BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21700_g3_i1 len=270 path=[1722:0-269]

Length=270
                                                                      Score     E

ref|XP_010665638.1|  PREDICTED: protein SRG1-like                     89.4    4e-19   
emb|CDP21916.1|  unnamed protein product                              85.5    2e-18   
ref|XP_002519761.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  87.0    3e-18   Ricinus communis
ref|XP_011045559.1|  PREDICTED: protein SRG1                          86.7    4e-18   
emb|CDP20896.1|  unnamed protein product                              85.1    7e-18   
emb|CDP20118.1|  unnamed protein product                              83.2    2e-17   
ref|XP_010273388.1|  PREDICTED: protein SRG1-like                     84.0    4e-17   
ref|XP_006355571.1|  PREDICTED: protein SRG1-like                     83.6    4e-17   
emb|CDP20503.1|  unnamed protein product                              83.6    4e-17   
ref|XP_007022032.1|  Senescence-related gene 1                        84.0    5e-17   
gb|KEH38521.1|  2OG-Fe(II) oxygenase family oxidoreductase            81.3    8e-17   
ref|XP_002300453.1|  SENESCENCE-RELATED GENE 1 family protein         82.8    9e-17   Populus trichocarpa [western balsam poplar]
emb|CDP14579.1|  unnamed protein product                              82.0    2e-16   
gb|KEH38519.1|  2OG-Fe(II) oxygenase family oxidoreductase            81.3    4e-16   
ref|XP_006442336.1|  hypothetical protein CICLE_v10024324mg           79.0    4e-16   
ref|XP_002300451.1|  SENESCENCE-RELATED GENE 1 family protein         81.3    4e-16   Populus trichocarpa [western balsam poplar]
gb|KDP21184.1|  hypothetical protein JCGZ_21655                       81.3    4e-16   
gb|KDO41542.1|  hypothetical protein CISIN_1g030400mg                 79.0    5e-16   
gb|KEH38520.1|  2OG-Fe(II) oxygenase family oxidoreductase            80.1    5e-16   
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2          80.5    6e-16   
ref|XP_007025217.1|  Senescence-related gene 1                        80.9    6e-16   
ref|XP_010057216.1|  PREDICTED: protein SRG1-like isoform X1          80.5    6e-16   
ref|XP_006442330.1|  hypothetical protein CICLE_v10020843mg           80.5    7e-16   
emb|CDP17938.1|  unnamed protein product                              78.6    8e-16   
gb|KHN36942.1|  Protein SRG1                                          80.1    8e-16   
ref|XP_003543178.1|  PREDICTED: protein SRG1                          80.1    8e-16   
ref|XP_007149499.1|  hypothetical protein PHAVU_005G075500g           79.3    1e-15   
ref|XP_010057211.1|  PREDICTED: protein SRG1-like                     79.7    1e-15   
ref|XP_006442335.1|  hypothetical protein CICLE_v10020844mg           79.7    1e-15   
ref|XP_003638414.1|  SRG1-like protein                                80.1    1e-15   
ref|XP_008463796.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  79.3    2e-15   
ref|XP_004488689.1|  PREDICTED: protein SRG1-like                     79.3    2e-15   
ref|XP_010041379.1|  PREDICTED: protein SRG1-like                     78.6    2e-15   
ref|XP_006477806.1|  PREDICTED: protein SRG1-like                     79.0    2e-15   
ref|XP_002269087.1|  PREDICTED: protein SRG1                          79.0    3e-15   Vitis vinifera
ref|XP_006477891.1|  PREDICTED: protein SRG1-like                     78.6    3e-15   
ref|XP_003546739.1|  PREDICTED: protein SRG1                          78.6    3e-15   
ref|XP_009610877.1|  PREDICTED: protein SRG1-like                     78.6    3e-15   
ref|XP_011085296.1|  PREDICTED: protein SRG1-like                     78.2    4e-15   
ref|XP_009757227.1|  PREDICTED: protein SRG1-like isoform X2          78.6    4e-15   
ref|XP_002519766.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  78.2    5e-15   Ricinus communis
ref|XP_011045561.1|  PREDICTED: protein SRG1-like                     78.2    5e-15   
ref|XP_009757223.1|  PREDICTED: protein SRG1-like isoform X1          78.2    5e-15   
ref|XP_006428589.1|  hypothetical protein CICLE_v10012028mg           77.0    5e-15   
ref|XP_007025218.1|  Senescence-related gene 1, putative              77.8    6e-15   
ref|XP_006477808.1|  PREDICTED: protein SRG1-like                     77.8    6e-15   
emb|CBI30803.3|  unnamed protein product                              76.3    6e-15   
ref|XP_007025223.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  77.4    6e-15   
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  77.8    7e-15   
ref|XP_007022033.1|  Senescence-related gene 1                        79.3    7e-15   
ref|XP_006369971.1|  hypothetical protein POPTR_0001s36510g           75.9    7e-15   
gb|KDO54061.1|  hypothetical protein CISIN_1g018035mg                 77.4    8e-15   
ref|XP_004488976.1|  PREDICTED: protein SRG1-like                     77.4    8e-15   
gb|KDO41540.1|  hypothetical protein CISIN_1g039640mg                 75.5    9e-15   
gb|KDP25011.1|  hypothetical protein JCGZ_23994                       77.0    9e-15   
ref|XP_010057213.1|  PREDICTED: protein SRG1-like isoform X1          77.4    9e-15   
gb|KDP47183.1|  hypothetical protein JCGZ_25692                       77.0    1e-14   
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2          77.4    1e-14   
ref|XP_009772021.1|  PREDICTED: protein SRG1-like                     77.0    1e-14   
ref|XP_006428590.1|  hypothetical protein CICLE_v10012028mg           77.0    1e-14   
ref|XP_006477892.1|  PREDICTED: protein SRG1-like                     75.5    2e-14   
ref|XP_006477893.1|  PREDICTED: protein SRG1-like                     75.9    2e-14   
ref|XP_007022030.1|  Senescence-related gene 1                        76.6    2e-14   
ref|XP_010273386.1|  PREDICTED: protein SRG1-like                     76.6    2e-14   
gb|KDO52129.1|  hypothetical protein CISIN_1g018426mg                 76.3    2e-14   
gb|KHG06473.1|  Protein SRG1 -like protein                            76.6    2e-14   
ref|XP_006442328.1|  hypothetical protein CICLE_v10020825mg           76.3    2e-14   
ref|XP_002271080.1|  PREDICTED: protein SRG1                          76.3    2e-14   Vitis vinifera
ref|XP_006442333.1|  hypothetical protein CICLE_v10020840mg           76.3    3e-14   
gb|KDO52127.1|  hypothetical protein CISIN_1g045260mg                 75.9    3e-14   
ref|XP_004233001.1|  PREDICTED: protein SRG1-like                     75.9    3e-14   
ref|XP_006477804.1|  PREDICTED: protein SRG1-like                     75.9    3e-14   
gb|KDP32875.1|  hypothetical protein JCGZ_12167                       75.9    3e-14   
ref|XP_006439037.1|  hypothetical protein CICLE_v10031934mg           75.9    4e-14   
ref|XP_011085300.1|  PREDICTED: protein SRG1-like                     75.9    4e-14   
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                     75.9    4e-14   
ref|XP_004232992.1|  PREDICTED: protein SRG1                          75.9    4e-14   
gb|KDP22220.1|  hypothetical protein JCGZ_26051                       75.5    4e-14   
ref|XP_006442325.1|  hypothetical protein CICLE_v10020838mg           75.5    4e-14   
ref|XP_004295415.1|  PREDICTED: protein SRG1-like                     75.5    4e-14   
gb|KCW74252.1|  hypothetical protein EUGRSUZ_E02895                   73.9    5e-14   
ref|XP_009610870.1|  PREDICTED: protein SRG1-like                     75.5    5e-14   
ref|XP_011085301.1|  PREDICTED: protein SRG1-like                     75.1    5e-14   
ref|XP_004233005.2|  PREDICTED: codeine O-demethylase-like            75.5    5e-14   
ref|XP_004301702.1|  PREDICTED: S-norcoclaurine synthase 1-like       75.1    6e-14   
ref|XP_010057212.1|  PREDICTED: protein SRG1-like                     75.1    7e-14   
ref|XP_006355623.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  74.7    8e-14   
ref|XP_008378981.1|  PREDICTED: protein SRG1-like                     73.2    8e-14   
ref|XP_006482819.1|  PREDICTED: protein SRG1-like                     74.7    9e-14   
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                     74.7    9e-14   
ref|NP_001240998.1|  uncharacterized protein LOC100786574             74.7    9e-14   
ref|XP_009799621.1|  PREDICTED: protein SRG1-like isoform X2          73.2    1e-13   
ref|XP_004233861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  76.3    1e-13   
ref|XP_003540518.1|  PREDICTED: protein SRG1-like                     74.3    1e-13   
ref|XP_006355625.1|  PREDICTED: protein SRG1-like                     74.3    1e-13   
ref|XP_010057208.1|  PREDICTED: protein SRG1-like                     74.3    1e-13   
ref|XP_010272749.1|  PREDICTED: protein SRG1-like                     74.3    1e-13   
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                     74.3    1e-13   
ref|XP_009610868.1|  PREDICTED: protein SRG1-like isoform X1          74.3    1e-13   
ref|XP_003638391.1|  Protein SRG1                                     71.2    2e-13   
ref|XP_007025221.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  74.7    2e-13   
gb|AGL52586.1|  2-oxoglutarate/Fe2+-dependent dioxygenase             73.9    2e-13   
ref|XP_004134919.1|  PREDICTED: protein SRG1-like                     73.6    2e-13   
ref|XP_004146011.1|  PREDICTED: protein SRG1-like                     73.6    2e-13   
ref|XP_009799618.1|  PREDICTED: protein SRG1-like isoform X1          73.6    2e-13   
gb|EYU28157.1|  hypothetical protein MIMGU_mgv1a016759mg              70.5    2e-13   
ref|XP_009382430.1|  PREDICTED: S-norcoclaurine synthase 1-like       73.6    2e-13   
gb|KHG25230.1|  Protein SRG1 -like protein                            73.2    3e-13   
ref|XP_011085299.1|  PREDICTED: protein SRG1-like                     73.2    3e-13   
ref|XP_002528471.1|  Naringenin,2-oxoglutarate 3-dioxygenase, put...  72.8    3e-13   Ricinus communis
ref|XP_011046705.1|  PREDICTED: protein SRG1-like                     69.7    3e-13   
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                     72.8    4e-13   
ref|XP_009382429.1|  PREDICTED: S-norcoclaurine synthase 1-like       72.8    4e-13   
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1          73.2    4e-13   
ref|XP_011005822.1|  PREDICTED: protein SRG1-like                     72.8    4e-13   
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                     72.8    4e-13   
ref|XP_007149498.1|  hypothetical protein PHAVU_005G075400g           72.8    4e-13   
ref|XP_009382428.1|  PREDICTED: S-norcoclaurine synthase 1-like       72.8    4e-13   
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                     72.8    5e-13   
gb|KEH19984.1|  flavonol synthase/flavanone 3-hydroxylase             72.8    5e-13   
ref|XP_007214442.1|  hypothetical protein PRUPE_ppa024861mg           72.8    5e-13   
ref|XP_010057196.1|  PREDICTED: protein SRG1-like isoform X2          71.6    6e-13   
ref|XP_006355570.1|  PREDICTED: protein SRG1-like                     72.4    6e-13   
