     + +    + GM   + E V AV++ +  +      NS
Sbjct  319   VFSCTK----NKRQFENCSDSEFLKKSRSKDEGMPGTICEAVNAVSSFSDGKSGDLNSNS  374

Query  480   LLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             + IE VI  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  375   VAIECVIAAVQALPDMDEDLILDACDFLEDEM--KAKTFMALD  415


 Score =   117 bits (292),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+L+Q+QKGNR    F K+AW+EMI  F+ K+  K+D ++LKNRYK
Sbjct  136   RTYWQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYK  195

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ N F+WD++RQMVT +D  W DY+K     ++F
Sbjct  196   TLRRQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQF  242


 Score = 35.4 bits (80),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             H +   + T+ VPY+ +L +I GH   D     S  D++  NEV+ ++ +  +K     +
Sbjct  236   HTDARQFMTRPVPYFKDLCVICGHPSIDENDCFSIQDLEMHNEVQEIKFQGASKSSQHPV  295

Query  1149  DWSETMEQHFIQLMLEQVQEGNK  1081
               SE+ E     L+    + G+K
Sbjct  296   -ASESGEDELGDLLEAAARMGSK  317



>gb|KDO87096.1| hypothetical protein CISIN_1g009421mg [Citrus sinensis]
Length=449

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 93/283 (33%), Positives = 143/283 (51%), Gaps = 24/283 (8%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M+++FI LMLEQVQ+GN+++  F+ +AWI MI +FN  FGF+Y   +LK R+  LR
Sbjct  157   WQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYKTLR  216

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             RQY  +K LL  +GF+W E  QM+ A+D VW+  +K     R++  + + ++KD+ +ICG
Sbjct  217   RQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQFMTRPVPYFKDLCVICG  276

Query  786   ----NETPTFQYG----------YPFVKAGEFCV-PIIQTTGKE--GNLreveeiveddd  658
                 +E   F               F  A +    P+   +G++  G+L E    +    
Sbjct  277   HPSIDENDCFSIQDLEMHNEVQEIKFQGASKSSQHPVASESGEDELGDLLEAAARMGSKP  336

Query  657   ereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTk-eekkkkKNS  481
                  K     K   E C     + +    + GM   + E V AV++ +  +      NS
Sbjct  337   VFSCTK----NKRQFENCSDSEFLKKSRSKDEGMPGTICEAVNAVSSFSDGKSGDLNSNS  392

Query  480   LLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             + IE VI  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  393   VAIECVIAAVQALPDMDEDLILDACDFLEDEM--KAKTFMALD  433


 Score =   117 bits (292),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+L+Q+QKGNR    F K+AW+EMI  F+ K+  K+D ++LKNRYK
Sbjct  154   RTYWQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYK  213

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ N F+WD++RQMVT +D  W DY+K     ++F
Sbjct  214   TLRRQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQF  260


 Score = 35.4 bits (80),  Expect(2) = 2e-27, Method: Compositional matrix adjust.
 Identities = 22/83 (27%), Positives = 40/83 (48%), Gaps = 1/83 (1%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKI  1150
             H +   + T+ VPY+ +L +I GH   D     S  D++  NEV+ ++ +  +K     +
Sbjct  254   HTDARQFMTRPVPYFKDLCVICGHPSIDENDCFSIQDLEMHNEVQEIKFQGASKSSQHPV  313

Query  1149  DWSETMEQHFIQLMLEQVQEGNK  1081
               SE+ E     L+    + G+K
Sbjct  314   -ASESGEDELGDLLEAAARMGSK  335



>ref|XP_008345617.1| PREDICTED: uncharacterized protein LOC103408553 [Malus domestica]
Length=402

 Score =   134 bits (338),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 104/182 (57%), Gaps = 6/182 (3%)
 Frame = -2

Query  1326  PEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKKID  1147
             P+ E YRTK  P YN+L +I+G++ +  RY+ S         V    D        ++ D
Sbjct  17    PDTEAYRTKSTPNYNDLCLIYGNSNSGERYNQSG------QAVGCNGDANYNHSYHRRTD  70

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W+  M+++FI LMLEQV+ G+ +N+ F   AW  M++ F   FG Q+ K VLK+RF  LR
Sbjct  71    WTPPMDRYFIDLMLEQVRNGSMVNQKFSKLAWTDMVSKFRAQFGSQHDKDVLKSRFVNLR  130

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             +++  +K LL Q GF W E  Q I A+  +W   +K +   R YRN++L  + D+ +I G
Sbjct  131   KRFNDMKTLLDQSGFTWDEMQQRITADGDLWDAHVKVRPDARSYRNRTLPNFNDLCLIYG  190

Query  786   NE  781
             NE
Sbjct  191   NE  192


 Score = 96.3 bits (238),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 77/110 (70%), Gaps = 1/110 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R++WT  MD YFI+L+L+Q++ G+  +  FSK AW +M++ F  ++  +HD DVLK+R+ 
Sbjct  68    RTDWTPPMDRYFIDLMLEQVRNGSMVNQKFSKLAWTDMVSKFRAQFGSQHDKDVLKSRFV  127

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNH  1382
             +LRK++++ K +L+Q+ F WD+ +Q +T + + WD ++KV+   + + N 
Sbjct  128   NLRKRFNDMKTLLDQSGFTWDEMQQRITADGDLWDAHVKVRPDARSYRNR  177


 Score = 30.0 bits (66),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 12/42 (29%), Positives = 24/42 (57%), Gaps = 0/42 (0%)
 Frame = -2

Query  1326  PEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENE  1201
             P+   YR + +P +N+L +I+G+  +  R   S   +D E++
Sbjct  169   PDARSYRNRTLPNFNDLCLIYGNEDSLKREGSSNHSMDAEDD  210



>ref|XP_002269324.1| PREDICTED: uncharacterized protein At2g29880 [Vitis vinifera]
 ref|XP_010652217.1| PREDICTED: uncharacterized protein At2g29880 [Vitis vinifera]
 ref|XP_010652218.1| PREDICTED: uncharacterized protein At2g29880 [Vitis vinifera]
 ref|XP_010652219.1| PREDICTED: uncharacterized protein At2g29880 [Vitis vinifera]
Length=533

 Score =   136 bits (343),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 152/278 (55%), Gaps = 23/278 (8%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M+++FI LML+QVQ+GN+++  F+ +AW+ MI +FN  FGF+Y   VLK RF  LR
Sbjct  249   WQPPMDRYFIDLMLDQVQKGNQVDGVFRKQAWMEMIASFNAKFGFKYDMDVLKNRFKTLR  308

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC-  790
             RQY  ++ LL  +GF+W +  QM+ A+D VW+  IK     R+Y  + + +Y+D+ +IC 
Sbjct  309   RQYNVIRSLLDLNGFIWDDTRQMVTADDCVWQDYIKTHTNARQYMTRPVPYYQDLCVICR  368

Query  789   -----GNETPTFQYGY------PFVKAGEFCVPIIQTTGKEGNLreveeivedddereEK  643
                  G +T     GY      P VK  +  + I ++     +  E    +++      +
Sbjct  369   ELSIDGRDT---DLGYDEPDDIPEVKF-QGVLKISESPAASFSSEEQLGELKESSHSGLR  424

Query  642   KCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkkkKN-SLLIED  466
             + +   + P      P  I ++   +  M  A++EMV AV++++++ K  + + S+ IE 
Sbjct  425   RNKRQLENPSNSAT-PKRIRKK---DGNMASALREMVTAVSSISEKNKDDENSGSISIES  480

Query  465   VIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             VI  +QA+P+MD++  L        E   KAK FLALD
Sbjct  481   VIEAVQALPDMDEELVLDACDFLEDEK--KAKTFLALD  516


 Score =   122 bits (305),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = -1

Query  1759  KNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFS  1580
             K +    +   S S   R+ W   MD YFI+L+LDQ+QKGN+    F KQAW+EMIA F+
Sbjct  229   KPQAPPGETGPSMSHRTRTYWQPPMDRYFIDLMLDQVQKGNQVDGVFRKQAWMEMIASFN  288

Query  1579  HKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              K+  K+D DVLKNR+K LR+QY+  + +L+ N FIWDD+RQMVT +D  W DYIK 
Sbjct  289   AKFGFKYDMDVLKNRFKTLRRQYNVIRSLLDLNGFIWDDTRQMVTADDCVWQDYIKT  345


 Score = 27.3 bits (59),  Expect(2) = 1e-26, Method: Compositional matrix adjust.
 Identities = 17/56 (30%), Positives = 25/56 (45%), Gaps = 7/56 (13%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFD-------IDFENEVKILE  1186
              H     Y T+ VPYY +L +I      DGR +   +D       + F+  +KI E
Sbjct  345   THTNARQYMTRPVPYYQDLCVICRELSIDGRDTDLGYDEPDDIPEVKFQGVLKISE  400


 Score =   117 bits (292),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV +GN+++   F  +AW  M   FN  F FQY K VLK R   L
Sbjct  16    WTPEMDRYFIDLMLEQVNKGNRIDDHLFSKRAWKQMTALFNAKFNFQYEKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y A+K LL Q GF W E+ QM+ A++ VW + IK     R YR K++ +Y D+  I 
Sbjct  76    RNLYKAIKNLLCQRGFSWDEQRQMVTADNNVWDEYIKGHPDARSYRIKTIPYYNDLCFIY  135

Query  789   GNETPTFQYGYPFVKAGEF  733
              N TP  Q G  F   G  
Sbjct  136   RNATPE-QKGNHFGHDGNL  153


 Score =   100 bits (250),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/130 (42%), Positives = 82/130 (63%), Gaps = 4/130 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             + ++  R+ WT  MD YFI+L+L+Q+ KGNR     FSK+AW +M ALF+ K+  +++ D
Sbjct  7     NGNDRFRTIWTPEMDRYFIDLMLEQVNKGNRIDDHLFSKRAWKQMTALFNAKFNFQYEKD  66

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   K +L Q  F WD+ RQMVT ++  WD+YIK     + +   +K 
Sbjct  67    VLKNRHKTLRNLYKAIKNLLCQRGFSWDEQRQMVTADNNVWDEYIKGHPDARSY--RIKT  124

Query  1372  IAHYILVSFV  1343
             I +Y  + F+
Sbjct  125   IPYYNDLCFI  134



>ref|XP_008369077.1| PREDICTED: uncharacterized protein LOC103432649 isoform X2 [Malus 
domestica]
Length=502

 Score =   135 bits (341),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 110/381 (29%), Positives = 178/381 (47%), Gaps = 67/381 (18%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------------HTVADGRYSLS----------  1228
             HP+   +R K +PYY +L +I+G                H+   G+ + +          
Sbjct  114   HPDARSFRIKTIPYYRDLCLIYGDAAFEEKGDNVPEESSHSSETGKTAATQPTNVNQDKA  173

Query  1227  -------------------CFDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLML  1105
                                CFD+       + E    T  +  +  W   M+ +FI L+ 
Sbjct  174   EALRDIIVGEDYGXAISEKCFDVSQHAITSVPE---ITASNRSRTYWQPPMDCYFIDLLQ  230

Query  1104  EQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDG  925
             EQV++G++++  F+ +AW  MI  FN  FGF Y   VLK R   L+RQY  +K LL  DG
Sbjct  231   EQVRKGSRVDGVFRKQAWKEMIALFNAKFGFNYDMDVLKNRHKTLKRQYNVIKNLLELDG  290

Query  924   FMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPF--  751
             F W ++  M+ A+D VW+  IK     R++  + + +YKD+ +IC    P+      +  
Sbjct  291   FCWDDKRHMVTADDYVWQDYIKEHTDARQFMTRPVPYYKDLCMICD---PSLDDRDCYSG  347

Query  750   --------VKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGP  595
                     V+  +FC  +  T+ +  +     E    + +     C +  +   E C   
Sbjct  348   QDVEQQNQVEGAKFCGAL--TSLQSASTSVSXEDDVVEVQESSLMC-HKKRRQLENCSNQ  404

Query  594   SEINEETEIEIGMEDAMQEMVAAVTALTkeek-kkkKNSLLIEDVIYILQAMPEMddddd  418
             +      E + GM  A++EM +AV+ L+ +++     NS  IE VI  +QA+P+M  D+D
Sbjct  405   AHPKRSREADGGMASALREMASAVSLLSDKKRXDANMNSGSIESVIEAIQALPDM--DED  462

Query  417   llldacdfledDNKAKVFLAL  355
             L+LDACD LED+ KAK F+AL
Sbjct  463   LVLDACDLLEDEKKAKTFMAL  483


 Score =   111 bits (277),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 76/131 (58%), Gaps = 1/131 (1%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKV  997
             T  D  +  W+  M+++FI LMLEQV +GNK +   F  +AW HM + FN  F F Y K 
Sbjct  7     TGGDRLRTVWTPEMDRYFIDLMLEQVGKGNKFDDHLFSKRAWKHMXSLFNAKFNFPYEKD  66

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK R   LR  Y AVK LL Q GF W E  QM+ A++  W   IK     R +R K++ 
Sbjct  67    VLKNRHKTLRNLYKAVKILLHQRGFSWDETRQMVTADNNAWDGYIKVHPDARSFRIKTIP  126

Query  816   FYKDMSIICGN  784
             +Y+D+ +I G+
Sbjct  127   YYRDLCLIYGD  137


 Score =   108 bits (269),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++S   R+ W   MD YFI+LL +Q++KG+R    F KQAW EMIALF+ K+   +D DV
Sbjct  208   TASNRSRTYWQPPMDCYFIDLLQEQVRKGSRVDGVFRKQAWKEMIALFNAKFGFNYDMDV  267

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKNR+K L++QY+  K +LE + F WDD R MVT +D  W DYIK
Sbjct  268   LKNRHKTLKRQYNVIKNLLELDGFCWDDKRHMVTADDYVWQDYIK  312


 Score =   103 bits (257),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             +  + LR+ WT  MD YFI+L+L+Q+ KGN+     FSK+AW  M +LF+ K+   ++ D
Sbjct  7     TGGDRLRTVWTPEMDRYFIDLMLEQVGKGNKFDDHLFSKRAWKHMXSLFNAKFNFPYEKD  66

Query  1549  VLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   KI L Q  F WD++RQMVT ++  WD YIKV    + F   +K 
Sbjct  67    VLKNRHKTLRNLYKAVKILLHQRGFSWDETRQMVTADNNAWDGYIKVHPDARSF--RIKT  124

Query  1372  IAHY  1361
             I +Y
Sbjct  125   IPYY  128



>ref|XP_008369076.1| PREDICTED: uncharacterized protein LOC103432649 isoform X1 [Malus 
domestica]
Length=513

 Score =   136 bits (342),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 110/381 (29%), Positives = 178/381 (47%), Gaps = 67/381 (18%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------------HTVADGRYSLS----------  1228
             HP+   +R K +PYY +L +I+G                H+   G+ + +          
Sbjct  125   HPDARSFRIKTIPYYRDLCLIYGDAAFEEKGDNVPEESSHSSETGKTAATQPTNVNQDKA  184

Query  1227  -------------------CFDIDFENEVKILEDKIPTKDDAKKIDWSETMEQHFIQLML  1105
                                CFD+       + E    T  +  +  W   M+ +FI L+ 
Sbjct  185   EALRDIIVGEDYGXAISEKCFDVSQHAITSVPE---ITASNRSRTYWQPPMDCYFIDLLQ  241

Query  1104  EQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDG  925
             EQV++G++++  F+ +AW  MI  FN  FGF Y   VLK R   L+RQY  +K LL  DG
Sbjct  242   EQVRKGSRVDGVFRKQAWKEMIALFNAKFGFNYDMDVLKNRHKTLKRQYNVIKNLLELDG  301

Query  924   FMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETPTFQYGYPF--  751
             F W ++  M+ A+D VW+  IK     R++  + + +YKD+ +IC    P+      +  
Sbjct  302   FCWDDKRHMVTADDYVWQDYIKEHTDARQFMTRPVPYYKDLCMICD---PSLDDRDCYSG  358

Query  750   --------VKAGEFCVPIIQTTGKEGNLreveeivedddereEKKCRYDTKEPKEPCKGP  595
                     V+  +FC  +  T+ +  +     E    + +     C +  +   E C   
Sbjct  359   QDVEQQNQVEGAKFCGAL--TSLQSASTSVSXEDDVVEVQESSLMC-HKKRRQLENCSNQ  415

Query  594   SEINEETEIEIGMEDAMQEMVAAVTALTkeek-kkkKNSLLIEDVIYILQAMPEMddddd  418
             +      E + GM  A++EM +AV+ L+ +++     NS  IE VI  +QA+P+M  D+D
Sbjct  416   AHPKRSREADGGMASALREMASAVSLLSDKKRXDANMNSGSIESVIEAIQALPDM--DED  473

Query  417   llldacdfledDNKAKVFLAL  355
             L+LDACD LED+ KAK F+AL
Sbjct  474   LVLDACDLLEDEKKAKTFMAL  494


 Score =   112 bits (281),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 81/141 (57%), Gaps = 1/141 (1%)
 Frame = -2

Query  1203  EVKILEDKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFN  1027
             E++ +  +  T  D  +  W+  M+++FI LMLEQV +GNK +   F  +AW HM + FN
Sbjct  8     EIESMGTRARTGGDRLRTVWTPEMDRYFIDLMLEQVGKGNKFDDHLFSKRAWKHMXSLFN  67

Query  1026  TAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQY  847
               F F Y K VLK R   LR  Y AVK LL Q GF W E  QM+ A++  W   IK    
Sbjct  68    AKFNFPYEKDVLKNRHKTLRNLYKAVKILLHQRGFSWDETRQMVTADNNAWDGYIKVHPD  127

Query  846   FRRYRNKSLSFYKDMSIICGN  784
              R +R K++ +Y+D+ +I G+
Sbjct  128   ARSFRIKTIPYYRDLCLIYGD  148


 Score =   108 bits (269),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (69%), Gaps = 1/105 (1%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDV  1547
             ++S   R+ W   MD YFI+LL +Q++KG+R    F KQAW EMIALF+ K+   +D DV
Sbjct  219   TASNRSRTYWQPPMDCYFIDLLQEQVRKGSRVDGVFRKQAWKEMIALFNAKFGFNYDMDV  278

Query  1546  LKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             LKNR+K L++QY+  K +LE + F WDD R MVT +D  W DYIK
Sbjct  279   LKNRHKTLKRQYNVIKNLLELDGFCWDDKRHMVTADDYVWQDYIK  323


 Score =   103 bits (257),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 78/124 (63%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             +  + LR+ WT  MD YFI+L+L+Q+ KGN+     FSK+AW  M +LF+ K+   ++ D
Sbjct  18    TGGDRLRTVWTPEMDRYFIDLMLEQVGKGNKFDDHLFSKRAWKHMXSLFNAKFNFPYEKD  77

Query  1549  VLKNRYKHLRKQYHNTKI-LEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  Y   KI L Q  F WD++RQMVT ++  WD YIKV    + F   +K 
Sbjct  78    VLKNRHKTLRNLYKAVKILLHQRGFSWDETRQMVTADNNAWDGYIKVHPDARSF--RIKT  135

Query  1372  IAHY  1361
             I +Y
Sbjct  136   IPYY  139



>ref|XP_010247462.1| PREDICTED: uncharacterized protein LOC104590478 [Nelumbo nucifera]
 ref|XP_010247463.1| PREDICTED: uncharacterized protein LOC104590478 [Nelumbo nucifera]
Length=709

 Score = 95.1 bits (235),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/201 (28%), Positives = 95/201 (47%), Gaps = 9/201 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT---VADGRYSLSCFDIDFENEVKILED-----KIP  1174
             HP+   +R + + YYNEL II G+    V   R ++   D+  +NE  +  D        
Sbjct  195   HPDARAFRARFIEYYNELCIILGNDYVPVTYYRTNVDVVDLSADNEGIVATDTSHIHSSK  254

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQ-EGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             TKD  K I W++ M+    ++++E+ + +GN  ++  ++ A+   + A N  F     K 
Sbjct  255   TKDKGKYIVWTDEMDHCLSKILVEEAKKQGNIKDQNLRHMAYEVALMALNEKFALDLTKD  314

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
              ++ R    ++QY  +K LLS   F W E  +M+ A D  W   IK     + +R + + 
Sbjct  315   HIRNRLKTWKKQYGVLKELLSHSEFKWDETRKMVFASDSAWNDYIKIHPDAKAFRARHIG  374

Query  816   FYKDMSIICGNETPTFQYGYP  754
              Y ++ II GNE        P
Sbjct  375   NYNELCIIMGNEQAVESCSKP  395


 Score = 68.9 bits (167),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 55/97 (57%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             W + MD    + L +Q++KGN+   + +  A+   ++  +  +      + ++NR K L+
Sbjct  98    WRNEMDRCLTKTLAEQVKKGNKIDKNLTSSAYTAAVSALNKNFGLDLTKEHIRNRLKTLK  157

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQY   K +L QN F WD+ R+MV  ND  W+DYIKV
Sbjct  158   KQYGILKDLLSQNGFEWDEKRKMVIANDSVWNDYIKV  194


 Score =   104 bits (260),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 105/215 (49%), Gaps = 17/215 (8%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSC------FDIDFENEVKILE--DKIP  1174
             HP+ + +R + +  YNEL II G+  A      SC       D+DF  + + +E  D   
Sbjct  362   HPDAKAFRARHIGNYNELCIIMGNEQA----VESCSKPNEEVDMDFATDYEGIETVDASQ  417

Query  1173  T-KDDAKK----IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQ  1009
             T  +DAK+    + W+  M++     + +QV++GNK ++  K+ A++  + A N  F   
Sbjct  418   THSEDAKEKGRYLVWTNEMDRCLAVTLADQVKQGNKRHKVLKHAAYMAAVRALNERFALD  477

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
               K  ++ R    ++QY  +K LLSQ GF W+E  +M+VA D VW   IKA    R  R 
Sbjct  478   LTKDHVRNRLKTWKKQYAVLKELLSQSGFHWNETQKMVVANDSVWNDYIKAHPDARYLRA  537

Query  828   KSLSFYKDMSIICGNETPTFQYGYPFVKAGEFCVP  724
             +S+  Y ++ II GN      Y     K      P
Sbjct  538   RSVENYDELCIIFGNGQANGNYSRDISKVDVGLSP  572


 Score = 56.2 bits (134),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 2/98 (2%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQK-GNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHL  1523
             WT  MD    ++L+++ +K GN    +    A+   +   + K+      D ++NR K  
Sbjct  264   WTDEMDHCLSKILVEEAKKQGNIKDQNLRHMAYEVALMALNEKFALDLTKDHIRNRLKTW  323

Query  1522  RKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             +KQY   K +L  +EF WD++R+MV  +D  W+DYIK+
Sbjct  324   KKQYGVLKELLSHSEFKWDETRKMVFASDSAWNDYIKI  361


 Score = 97.8 bits (242),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 75/131 (57%), Gaps = 0/131 (0%)
 Frame = -2

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
             T +  K + W   M++   + + EQV++GNK+++   + A+   ++A N  FG    K  
Sbjct  89    TNEKGKNVMWRNEMDRCLTKTLAEQVKKGNKIDKNLTSSAYTAAVSALNKNFGLDLTKEH  148

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             ++ R   L++QY  +K LLSQ+GF W E+ +M++A D VW   IK     R +R + + +
Sbjct  149   IRNRLKTLKKQYGILKDLLSQNGFEWDEKRKMVIANDSVWNDYIKVHPDARAFRARFIEY  208

Query  813   YKDMSIICGNE  781
             Y ++ II GN+
Sbjct  209   YNELCIILGND  219


 Score = 62.0 bits (149),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/97 (32%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT+ MD      L DQ+++GN+        A++  +   + ++      D ++NR K  +
Sbjct  432   WTNEMDRCLAVTLADQVKQGNKRHKVLKHAAYMAAVRALNERFALDLTKDHVRNRLKTWK  491

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQY   K +L Q+ F W+++++MV  ND  W+DYIK 
Sbjct  492   KQYAVLKELLSQSGFHWNETQKMVVANDSVWNDYIKA  528


 Score = 39.3 bits (90),  Expect(2) = 2e-12, Method: Compositional matrix adjust.
 Identities = 23/73 (32%), Positives = 36/73 (49%), Gaps = 5/73 (7%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-----ENEVKILEDKIPTK  1168
             AHP+    R + V  Y+EL IIFG+  A+G YS     +D       ++++I +  +   
Sbjct  528   AHPDARYLRARSVENYDELCIIFGNGQANGNYSRDISKVDVGLSPDSDDLEIPDRCLSAD  587

Query  1167  DDAKKIDWSETME  1129
             DD    +  E ME
Sbjct  588   DDVSNDNIDEGME  600



>ref|XP_007051026.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOX95183.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=375

 Score =   134 bits (336),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 112/225 (50%), Gaps = 43/225 (19%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFG----------------HTVADGRYSLSCFDIDFENEV  1198
             +P++ PYR K VPYYN+L  I+G                H   D   S +  +   E  +
Sbjct  114   NPDVRPYRVKTVPYYNDLCFIYGDRRAGEKGDNVSETSSHLGEDETGSAAQPECANEGAL  173

Query  1197  KIL------EDKIPTKDDAK------------------KIDWSETMEQHFIQLMLEQVQE  1090
             K +      ED I    + K                  + +W   M++ FI LMLEQV +
Sbjct  174   KAVHEIAADEDCISVSQEVKDTPETMPNVTTTPLYSRTRTNWHPPMDRSFIDLMLEQVHK  233

Query  1089  GNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHE  910
             GN+++  F+ +AW+ MI +FN  FGF Y   +LK R+  LRRQY  +K +L  DGF W +
Sbjct  234   GNQVDGVFRKQAWVEMIASFNAKFGFNYDMDILKNRYKTLRRQYNLIKNILQLDGFAWDD  293