gb|KEH19983.1|  flavonol synthase/flavanone 3-hydroxylase             72.4    6e-13   
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                     72.4    8e-13   
gb|KCW74247.1|  hypothetical protein EUGRSUZ_E02887                   71.2    9e-13   
ref|XP_002314207.1|  hypothetical protein POPTR_0009s03100g           72.0    9e-13   Populus trichocarpa [western balsam poplar]
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                     71.6    1e-12   
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1          71.6    1e-12   
gb|KDP21185.1|  hypothetical protein JCGZ_21656                       70.9    1e-12   
sp|D4N502.1|DIOX3_PAPSO  RecName: Full=Codeine O-demethylase          71.6    1e-12   Papaver somniferum
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                     71.6    1e-12   
ref|XP_010057204.1|  PREDICTED: protein SRG1-like                     71.6    1e-12   
gb|KDO54069.1|  hypothetical protein CISIN_1g023533mg                 70.5    2e-12   
gb|AGL52587.1|  2-oxoglutarate/Fe2+-dependent dioxygenase             71.6    2e-12   
gb|KCW74242.1|  hypothetical protein EUGRSUZ_E02880                   71.2    2e-12   
ref|XP_007022024.1|  Senescence-related gene 1                        71.2    2e-12   
gb|KDP23860.1|  hypothetical protein JCGZ_27165                       71.2    2e-12   
ref|XP_010273389.1|  PREDICTED: protein SRG1-like                     71.2    2e-12   
ref|XP_002519765.1|  hypothetical protein RCOM_0635410                67.8    2e-12   Ricinus communis
gb|KHF98196.1|  Protein SRG1 -like protein                            71.2    2e-12   
ref|XP_006489681.1|  PREDICTED: protein SRG1-like                     71.2    2e-12   
sp|D4N500.1|DIOX1_PAPSO  RecName: Full=Thebaine 6-O-demethylase       71.2    2e-12   Papaver somniferum
ref|XP_006579891.1|  PREDICTED: codeine O-demethylase-like            69.7    2e-12   
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                   70.9    2e-12   
ref|XP_009382431.1|  PREDICTED: S-norcoclaurine synthase 1-like       70.9    2e-12   
ref|XP_007211481.1|  hypothetical protein PRUPE_ppa007600mg           70.9    2e-12   
ref|XP_009799622.1|  PREDICTED: protein SRG1-like                     70.9    2e-12   
ref|XP_009106564.1|  PREDICTED: protein SRG1                          70.9    2e-12   
gb|KHN25971.1|  Protein SRG1                                          71.6    2e-12   
ref|XP_007211480.1|  hypothetical protein PRUPE_ppa007597mg           70.9    2e-12   
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  70.9    2e-12   
ref|XP_003518803.1|  PREDICTED: protein SRG1-like                     70.5    3e-12   
emb|CDX86869.1|  BnaA09g22590D                                        68.9    3e-12   
ref|XP_006301213.1|  hypothetical protein CARUB_v10021617mg           70.5    3e-12   
ref|XP_006355573.1|  PREDICTED: protein SRG1-like                     70.5    3e-12   
ref|XP_009376708.1|  PREDICTED: protein SRG1-like                     70.5    3e-12   
emb|CDP18686.1|  unnamed protein product                              70.9    3e-12   
gb|KEH27885.1|  flavonol synthase/flavanone 3-hydroxylase             70.5    4e-12   
gb|KDO52128.1|  hypothetical protein CISIN_1g035879mg                 70.1    4e-12   
gb|KEH38517.1|  2OG-Fe(II) oxygenase family oxidoreductase            70.1    5e-12   
ref|XP_007013636.1|  Senescence-related gene 1                        70.1    5e-12   
ref|XP_006477805.1|  PREDICTED: protein SRG1-like                     70.5    5e-12   
ref|XP_009383076.1|  PREDICTED: S-norcoclaurine synthase 1-like       67.8    6e-12   
ref|XP_010057198.1|  PREDICTED: protein SRG1-like isoform X2          69.7    6e-12   
ref|XP_002528475.1|  Leucoanthocyanidin dioxygenase, putative         69.7    6e-12   Ricinus communis
ref|XP_008226353.1|  PREDICTED: protein SRG1-like                     69.7    6e-12   
ref|XP_003638405.1|  Protein SRG1                                     69.7    6e-12   
ref|XP_010057197.1|  PREDICTED: protein SRG1-like isoform X1          69.7    6e-12   
gb|KHG24159.1|  S-norcoclaurine synthase 1                            69.3    6e-12   
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  69.7    6e-12   
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988  70.9    6e-12   
ref|XP_010057200.1|  PREDICTED: protein SRG1-like isoform X2          69.7    7e-12   
ref|XP_009757204.1|  PREDICTED: thebaine 6-O-demethylase-like iso...  65.9    7e-12   
ref|XP_009757210.1|  PREDICTED: thebaine 6-O-demethylase-like iso...  65.9    7e-12   
ref|XP_002889198.1|  oxidoreductase                                   69.3    7e-12   
ref|XP_003517890.1|  PREDICTED: protein SRG1-like isoform X1          69.3    8e-12   
ref|XP_002519762.1|  Leucoanthocyanidin dioxygenase, putative         67.4    9e-12   Ricinus communis
ref|XP_009376718.1|  PREDICTED: protein SRG1-like isoform X1          69.3    1e-11   
ref|XP_002532986.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  68.9    1e-11   Ricinus communis
ref|XP_006389976.1|  hypothetical protein EUTSA_v10018772mg           68.9    1e-11   
emb|CDY52434.1|  BnaA07g39110D                                        68.9    1e-11   
ref|XP_006355576.1|  PREDICTED: protein SRG1-like                     67.0    1e-11   
gb|KDP21186.1|  hypothetical protein JCGZ_21657                       68.6    1e-11   
ref|XP_009376719.1|  PREDICTED: protein SRG1-like isoform X2          68.6    2e-11   
ref|XP_010089186.1|  Protein SRG1                                     67.8    2e-11   
ref|XP_009376717.1|  PREDICTED: protein SRG1-like                     68.2    2e-11   
ref|XP_010540138.1|  PREDICTED: protein SRG1-like                     68.6    2e-11   
gb|AFK39688.1|  unknown                                               68.2    2e-11   
gb|KDO39453.1|  hypothetical protein CISIN_1g046251mg                 64.3    2e-11   
ref|XP_008366518.1|  PREDICTED: protein SRG1-like                     68.2    3e-11   
ref|XP_006575845.1|  PREDICTED: protein SRG1-like                     67.4    3e-11   
ref|XP_010096601.1|  Protein SRG1                                     67.8    3e-11   
ref|XP_010498039.1|  PREDICTED: protein SRG1-like                     67.8    4e-11   
ref|XP_002278096.3|  PREDICTED: protein SRG1-like                     67.8    4e-11   Vitis vinifera
ref|XP_010540139.1|  PREDICTED: protein SRG1-like                     67.4    4e-11   
ref|XP_008238358.1|  PREDICTED: S-norcoclaurine synthase 1-like       67.4    4e-11   
gb|AFK41350.1|  unknown                                               67.4    5e-11   
ref|XP_007158816.1|  hypothetical protein PHAVU_002G184400g           67.0    5e-11   
gb|AFK33687.1|  unknown                                               64.3    5e-11   
ref|XP_006442327.1|  hypothetical protein CICLE_v10020829mg           67.0    5e-11   
ref|XP_010476833.1|  PREDICTED: protein SRG1-like                     67.0    5e-11   
ref|XP_007209291.1|  hypothetical protein PRUPE_ppa007716mg           67.0    5e-11   
ref|XP_011028238.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  67.0    6e-11   
ref|XP_011028237.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  67.0    6e-11   
ref|XP_006489639.1|  PREDICTED: protein SRG1-like                     67.0    6e-11   
emb|CDP18687.1|  unnamed protein product                              65.1    6e-11   
ref|XP_002279625.1|  PREDICTED: S-norcoclaurine synthase 1            66.6    7e-11   Vitis vinifera
ref|XP_006355575.1|  PREDICTED: protein SRG1-like                     66.6    8e-11   
gb|AFN53719.1|  putative Fe(II) oxygenase superfamily protein         67.8    9e-11   
ref|XP_002268288.1|  PREDICTED: protein SRG1                          66.6    9e-11   Vitis vinifera
ref|XP_010095129.1|  Protein SRG1                                     66.2    1e-10   
ref|XP_010459259.1|  PREDICTED: protein SRG1-like                     65.9    1e-10   
ref|XP_009376721.1|  PREDICTED: protein SRG1-like isoform X2          65.9    1e-10   
ref|XP_009376720.1|  PREDICTED: protein SRG1-like isoform X1          65.9    1e-10   
ref|XP_006378698.1|  hypothetical protein POPTR_0010s20860g           65.5    1e-10   
ref|XP_002890198.1|  hypothetical protein ARALYDRAFT_889094           65.9    1e-10   
gb|KCW54631.1|  hypothetical protein EUGRSUZ_I00575                   65.1    1e-10   
ref|XP_006355577.1|  PREDICTED: protein SRG1-like                     65.9    1e-10   
gb|KHM98992.1|  Codeine O-demethylase                                 65.1    1e-10   
ref|XP_006355578.1|  PREDICTED: protein SRG1-like                     65.9    2e-10   
ref|XP_010476836.1|  PREDICTED: protein SRG1-like                     65.9    2e-10   
ref|XP_002519769.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  65.9    2e-10   Ricinus communis
ref|XP_011042009.1|  PREDICTED: protein SRG1-like                     65.5    2e-10   
ref|XP_007149079.1|  hypothetical protein PHAVU_005G039300g           65.5    2e-10   
ref|XP_004490337.1|  PREDICTED: protein SRG1-like                     65.5    2e-10   
emb|CDX94460.1|  BnaC01g17240D                                        62.8    2e-10   
ref|XP_010027975.1|  PREDICTED: protein SRG1-like                     65.5    2e-10   
gb|AFK47220.1|  unknown                                               65.1    2e-10   
gb|KDP20395.1|  hypothetical protein JCGZ_05278                       65.1    2e-10   
emb|CAN72414.1|  hypothetical protein VITISV_032872                   65.5    2e-10   Vitis vinifera
sp|A2A1A0.1|NCS1_COPJA  RecName: Full=S-norcoclaurine synthase 1;...  65.1    3e-10   Coptis japonica
ref|XP_006435684.1|  hypothetical protein CICLE_v10033625mg           65.1    3e-10   
ref|XP_010476835.1|  PREDICTED: protein SRG1                          65.1    3e-10   
gb|KDO69078.1|  hypothetical protein CISIN_1g046496mg                 65.1    3e-10   
ref|XP_009772022.1|  PREDICTED: protein SRG1-like                     64.7    3e-10   
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                     64.7    3e-10   
gb|KEH22931.1|  2OG-Fe(II) oxygenase family oxidoreductase            64.7    4e-10   
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like       64.7    4e-10   
ref|XP_006420337.1|  hypothetical protein CICLE_v10005281mg           64.7    4e-10   
ref|XP_006467559.1|  PREDICTED: protein SRG1-like isoform X2          64.3    4e-10   
gb|KEH33163.1|  2OG-Fe(II) oxygenase family oxidoreductase            63.5    4e-10   
ref|XP_010104366.1|  S-norcoclaurine synthase 1                       64.7    4e-10   
ref|XP_003552186.2|  PREDICTED: protein SRG1-like                     64.7    4e-10   
ref|XP_010498038.1|  PREDICTED: protein SRG1-like                     64.3    5e-10   
ref|XP_008345138.1|  PREDICTED: protein SRG1-like                     64.7    5e-10   
ref|XP_010433658.1|  PREDICTED: protein SRG1-like                     64.3    5e-10   
gb|KEH33162.1|  2OG-Fe(II) oxygenase family oxidoreductase            64.3    5e-10   