Query  909   RHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNETP  775
               QM+ A+D VW+  IK     R++  + + +YKD+ +IC +  P
Sbjct  294   ARQMVTADDSVWQDYIKDA---RQFMTRPVPYYKDLCLICNDPDP  335


 Score =   113 bits (283),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+NW   MD  FI+L+L+Q+ KGN+    F KQAW+EMIA F+ K+   +D D+LKNRYK
Sbjct  212   RTNWHPPMDRSFIDLMLEQVHKGNQVDGVFRKQAWVEMIASFNAKFGFNYDMDILKNRYK  271

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              LR+QY+  K IL+ + F WDD+RQMVT +D  W DYIK
Sbjct  272   TLRRQYNLIKNILQLDGFAWDDARQMVTADDSVWQDYIK  310


 Score =   110 bits (275),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV  GN+ +   F   AW +MI+ FN  F F+Y K VLK R   L
Sbjct  16    WTPEMDRYFIDLMLEQVNNGNRFDDHVFSKTAWKNMISMFNERFNFEYDKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y  VK LL+Q GF W    QM++A+ +VW + IK     R YR K++ +Y D+  I 
Sbjct  76    RNLYKGVKNLLNQKGFTWDATRQMVIADGKVWDEYIKVNPDVRPYRVKTVPYYNDLCFIY  135

Query  789   GN  784
             G+
Sbjct  136   GD  137


 Score =   100 bits (250),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 78/125 (62%), Gaps = 4/125 (3%)
 Frame = -1

Query  1711  LRSNWTHVMDDYFIELLLDQIQKGNR-TSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNR  1535
             LR+ WT  MD YFI+L+L+Q+  GNR     FSK AW  MI++F+ ++  ++D DVLKNR
Sbjct  12    LRTIWTPEMDRYFIDLMLEQVNNGNRFDDHVFSKTAWKNMISMFNERFNFEYDKDVLKNR  71

Query  1534  YKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYI  1358
             +K LR  Y   K +L Q  F WD +RQMV  + + WD+YIKV    + +   +K + +Y 
Sbjct  72    HKTLRNLYKGVKNLLNQKGFTWDATRQMVIADGKVWDEYIKVNPDVRPY--RVKTVPYYN  129

Query  1357  LVSFV  1343
              + F+
Sbjct  130   DLCFI  134



>ref|XP_010104516.1| hypothetical protein L484_025489 [Morus notabilis]
 gb|EXC01117.1| hypothetical protein L484_025489 [Morus notabilis]
Length=352

 Score =   133 bits (334),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 116/349 (33%), Positives = 173/349 (50%), Gaps = 37/349 (11%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKD-----  1165
              P+   YR K VP +++L IIFG   +DGRY     D+D   E+ +L     T D     
Sbjct  4     RPDARSYRVKTVPGFHKLCIIFGEEHSDGRYGRLARDVDPVGELPVLMTSEETNDLTAAN  63

Query  1164  -DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
               + +++W+  +++  I LMLEQVQ+GNK++  F  +AW +M+ +F+   G Q  K  L+
Sbjct  64    AISSRLEWTPQLDRCLIDLMLEQVQKGNKIDSAFNEQAWDNMLKSFSETLGLQCYKTFLE  123

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+   + QY  +  +LS  GF W E   M++A++ VW+  IK +     YRN  LS + 
Sbjct  124   DRYLWFKNQYDGISKILSCSGFAWDETRHMVIADNDVWEAYIKERPDAVSYRNTCLSSFS  183

Query  807   DMSIICGN---------ETPTFQYGYPFVKAGEFCVPI-------IQTTGKEGNLrevee  676
             D+  I  N               Y     +    C  +       I   G  GNL    +
Sbjct  184   DLCKIFQNRLLDERINGHDAEMMYDDQGPQMASHCRILETLTDLEIVVDGASGNLTLSTD  243

Query  675   ivedddereEKKCRYDTKEPKEP-CKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeek  499
              V   ++++        K P  P   GP E  ++T+ E  + +++ EM   V  L K+E 
Sbjct  244   NVNMTEKQK--------KRPASPLVSGPPEKVQKTQSENRL-NSLSEMADLVAELAKKEN  294

Query  498   kkkKNSLLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             K   +   IE  I  LQA+P+M  DD+LLLDACD LED+ KAK FLALD
Sbjct  295   KSDHS---IEVAIDALQAIPDM--DDELLLDACDLLEDERKAKTFLALD  338


 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 68/122 (56%), Gaps = 1/122 (1%)
 Frame = -1

Query  1777  SRLSALKNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLE  1598
               L  L       D + +++ + R  WT  +D   I+L+L+Q+QKGN+  ++F++QAW  
Sbjct  45    GELPVLMTSEETNDLTAANAISSRLEWTPQLDRCLIDLMLEQVQKGNKIDSAFNEQAWDN  104

Query  1597  MIALFSHKYKCKHDTDVLKNRYKHLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDY  1421
             M+  FS     +     L++RY   + QY   +KIL  + F WD++R MV  +++ W+ Y
Sbjct  105   MLKSFSETLGLQCYKTFLEDRYLWFKNQYDGISKILSCSGFAWDETRHMVIADNDVWEAY  164

Query  1420  IK  1415
             IK
Sbjct  165   IK  166



>ref|XP_006444434.1| hypothetical protein CICLE_v10019662mg [Citrus clementina]
 ref|XP_006480024.1| PREDICTED: uncharacterized protein LOC102620565 isoform X1 [Citrus 
sinensis]
 ref|XP_006480025.1| PREDICTED: uncharacterized protein LOC102620565 isoform X2 [Citrus 
sinensis]
 gb|ESR57674.1| hypothetical protein CICLE_v10019662mg [Citrus clementina]
 gb|KDO87095.1| hypothetical protein CISIN_1g009421mg [Citrus sinensis]
Length=535

 Score =   135 bits (339),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 142/280 (51%), Gaps = 18/280 (6%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLR  967
             W   M+++FI LMLEQVQ+GN+++  F+ +AWI MI +FN  FGF+Y   +LK R+  LR
Sbjct  243   WQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYKTLR  302

Query  966   RQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICG  787
             RQY  +K LL  +GF+W E  QM+ A+D VW+  +K     R++  + + ++KD+ +ICG
Sbjct  303   RQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQFMTRPVPYFKDLCVICG  362

Query  786   ----NETPTFQYG----------YPFVKAGEFCVPIIQTTGKEGNLreveeivedddere  649
                 +E   F               F  A +     + +   E  L ++ E       + 
Sbjct  363   HPSIDENDCFSIQDLEMHNEVQEIKFQGASKSSQHPVASESGEDELGDLLEAAARMGSKP  422

Query  648   EKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTk-eekkkkKNSLLI  472
                C  + ++  E C     + +    + GM   + E V AV++ +  +      NS+ I
Sbjct  423   VFSCTKNKRQ-FENCSDSEFLKKSRSKDEGMPGTICEAVNAVSSFSDGKSGDLNSNSVAI  481

Query  471   EDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             E VI  +QA+P+MD+D  L        E   KAK F+ALD
Sbjct  482   ECVIAAVQALPDMDEDLILDACDFLEDEM--KAKTFMALD  519


 Score =   116 bits (291),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI+L+L+Q+QKGNR    F K+AW+EMI  F+ K+  K+D ++LKNRYK
Sbjct  240   RTYWQPPMDRYFIDLMLEQVQKGNRIDGVFRKEAWIEMIGSFNAKFGFKYDIEILKNRYK  299

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L+ N F+WD++RQMVT +D  W DY+K     ++F
Sbjct  300   TLRRQYNVIKNLLDLNGFVWDEARQMVTADDYVWQDYVKTHTDARQF  346


 Score = 35.0 bits (79),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 22/84 (26%), Positives = 40/84 (48%), Gaps = 1/84 (1%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
              H +   + T+ VPY+ +L +I GH   D     S  D++  NEV+ ++ +  +K     
Sbjct  339   THTDARQFMTRPVPYFKDLCVICGHPSIDENDCFSIQDLEMHNEVQEIKFQGASKSSQHP  398

Query  1152  IDWSETMEQHFIQLMLEQVQEGNK  1081
             +  SE+ E     L+    + G+K
Sbjct  399   VA-SESGEDELGDLLEAAARMGSK  421


 Score =   114 bits (284),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 79/130 (61%), Gaps = 1/130 (1%)
 Frame = -2

Query  1164  DAKKIDWSETMEQHFIQLMLEQVQEGNKLNRT-FKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  +  W+  M+++FI LMLEQ+ +GN+ +   F  +AW  M + F+  F FQY K VLK
Sbjct  10    DRNRTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLK  69

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R+  LR  Y AVK LL Q GF W E  QM+ A++ +W++ IK     R YR K++ +Y 
Sbjct  70    NRYKTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIKEHPEARSYRIKTVPYYN  129

Query  807   DMSIICGNET  778
             D+ +I GN+ 
Sbjct  130   DLCLIYGNKA  139


 Score =   100 bits (250),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 70/100 (70%), Gaps = 2/100 (2%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRY  1532
             R+ WT  MD YFI+L+L+Q+ KGNR     FSK+AW +M ++FS K+K ++  DVLKNRY
Sbjct  13    RTVWTPEMDRYFIDLMLEQLSKGNRFDDPLFSKRAWKQMTSVFSAKFKFQYHKDVLKNRY  72

Query  1531  KHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             K LR  Y   K +L+Q  F WD+ RQMVT ++  W++YIK
Sbjct  73    KTLRSLYRAVKSLLDQKGFSWDEMRQMVTADNTIWEEYIK  112



>emb|CAN71765.1| hypothetical protein VITISV_026917 [Vitis vinifera]
Length=975

 Score =   136 bits (342),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 101/288 (35%), Positives = 165/288 (57%), Gaps = 23/288 (8%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
             P+     +  W   M+++FI LML+QVQ+GN+++  F+ +AW+ MI +FN  FGF+Y   
Sbjct  681   PSMSHRTRTYWQPPMDRYFIDLMLDQVQKGNQVDGVFRKQAWMEMIASFNAKFGFKYDMD  740

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             VLK RF  LRRQY  ++ LL  +GF+W +  QM+ A+D VW+  IK     R+Y  + + 
Sbjct  741   VLKNRFKTLRRQYNVIRSLLDLNGFIWDDTRQMVTADDCVWQDYIKTHTNARQYMTRPVP  800

Query  816   FYKDMSIIC------GNETPTFQYGY------PFVKAGEFCVPIIQTTGKEGNLreveei  673
             +Y+D+ +IC      G +T     GY      P VK  +  + I ++     +  E    
Sbjct  801   YYQDLCVICRELSIDGRDT---DLGYDEPDDIPEVKF-QGVLKISESPAASFSSEEQLGE  856

Query  672   vedddereEKKCRYDTKEPKEPCKGPSEINEETEIEIGMEDAMQEMVAAVTALTkeekkk  493
             +++      ++ +   + P      P  I ++   +  M  A++EMV AV++++++ K  
Sbjct  857   LKESSHSGLRRNKRQLENPSNSAT-PKRIRKK---DGNMASALREMVTAVSSISEKNKDD  912

Query  492   kKN-SLLIEDVIYILQAMPEMdddddllldacdfledDNKAKVFLALD  352
             + + S+ IE VI  +QA+P+M  D++L+LDACDFLED+ KAK FLALD
Sbjct  913   ENSGSISIESVIEAVQALPDM--DEELVLDACDFLEDEKKAKTFLALD  958


 Score =   123 bits (308),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 79/116 (68%), Gaps = 1/116 (1%)
 Frame = -1

Query  1759  KNRGAMEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFS  1580
             K +    +   S S   R+ W   MD YFI+L+LDQ+QKGN+    F KQAW+EMIA F+
Sbjct  671   KPQAPPGETGPSMSHRTRTYWQPPMDRYFIDLMLDQVQKGNQVDGVFRKQAWMEMIASFN  730

Query  1579  HKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              K+  K+D DVLKNR+K LR+QY+  + +L+ N FIWDD+RQMVT +D  W DYIK
Sbjct  731   AKFGFKYDMDVLKNRFKTLRRQYNVIRSLLDLNGFIWDDTRQMVTADDCVWQDYIK  786


 Score = 27.3 bits (59),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 17/55 (31%), Positives = 25/55 (45%), Gaps = 7/55 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFD-------IDFENEVKILE  1186
             H     Y T+ VPYY +L +I      DGR +   +D       + F+  +KI E
Sbjct  788   HTNARQYMTRPVPYYQDLCVICRELSIDGRDTDLGYDEPDDIPEVKFQGVLKISE  842


 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 79/139 (57%), Gaps = 2/139 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+++FI LMLEQV +GN+++   F  +AW  M   FN  F FQY K VLK R   L
Sbjct  458   WTPEMDRYFIDLMLEQVNKGNRIDDHLFSKRAWKQMTALFNAKFNFQYEKDVLKNRHKTL  517