ref|XP_006449603.1|  hypothetical protein CICLE_v10015853mg           64.3    5e-10   
gb|EPS65204.1|  hypothetical protein M569_09574                       63.5    5e-10   
ref|XP_006467558.1|  PREDICTED: protein SRG1-like isoform X1          64.3    5e-10   
ref|XP_007009259.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  64.3    5e-10   
ref|NP_177976.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  63.9    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004233003.1|  PREDICTED: protein SRG1-like                     63.9    7e-10   
ref|XP_006480889.1|  PREDICTED: protein SRG1-like                     63.9    7e-10   
ref|XP_006452690.1|  hypothetical protein CICLE_v100105992mg          61.6    8e-10   
gb|KFK42230.1|  hypothetical protein AALP_AA2G228500                  63.9    8e-10   
gb|KHG12687.1|  S-norcoclaurine synthase 1                            63.5    9e-10   
emb|CDX88453.1|  BnaC06g38970D                                        63.5    9e-10   
emb|CDP08365.1|  unnamed protein product                              63.5    9e-10   
ref|NP_173145.1|  Fe(II)/ascorbate oxidase family protein SRG1        63.5    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like       63.5    1e-09   
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                     63.5    1e-09   
ref|XP_002313472.1|  hypothetical protein POPTR_0009s02780g           63.2    1e-09   Populus trichocarpa [western balsam poplar]
emb|CDX81796.1|  BnaC08g38050D                                        63.2    1e-09   
gb|KEH22932.1|  2OG-Fe(II) oxygenase family oxidoreductase            63.2    1e-09   
sp|D4N501.1|DIOX2_PAPSO  RecName: Full=Probable 2-oxoglutarate/Fe...  63.2    1e-09   Papaver somniferum
ref|XP_011002650.1|  PREDICTED: S-norcoclaurine synthase 1-like       63.2    1e-09   
ref|XP_003531421.1|  PREDICTED: protein SRG1-like                     63.2    1e-09   
emb|CAN60619.1|  hypothetical protein VITISV_010885                   63.2    1e-09   Vitis vinifera
ref|XP_002279610.1|  PREDICTED: S-norcoclaurine synthase 1-like       63.2    2e-09   Vitis vinifera
ref|XP_010448855.1|  PREDICTED: protein SRG1-like                     63.2    2e-09   
ref|XP_010662429.1|  PREDICTED: protein SRG1 isoform X2               62.8    2e-09   
ref|XP_010662431.1|  PREDICTED: protein SRG1 isoform X3               62.8    2e-09   
gb|KHN29183.1|  Protein SRG1                                          62.8    2e-09   
ref|XP_002267405.1|  PREDICTED: protein SRG1 isoform X1               62.8    2e-09   Vitis vinifera
ref|XP_007039569.1|  S-norcoclaurine synthase 1, putative             63.2    2e-09   
ref|XP_006602603.1|  PREDICTED: protein SRG1-like isoform X2          62.8    2e-09   
ref|XP_010417451.1|  PREDICTED: protein SRG1-like isoform X1          62.8    2e-09   
ref|XP_003552185.2|  PREDICTED: protein SRG1-like isoform X1          62.8    2e-09   
ref|XP_010654354.1|  PREDICTED: protein SRG1-like                     62.8    2e-09   
gb|KHN19470.1|  Protein SRG1                                          62.8    2e-09   
ref|XP_006305827.1|  hypothetical protein CARUB_v10010858mg           62.8    2e-09   
gb|AFK43235.1|  unknown                                               62.8    2e-09   
ref|NP_001242069.1|  uncharacterized protein LOC100777264             62.8    2e-09   
emb|CDX92690.1|  BnaC07g39480D                                        60.8    2e-09   
ref|XP_006413319.1|  hypothetical protein EUTSA_v10025577mg           62.4    2e-09   
ref|XP_010459260.1|  PREDICTED: protein SRG1-like                     62.4    2e-09   
ref|NP_173144.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  62.4    2e-09   
emb|CDP12963.1|  unnamed protein product                              60.5    3e-09   
ref|XP_010429681.1|  PREDICTED: protein SRG1-like                     62.4    3e-09   
ref|XP_009382554.1|  PREDICTED: protein SRG1-like                     62.4    3e-09   
ref|XP_006494121.1|  PREDICTED: protein SRG1-like                     60.1    3e-09   
ref|XP_006442334.1|  hypothetical protein CICLE_v10023680mg           60.5    3e-09   
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2          62.0    3e-09   
ref|XP_008223172.1|  PREDICTED: protein SRG1                          62.0    3e-09   
ref|XP_006429134.1|  hypothetical protein CICLE_v10011334mg           62.8    3e-09   
ref|XP_010053577.1|  PREDICTED: S-norcoclaurine synthase 1-like       62.0    4e-09   
ref|XP_002267208.1|  PREDICTED: protein SRG1                          62.0    4e-09   
ref|XP_006432909.1|  hypothetical protein CICLE_v10003168mg           59.7    4e-09   
emb|CDY24859.1|  BnaA08g14510D                                        58.9    4e-09   
ref|XP_004490335.1|  PREDICTED: protein SRG1-like isoform X2          61.2    4e-09   
emb|CDY24858.1|  BnaA08g14520D                                        61.6    4e-09   
ref|XP_002279355.1|  PREDICTED: S-norcoclaurine synthase 1            61.6    4e-09   
ref|XP_003614589.1|  SRG1-like protein                                61.6    4e-09   
gb|AHW42455.1|  GA2ox5                                                61.6    5e-09   
ref|XP_010498040.1|  PREDICTED: protein SRG1-like                     61.6    5e-09   
ref|XP_009109218.1|  PREDICTED: protein SRG1-like                     61.6    5e-09   
gb|KEH22929.1|  2OG-Fe(II) oxygenase family oxidoreductase            61.2    6e-09   
gb|KHN29926.1|  Protein SRG1-like protein                             59.3    8e-09   
ref|XP_008803154.1|  PREDICTED: protein SRG1-like                     60.8    8e-09   
gb|KFK33253.1|  hypothetical protein AALP_AA6G350500                  60.8    8e-09   
ref|XP_009139101.1|  PREDICTED: protein SRG1-like isoform X1          60.8    8e-09   
gb|KEH22933.1|  2OG-Fe(II) oxygenase family oxidoreductase            60.8    8e-09   
ref|XP_009139110.1|  PREDICTED: protein SRG1-like isoform X2          60.8    9e-09   
emb|CDY08970.1|  BnaC08g12000D                                        60.8    9e-09   
ref|XP_004490334.1|  PREDICTED: protein SRG1-like isoform X1          60.8    9e-09   
emb|CBI30521.3|  unnamed protein product                              62.0    9e-09   
ref|XP_008644315.1|  PREDICTED: S-norcoclaurine synthase 1-like       60.8    1e-08   
ref|XP_002869680.1|  oxidoreductase                                   60.8    1e-08   
ref|XP_002457721.1|  hypothetical protein SORBIDRAFT_03g012360        60.1    1e-08   
gb|AFK43602.1|  unknown                                               58.5    1e-08   
ref|XP_009610881.1|  PREDICTED: protein SRG1-like                     60.5    1e-08   
gb|KHG08200.1|  S-norcoclaurine synthase 1                            60.1    1e-08   
ref|XP_002512155.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  59.3    2e-08   
gb|KHG18773.1|  S-norcoclaurine synthase 1                            60.1    2e-08   
gb|KEH27888.1|  2OG-Fe(II) oxygenase family oxidoreductase            60.1    2e-08   
gb|KHN29925.1|  Protein SRG1-like protein                             60.1    2e-08   
ref|XP_003529241.1|  PREDICTED: codeine O-demethylase-like            60.1    2e-08   
ref|XP_007223329.1|  hypothetical protein PRUPE_ppa007361mg           60.1    2e-08   
emb|CBI33964.3|  unnamed protein product                              58.9    2e-08   
ref|XP_004134481.1|  PREDICTED: protein SRG1-like                     60.1    2e-08   
ref|XP_004159844.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...  60.1    2e-08   
ref|XP_007153174.1|  hypothetical protein PHAVU_003G013200g           59.7    2e-08   
gb|KFK43894.1|  hypothetical protein AALP_AA1G187900                  59.7    2e-08   
ref|XP_008242498.1|  PREDICTED: protein SRG1-like                     59.7    2e-08   
dbj|BAC42769.1|  SRG1 like protein                                    59.7    2e-08   
ref|XP_008778925.1|  PREDICTED: protein SRG1-like                     59.3    2e-08   
gb|KCW74239.1|  hypothetical protein EUGRSUZ_E02878                   58.9    2e-08   
gb|AES78791.2|  2OG-Fe(II) oxygenase family oxidoreductase, putative  59.3    2e-08   
emb|CDY08972.1|  BnaC08g12020D                                        57.0    2e-08   
ref|XP_006432905.1|  hypothetical protein CICLE_v10001623mg           59.7    3e-08   
gb|KCW47843.1|  hypothetical protein EUGRSUZ_K01583                   59.7    3e-08   
gb|EMT07771.1|  hypothetical protein F775_18948                       57.0    3e-08   
gb|KEH17521.1|  flavonol synthase/flavanone 3-hydroxylase             59.7    3e-08   
ref|XP_006644154.1|  PREDICTED: protein SRG1-like                     59.3    3e-08   
gb|KEH17519.1|  flavonol synthase/flavanone 3-hydroxylase             59.3    3e-08   
ref|XP_010036328.1|  PREDICTED: protein SRG1-like                     59.7    3e-08   
gb|AFK37891.1|  unknown                                               58.9    3e-08   
ref|XP_006435645.1|  hypothetical protein CICLE_v10033449mg           59.3    3e-08   
gb|KEH27886.1|  2OG-Fe(II) oxygenase family oxidoreductase            59.3    3e-08   
ref|XP_010537692.1|  PREDICTED: protein SRG1-like isoform X2          59.3    3e-08   
ref|XP_010537691.1|  PREDICTED: protein SRG1-like isoform X1          59.3    3e-08   
ref|XP_007207795.1|  hypothetical protein PRUPE_ppa025000mg           59.3    3e-08   
emb|CDY21769.1|  BnaA09g45200D                                        59.3    3e-08   
ref|XP_010059077.1|  PREDICTED: codeine O-demethylase-like            59.3    4e-08   
ref|XP_010448451.1|  PREDICTED: protein SRG1-like                     58.9    4e-08   
gb|ACU21203.1|  unknown                                               58.2    4e-08   
ref|XP_006855491.1|  hypothetical protein AMTR_s00057p00196790        58.9    4e-08   
ref|XP_010665637.1|  PREDICTED: protein SRG1-like                     58.9    4e-08   
ref|XP_009117729.1|  PREDICTED: protein SRG1                          58.9    4e-08   
ref|XP_008240663.1|  PREDICTED: protein SRG1-like                     58.9    4e-08   
ref|XP_003516325.1|  PREDICTED: protein SRG1                          58.9    4e-08   
ref|XP_006355629.1|  PREDICTED: protein SRG1-like                     58.9    4e-08   
gb|KCW77264.1|  hypothetical protein EUGRSUZ_D01621                   58.9    5e-08   
ref|XP_009401664.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.9    5e-08   
gb|KEH27901.1|  flavonol synthase/flavanone 3-hydroxylase             58.5    5e-08   
gb|KCW74238.1|  hypothetical protein EUGRSUZ_E02876                   58.5    5e-08   
ref|XP_006302461.1|  hypothetical protein CARUB_v10020553mg           58.5    5e-08   
gb|KDO41914.1|  hypothetical protein CISIN_1g0264531mg                55.8    5e-08   
ref|XP_010664098.1|  PREDICTED: S-norcoclaurine synthase 1 isofor...  58.5    6e-08   
gb|KEH27900.1|  flavonol synthase/flavanone 3-hydroxylase             57.8    6e-08   
gb|KDP21180.1|  hypothetical protein JCGZ_21651                       58.5    6e-08   
ref|XP_006494099.1|  PREDICTED: protein SRG1-like                     58.5    6e-08   
ref|XP_006432901.1|  hypothetical protein CICLE_v10001620mg           58.5    6e-08   
ref|XP_008438869.1|  PREDICTED: protein SRG1                          58.5    7e-08   
ref|XP_006355628.1|  PREDICTED: protein SRG1-like                     58.2    7e-08   
ref|XP_003614574.1|  Protein SRG1                                     58.2    8e-08   
ref|XP_004513256.1|  PREDICTED: protein SRG1-like                     57.8    8e-08   
gb|KEH40722.1|  2OG-Fe(II) oxygenase family oxidoreductase            58.2    8e-08   
ref|XP_009376707.1|  PREDICTED: protein SRG1-like                     58.2    9e-08   
ref|XP_008796105.1|  PREDICTED: S-norcoclaurine synthase 1-like       58.2    9e-08   
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                     58.2    9e-08   
ref|XP_010107326.1|  Protein SRG1                                     57.8    1e-07   
ref|XP_009109219.1|  PREDICTED: protein SRG1-like isoform X1          57.8    1e-07   
ref|XP_009109220.1|  PREDICTED: protein SRG1-like isoform X2          57.8    1e-07   
gb|KDO69142.1|  hypothetical protein CISIN_1g047368mg                 57.8    1e-07   
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                     57.8    1e-07   
ref|XP_006595433.1|  PREDICTED: protein SRG1-like                     54.7    1e-07   
ref|XP_006416751.1|  hypothetical protein EUTSA_v10008010mg           57.4    1e-07   
ref|XP_009137512.1|  PREDICTED: protein SRG1-like                     57.4    1e-07   
ref|XP_010525534.1|  PREDICTED: protein SRG1-like                     57.4    1e-07   
ref|XP_007158811.1|  hypothetical protein PHAVU_002G183900g           57.0    1e-07   
emb|CBI30795.3|  unnamed protein product                              57.8    1e-07   
gb|AGL52588.1|  2-oxoglutarate/Fe2+-dependent dioxygenase             57.4    1e-07   
emb|CDY11068.1|  BnaA03g47270D                                        57.4    1e-07   
gb|EMT08383.1|  S-norcoclaurine synthase 1                            57.4    1e-07   
emb|CDX92689.1|  BnaC07g39470D                                        57.4    1e-07   
gb|KCW74257.1|  hypothetical protein EUGRSUZ_E02903                   57.0    2e-07   
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                     57.4    2e-07   
emb|CDP21301.1|  unnamed protein product                              56.6    2e-07   
gb|AFK46862.1|  unknown                                               57.4    2e-07   
ref|XP_010050574.1|  PREDICTED: protein SRG1-like                     57.4    2e-07   
ref|XP_003518805.1|  PREDICTED: protein SRG1                          57.4    2e-07   
ref|XP_003556637.1|  PREDICTED: protein SRG1-like                     57.4    2e-07   
gb|KEH23007.1|  2OG-Fe(II) oxygenase family oxidoreductase            57.0    2e-07   
ref|XP_010259688.1|  PREDICTED: protein SRG1-like                     57.0    2e-07   
ref|XP_002466069.1|  hypothetical protein SORBIDRAFT_01g000650        57.0    2e-07   
ref|XP_002466070.1|  hypothetical protein SORBIDRAFT_01g000660        57.0    2e-07   
ref|XP_010059076.1|  PREDICTED: codeine O-demethylase-like            57.0    2e-07   
ref|XP_010927460.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...  57.0    2e-07   
ref|XP_003622573.1|  Protein SRG1                                     56.6    2e-07   
gb|EYU28156.1|  hypothetical protein MIMGU_mgv1a009322mg              56.6    2e-07   
dbj|BAE99802.1|  SRG1-like protein                                    56.6    3e-07   
ref|NP_194260.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  56.6    3e-07   
gb|KDP21182.1|  hypothetical protein JCGZ_21653                       56.6    3e-07   
ref|XP_004302752.1|  PREDICTED: protein SRG1-like                     56.6    3e-07   
gb|KDP21181.1|  hypothetical protein JCGZ_21652                       56.6    3e-07   
ref|XP_003614575.1|  SRG1-like protein                                56.2    4e-07   
gb|KEH27983.1|  flavonol synthase/flavanone 3-hydroxylase             55.5    4e-07   
ref|XP_002449221.1|  hypothetical protein SORBIDRAFT_05g006570        56.2    4e-07   
ref|XP_010053574.1|  PREDICTED: S-norcoclaurine synthase 1-like       56.2    4e-07   
ref|XP_006432907.1|  hypothetical protein CICLE_v10001648mg           55.5    4e-07   
ref|XP_004302751.1|  PREDICTED: protein SRG1-like                     55.8    5e-07   
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg           55.8    5e-07   
ref|XP_004964638.1|  PREDICTED: protein SRG1-like                     55.8    5e-07   
ref|NP_001065363.2|  Os10g0558400                                     55.8    5e-07   
ref|XP_010533099.1|  PREDICTED: protein SRG1                          55.8    5e-07   
ref|XP_006378697.1|  hypothetical protein POPTR_0010s20850g           55.8    5e-07   
gb|KHG05552.1|  S-norcoclaurine synthase 1                            55.8    5e-07   
ref|XP_002527641.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  55.8    5e-07   
ref|XP_004967582.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  55.8    5e-07   
ref|XP_010937784.1|  PREDICTED: protein SRG1-like                     55.1    5e-07   
ref|XP_011002641.1|  PREDICTED: protein SRG1-like                     55.8    6e-07   
gb|AAP54987.2|  oxidoreductase, 2OG-Fe oxygenase family protein       55.8    6e-07   
ref|XP_010664087.1|  PREDICTED: S-norcoclaurine synthase 1-like       55.5    6e-07   
ref|XP_004986102.1|  PREDICTED: S-norcoclaurine synthase 1-like       55.5    6e-07   
ref|XP_002279404.1|  PREDICTED: S-norcoclaurine synthase 1            55.5    7e-07   
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...  55.5    7e-07   
ref|XP_009117731.1|  PREDICTED: protein SRG1-like                     55.5    7e-07   
ref|XP_004305192.1|  PREDICTED: protein SRG1-like                     55.5    7e-07   
emb|CAN71933.1|  hypothetical protein VITISV_013422                   53.1    7e-07   
emb|CDX89426.1|  BnaA01g14670D                                        53.1    7e-07   
ref|NP_001183022.1|  hypothetical protein                             55.5    7e-07   
ref|XP_010919856.1|  PREDICTED: S-norcoclaurine synthase 1-like       55.5    7e-07   
ref|XP_004986813.1|  PREDICTED: S-norcoclaurine synthase 1-like       54.7    8e-07   
ref|XP_006452693.1|  hypothetical protein CICLE_v10008745mg           55.1    8e-07   
ref|XP_004983675.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  55.1    9e-07   
ref|XP_010095128.1|  putative xyloglucan endotransglucosylase/hyd...  55.8    9e-07   
ref|XP_009109221.1|  PREDICTED: protein SRG1-like                     55.1    9e-07   
ref|XP_007035548.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  55.1    1e-06   
gb|KDP39997.1|  hypothetical protein JCGZ_01995                       55.1    1e-06   
ref|XP_004983674.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  55.1    1e-06   
ref|XP_002465244.1|  hypothetical protein SORBIDRAFT_01g034900        53.9    1e-06   
emb|CBI33962.3|  unnamed protein product                              55.5    1e-06   
ref|XP_004980988.1|  PREDICTED: S-norcoclaurine synthase 1-like       54.7    1e-06   
ref|XP_009773005.1|  PREDICTED: protein SRG1-like                     52.8    1e-06   
ref|XP_007035547.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  54.7    1e-06   
ref|XP_009620034.1|  PREDICTED: thebaine 6-O-demethylase-like iso...  54.7    1e-06   
ref|NP_001042986.1|  Os01g0351800                                     54.7    1e-06   
ref|XP_002461737.1|  hypothetical protein SORBIDRAFT_02g007240        54.7    1e-06   
emb|CDM80650.1|  unnamed protein product                              54.7    1e-06   
gb|EAY73950.1|  hypothetical protein OsI_01835                        54.3    1e-06   
ref|XP_009384465.1|  PREDICTED: S-norcoclaurine synthase 1-like       54.3    1e-06   
ref|XP_009352238.1|  PREDICTED: protein SRG1-like                     54.3    2e-06   
ref|XP_006287961.1|  hypothetical protein CARUB_v10001196mg           54.7    2e-06   
gb|AGT16051.1|  oxygenase                                             54.3    2e-06   
ref|XP_004492163.1|  PREDICTED: protein SRG1-like                     54.3    2e-06   
ref|NP_001042987.1|  Os01g0352100                                     54.3    2e-06   
ref|XP_004296820.1|  PREDICTED: protein SRG1-like                     54.3    2e-06   
ref|XP_002457719.1|  hypothetical protein SORBIDRAFT_03g012350        53.9    2e-06   
gb|KHN29927.1|  Protein SRG1-like protein                             53.9    2e-06   
ref|XP_004492177.1|  PREDICTED: protein SRG1-like                     53.9    2e-06   
emb|CAN69330.1|  hypothetical protein VITISV_016336                   53.9    2e-06   
ref|XP_010050489.1|  PREDICTED: protein SRG1-like                     53.9    3e-06   
ref|XP_003560597.1|  PREDICTED: S-norcoclaurine synthase 1-like       53.9    3e-06   
ref|NP_001239868.1|  uncharacterized protein LOC100780588             52.0    3e-06   
ref|XP_009382555.1|  PREDICTED: protein SRG1-like                     53.5    3e-06   
gb|EAY73954.1|  hypothetical protein OsI_01838                        53.9    3e-06   
ref|XP_002282580.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  53.1    3e-06   
gb|EMT26488.1|  S-norcoclaurine synthase 1                            53.5    3e-06   
ref|XP_002437986.1|  hypothetical protein SORBIDRAFT_10g005940        53.5    3e-06   
ref|XP_006432912.1|  hypothetical protein CICLE_v10001626mg           52.8    4e-06   
emb|CDP06586.1|  unnamed protein product                              53.5    4e-06   
ref|XP_002270138.1|  PREDICTED: protein SRG1                          53.1    4e-06   
ref|XP_010664126.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  53.1    4e-06   
ref|XP_010664128.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  53.1    4e-06   
ref|XP_006432911.1|  hypothetical protein CICLE_v10001626mg           53.1    4e-06   
ref|XP_002272119.1|  PREDICTED: protein SRG1                          53.1    4e-06   
ref|XP_010664106.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  53.1    4e-06   
gb|AGQ42613.1|  2ODDlike1                                             53.1    4e-06   
ref|XP_006432916.1|  hypothetical protein CICLE_v10001622mg           53.1    4e-06   
gb|KDO39329.1|  hypothetical protein CISIN_1g018221mg                 53.1    4e-06   
ref|XP_004305191.1|  PREDICTED: protein SRG1-like                     53.1    5e-06   
gb|KDP20394.1|  hypothetical protein JCGZ_05277                       53.1    5e-06   
emb|CDM86075.1|  unnamed protein product                              53.1    5e-06   
ref|XP_009149139.1|  PREDICTED: protein SRG1-like                     53.1    5e-06   
ref|XP_010050492.1|  PREDICTED: protein SRG1-like                     53.1    5e-06   
ref|XP_010034113.1|  PREDICTED: protein SRG1-like                     53.1    5e-06   
ref|XP_011044508.1|  PREDICTED: protein SRG1 isoform X1               52.8    5e-06   