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIIC  790
             R  Y A+K LL Q GF W E+ QM+ A++ VW + IK     R YR K++ +Y D+  I 
Sbjct  518   RNLYKAIKNLLCQRGFSWDEQRQMVTADNNVWDEYIKGHPDARSYRIKTIPYYNDLCFIY  577

Query  789   GNETPTFQYGYPFVKAGEF  733
              N TP  Q G  F   G  
Sbjct  578   RNATPE-QKGNHFGHDGNL  595


 Score =   101 bits (252),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 79/125 (63%), Gaps = 4/125 (3%)
 Frame = -1

Query  1711  LRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNR  1535
              R+ WT  MD YFI+L+L+Q+ KGNR     FSK+AW +M ALF+ K+  +++ DVLKNR
Sbjct  454   FRTIWTPEMDRYFIDLMLEQVNKGNRIDDHLFSKRAWKQMTALFNAKFNFQYEKDVLKNR  513

Query  1534  YKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYI  1358
             +K LR  Y   K +L Q  F WD+ RQMVT ++  WD+YIK     + +   +K I +Y 
Sbjct  514   HKTLRNLYKAIKNLLCQRGFSWDEQRQMVTADNNVWDEYIKGHPDARSY--RIKTIPYYN  571

Query  1357  LVSFV  1343
              + F+
Sbjct  572   DLCFI  576



>ref|XP_007146152.1| hypothetical protein PHAVU_006G016600g [Phaseolus vulgaris]
 gb|ESW18146.1| hypothetical protein PHAVU_006G016600g [Phaseolus vulgaris]
Length=838

 Score =   103 bits (258),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 104/201 (52%), Gaps = 8/201 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVA-DGRYSLSCFDIDF--ENEVKILEDKIP-----  1174
             +P+    + +V+  YNEL II GH    +   S +C ++    +N V+ ++++       
Sbjct  489   NPDARLLKGRVIRNYNELCIIIGHCDPHNSPMSGACANMGMTTDNGVREVQERYCRRTNF  548

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
              K+  K + W++ M++   +L+  QV  GNKL + FK  A+I ++TA N  FG    K  
Sbjct  549   AKEKGKNVTWTDEMDRCLTELLFNQVLLGNKLEKNFKTSAYIAVLTALNERFGLNITKEN  608

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             + +R N  R+QY  +K +LSQ  F W E  +M+VA D  W + I+     +  R++ +  
Sbjct  609   IISRLNAWRKQYGLLKEMLSQGSFEWDEGCKMVVATDLEWNEYIEKHPDAKHLRDRHIEN  668

Query  813   YKDMSIICGNETPTFQYGYPF  751
             Y ++ +I GNE     +   F
Sbjct  669   YHELGMIVGNEQGIGNWSENF  689


 Score = 57.0 bits (136),  Expect(2) = 5e-30, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS-KQAWLEMIAL-FSHKYKCKHDTDVLKNRYKH  1526
             WT  MD      L+ QI++GNR+   +  + A  E   L  + K++     + +KNR K 
Sbjct  390   WTSDMDSCLSATLVQQIKEGNRSEFDYKLRPAAFEACVLAINEKFQLYLTKEHVKNRLKT  449

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W++YIK
Sbjct  450   WKKQYDILKELINQSSFEWDEKRKMVIANDSVWNEYIK  487


 Score = 87.0 bits (214),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 94/190 (49%), Gaps = 7/190 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH--TVADGRYSLSCFDIDF-----ENEVKILEDKIPT  1171
             HP+   ++ K +  Y++L  I G+   +A    +++  D++F     + ++ I+ +    
Sbjct  173   HPDARIFQAKSIENYDQLCAILGNEQVIASLSDNVTDTDVNFAVDKRDPDLAIVSEIHHD  232

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              +  K + W+  M+    +++++QV++G K+++    +A+   ++  N  FG    K  +
Sbjct  233   GNQTKNLRWTVEMDHWLGKILVDQVKKGLKVDKVLLTEAYEAAVSVVNAKFGLHLTKFNI  292

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    ++QY  +K +LS  GF W E  +MI+A D  W   I+     R +R +    Y
Sbjct  293   KNRLKTWKKQYEQLKEILSHTGFKWDETKKMIIASDSTWNDYIRTHLDARTFRGRVFENY  352

Query  810   KDMSIICGNE  781
                 II GNE
Sbjct  353   DQFCIIFGNE  362


 Score = 63.5 bits (153),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD    E+L +Q++KGN+        A+   +   + KY        +KNR K  R
Sbjct  76    WTSEMDKCLTEVLAEQVKKGNKMDNILKPAAFSGALKTLNEKYGMYVTKGHIKNRLKTWR  135

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+   K +L Q  F+W+++++MV  ++  W+DYIKV
Sbjct  136   KQFGILKELLAQRGFMWNETKKMVVADNSVWNDYIKV  172


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K+ AK + W+  M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +
Sbjct  68    KEKAKYMVWTSEMDKCLTEVLAEQVKKGNKMDNILKPAAFSGALKTLNEKYGMYVTKGHI  127

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    R+Q+  +K LL+Q GFMW+E  +M+VA++ VW   IK     R ++ KS+  Y
Sbjct  128   KNRLKTWRKQFGILKELLAQRGFMWNETKKMVVADNSVWNDYIKVHPDARIFQAKSIENY  187

Query  810   KDMSIICGNE  781
               +  I GNE
Sbjct  188   DQLCAILGNE  197


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 90/188 (48%), Gaps = 11/188 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
              H +   +R +V   Y++  IIFG+       S  C  ++++         +  +D  ++
Sbjct  337   THLDARTFRGRVFENYDQFCIIFGNEPLYWDESEPCDAVNYD---------VNVRDPGRQ  387

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNK--AWIHMITAFNTAFGFQYGKVVLKTRF  979
             + W+  M+      +++Q++EGN+    +K +  A+   + A N  F     K  +K R 
Sbjct  388   MRWTSDMDSCLSATLVQQIKEGNRSEFDYKLRPAAFEACVLAINEKFQLYLTKEHVKNRL  447

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
                ++QY  +K L++Q  F W E+ +M++A D VW + IK     R  + + +  Y ++ 
Sbjct  448   KTWKKQYDILKELINQSSFEWDEKRKMVIANDSVWNEYIKKNPDARLLKGRVIRNYNELC  507

Query  798   IICGNETP  775
             II G+  P
Sbjct  508   IIIGHCDP  515


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
              ++T    WT  MD +  ++L+DQ++KG +       +A+   +++ + K+        +
Sbjct  233   GNQTKNLRWTVEMDHWLGKILVDQVKKGLKVDKVLLTEAYEAAVSVVNAKFGLHLTKFNI  292

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KNR K  +KQY   K IL    F WD++++M+  +D  W+DYI+  +  + F   +
Sbjct  293   KNRLKTWKKQYEQLKEILSHTGFKWDETKKMIIASDSTWNDYIRTHLDARTFRGRV  348


 Score = 56.2 bits (134),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD    ELL +Q+  GN+   +F   A++ ++   + ++      + + +R    R
Sbjct  558   WTDEMDRCLTELLFNQVLLGNKLEKNFKTSAYIAVLTALNERFGLNITKENIISRLNAWR  617

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQY   K +L Q  F WD+  +MV   D +W++YI+
Sbjct  618   KQYGLLKEMLSQGSFEWDEGCKMVVATDLEWNEYIE  653


 Score = 25.0 bits (53),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/42 (29%), Positives = 22/42 (52%), Gaps = 2/42 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDF  1210
             HP+ +  R + +  Y+EL +I G+    G +S     FD++ 
Sbjct  655   HPDAKHLRDRHIENYHELGMIVGNEQGIGNWSENFERFDVNI  696



>ref|XP_008392051.1| PREDICTED: uncharacterized protein LOC103454236 [Malus domestica]
Length=172

 Score =   126 bits (316),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 96/140 (69%), Gaps = 7/140 (5%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   S ++S+ +R+NWT   D++FI+L+L+Q+ KGN+T   F KQAW +MI LF++++  
Sbjct  1     MYAGSSTTSDHVRANWTPSQDNFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFS  1388
             K+DTD+LKNRYK LRKQY   K +++Q  F WD+++QM+T +D  W++YIK     Q + 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQGNFRWDETQQMITADDNVWNNYIKAHPEMQXY-  119

Query  1387  NHLKIIAHY----ILVSFVV  1340
                K+I+HY    I+ S VV
Sbjct  120   -RTKVISHYDELCIIYSTVV  138


 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 74/128 (58%), Gaps = 0/128 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              T  D  + +W+ + +  FI LMLEQV +GNK    F+ +AW  MI  FN  FGF+Y   
Sbjct  6     STTSDHVRANWTPSQDNFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGFKYDTD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLS  817
             +LK R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA    + YR K +S
Sbjct  66    ILKNRYKRLRKQYSEMKSLVDQGNFRWDETQQMITADDNVWNNYIKAHPEMQXYRTKVIS  125

Query  816   FYKDMSII  793
              Y ++ II
Sbjct  126   HYDELCII  133



>ref|XP_007146151.1| hypothetical protein PHAVU_006G016600g [Phaseolus vulgaris]
 gb|ESW18145.1| hypothetical protein PHAVU_006G016600g [Phaseolus vulgaris]
Length=813

 Score =   103 bits (257),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/201 (30%), Positives = 104/201 (52%), Gaps = 8/201 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVA-DGRYSLSCFDIDF--ENEVKILEDKIP-----  1174
             +P+    + +V+  YNEL II GH    +   S +C ++    +N V+ ++++       
Sbjct  464   NPDARLLKGRVIRNYNELCIIIGHCDPHNSPMSGACANMGMTTDNGVREVQERYCRRTNF  523

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
              K+  K + W++ M++   +L+  QV  GNKL + FK  A+I ++TA N  FG    K  
Sbjct  524   AKEKGKNVTWTDEMDRCLTELLFNQVLLGNKLEKNFKTSAYIAVLTALNERFGLNITKEN  583

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             + +R N  R+QY  +K +LSQ  F W E  +M+VA D  W + I+     +  R++ +  
Sbjct  584   IISRLNAWRKQYGLLKEMLSQGSFEWDEGCKMVVATDLEWNEYIEKHPDAKHLRDRHIEN  643

Query  813   YKDMSIICGNETPTFQYGYPF  751
             Y ++ +I GNE     +   F
Sbjct  644   YHELGMIVGNEQGIGNWSENF  664


 Score = 57.0 bits (136),  Expect(2) = 6e-30, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS-KQAWLEMIAL-FSHKYKCKHDTDVLKNRYKH  1526
             WT  MD      L+ QI++GNR+   +  + A  E   L  + K++     + +KNR K 
Sbjct  365   WTSDMDSCLSATLVQQIKEGNRSEFDYKLRPAAFEACVLAINEKFQLYLTKEHVKNRLKT  424

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W++YIK
Sbjct  425   WKKQYDILKELINQSSFEWDEKRKMVIANDSVWNEYIK  462


 Score = 87.0 bits (214),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 94/190 (49%), Gaps = 7/190 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH--TVADGRYSLSCFDIDF-----ENEVKILEDKIPT  1171
             HP+   ++ K +  Y++L  I G+   +A    +++  D++F     + ++ I+ +    
Sbjct  148   HPDARIFQAKSIENYDQLCAILGNEQVIASLSDNVTDTDVNFAVDKRDPDLAIVSEIHHD  207

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              +  K + W+  M+    +++++QV++G K+++    +A+   ++  N  FG    K  +
Sbjct  208   GNQTKNLRWTVEMDHWLGKILVDQVKKGLKVDKVLLTEAYEAAVSVVNAKFGLHLTKFNI  267

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    ++QY  +K +LS  GF W E  +MI+A D  W   I+     R +R +    Y
Sbjct  268   KNRLKTWKKQYEQLKEILSHTGFKWDETKKMIIASDSTWNDYIRTHLDARTFRGRVFENY  327

Query  810   KDMSIICGNE  781
                 II GNE
Sbjct  328   DQFCIIFGNE  337


 Score = 63.5 bits (153),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 53/97 (55%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD    E+L +Q++KGN+        A+   +   + KY        +KNR K  R
Sbjct  51    WTSEMDKCLTEVLAEQVKKGNKMDNILKPAAFSGALKTLNEKYGMYVTKGHIKNRLKTWR  110

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+   K +L Q  F+W+++++MV  ++  W+DYIKV
Sbjct  111   KQFGILKELLAQRGFMWNETKKMVVADNSVWNDYIKV  147


 Score = 87.0 bits (214),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K+ AK + W+  M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +
Sbjct  43    KEKAKYMVWTSEMDKCLTEVLAEQVKKGNKMDNILKPAAFSGALKTLNEKYGMYVTKGHI  102

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    R+Q+  +K LL+Q GFMW+E  +M+VA++ VW   IK     R ++ KS+  Y
Sbjct  103   KNRLKTWRKQFGILKELLAQRGFMWNETKKMVVADNSVWNDYIKVHPDARIFQAKSIENY  162

Query  810   KDMSIICGNE  781
               +  I GNE
Sbjct  163   DQLCAILGNE  172