>ref|XP_010665638.1| PREDICTED: protein SRG1-like [Beta vulgaris subsp. vulgaris]
Length=367

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 54/78 (69%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G+S  VPSVQ++AKE+   IPSRYVR+ G  +   P    S+  VPVIDLQ+LL  E+
Sbjct  9    NFGSSFIVPSVQELAKESIVSIPSRYVRDNG-DQLEYPNSQSSSFSVPVIDLQRLLHAEY  67

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KLH ACK+WGFF
Sbjct  68   IDSELHKLHSACKEWGFF  85



>emb|CDP21916.1| unnamed protein product [Coffea canephora]
Length=187

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+GV      LG+SL VP VQ++AKE  A +P RY+R       P      S  ++PVI
Sbjct  1    MESGVIN----LGSSLKVPYVQELAKEKFASVPPRYIRP-----DPTKLHGASTEEIPVI  51

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D+Q+LLS+E  + EL+KLHFACK+WGFF
Sbjct  52   DMQRLLSDESVNPELEKLHFACKEWGFF  79



>ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42734.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=360

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+ V   T  LG+SLPVPSVQ++A ++ A +P+RYVR   +     P    S+S VPVI
Sbjct  1    MESKVTALT--LGSSLPVPSVQELANKSLATVPTRYVR-SDQDPPFIPTSSSSSSQVPVI  57

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D++KLLSE++ D+EL++ H ACKDWGFF
Sbjct  58   DMEKLLSEQFMDAELERFHHACKDWGFF  85



>ref|XP_011045559.1| PREDICTED: protein SRG1 [Populus euphratica]
Length=355

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 61/85 (72%), Gaps = 3/85 (4%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVPVIDLQ  195
            ++++  +LG+SL VP VQ++AK NPA IP RY+R      +  P+  C S +++PV+D++
Sbjct  1    MESNVVQLGSSLIVPCVQELAKVNPAAIPPRYIRPDQDQPTIIPS--CASVNEIPVVDMR  58

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
            +LL +E  DSEL KLH AC+DWGFF
Sbjct  59   RLLDQESMDSELAKLHLACRDWGFF  83



>emb|CDP20896.1| unnamed protein product [Coffea canephora]
Length=307

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 9/88 (10%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+G+      LG+SL VP VQ++AKE  A +P RY+R       P      S  ++PVI
Sbjct  1    MESGMIN----LGSSLKVPYVQELAKEKFASVPPRYIRP-----DPTKLHGVSTEEIPVI  51

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D+Q+LLS+E  + EL+KLHFACK+WGFF
Sbjct  52   DMQRLLSDESVNPELEKLHFACKEWGFF  79



>emb|CDP20118.1| unnamed protein product [Coffea canephora]
Length=194

 Score = 83.2 bits (204),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 54/82 (66%), Gaps = 3/82 (4%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS-  207
            T++LG SL VP VQ + KENP+ +P+RY+R     + P  +   S   +PV+D+Q L S 
Sbjct  5    TRKLGGSLKVPFVQDLTKENPSSVPTRYIRPDN-DQYPTISNGGSFHQIPVVDMQNLFSS  63

Query  208  -EEWGDSELQKLHFACKDWGFF  270
             EE  D ELQKLH ACK+WGFF
Sbjct  64   AEEVSDLELQKLHSACKEWGFF  85



>ref|XP_010273388.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=366

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 53/77 (69%), Gaps = 3/77 (4%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG+S+ VP VQ++AK++  ++P RYVR       P  + P S   +PVID+Q LLSEE  
Sbjct  14   LGSSILVPCVQELAKQHLVIVPPRYVR---SQHPPIISNPDSIPTIPVIDMQSLLSEESM  70

Query  220  DSELQKLHFACKDWGFF  270
            DSEL +LH ACKDWGFF
Sbjct  71   DSELSRLHAACKDWGFF  87



>ref|XP_006355571.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=357

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 57/81 (70%), Gaps = 8/81 (10%)
 Frame = +1

Query  28   DTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS  207
            +    G SL VPSVQ++AK++   IPSRYVR   + ESP  +   +A+ VP+IDLQKL+S
Sbjct  6    EKMNFGKSLLVPSVQELAKQHLTNIPSRYVR--SEQESPVIS---AAASVPIIDLQKLIS  60

Query  208  EEWGDSELQKLHFACKDWGFF  270
               GDSELQKLHFAC+ WGF 
Sbjct  61   ---GDSELQKLHFACQQWGFL  78



>emb|CDP20503.1| unnamed protein product [Coffea canephora]
Length=360

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 5/78 (6%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG SL VP VQ++AKE  A +P RY+R       P      S  ++PVID+Q+LLS+E 
Sbjct  7    KLGGSLKVPYVQELAKEKFASVPPRYIRP-----DPTKLHGVSTEEIPVIDMQRLLSDES  61