 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 90/188 (48%), Gaps = 11/188 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
              H +   +R +V   Y++  IIFG+       S  C  ++++         +  +D  ++
Sbjct  312   THLDARTFRGRVFENYDQFCIIFGNEPLYWDESEPCDAVNYD---------VNVRDPGRQ  362

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNK--AWIHMITAFNTAFGFQYGKVVLKTRF  979
             + W+  M+      +++Q++EGN+    +K +  A+   + A N  F     K  +K R 
Sbjct  363   MRWTSDMDSCLSATLVQQIKEGNRSEFDYKLRPAAFEACVLAINEKFQLYLTKEHVKNRL  422

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
                ++QY  +K L++Q  F W E+ +M++A D VW + IK     R  + + +  Y ++ 
Sbjct  423   KTWKKQYDILKELINQSSFEWDEKRKMVIANDSVWNEYIKKNPDARLLKGRVIRNYNELC  482

Query  798   IICGNETP  775
             II G+  P
Sbjct  483   IIIGHCDP  490


 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/116 (28%), Positives = 61/116 (53%), Gaps = 1/116 (1%)
 Frame = -1

Query  1723  SSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVL  1544
              ++T    WT  MD +  ++L+DQ++KG +       +A+   +++ + K+        +
Sbjct  208   GNQTKNLRWTVEMDHWLGKILVDQVKKGLKVDKVLLTEAYEAAVSVVNAKFGLHLTKFNI  267

Query  1543  KNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KNR K  +KQY   K IL    F WD++++M+  +D  W+DYI+  +  + F   +
Sbjct  268   KNRLKTWKKQYEQLKEILSHTGFKWDETKKMIIASDSTWNDYIRTHLDARTFRGRV  323


 Score = 55.8 bits (133),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 50/96 (52%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD    ELL +Q+  GN+   +F   A++ ++   + ++      + + +R    R
Sbjct  533   WTDEMDRCLTELLFNQVLLGNKLEKNFKTSAYIAVLTALNERFGLNITKENIISRLNAWR  592

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQY   K +L Q  F WD+  +MV   D +W++YI+
Sbjct  593   KQYGLLKEMLSQGSFEWDEGCKMVVATDLEWNEYIE  628


 Score = 25.0 bits (53),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 12/42 (29%), Positives = 22/42 (52%), Gaps = 2/42 (5%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYS--LSCFDIDF  1210
             HP+ +  R + +  Y+EL +I G+    G +S     FD++ 
Sbjct  630   HPDAKHLRDRHIENYHELGMIVGNEQGIGNWSENFERFDVNI  671



>ref|XP_006583985.1| PREDICTED: uncharacterized protein LOC100785875 isoform X2 [Glycine 
max]
Length=844

 Score =   103 bits (258),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 101/196 (52%), Gaps = 3/196 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT-VADGRYSLSCFDIDFENEVKILE-DKIPTKDDAK  1156
             +P+    + +V+  YNEL II GH   AD   + +C ++    +  ++E  +   K+  K
Sbjct  498   NPDARILKGRVIRNYNELCIILGHCDPADSSINGACANMGMTTDDGVMEVQETKEKEKVK  557

Query  1155  KI-DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              +  W++ M+    +L++ QV  GN+L + FK  A+I  +TA N  F     K  +  R 
Sbjct  558   NVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNERFDLNLTKENIINRL  617

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
              + ++QY  +K +LSQ  F W E  +M+VA D  W + IK   Y R  R++ +  Y ++ 
Sbjct  618   KIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIKKHPYARHLRDRHIENYHELG  677

Query  798   IICGNETPTFQYGYPF  751
             +I G+E  +  +   F
Sbjct  678   MIVGDEQGSGNWSENF  693


 Score = 56.2 bits (134),  Expect(2) = 7e-30, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS--KQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             WT  MD     +L+ QI++GNR+   ++    A+   +   + K++     + +KNR + 
Sbjct  399   WTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLYLTKEHVKNRLRT  458

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W +YIK
Sbjct  459   WKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIK  496


 Score = 90.5 bits (223),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (48%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIP  1174
             AHP+   +R K +  Y++L  I G+  A    S +  DID        + ++ I+ +   
Sbjct  173   AHPDARIFRAKSIENYDQLCTILGNDQAIASLSDNVTDIDVTFAVDKGDPDLAIVSEIQT  232

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               +  K   W+  M+    +++++QV++G K+++ F  +A+   ++A N  FG    K  
Sbjct  233   DGNQTKNFRWTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFN  292

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             +K R    ++Q+  +K +LS  GF W    +MI+A D  W   I+     R +R +    
Sbjct  293   VKNRLKTWKKQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRVFEN  352

Query  813   YKDMSIICGN  784
             Y    II G+
Sbjct  353   YDQFCIIFGH  362


 Score = 60.8 bits (146),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT+ MD    ++L +Q++KGN+        A+   +   + KY      + +KNR K  R
Sbjct  77    WTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHIKNRLKTWR  136

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+   K +L  + F+W+++++MV  ++  W+DYIK 
Sbjct  137   KQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKA  173


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K+ AK + W+  M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +
Sbjct  69    KEKAKYMVWTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHI  128

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    R+Q+  +K LL+  GFMW+E  +M+VA++ VW   IKA    R +R KS+  Y
Sbjct  129   KNRLKTWRKQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKAHPDARIFRAKSIENY  188

Query  810   KDMSIICGNE  781
               +  I GN+
Sbjct  189   DQLCTILGND  198


 Score = 82.0 bits (201),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 93/200 (47%), Gaps = 25/200 (13%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGH-----------TVADGRYSLSCFDIDFENEVKILE  1186
              H +   +R +V   Y++  IIFGH           T  +   +LS + ++++  V    
Sbjct  338   THLDARTFRGRVFENYDQFCIIFGHFYEPLHWDESGTCDETVEALSVYPVNYDISV----  393

Query  1185  DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGF  1012
                      + I W+  M+     ++++Q+++GN  K + T +  A+   + A N  F  
Sbjct  394   --------GRHIRWTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQL  445

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
                K  +K R    ++QY  +K L++Q GF W E+ +M++A D VW + IK     R  +
Sbjct  446   YLTKEHVKNRLRTWKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIKKNPDARILK  505

Query  831   NKSLSFYKDMSIICGNETPT  772
              + +  Y ++ II G+  P 
Sbjct  506   GRVIRNYNELCIILGHCDPA  525


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 7/128 (5%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             G ME       E +++   WT  MD    ELL++Q+  GNR    F   A++  +   + 
Sbjct  543   GVMEVQETKEKEKVKNVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNE  602

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             ++      + + NR K  +KQY   K +L Q  F WD+  +MV   D  WD+YIK     
Sbjct  603   RFDLNLTKENIINRLKIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIK----K  658

Query  1399  QKFSNHLK  1376
               ++ HL+
Sbjct  659   HPYARHLR  666


 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 57/108 (53%), Gaps = 1/108 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+   ++  + K+        +KNR K  +
Sbjct  242   WTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFNVKNRLKTWK  301

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KQ+   K IL    F WD +++M+  ND  W+DYI+  +  + F   +
Sbjct  302   KQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRV  349



>ref|XP_006583986.1| PREDICTED: uncharacterized protein LOC100785875 isoform X3 [Glycine 
max]
 ref|XP_006583987.1| PREDICTED: uncharacterized protein LOC100785875 isoform X4 [Glycine 
max]
Length=802

 Score =   103 bits (257),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 101/196 (52%), Gaps = 3/196 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT-VADGRYSLSCFDIDFENEVKILE-DKIPTKDDAK  1156
             +P+    + +V+  YNEL II GH   AD   + +C ++    +  ++E  +   K+  K
Sbjct  456   NPDARILKGRVIRNYNELCIILGHCDPADSSINGACANMGMTTDDGVMEVQETKEKEKVK  515

Query  1155  KI-DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              +  W++ M+    +L++ QV  GN+L + FK  A+I  +TA N  F     K  +  R 
Sbjct  516   NVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNERFDLNLTKENIINRL  575

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
              + ++QY  +K +LSQ  F W E  +M+VA D  W + IK   Y R  R++ +  Y ++ 
Sbjct  576   KIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIKKHPYARHLRDRHIENYHELG  635

Query  798   IICGNETPTFQYGYPF  751
             +I G+E  +  +   F
Sbjct  636   MIVGDEQGSGNWSENF  651


 Score = 56.2 bits (134),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS--KQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             WT  MD     +L+ QI++GNR+   ++    A+   +   + K++     + +KNR + 
Sbjct  357   WTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLYLTKEHVKNRLRT  416

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W +YIK
Sbjct  417   WKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIK  454


 Score = 89.7 bits (221),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (48%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIP  1174
             AHP+   +R K +  Y++L  I G+  A    S +  DID        + ++ I+ +   
Sbjct  131   AHPDARIFRAKSIENYDQLCTILGNDQAIASLSDNVTDIDVTFAVDKGDPDLAIVSEIQT  190

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               +  K   W+  M+    +++++QV++G K+++ F  +A+   ++A N  FG    K  
Sbjct  191   DGNQTKNFRWTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFN  250

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             +K R    ++Q+  +K +LS  GF W    +MI+A D  W   I+     R +R +    
Sbjct  251   VKNRLKTWKKQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRVFEN  310

Query  813   YKDMSIICGN  784
             Y    II G+
Sbjct  311   YDQFCIIFGH  320


 Score = 60.8 bits (146),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT+ MD    ++L +Q++KGN+        A+   +   + KY      + +KNR K  R
Sbjct  35    WTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHIKNRLKTWR  94

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+   K +L  + F+W+++++MV  ++  W+DYIK 
Sbjct  95    KQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKA  131


 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K+ AK + W+  M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +
Sbjct  27    KEKAKYMVWTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHI  86

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    R+Q+  +K LL+  GFMW+E  +M+VA++ VW   IKA    R +R KS+  Y
Sbjct  87    KNRLKTWRKQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKAHPDARIFRAKSIENY  146

Query  810   KDMSIICGNE  781
               +  I GN+
Sbjct  147   DQLCTILGND  156


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (47%), Gaps = 25/199 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH-----------TVADGRYSLSCFDIDFENEVKILED  1183
             H +   +R +V   Y++  IIFGH           T  +   +LS + ++++  V     
Sbjct  297   HLDARTFRGRVFENYDQFCIIFGHFYEPLHWDESGTCDETVEALSVYPVNYDISV-----  351

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGFQ  1009
                     + I W+  M+     ++++Q+++GN  K + T +  A+   + A N  F   
Sbjct  352   -------GRHIRWTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLY  404

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
               K  +K R    ++QY  +K L++Q GF W E+ +M++A D VW + IK     R  + 
Sbjct  405   LTKEHVKNRLRTWKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIKKNPDARILKG  464

Query  828   KSLSFYKDMSIICGNETPT  772
             + +  Y ++ II G+  P 
Sbjct  465   RVIRNYNELCIILGHCDPA  483


 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 7/128 (5%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             G ME       E +++   WT  MD    ELL++Q+  GNR    F   A++  +   + 
Sbjct  501   GVMEVQETKEKEKVKNVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNE  560

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             ++      + + NR K  +KQY   K +L Q  F WD+  +MV   D  WD+YIK     
Sbjct  561   RFDLNLTKENIINRLKIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIK----K  616

Query  1399  QKFSNHLK  1376
               ++ HL+
Sbjct  617   HPYARHLR  624


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 57/108 (53%), Gaps = 1/108 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+   ++  + K+        +KNR K  +
Sbjct  200   WTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFNVKNRLKTWK  259

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KQ+   K IL    F WD +++M+  ND  W+DYI+  +  + F   +
Sbjct  260   KQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRV  307



>gb|KHN28185.1| Hypothetical protein glysoja_024003 [Glycine soja]
Length=764

 Score =   103 bits (257),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 101/196 (52%), Gaps = 3/196 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT-VADGRYSLSCFDIDFENEVKILE-DKIPTKDDAK  1156
             +P+    + +V+  YNEL II GH   AD   + +C ++    +  ++E  +   K+  K
Sbjct  418   NPDARILKGRVIRNYNELCIILGHCDPADSSINGACANMGMTTDDGVMEVQETKEKEKVK  477

Query  1155  KI-DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              +  W++ M+    +L++ QV  GN+L + FK  A+I  +TA N  F     K  +  R 
Sbjct  478   NVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNERFDLNLTKENIINRL  537

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
              + ++QY  +K +LSQ  F W E  +M+VA D  W + IK   Y R  R++ +  Y ++ 
Sbjct  538   KIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIKKHPYARHLRDRHIENYHELG  597

Query  798   IICGNETPTFQYGYPF  751
             +I G+E  +  +   F
Sbjct  598   MIVGDEQGSGNWSENF  613


 Score = 56.2 bits (134),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS--KQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             WT  MD     +L+ QI++GNR+   ++    A+   +   + K++     + +KNR + 
Sbjct  319   WTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLYLTKEHVKNRLRT  378

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W +YIK
Sbjct  379   WKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIK  416


 Score = 90.1 bits (222),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (48%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIP  1174
             AHP+   +R K +  Y++L  I G+  A    S +  DID        + ++ I+ +   
Sbjct  93    AHPDARIFRAKSIENYDQLCTILGNDQAIASLSDNVTDIDVTFAVDKGDPDLAIVSEIQT  152

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               +  K   W+  M+    +++++QV++G K+++ F  +A+   ++A N  FG    K  
Sbjct  153   DGNQTKNFRWTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFN  212

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             +K R    ++Q+  +K +LS  GF W    +MI+A D  W   I+     R +R +    
Sbjct  213   VKNRLKTWKKQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRVFEN  272

Query  813   YKDMSIICGN  784
             Y    II G+
Sbjct  273   YDQFCIIFGH  282


 Score = 55.8 bits (133),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = -1

Query  1687  MDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYH  1508
             MD    ++L +Q++KGN+        A+   +   + KY      + +KNR K  RKQ+ 
Sbjct  1     MDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHIKNRLKTWRKQFG  60

Query  1507  NTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
               K +L  + F+W+++++MV  ++  W+DYIK 
Sbjct  61    VLKELLAHSGFMWNETKKMVVADNSVWNDYIKA  93


 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 66/118 (56%), Gaps = 0/118 (0%)
 Frame = -2

Query  1134  MEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLLRRQYF  955
             M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +K R    R+Q+ 
Sbjct  1     MDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHIKNRLKTWRKQFG  60

Query  954   AVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSIICGNE  781
              +K LL+  GFMW+E  +M+VA++ VW   IKA    R +R KS+  Y  +  I GN+
Sbjct  61    VLKELLAHSGFMWNETKKMVVADNSVWNDYIKAHPDARIFRAKSIENYDQLCTILGND  118


 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (47%), Gaps = 25/199 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH-----------TVADGRYSLSCFDIDFENEVKILED  1183
             H +   +R +V   Y++  IIFGH           T  +   +LS + ++++  V     
Sbjct  259   HLDARTFRGRVFENYDQFCIIFGHFYEPLHWDESGTCDETVEALSVYPVNYDISV-----  313

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGFQ  1009
                     + I W+  M+     ++++Q+++GN  K + T +  A+   + A N  F   
Sbjct  314   -------GRHIRWTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLY  366

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
               K  +K R    ++QY  +K L++Q GF W E+ +M++A D VW + IK     R  + 
Sbjct  367   LTKEHVKNRLRTWKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIKKNPDARILKG  426

Query  828   KSLSFYKDMSIICGNETPT  772
             + +  Y ++ II G+  P 
Sbjct  427   RVIRNYNELCIILGHCDPA  445


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 7/128 (5%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             G ME       E +++   WT  MD    ELL++Q+  GNR    F   A++  +   + 
Sbjct  463   GVMEVQETKEKEKVKNVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNE  522

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             ++      + + NR K  +KQY   K +L Q  F WD+  +MV   D  WD+YIK     
Sbjct  523   RFDLNLTKENIINRLKIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIK----K  578

Query  1399  QKFSNHLK  1376
               ++ HL+
Sbjct  579   HPYARHLR  586


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 57/108 (53%), Gaps = 1/108 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+   ++  + K+        +KNR K  +
Sbjct  162   WTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFNVKNRLKTWK  221

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KQ+   K IL    F WD +++M+  ND  W+DYI+  +  + F   +
Sbjct  222   KQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRV  269



>ref|XP_006583988.1| PREDICTED: uncharacterized protein LOC100785875 isoform X5 [Glycine 
max]
Length=792

 Score =   103 bits (257),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 101/196 (52%), Gaps = 3/196 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT-VADGRYSLSCFDIDFENEVKILE-DKIPTKDDAK  1156
             +P+    + +V+  YNEL II GH   AD   + +C ++    +  ++E  +   K+  K
Sbjct  446   NPDARILKGRVIRNYNELCIILGHCDPADSSINGACANMGMTTDDGVMEVQETKEKEKVK  505

Query  1155  KI-DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              +  W++ M+    +L++ QV  GN+L + FK  A+I  +TA N  F     K  +  R 
Sbjct  506   NVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNERFDLNLTKENIINRL  565

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
              + ++QY  +K +LSQ  F W E  +M+VA D  W + IK   Y R  R++ +  Y ++ 
Sbjct  566   KIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIKKHPYARHLRDRHIENYHELG  625

Query  798   IICGNETPTFQYGYPF  751
             +I G+E  +  +   F
Sbjct  626   MIVGDEQGSGNWSENF  641


 Score = 56.2 bits (134),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS--KQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             WT  MD     +L+ QI++GNR+   ++    A+   +   + K++     + +KNR + 
Sbjct  347   WTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLYLTKEHVKNRLRT  406

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W +YIK
Sbjct  407   WKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIK  444


 Score = 89.7 bits (221),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (48%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIP  1174
             AHP+   +R K +  Y++L  I G+  A    S +  DID        + ++ I+ +   
Sbjct  121   AHPDARIFRAKSIENYDQLCTILGNDQAIASLSDNVTDIDVTFAVDKGDPDLAIVSEIQT  180

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               +  K   W+  M+    +++++QV++G K+++ F  +A+   ++A N  FG    K  
Sbjct  181   DGNQTKNFRWTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFN  240

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             +K R    ++Q+  +K +LS  GF W    +MI+A D  W   I+     R +R +    
Sbjct  241   VKNRLKTWKKQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRVFEN  300

Query  813   YKDMSIICGN  784
             Y    II G+
Sbjct  301   YDQFCIIFGH  310


 Score = 60.8 bits (146),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT+ MD    ++L +Q++KGN+        A+   +   + KY      + +KNR K  R
Sbjct  25    WTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHIKNRLKTWR  84

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+   K +L  + F+W+++++MV  ++  W+DYIK 
Sbjct  85    KQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKA  121


 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K+ AK + W+  M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +
Sbjct  17    KEKAKYMVWTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHI  76

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    R+Q+  +K LL+  GFMW+E  +M+VA++ VW   IKA    R +R KS+  Y
Sbjct  77    KNRLKTWRKQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKAHPDARIFRAKSIENY  136

Query  810   KDMSIICGNE  781
               +  I GN+
Sbjct  137   DQLCTILGND  146


 Score = 81.6 bits (200),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/199 (25%), Positives = 93/199 (47%), Gaps = 25/199 (13%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH-----------TVADGRYSLSCFDIDFENEVKILED  1183
             H +   +R +V   Y++  IIFGH           T  +   +LS + ++++  V     
Sbjct  287   HLDARTFRGRVFENYDQFCIIFGHFYEPLHWDESGTCDETVEALSVYPVNYDISV-----  341

Query  1182  KIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGFQ  1009
                     + I W+  M+     ++++Q+++GN  K + T +  A+   + A N  F   
Sbjct  342   -------GRHIRWTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLY  394

Query  1008  YGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRN  829
               K  +K R    ++QY  +K L++Q GF W E+ +M++A D VW + IK     R  + 
Sbjct  395   LTKEHVKNRLRTWKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIKKNPDARILKG  454

Query  828   KSLSFYKDMSIICGNETPT  772
             + +  Y ++ II G+  P 
Sbjct  455   RVIRNYNELCIILGHCDPA  473


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 7/128 (5%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             G ME       E +++   WT  MD    ELL++Q+  GNR    F   A++  +   + 
Sbjct  491   GVMEVQETKEKEKVKNVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNE  550

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             ++      + + NR K  +KQY   K +L Q  F WD+  +MV   D  WD+YIK     
Sbjct  551   RFDLNLTKENIINRLKIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIK----K  606

Query  1399  QKFSNHLK  1376
               ++ HL+
Sbjct  607   HPYARHLR  614


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 57/108 (53%), Gaps = 1/108 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+   ++  + K+        +KNR K  +
Sbjct  190   WTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFNVKNRLKTWK  249

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KQ+   K IL    F WD +++M+  ND  W+DYI+  +  + F   +
Sbjct  250   KQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRV  297



>ref|XP_003529492.2| PREDICTED: uncharacterized protein LOC100785875 isoform X1 [Glycine 
max]
Length=789

 Score =   103 bits (257),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 101/196 (52%), Gaps = 3/196 (2%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHT-VADGRYSLSCFDIDFENEVKILE-DKIPTKDDAK  1156
             +P+    + +V+  YNEL II GH   AD   + +C ++    +  ++E  +   K+  K
Sbjct  443   NPDARILKGRVIRNYNELCIILGHCDPADSSINGACANMGMTTDDGVMEVQETKEKEKVK  502

Query  1155  KI-DWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRF  979
              +  W++ M+    +L++ QV  GN+L + FK  A+I  +TA N  F     K  +  R 
Sbjct  503   NVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNERFDLNLTKENIINRL  562

Query  978   NLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMS  799
              + ++QY  +K +LSQ  F W E  +M+VA D  W + IK   Y R  R++ +  Y ++ 
Sbjct  563   KIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIKKHPYARHLRDRHIENYHELG  622

Query  798   IICGNETPTFQYGYPF  751
             +I G+E  +  +   F
Sbjct  623   MIVGDEQGSGNWSENF  638


 Score = 56.2 bits (134),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 54/98 (55%), Gaps = 3/98 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS--KQAWLEMIALFSHKYKCKHDTDVLKNRYKH  1526
             WT  MD     +L+ QI++GNR+   ++    A+   +   + K++     + +KNR + 
Sbjct  344   WTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQLYLTKEHVKNRLRT  403

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              +KQY   K ++ Q+ F WD+ R+MV  ND  W +YIK
Sbjct  404   WKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIK  441


 Score = 89.7 bits (221),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 91/190 (48%), Gaps = 7/190 (4%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIP  1174
             AHP+   +R K +  Y++L  I G+  A    S +  DID        + ++ I+ +   
Sbjct  118   AHPDARIFRAKSIENYDQLCTILGNDQAIASLSDNVTDIDVTFAVDKGDPDLAIVSEIQT  177

Query  1173  TKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVV  994
               +  K   W+  M+    +++++QV++G K+++ F  +A+   ++A N  FG    K  
Sbjct  178   DGNQTKNFRWTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFN  237

Query  993   LKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSF  814
             +K R    ++Q+  +K +LS  GF W    +MI+A D  W   I+     R +R +    
Sbjct  238   VKNRLKTWKKQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRVFEN  297

Query  813   YKDMSIICGN  784
             Y    II G+
Sbjct  298   YDQFCIIFGH  307


 Score = 60.8 bits (146),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 54/97 (56%), Gaps = 1/97 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT+ MD    ++L +Q++KGN+        A+   +   + KY      + +KNR K  R
Sbjct  22    WTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHIKNRLKTWR  81

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             KQ+   K +L  + F+W+++++MV  ++  W+DYIK 
Sbjct  82    KQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKA  118


 Score = 88.6 bits (218),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 73/130 (56%), Gaps = 0/130 (0%)
 Frame = -2

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
             K+ AK + W+  M++   +++ EQV++GNK++   K  A+   +   N  +G    K  +
Sbjct  14    KEKAKYMVWTNEMDKCLTKVLAEQVKKGNKVDNILKPAAFAGALKTLNEKYGLYLTKEHI  73

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    R+Q+  +K LL+  GFMW+E  +M+VA++ VW   IKA    R +R KS+  Y
Sbjct  74    KNRLKTWRKQFGVLKELLAHSGFMWNETKKMVVADNSVWNDYIKAHPDARIFRAKSIENY  133

Query  810   KDMSIICGNE  781
               +  I GN+
Sbjct  134   DQLCTILGND  143


 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/200 (25%), Positives = 93/200 (47%), Gaps = 25/200 (13%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGH-----------TVADGRYSLSCFDIDFENEVKILE  1186
              H +   +R +V   Y++  IIFGH           T  +   +LS + ++++  V    
Sbjct  283   THLDARTFRGRVFENYDQFCIIFGHFYEPLHWDESGTCDETVEALSVYPVNYDISV----  338

Query  1185  DKIPTKDDAKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGF  1012
                      + I W+  M+     ++++Q+++GN  K + T +  A+   + A N  F  
Sbjct  339   --------GRHIRWTSDMDSCLSAILVQQIKQGNRSKFDYTLRPDAFEASVLAINEKFQL  390

Query  1011  QYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYR  832
                K  +K R    ++QY  +K L++Q GF W E+ +M++A D VW + IK     R  +
Sbjct  391   YLTKEHVKNRLRTWKKQYAILKELMTQSGFEWDEKRKMVIANDSVWTEYIKKNPDARILK  450

Query  831   NKSLSFYKDMSIICGNETPT  772
              + +  Y ++ II G+  P 
Sbjct  451   GRVIRNYNELCIILGHCDPA  470


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 7/128 (5%)
 Frame = -1

Query  1750  GAMEDDSCSSSETLRS--NWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSH  1577
             G ME       E +++   WT  MD    ELL++Q+  GNR    F   A++  +   + 
Sbjct  488   GVMEVQETKEKEKVKNVVTWTDEMDHCLTELLVNQVMLGNRLEKFFKTSAYIAALTALNE  547