Query  217  GDSELQKLHFACKDWGFF  270
             + EL+KLHFACK+WGFF
Sbjct  62   VNPELEKLHFACKEWGFF  79



>ref|XP_007022032.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13557.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score = 84.0 bits (206),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 58/78 (74%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            + G+SLPVPSVQ++AK++ A IP RY+R     E P  ++  S S++PVID++ L+S+E 
Sbjct  7    KYGSSLPVPSVQELAKKSIATIPPRYLRPDL--EKPIVSDAGSMSEIPVIDMEGLVSKES  64

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  65   MDSELAKLDFACKEWGFF  82



>gb|KEH38521.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=174

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AKE  + +P RY++   + +     E  S  ++PVID++KLLS E+G 
Sbjct  9    GTSLLVPSVQELAKEKISTVPPRYIQ--SQHDELVINEANSILEIPVIDMKKLLSLEYGS  66

Query  223  SELQKLHFACKDWGFF  270
             EL KLH ACKDWGFF
Sbjct  67   LELSKLHLACKDWGFF  82



>ref|XP_002300453.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85258.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=355

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 3/79 (4%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVPVIDLQKLLSEE  213
            + G+SL VP VQ++AK N A IP RY+R      +  P+  C S +++PV+D+Q+LL +E
Sbjct  7    QFGSSLIVPCVQELAKVNTAAIPPRYIRPDQDQPTIIPS--CASVNEIPVVDMQRLLDQE  64

Query  214  WGDSELQKLHFACKDWGFF  270
              DSEL KLH AC+DWGFF
Sbjct  65   SMDSELAKLHLACRDWGFF  83



>emb|CDP14579.1| unnamed protein product [Coffea canephora]
Length=365

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G SL VPSVQ++AK+  + IP RYV      ESP  +   S   VPVID+++LLSE  
Sbjct  10   NFGKSLIVPSVQELAKQPISKIPPRYVHHDE--ESPIVSHETSLPAVPVIDVERLLSENS  67

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL+KLH ACKDWGFF
Sbjct  68   MDSELEKLHLACKDWGFF  85



>gb|KEH38519.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=358

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AKE  + +P+RY++   + E     E  S  ++PVID++KLLS E+G 
Sbjct  9    GTSLLVPSVQELAKEKISTVPARYIQS--QHEELVINEANSILEIPVIDMKKLLSLEYGS  66

Query  223  SELQKLHFACKDWGFF  270
             EL KLH ACKDWGFF
Sbjct  67   LELSKLHLACKDWGFF  82



>ref|XP_006442336.1| hypothetical protein CICLE_v10024324mg [Citrus clementina]
 gb|ESR55576.1| hypothetical protein CICLE_v10024324mg [Citrus clementina]
Length=157

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            RLG  LPVP VQ++AK+  AV+P  Y+R   KG++P  +     S +PVI++Q L SEE 
Sbjct  3    RLGGFLPVPYVQELAKKPMAVVPPIYMRP--KGDTPTISNDTLNSKIPVINMQSLYSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+ GFF
Sbjct  61   MDSELAKLDFACKELGFF  78



>ref|XP_002300451.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85256.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=359

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG+SL VP VQ++AK+    +P RY+R     E P  A     S+VPVID+Q+LL +E  
Sbjct  8    LGSSLLVPCVQELAKDLLVAVPPRYIRYDQ--EHPIIASHDPVSEVPVIDMQRLLDQETM  65

Query  220  DSELQKLHFACKDWGFF  270
            DSEL +LHFACK WGFF
Sbjct  66   DSELGRLHFACKTWGFF  82



>gb|KDP21184.1| hypothetical protein JCGZ_21655 [Jatropha curcas]
Length=369

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 55/87 (63%), Gaps = 1/87 (1%)
 Frame = +1

Query  10   ETGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVID  189
            E  +     RLG+++ VPSV+++AKE    IP RYV    +  S    +  S   +PVID
Sbjct  3    EAALMEAKSRLGSTVLVPSVKELAKEQFISIPPRYVHHDQQPPSTV-IDTNSLPQIPVID  61

Query  190  LQKLLSEEWGDSELQKLHFACKDWGFF  270
            + KLLS+E+ DSELQK H AC+DWGFF
Sbjct  62   MAKLLSQEFMDSELQKFHHACRDWGFF  88



>gb|KDO41542.1| hypothetical protein CISIN_1g030400mg [Citrus sinensis]
Length=178

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q LLSEE 
Sbjct  3    KIGGSLLVPCVQELVKNPMLVVPPRYIRPDQ--DSPINSDDTLISQIPVIDMQSLLSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  61   MDSELAKLDFACKEWGFF  78



>gb|KEH38520.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=278

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AKE  + +P+RY++   + E     E  S  ++PVID++KLLS E+G 
Sbjct  9    GTSLLVPSVQELAKEKISTVPARYIQS--QHEELVINEANSILEIPVIDMKKLLSLEYGS  66

Query  223  SELQKLHFACKDWGFF  270
             EL KLH ACKDWGFF
Sbjct  67   LELSKLHLACKDWGFF  82



>ref|XP_010057217.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=359

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G  L +P VQ + KENP  +P RYVR     E P   + CS   VPVIDL +L+SE+   
Sbjct  9    GRLLHMPCVQDVLKENPTTVPERYVR--SDLEPPMIMDACSGLQVPVIDLGRLVSEDCSK  66

Query  223  SELQKLHFACKDWGFF  270
             EL+KLH ACKDWGFF
Sbjct  67   LELKKLHHACKDWGFF  82



>ref|XP_007025217.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY27839.1| Senescence-related gene 1 [Theobroma cacao]
Length=368

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 58/87 (67%), Gaps = 5/87 (6%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD---VPVID  189
            ++T   +LGASL VP VQ++AKE+   +PSRY+R     E PAP    + S    VPVID
Sbjct  1    METQPPKLGASLLVPCVQELAKEHLIEVPSRYLR--STDEDPAPFLSNANSSLLQVPVID  58

Query  190  LQKLLSEEWGDSELQKLHFACKDWGFF  270
            +QKL S+   DSE +KLH ACK+WGFF
Sbjct  59   MQKLSSKHLKDSESEKLHHACKEWGFF  85



>ref|XP_010057216.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=360

 Score = 80.5 bits (197),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G  L +P VQ + KENP  +P RYVR     E P   + CS   VPVIDL +L+SE+   
Sbjct  9    GRLLHMPCVQDVLKENPTTVPERYVR--SDLEPPMIMDACSGLQVPVIDLGRLVSEDCSK  66

Query  223  SELQKLHFACKDWGFF  270
             EL+KLH ACKDWGFF
Sbjct  67   LELKKLHHACKDWGFF  82



>ref|XP_006442330.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
 gb|ESR55570.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
Length=355

 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G+SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q LLSEE 
Sbjct  3    QIGSSLLVPCVQELVKNPALVVPDRYIRPDQ--DSPLISDDTLISQIPVIDMQSLLSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  61   MDSELAKLDFACKEWGFF  78



>emb|CDP17938.1| unnamed protein product [Coffea canephora]
Length=178

 Score = 78.6 bits (192),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 9/88 (10%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+G+     +LG SL VP VQ++AK+  A +P RY+R       P      S  ++PVI
Sbjct  1    MESGMI----KLGRSLKVPYVQELAKQKFASVPPRYIRP-----DPTKLHGVSTEEIPVI  51

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D+Q+LLS+E  + EL+KLH ACK+WGFF
Sbjct  52   DMQRLLSDESLNPELEKLHCACKEWGFF  79



>gb|KHN36942.1| Protein SRG1 [Glycine soja]
Length=360

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSV ++AKEN   +P RY++   +       E  S  ++PVID+ +LLS E G 
Sbjct  10   GTSLLVPSVLELAKENLTTVPQRYIQPQHQDMVLISEEDHSTLEIPVIDMHRLLSVESGS  69

Query  223  SELQKLHFACKDWGFF  270
            SEL KLH ACK+WGFF
Sbjct  70   SELDKLHLACKEWGFF  85



>ref|XP_003543178.1| PREDICTED: protein SRG1 [Glycine max]
Length=357

 Score = 80.1 bits (196),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSV ++AKEN   +P RY++   +       E  S  ++PVID+ +LLS E G 
Sbjct  10   GTSLLVPSVLELAKENLTTVPQRYIQPQHQDMVLISEEDHSTLEIPVIDMHRLLSVESGS  69

Query  223  SELQKLHFACKDWGFF  270
            SEL KLH ACK+WGFF
Sbjct  70   SELDKLHLACKEWGFF  85



>ref|XP_007149499.1| hypothetical protein PHAVU_005G075500g [Phaseolus vulgaris]
 gb|ESW21493.1| hypothetical protein PHAVU_005G075500g [Phaseolus vulgaris]
Length=311

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 56/76 (74%), Gaps = 1/76 (1%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AK+N + +P RY++   + +    ++  +  ++PVID+Q+LLS+E G+
Sbjct  9    GTSLLVPSVQELAKQNLSTVPQRYIQPQHQEQMVLISQQPNL-EIPVIDMQRLLSQESGN  67

Query  223  SELQKLHFACKDWGFF  270
            SEL KLH AC++WGFF
Sbjct  68   SELDKLHLACQEWGFF  83



>ref|XP_010057211.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74256.1| hypothetical protein EUGRSUZ_E02902 [Eucalyptus grandis]
Length=363

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 54/89 (61%), Gaps = 7/89 (8%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSA-SDVPV  183
            MET V T  +    SL VP VQ + KENP  +  RY+R+    ESP   + CS    VPV
Sbjct  1    METQVNTRER----SLLVPCVQDILKENPTTVSKRYIRDDQ--ESPVITDACSGLPQVPV  54

Query  184  IDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            IDL +L+ EE    EL+KLH ACKDWGFF
Sbjct  55   IDLGRLVLEEVAKPELEKLHHACKDWGFF  83



>ref|XP_006442335.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
 gb|ESR55575.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
Length=355

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q LLSEE 
Sbjct  3    KIGGSLLVPCVQELVKNPMLVVPPRYIRPDQ--DSPINSDDTLISQIPVIDMQSLLSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  61   MDSELAKLDFACKEWGFF  78



>ref|XP_003638414.1| SRG1-like protein [Medicago truncatula]
Length=400

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AKE  + +P RY++   + +     E  S  ++PVID++KLLS E+G 
Sbjct  9    GTSLLVPSVQELAKEKISTVPPRYIQS--QHDELVINEANSILEIPVIDMKKLLSLEYGS  66

Query  223  SELQKLHFACKDWGFF  270
             EL KLH ACKDWGFF
Sbjct  67   LELSKLHLACKDWGFF  82



>ref|XP_008463796.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Cucumis melo]
Length=361

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 52/83 (63%), Gaps = 3/83 (4%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKL  201
            K DT R G+S+ VPSVQ++AK     IP RY+       SP  ++   AS +PVID+  L
Sbjct  5    KNDTLRYGSSILVPSVQELAKHPITEIPHRYIHPDLLHHSPISSD---ASQIPVIDMSNL  61

Query  202  LSEEWGDSELQKLHFACKDWGFF  270
             S +  DSEL +LH ACK+WGFF
Sbjct  62   RSHDTMDSELSRLHSACKNWGFF  84



>ref|XP_004488689.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=352

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 53/76 (70%), Gaps = 2/76 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AKEN + +P RY++   +G      +  +  ++P+ID+ +LLS E+G 
Sbjct  9    GTSLLVPSVQELAKENISEVPPRYIQSQHEGLVLTKID--NILEIPIIDMHRLLSLEFGS  66

Query  223  SELQKLHFACKDWGFF  270
            SEL KLH ACKDWGFF
Sbjct  67   SELTKLHLACKDWGFF  82



>ref|XP_010041379.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW44395.1| hypothetical protein EUGRSUZ_L02122 [Eucalyptus grandis]
Length=305

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +1

Query  52   LPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSEL  231
            L VP VQ M KENP  +P RYVR+  +   P     CS   +PVIDL +L+SE+    EL
Sbjct  12   LHVPWVQDMMKENPTTVPERYVRDDLE---PVIMGACSGLQLPVIDLGRLVSEDCAKLEL  68

Query  232  QKLHFACKDWGFF  270
            +KLH ACKDWGFF
Sbjct  69   KKLHHACKDWGFF  81



>ref|XP_006477806.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 ref|XP_006477807.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G+SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q LLS+E 
Sbjct  3    QIGSSLLVPCVQELVKNPALVVPDRYIRPDQ--DSPLISDDILISQIPVIDMQSLLSKES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  61   MDSELAKLDFACKEWGFF  78



>ref|XP_002269087.1| PREDICTED: protein SRG1 [Vitis vinifera]
 emb|CBI30797.3| unnamed protein product [Vitis vinifera]
Length=366

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            LG SL VPSVQ++AK+    +P RY+R E         +  CS+  VPVID  +L+S + 
Sbjct  9    LGGSLMVPSVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHVPVIDFHRLVSGDV  68

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KLH+ACKDWGFF
Sbjct  69   LDSELDKLHYACKDWGFF  86



>ref|XP_006477891.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++AK +  V+P RY+R   +  +   ++    S +PVID+Q LLSEE 
Sbjct  3    KVGGSLSVPCVQELAKNDTLVVPPRYIRPD-QNATTIISDDALVSKLPVIDMQSLLSEEL  61

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACKDWGFF
Sbjct  62   MDSELAKLDSACKDWGFF  79



>ref|XP_003546739.1| PREDICTED: protein SRG1 [Glycine max]
 gb|KHN47490.1| Protein SRG1 [Glycine soja]
Length=353

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 7/77 (9%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG SL VPSVQ++AK+N + +P RY++       P   E  S  ++P+ID+Q LLS E  
Sbjct  8    LGTSLLVPSVQELAKQNLSTVPHRYIQ-------PQNEEAISIPEIPIIDMQSLLSVESC  60

Query  220  DSELQKLHFACKDWGFF  270
             SEL KLH ACK+WGFF
Sbjct  61   SSELAKLHLACKEWGFF  77



>ref|XP_009610877.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=364

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 5/82 (6%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS--DVPVIDLQKLL  204
            ++++G+SL VPSVQ++AK+  AV P RY+R+    E+P      S+    VPVID++KLL
Sbjct  7    SRKIGSSLKVPSVQELAKQQLAV-PPRYIRDDI--ETPVLTSNSSSILPQVPVIDMEKLL  63

Query  205  SEEWGDSELQKLHFACKDWGFF  270
            +    DSELQ+LHFACK+WGFF
Sbjct  64   AIGNDDSELQRLHFACKEWGFF  85



>ref|XP_011085296.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=356

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG+SLPVP VQ++AKE  A +P RYVR      +   A   S   +PVID+QK      
Sbjct  7    KLGSSLPVPIVQELAKEKLATVPPRYVRPDQHQHTILSALNSSFPQIPVIDMQKFSDIYT  66

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQ LH AC++WGFF
Sbjct  67   MDSELQALHNACQEWGFF  84



>ref|XP_009757227.1| PREDICTED: protein SRG1-like isoform X2 [Nicotiana sylvestris]
Length=364

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G SL VPSVQ++A E+   IP+RYVR   + ESPA ++      VPVIDL+KL+S + 
Sbjct  10   NFGKSLLVPSVQELANEHLTNIPARYVRP--EQESPAVSDGTVGPTVPVIDLKKLVSGDS  67

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQKLH AC+ WGF 
Sbjct  68   MDSELQKLHSACQHWGFL  85



>ref|XP_002519766.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42739.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=366

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKL  201
            + +  +LG+SLPVPSVQ++AKE    +P +YVR     E P  +   +   VPV+D+QKL
Sbjct  3    QANATKLGSSLPVPSVQELAKELLTQVPLKYVRP--DLEPPLLSNTAALLQVPVVDMQKL  60

Query  202  LSEEWGDSELQKLHFACKDWGFF  270
            LSE+  D EL KL  ACK+WGFF
Sbjct  61   LSEDSVDLELNKLDRACKEWGFF  83



>ref|XP_011045561.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=359

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG+SL VP VQ++AK+    +P RY+R     E P  A     S+VPVID+Q+LL +E  
Sbjct  8    LGSSLLVPCVQELAKDPLVAVPPRYLRYDQ--EHPIIASHDPVSEVPVIDMQRLLDQETM  65

Query  220  DSELQKLHFACKDWGFF  270
            DSEL +LH ACK WGFF
Sbjct  66   DSELGRLHLACKTWGFF  82



>ref|XP_009757223.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
Length=378

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G SL VPSVQ++A E+   IP+RYVR   + ESPA ++      VPVIDL+KL+S + 
Sbjct  24   NFGKSLLVPSVQELANEHLTNIPARYVRP--EQESPAVSDGTVGPTVPVIDLKKLVSGDS  81

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQKLH AC+ WGF 
Sbjct  82   MDSELQKLHSACQHWGFL  99



>ref|XP_006428589.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
 gb|ESR41829.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
Length=283

 Score = 77.0 bits (188),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            +G SLPVP VQ +AK+    +P +Y+R     ESP       A++VPVID+ KLLS ++ 
Sbjct  8    MGRSLPVPCVQDLAKKPLTNVPPQYIR--ADQESPFICNADLAANVPVIDMSKLLSADFM  65

Query  220  DSELQKLHFACKDWGFF  270
            DSEL K H ACK+WGFF
Sbjct  66   DSELHKFHHACKEWGFF  82



>ref|XP_007025218.1| Senescence-related gene 1, putative [Theobroma cacao]
 gb|EOY27840.1| Senescence-related gene 1, putative [Theobroma cacao]
Length=357

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 59/87 (68%), Gaps = 6/87 (7%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESP--APAEPCSASDVPVIDL  192
            ++++  +LG+S+PVPSVQ++AKE    +P RY R     + P     + CS   VPVID+
Sbjct  1    MESELTKLGSSIPVPSVQEVAKEALGRVPQRYQR---PDQDPPFTSIDTCSPQQVPVIDM  57

Query  193  QKLLS-EEWGDSELQKLHFACKDWGFF  270
             KLLS + + D EL+KLH+ACK+WGFF
Sbjct  58   LKLLSGDHFMDVELEKLHYACKEWGFF  84



>ref|XP_006477808.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q LLSEE 
Sbjct  3    KIGGSLLVPCVQELVKNPMLVVPPRYIRPDQ--DSPLNSDDTLISQIPVIDMQSLLSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACKDWGFF
Sbjct  61   MDSELAKLDSACKDWGFF  78



>emb|CBI30803.3| unnamed protein product [Vitis vinifera]
Length=181

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            LG SLPVP VQ++AK+    +P RY+R E         +  CS+   PVID  +L+S + 
Sbjct  9    LGGSLPVPCVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHAPVIDFNRLVSGDS  68

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KLH+ACK+WGFF
Sbjct  69   MDSELDKLHYACKEWGFF  86



>ref|XP_007025223.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY27845.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 3 [Theobroma cacao]
Length=343

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+    +    G S+ VPSVQ++AKE    IP RY+R   +  S    E   +  VP+I
Sbjct  1    MESRADAEVVNFGKSIIVPSVQELAKEPITKIPHRYLRPEQEPHSVLGDELLPS--VPII  58

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            DLQKL++ ++ DSEL++LH ACKDWGFF
Sbjct  59   DLQKLVAGDFVDSELERLHSACKDWGFF  86



>ref|XP_007025222.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY27844.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=366

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+    +    G S+ VPSVQ++AKE    IP RY+R   +  S    E   +  VP+I
Sbjct  1    MESRADAEVVNFGKSIIVPSVQELAKEPITKIPHRYLRPEQEPHSVLGDELLPS--VPII  58

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            DLQKL++ ++ DSEL++LH ACKDWGFF
Sbjct  59   DLQKLVAGDFVDSELERLHSACKDWGFF  86



>ref|XP_007022033.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13558.1| Senescence-related gene 1 [Theobroma cacao]
Length=639

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 56/78 (72%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            + G+SL VPSVQ++AK++ A IP RY+R     E P  ++    S++PVID++ L+S+E 
Sbjct  292  KYGSSLLVPSVQELAKKSIATIPPRYLRPDL--EKPIVSDASLMSEIPVIDMEGLVSKES  349

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  350  MDSELAKLDFACKEWGFF  367