Query  1576  KYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFD  1400
             ++      + + NR K  +KQY   K +L Q  F WD+  +MV   D  WD+YIK     
Sbjct  548   RFDLNLTKENIINRLKIWKKQYDVLKEMLSQGRFEWDEGCKMVVATDLAWDEYIK----K  603

Query  1399  QKFSNHLK  1376
               ++ HL+
Sbjct  604   HPYARHLR  611


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 57/108 (53%), Gaps = 1/108 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+   ++  + K+        +KNR K  +
Sbjct  187   WTVAMDHWLGKILVDQVRKGLKVDKVFLTEAYNTAVSAVNAKFGLHLTKFNVKNRLKTWK  246

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHL  1379
             KQ+   K IL    F WD +++M+  ND  W+DYI+  +  + F   +
Sbjct  247   KQFEQLKEILSHTGFKWDGTKKMIIANDSTWNDYIRTHLDARTFRGRV  294



>ref|XP_004513956.1| PREDICTED: uncharacterized protein LOC101500085 isoform X2 [Cicer 
arietinum]
Length=814

 Score = 95.5 bits (236),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 93/196 (47%), Gaps = 6/196 (3%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGH------TVADGRYSLSCFDIDFENEVKILEDKIPTK  1168
             +P+    + +V+  Y EL II GH        +     ++  D   E +         T 
Sbjct  446   NPDARILKGRVIRNYEELCIIIGHLDPPGMNTSRANRGMTTDDNVMEVQETNYHGTDNTT  505

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             +  K + W++ M+    +L+++QV  GNKL + FK  A+I  +   N  F        +K
Sbjct  506   EKVKSVTWTDEMDHCLTELLVKQVMLGNKLEKNFKTSAYIATLAVLNERFDLNLTIENIK  565

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
             +R    ++QY  +K +LS+ GF W E  +++VA D  W + IK  +  R  R+K +  Y 
Sbjct  566   SRLRTWKKQYGLLKEMLSRGGFQWDEGRKVVVATDSTWNEYIKKHRDARHLRDKQIENYN  625

Query  807   DMSIICGNETPTFQYG  760
             ++ +I GN+  +  + 
Sbjct  626   ELGLIVGNDEASGNWS  641


 Score = 63.2 bits (152),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 3/99 (3%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFS-KQAWLEMIAL-FSHKYKCKHDTDVLKNRYKH  1526
             WT  MD    E+L+ QI+ GNR+      K A LE   L  + K+K     D +KNR K 
Sbjct  347   WTSDMDSCLSEILVQQIKLGNRSKFDHKLKPAALEAAVLAINDKFKLYMLKDHIKNRLKT  406

Query  1525  LRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              +KQY   K +L Q+ F WD++R+MV  +D  W++YIK+
Sbjct  407   WKKQYDTLKELLRQSGFEWDENRKMVIADDSVWNEYIKI  445


 Score = 93.2 bits (230),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 94/188 (50%), Gaps = 7/188 (4%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDF-------ENEVKILEDKIPT  1171
             HP+ + +R K +  Y++L  + G+  +  R S +  +ID        + ++ IL +    
Sbjct  119   HPDAKIFRAKSIENYDKLCFVLGNDQSIARLSDNVTEIDVNFTVDNGDPDLVILSETQTD  178

Query  1170  KDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVL  991
              +  K + W+E M+    +++++QV++G K++  F+ +A+   ++A N  FG    K  +
Sbjct  179   GNLTKNLRWTEEMDHWLGKILVDQVRKGLKIDNVFQTEAYDKAVSAMNAKFGLHLTKFNI  238

Query  990   KTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFY  811
             K R    ++QY   K +L   GF W E  +MI+A D  W + I+     R YR + L  Y
Sbjct  239   KNRLKTWKKQYEIAKEILCHAGFRWDETKKMIIANDSTWIEYIRTHPDARTYRARVLENY  298

Query  810   KDMSIICG  787
             +    I G
Sbjct  299   EQFCSIFG  306


 Score = 61.2 bits (147),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 29/96 (30%), Positives = 51/96 (53%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD+   ++L++Q++KGN+         +   +   + K+        +KNR K  R
Sbjct  22    WTAEMDNCLTDVLVEQVEKGNKVDNILKPAVFAAALKALNEKFGMHLTKGHIKNRLKTWR  81

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQ+   K +L    F+W+ +++MV  ND  W+DYI+
Sbjct  82    KQFAVLKELLAHRGFVWNKTQKMVVANDSVWNDYIR  117


 Score = 84.0 bits (206),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 93/191 (49%), Gaps = 6/191 (3%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGH--TVADGRYSLSCFD-IDFENEVKILEDKIPTKDD  1162
              HP+   YR +V+  Y +   IFGH         S+ C +  +FE+   +  D    KD 
Sbjct  283   THPDARTYRARVLENYEQFCSIFGHYNEPLHPSDSIPCDEPSEFESICPVNYDS-NLKDV  341

Query  1161  AKKIDWSETMEQHFIQLMLEQVQEGN--KLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
              K++ W+  M+    +++++Q++ GN  K +   K  A    + A N  F     K  +K
Sbjct  342   VKQMRWTSDMDSCLSEILVQQIKLGNRSKFDHKLKPAALEAAVLAINDKFKLYMLKDHIK  401

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R    ++QY  +K LL Q GF W E  +M++A+D VW + IK     R  + + +  Y+
Sbjct  402   NRLKTWKKQYDTLKELLRQSGFEWDENRKMVIADDSVWNEYIKINPDARILKGRVIRNYE  461

Query  807   DMSIICGNETP  775
             ++ II G+  P
Sbjct  462   ELCIIIGHLDP  472


 Score = 59.7 bits (143),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 54/96 (56%), Gaps = 1/96 (1%)
 Frame = -1

Query  1699  WTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLR  1520
             WT  MD +  ++L+DQ++KG +    F  +A+ + ++  + K+        +KNR K  +
Sbjct  187   WTEEMDHWLGKILVDQVRKGLKIDNVFQTEAYDKAVSAMNAKFGLHLTKFNIKNRLKTWK  246

Query  1519  KQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
             KQY   K IL    F WD++++M+  ND  W +YI+
Sbjct  247   KQYEIAKEILCHAGFRWDETKKMIIANDSTWIEYIR  282


 Score = 85.1 bits (209),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 80/167 (48%), Gaps = 8/167 (5%)
 Frame = -2

Query  1167  DDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLK  988
             D  K I W+  M+     +++EQV++GNK++   K   +   + A N  FG    K  +K
Sbjct  15    DRGKYIIWTAEMDNCLTDVLVEQVEKGNKVDNILKPAVFAAALKALNEKFGMHLTKGHIK  74

Query  987   TRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYK  808
              R    R+Q+  +K LL+  GF+W++  +M+VA D VW   I+     + +R KS+  Y 
Sbjct  75    NRLKTWRKQFAVLKELLAHRGFVWNKTQKMVVANDSVWNDYIREHPDAKIFRAKSIENYD  134

Query  807   DMSIICGNETPTFQYGYPF--------VKAGEFCVPIIQTTGKEGNL  691
              +  + GN+    +             V  G+  + I+  T  +GNL
Sbjct  135   KLCFVLGNDQSIARLSDNVTEIDVNFTVDNGDPDLVILSETQTDGNL  181


 Score = 67.0 bits (162),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 75/151 (50%), Gaps = 19/151 (13%)
 Frame = -1

Query  1822  EKCGLIPRL-PYSYTSSRLSALKNRGAMEDDSC------------SSSETLRS-NWTHVM  1685
             E C +I  L P    +SR     NRG   DD+             +++E ++S  WT  M
Sbjct  462   ELCIIIGHLDPPGMNTSR----ANRGMTTDDNVMEVQETNYHGTDNTTEKVKSVTWTDEM  517

Query  1684  DDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHN  1505
             D    ELL+ Q+  GN+   +F   A++  +A+ + ++      + +K+R +  +KQY  
Sbjct  518   DHCLTELLVKQVMLGNKLEKNFKTSAYIATLAVLNERFDLNLTIENIKSRLRTWKKQYGL  577

Query  1504  TK-ILEQNEFIWDDSRQMVTGNDEKWDDYIK  1415
              K +L +  F WD+ R++V   D  W++YIK
Sbjct  578   LKEMLSRGGFQWDEGRKVVVATDSTWNEYIK  608



>ref|XP_010664794.1| PREDICTED: uncharacterized protein LOC100259109 [Vitis vinifera]
Length=495

 Score = 80.9 bits (198),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 92/200 (46%), Gaps = 20/200 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAK--  1156
             HPE+E  R K    Y +L  IF    +DG+ + +              D +P++D +K  
Sbjct  164   HPEVESIRFKGCLVYEQLHGIFSDLESDGKSAFA---------ATTQMDDLPSQDQSKLD  214

Query  1155  --KIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTR  982
               +  W  ++++ F+ L++ +    N+ N     KAW  +   FN   G  + +  L+  
Sbjct  215   QSRAKWMPSLDKIFVDLLVRK----NQQNCVSNKKAWKGIREEFNKQTGLNFEEQQLRNH  270

Query  981   FNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDM  802
              ++LRR Y  +  LL Q GF W E   M++A+ + W+  IKA       RNK    +K +
Sbjct  271   QSVLRRWYNNINSLLYQAGFSWDESKHMVMADGKTWENHIKAYPECETIRNKECPIFKQL  330

Query  801   SII-CGNETPT--FQYGYPF  751
              ++  G+E      Q G+ F
Sbjct  331   CLLFSGSEAEGRYVQSGHDF  350


 Score = 77.4 bits (189),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 13/123 (11%)
 Frame = -1

Query  1765  ALKNRGAM-----EDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWL  1601
             AL N G M     ED S       R+ W+  ++  F+EL+L+Q+ +GNR++ SFSK+AW 
Sbjct  47    ALSNSGEMMHQMDEDQS-------RAKWSTSLEKIFVELMLEQVLQGNRSNNSFSKKAWN  99

Query  1600  EMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDD  1424
              +   F+ +         LKNR+  LR+ Y++ K +L+Q+ F WD+SR +    DE W  
Sbjct  100   YICDEFNRQTGLNFHKQQLKNRHGVLRRLYNSLKLLLDQDGFSWDESRGLAIAEDEVWAK  159

Query  1423  YIK  1415
             YI+
Sbjct  160   YIE  162


 Score =   122 bits (306),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/180 (37%), Positives = 95/180 (53%), Gaps = 10/180 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
             AHPE E  R K  P Y +L  IF  + ADG+ +LS       N  +++       +D  +
Sbjct  15    AHPEAEAIRKKGCPIYEQLCTIFSDSEADGKCALS-------NSGEMMH---QMDEDQSR  64

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               WS ++E+ F++LMLEQV +GN+ N +F  KAW ++   FN   G  + K  LK R  +
Sbjct  65    AKWSTSLEKIFVELMLEQVLQGNRSNNSFSKKAWNYICDEFNRQTGLNFHKQQLKNRHGV  124

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRR Y ++K LL QDGF W E   + +AED VW K I+        R K    Y+ +  I
Sbjct  125   LRRLYNSLKLLLDQDGFSWDESRGLAIAEDEVWAKYIEEHPEVESIRFKGCLVYEQLHGI  184


 Score = 48.9 bits (115),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/100 (28%), Positives = 53/100 (53%), Gaps = 5/100 (5%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   +D  F++LL+    + N+ +   +K+AW  +   F+ +     +   L+N   
Sbjct  217   RAKWMPSLDKIFVDLLV----RKNQQNCVSNKKAWKGIREEFNKQTGLNFEEQQLRNHQS  272

Query  1528  HLRKQYHN-TKILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
              LR+ Y+N   +L Q  F WD+S+ MV  + + W+++IK 
Sbjct  273   VLRRWYNNINSLLYQAGFSWDESKHMVMADGKTWENHIKA  312


 Score = 38.1 bits (87),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 16/45 (36%), Positives = 27/45 (60%), Gaps = 0/45 (0%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEV  1198
             A+PE E  R K  P + +L ++F  + A+GRY  S  D + ++E+
Sbjct  312   AYPECETIRNKECPIFKQLCLLFSGSEAEGRYVQSGHDFELDHEI  356



>ref|XP_009144586.1| PREDICTED: uncharacterized protein LOC103868226 [Brassica rapa]
Length=418

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 102/183 (56%), Gaps = 3/183 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
              HP    +R K +P+Y +L +I+   +++ +   +  + D   + ++ E    +     +
Sbjct  113   GHPHSRSFRIKSIPFYKDLCLIYSDGMSEQKAPENITEGD---DNRLCESAKGSGISRCR  169

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W   M+++FI LMLEQ + GN++   F+ +AW  M+  FN  F   +   VLK R+  
Sbjct  170   TTWHPPMDRYFIGLMLEQARSGNQIEGAFRKQAWTEMVKLFNAKFDSSFTVDVLKNRYKT  229

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRRQY A+K LL  DGF W +   M+ A+D VW+  IKA +  R++  + + +YKD+ ++
Sbjct  230   LRRQYNAIKSLLRSDGFGWDDERHMVTADDNVWQDYIKAHRDARQFMTRPIPYYKDLCVV  289

Query  792   CGN  784
             CG+
Sbjct  290   CGD  292


 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+Q+FI+LMLEQV+ GN+ +   F  +AW  M +AF   F F YGK VLK R   L
Sbjct  16    WTPEMDQYFIELMLEQVKRGNRFDDHLFSKRAWKLMSSAFTARFKFPYGKDVLKNRHKTL  75

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  + +VK LL +DGF W ER QM+VA+  VW   +K   + R +R KS+ FYKD+ +I
Sbjct  76    RNLFRSVKSLLREDGFSWDERTQMVVADHCVWDVFLKGHPHSRSFRIKSIPFYKDLCLI  134


 Score =   104 bits (260),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI L+L+Q + GN+   +F KQAW EM+ LF+ K+      DVLKNRYK
Sbjct  169   RTTWHPPMDRYFIGLMLEQARSGNQIEGAFRKQAWTEMVKLFNAKFDSSFTVDVLKNRYK  228

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILV  1352
              LR+QY+  K +L  + F WDD R MVT +D  W DYIK     ++F    + I +Y  +
Sbjct  229   TLRRQYNAIKSLLRSDGFGWDDERHMVTADDNVWQDYIKAHRDARQFMT--RPIPYYKDL  286

Query  1351  SFVVC  1337
               VVC
Sbjct  287   C-VVC  290


 Score = 89.4 bits (220),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             S +E LR+ WT  MD YFIEL+L+Q+++GNR     FSK+AW  M + F+ ++K  +  D
Sbjct  7     SDNERLRTVWTPEMDQYFIELMLEQVKRGNRFDDHLFSKRAWKLMSSAFTARFKFPYGKD  66

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  + + K +L ++ F WD+  QMV  +   WD ++K     + F   +K 
Sbjct  67    VLKNRHKTLRNLFRSVKSLLREDGFSWDERTQMVVADHCVWDVFLKGHPHSRSF--RIKS  124

Query  1372  IAHY  1361
             I  Y
Sbjct  125   IPFY  128



>ref|XP_008367355.1| PREDICTED: uncharacterized protein LOC103430986 [Malus domestica]
Length=127

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 84/112 (75%), Gaps = 1/112 (1%)
 Frame = -1

Query  1744  MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKC  1565
             M   S ++S+ +R+NWT   D++FI+L+L+Q+ KGN+T   F KQAW +MI LF++++  
Sbjct  1     MYAGSSTTSDHVRANWTPSQDNFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGF  60

Query  1564  KHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKV  1412
             K+DTD+LKNRYK LRKQY   K +++Q  F WD+++QM+T +D+ W++YIK 
Sbjct  61    KYDTDILKNRYKRLRKQYSEMKSLVDQGNFRWDETQQMITADDBVWNNYIKA  112


 Score =   105 bits (261),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/117 (44%), Positives = 66/117 (56%), Gaps = 0/117 (0%)
 Frame = -2

Query  1176  PTKDDAKKIDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKV  997
              T  D  + +W+ + +  FI LMLEQV +GNK    F+ +AW  MI  FN  FGF+Y   
Sbjct  6     STTSDHVRANWTPSQDNFFIDLMLEQVSKGNKTGHGFRKQAWADMIVLFNNEFGFKYDTD  65

Query  996   VLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNK  826
             +LK R+  LR+QY  +K L+ Q  F W E  QMI A+D VW   IKA      YR K
Sbjct  66    ILKNRYKRLRKQYSEMKSLVDQGNFRWDETQQMITADDBVWNNYIKAHPEMXXYRTK  122



>emb|CDX97259.1| BnaA02g20500D [Brassica napus]
Length=476

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 102/183 (56%), Gaps = 3/183 (2%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
              HP    +R K +P+Y +L +I+   +++ +   +  + D   + ++ E    +     +
Sbjct  171   GHPHSRSFRIKSIPFYKDLCLIYSDGMSEQKAPENITEGD---DNRLCESAKGSGISRCR  227

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W   M+++FI LMLEQ + GN++   F+ +AW  M+  FN  F   +   VLK R+  
Sbjct  228   TTWHPPMDRYFIGLMLEQARSGNQIEGAFRKQAWTEMVKLFNAKFDSSFTVDVLKNRYKT  287

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRRQY A+K LL  DGF W +   M+ A+D VW+  IKA +  R++  + + +YKD+ ++
Sbjct  288   LRRQYNAIKSLLRSDGFGWDDERHMVTADDNVWQDYIKAHRDARQFMTRPIPYYKDLCVV  347

Query  792   CGN  784
             CG+
Sbjct  348   CGD  350


 Score =   115 bits (289),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 76/119 (64%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+Q+FI+LMLEQV+ GN+ +   F  +AW  M +AF   F F YGK VLK R   L
Sbjct  74    WTPEMDQYFIELMLEQVKRGNRFDDHLFSKRAWKLMSSAFTARFKFPYGKDVLKNRHKTL  133

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  + +VK LL +DGF W ER QM+VA+  VW   +K   + R +R KS+ FYKD+ +I
Sbjct  134   RNLFRSVKSLLREDGFSWDERTQMVVADHCVWDVFLKGHPHSRSFRIKSIPFYKDLCLI  192


 Score =   105 bits (261),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 75/125 (60%), Gaps = 4/125 (3%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI L+L+Q + GN+   +F KQAW EM+ LF+ K+      DVLKNRYK
Sbjct  227   RTTWHPPMDRYFIGLMLEQARSGNQIEGAFRKQAWTEMVKLFNAKFDSSFTVDVLKNRYK  286

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHYILV  1352
              LR+QY+  K +L  + F WDD R MVT +D  W DYIK     ++F    + I +Y  +
Sbjct  287   TLRRQYNAIKSLLRSDGFGWDDERHMVTADDNVWQDYIKAHRDARQFMT--RPIPYYKDL  344

Query  1351  SFVVC  1337
               VVC
Sbjct  345   C-VVC  348


 Score = 89.7 bits (221),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 75/124 (60%), Gaps = 4/124 (3%)
 Frame = -1

Query  1726  SSSETLRSNWTHVMDDYFIELLLDQIQKGNRTSTS-FSKQAWLEMIALFSHKYKCKHDTD  1550
             S +E LR+ WT  MD YFIEL+L+Q+++GNR     FSK+AW  M + F+ ++K  +  D
Sbjct  65    SDNERLRTVWTPEMDQYFIELMLEQVKRGNRFDDHLFSKRAWKLMSSAFTARFKFPYGKD  124

Query  1549  VLKNRYKHLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKFSNHLKI  1373
             VLKNR+K LR  + + K +L ++ F WD+  QMV  +   WD ++K     + F   +K 
Sbjct  125   VLKNRHKTLRNLFRSVKSLLREDGFSWDERTQMVVADHCVWDVFLKGHPHSRSF--RIKS  182

Query  1372  IAHY  1361
             I  Y
Sbjct  183   IPFY  186



>emb|CDY01920.1| BnaC02g28070D [Brassica napus]
Length=486

 Score =   129 bits (324),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 138/272 (51%), Gaps = 17/272 (6%)
 Frame = -2

Query  1332  AHPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDKIPTKDDAKK  1153
              HP    +R K +P+Y +L +I+   +++ +   +  + D   + ++ E    +     +
Sbjct  182   GHPHSRSFRIKSIPFYKDLCLIYSDGMSEQKAPENITEGD---DNRLCESTKGSGISRCR  238

Query  1152  IDWSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNL  973
               W   M+++FI LML+Q + GN++   F+ +AW  M+  FN  F   +   VLK R+  
Sbjct  239   TTWHPPMDRYFIGLMLDQARSGNQIEGAFRKQAWTEMVKLFNAKFDSSFTVDVLKNRYKT  298

Query  972   LRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             LRRQY A+K LL  DGF W +   M+ A+D VW+  IKA +  R++  + + +YKD+ ++
Sbjct  299   LRRQYNAIKSLLRSDGFCWDDERHMVTADDNVWQDYIKAHRDARQFMTRPIPYYKDLCVV  358

Query  792   CGN--ETPTFQYGYPFVKAGEF--CVPIIQTTGKEGNLreveeivedddereEKKCRYDT  625
             CG+  E+  F     F    EF      + ++G+E ++         +    E K + D 
Sbjct  359   CGDSEESDCFVATDWFDPEAEFHEGTTDLSSSGEEQDI---------NSLFCEPKNKRDH  409

Query  624   KEPKEPCKGPSEINEETEIEIGMEDAMQEMVA  529
             +    P K      +ET+  +G+EDA++ + A
Sbjct  410   QNGTSPVKLKKPRVDETKA-MGIEDAVEAIQA  440


 Score =   116 bits (290),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 77/119 (65%), Gaps = 1/119 (1%)
 Frame = -2

Query  1146  WSETMEQHFIQLMLEQVQEGNKLN-RTFKNKAWIHMITAFNTAFGFQYGKVVLKTRFNLL  970
             W+  M+Q+FI+LMLEQV+ GN+ +   F  +AW  M +AF   F F YGK VLK R   L
Sbjct  85    WTPEMDQYFIELMLEQVKRGNRFDDHLFSKRAWKLMSSAFTARFKFPYGKDVLKNRHKTL  144

Query  969   RRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRYRNKSLSFYKDMSII  793
             R  + +VK LL +DGF W ER QM+VA++ VW   +K   + R +R KS+ FYKD+ +I
Sbjct  145   RNLFRSVKSLLREDGFSWDERTQMVVADNCVWDVYLKGHPHSRSFRIKSIPFYKDLCLI  203


 Score =   107 bits (267),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 1/107 (1%)
 Frame = -1

Query  1708  RSNWTHVMDDYFIELLLDQIQKGNRTSTSFSKQAWLEMIALFSHKYKCKHDTDVLKNRYK  1529
             R+ W   MD YFI L+LDQ + GN+   +F KQAW EM+ LF+ K+      DVLKNRYK
Sbjct  238   RTTWHPPMDRYFIGLMLDQARSGNQIEGAFRKQAWTEMVKLFNAKFDSSFTVDVLKNRYK  297

Query  1528  HLRKQYHNTK-ILEQNEFIWDDSRQMVTGNDEKWDDYIKVQMFDQKF  1391
              LR+QY+  K +L  + F WDD R MVT +D  W DYIK     ++F
Sbjct  298   TLRRQYNAIKSLLRSDGFCWDDERHMVTADDNVWQDYIKAHRDARQF  344


 Score = 92.0 bits (227),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 5/153 (3%)
 Frame = -1

Query  1810  LIPRLPYSYTSSRLSALKNRGA-MEDDSCSSSETLRSNWTHVMDDYFIELLLDQIQKGNR  1634
             LIP+      S  L      GA M     S +E LR+ WT  MD YFIEL+L+Q+++GNR
Sbjct  47    LIPKSSPISLSLSLRRSSLTGAEMSTLGESENERLRTVWTPEMDQYFIELMLEQVKRGNR  106

Query  1633  TSTS-FSKQAWLEMIALFSHKYKCKHDTDVLKNRYKHLRKQYHNTK-ILEQNEFIWDDSR  1460
                  FSK+AW  M + F+ ++K  +  DVLKNR+K LR  + + K +L ++ F WD+  
Sbjct  107   FDDHLFSKRAWKLMSSAFTARFKFPYGKDVLKNRHKTLRNLFRSVKSLLREDGFSWDERT  166

Query  1459  QMVTGNDEKWDDYIKVQMFDQKFSNHLKIIAHY  1361
             QMV  ++  WD Y+K     + F   +K I  Y
Sbjct  167   QMVVADNCVWDVYLKGHPHSRSF--RIKSIPFY  197



>ref|XP_006289855.1| hypothetical protein CARUB_v10003465mg [Capsella rubella]
 gb|EOA22753.1| hypothetical protein CARUB_v10003465mg [Capsella rubella]
Length=441

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/197 (33%), Positives = 102/197 (52%), Gaps = 19/197 (10%)
 Frame = -2

Query  1329  HPEMEPYRTKVVPYYNELRIIFGHTVADGRYSLSCFDIDFENEVKILEDK----------  1180
             HP++  +R K +PYY +L +I+     DG       + + E E  I ED+          
Sbjct  114   HPDLRSFRIKPIPYYKDLCLIY----TDGMSEHKAEENNTEGETLIQEDEGYNRICESST  169

Query  1179  IPTKDDAKKID-----WSETMEQHFIQLMLEQVQEGNKLNRTFKNKAWIHMITAFNTAFG  1015
             + +      I      W   M+++FI LML Q   GN++   F+ +AW  M   FN  F 
Sbjct  170   VTSNSKGGNITRCRTTWHPPMDRYFIDLMLGQAGRGNQIEGVFRKQAWTEMANLFNAKFE  229

Query  1014  FQYGKVVLKTRFNLLRRQYFAVKYLLSQDGFMWHERHQMIVAEDRVWKKVIKAQQYFRRY  835
               +   VLK R+  LRRQ+ A+K LL  DGF W +  QM+ A+D VW+  IKA +  R++
Sbjct  23