 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 55/78 (71%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            + G+SL VPSVQ++ K++ A IP RY+R     E P  ++  S S++ VID++ L+S+E 
Sbjct  7    KYGSSLLVPSVQELGKKSIATIPPRYLRP--YLEKPIVSDAGSMSEIRVIDMEGLVSKES  64

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  65   MDSELAKLDFACKEWGFF  82



>ref|XP_006369971.1| hypothetical protein POPTR_0001s36510g [Populus trichocarpa]
 gb|ERP66540.1| hypothetical protein POPTR_0001s36510g [Populus trichocarpa]
Length=186

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG SL VP VQ++AKE+PA +P+RY+R           E  S   +PVID+++L+SEE  
Sbjct  6    LGKSLLVPCVQELAKESPATVPTRYLRLDQDPPIINNNEVASLPQIPVIDMRRLVSEEQM  65

Query  220  DSELQKLHFACKDWGFF  270
            D EL K+  ACK+WGFF
Sbjct  66   DLELDKMDRACKEWGFF  82



>gb|KDO54061.1| hypothetical protein CISIN_1g018035mg [Citrus sinensis]
Length=362

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            +G SLPVP VQ +AK+    +P +Y+R     ESP       A++VPVID+ KLLS ++ 
Sbjct  8    MGGSLPVPCVQDLAKKPLTNVPPQYIR--ADQESPFICNADLAANVPVIDMSKLLSADFM  65

Query  220  DSELQKLHFACKDWGFF  270
            DSEL K H ACK+WGFF
Sbjct  66   DSELHKFHHACKEWGFF  82



>ref|XP_004488976.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=355

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AK+N   +P RY++   +      A+  S  ++PVID+  LLS E+G 
Sbjct  9    GTSLLVPSVQELAKDNILTVPPRYIQSQHQDLVITEADH-SILEIPVIDMNNLLSLEFGS  67

Query  223  SELQKLHFACKDWGFF  270
            SEL KLH ACKDWGFF
Sbjct  68   SELAKLHLACKDWGFF  83



>gb|KDO41540.1| hypothetical protein CISIN_1g039640mg, partial [Citrus sinensis]
Length=161

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 52/79 (66%), Gaps = 2/79 (3%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            +RLG  LPVP VQ++AK+  AV+P  Y+R   KG++P  +     S +PVI++Q L SEE
Sbjct  2    ERLGGFLPVPYVQELAKKPMAVVPPIYMRP--KGDTPTISNGTLNSKIPVINMQSLYSEE  59

Query  214  WGDSELQKLHFACKDWGFF  270
              DSEL KL FACK  G F
Sbjct  60   SMDSELAKLDFACKQSGLF  78



>gb|KDP25011.1| hypothetical protein JCGZ_23994 [Jatropha curcas]
Length=344

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 12/79 (15%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
             LG+SL VPSVQ++AK    VIP RY+R E   G         S  ++PV+D+QKLLS+E
Sbjct  3    NLGSSLIVPSVQELAKVQTDVIPPRYIRQESDSG--------VSVMEIPVVDMQKLLSQE  54

Query  214  WGDSELQKLHFACKDWGFF  270
               SEL KLH+AC+ WGFF
Sbjct  55   ---SELDKLHYACRHWGFF  70



>ref|XP_010057213.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=359

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = +1

Query  52   LPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSEL  231
            L VP VQ + KENP  +P RYVR+  +   P     CS   +PVIDL +L+SE+    EL
Sbjct  12   LHVPWVQDIMKENPTTVPERYVRDDLE---PVIMGACSGLQLPVIDLGRLVSEDCAKLEL  68

Query  232  QKLHFACKDWGFF  270
            +KLH ACKDWGFF
Sbjct  69   KKLHHACKDWGFF  81



>gb|KDP47183.1| hypothetical protein JCGZ_25692 [Jatropha curcas]
Length=344

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 12/79 (15%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
             LG+SL VPSVQ++AK    VIP RY+R E   G         S  ++PV+D+QKLLS+E
Sbjct  3    NLGSSLIVPSVQELAKVQTDVIPPRYIRQESDSG--------VSVMEIPVVDMQKLLSQE  54

Query  214  WGDSELQKLHFACKDWGFF  270
               SEL KLH+AC+ WGFF
Sbjct  55   ---SELDKLHYACRHWGFF  70



>ref|XP_010057215.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=358

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 52/88 (59%), Gaps = 7/88 (8%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            MET V    + L     VP VQ + KENP  +P RYVR+  +   P     CS   +PVI
Sbjct  1    METQVNIPARLLH----VPWVQDIMKENPTTVPERYVRDDLE---PVIMGACSGLQLPVI  53

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            DL +L+SE+    EL+KLH ACKDWGFF
Sbjct  54   DLGRLVSEDCAKLELKKLHHACKDWGFF  81



>ref|XP_009772021.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=358

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  16   GVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQ  195
             ++  T  LG S+ VPSVQ++AK+    IPSRYVR+  +  S +  +     +VPVID+Q
Sbjct  2    AMEAHTTELGGSMKVPSVQELAKQKLVTIPSRYVRDD-QDRSISSLD----KEVPVIDMQ  56

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
             L S +  + ELQKLHFA KDWGFF
Sbjct  57   HLNSTDSMNLELQKLHFAAKDWGFF  81



>ref|XP_006428590.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
 ref|XP_006480427.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR41830.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
Length=362

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            +G SLPVP VQ +AK+    +P +Y+R     ESP       A++VPVID+ KLLS ++ 
Sbjct  8    MGRSLPVPCVQDLAKKPLTNVPPQYIR--ADQESPFICNADLAANVPVIDMSKLLSADFM  65

Query  220  DSELQKLHFACKDWGFF  270
            DSEL K H ACK+WGFF
Sbjct  66   DSELHKFHHACKEWGFF  82



>ref|XP_006477892.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=272

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++ K    V+P RY+      +SP  ++    S +PVID+Q LLSEE 
Sbjct  3    KIGGSLLVPCVQELVKNPMLVVPPRYI--CPDEDSPLNSDDTLISQIPVIDMQSLLSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  61   MDSELAKLDFACKEWGFF  78



>ref|XP_006477893.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=302

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++  SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q LLS+E 
Sbjct  3    QIARSLLVPCVQELVKNPALVVPDRYIRPDQ--DSPLISDDTLISQIPVIDMQSLLSKES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL FACK+WGFF
Sbjct  61   MDSELAKLDFACKEWGFF  78



>ref|XP_007022030.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13555.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 54/78 (69%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            + G+SL VPSVQ++AK+  A IP RY+R     E P  +   S S++PVID++ L+S+E 
Sbjct  7    KYGSSLLVPSVQELAKKPIATIPPRYLRP--DLEKPIVSNAGSISEIPVIDMEGLVSKES  64

Query  217  GDSELQKLHFACKDWGFF  270
             DS L KL FACK+WGFF
Sbjct  65   MDSSLAKLDFACKEWGFF  82



>ref|XP_010273386.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
 ref|XP_010273387.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=365

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query  25   TDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLL  204
            ++  RLG+S+PVP+VQ++A++    +P RY+R     + P      S   +PVIDL  LL
Sbjct  3    SELLRLGSSIPVPNVQELARKPMVTVPPRYLRPDQ--DPPVITNANSLPTIPVIDLNNLL  60

Query  205  SEEWGDSELQKLHFACKDWGFF  270
            S E  DSE  +LH ACKDWGFF
Sbjct  61   SAESMDSESARLHSACKDWGFF  82



>gb|KDO52129.1| hypothetical protein CISIN_1g018426mg [Citrus sinensis]
Length=356

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++AK    V+P RY+R   +  +   ++    S +PVID+Q LLSEE 
Sbjct  3    KVGGSLSVPCVQELAKNATLVVPPRYIR-ADQDATTIISDDALVSKLPVIDMQSLLSEEL  61

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACK+WGFF
Sbjct  62   MDSELAKLDSACKEWGFF  79



>gb|KHG06473.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=372

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 13/94 (14%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS-----  171
            ME+    +    G S+ VPSVQ++AK+  A IP RY+R       P   +P S S     
Sbjct  1    MESPTDAEFVNFGKSIIVPSVQELAKDPIAKIPPRYLR-------PLQGQPHSISPNHHL  53

Query  172  -DVPVIDLQKLLSEEWGDSELQKLHFACKDWGFF  270
              VP+IDLQKL + ++ DSELQ+LH ACK+WGFF
Sbjct  54   PSVPIIDLQKLAAGDFVDSELQRLHSACKEWGFF  87



>ref|XP_006442328.1| hypothetical protein CICLE_v10020825mg [Citrus clementina]
 gb|ESR55568.1| hypothetical protein CICLE_v10020825mg [Citrus clementina]
Length=356

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ++AK    V+P RY+R   +  +   ++    S +PVID+Q LLSEE 
Sbjct  3    KVGGSLSVPCVQELAKNATLVVPPRYIR-ADQDATTIISDDALVSKLPVIDMQSLLSEEL  61

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACK+WGFF
Sbjct  62   MDSELAKLDSACKEWGFF  79



>ref|XP_002271080.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=354

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            LG SLPVP VQ++AK+    +P RY+R E         +  CS+   PVID  +L+S + 
Sbjct  9    LGGSLPVPCVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHAPVIDFNRLVSGDS  68

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KLH+ACK+WGFF
Sbjct  69   MDSELDKLHYACKEWGFF  86



>ref|XP_006442333.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
 gb|ESR55573.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
Length=355

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G+SL VP VQ++ K    V+P RY+R     +SP  ++    S +PVID+Q L SEE 
Sbjct  3    QIGSSLLVPCVQELVKNPALVVPDRYIRPDQ--DSPLISDDTLISQIPVIDMQSLHSEES  60

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL F CK+WGFF
Sbjct  61   MDSELAKLDFVCKEWGFF  78



>gb|KDO52127.1| hypothetical protein CISIN_1g045260mg [Citrus sinensis]
Length=355

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAV-IPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            + G SL VPSV+++A ENP V +P RY+R   K ++P  ++    S  PVID++ LLSEE
Sbjct  3    KYGGSLLVPSVKELA-ENPMVAVPPRYIRP--KQDAPVISDNTLISKFPVIDMESLLSEE  59

Query  214  WGDSELQKLHFACKDWGFF  270
              DSEL KL FAC++WGFF
Sbjct  60   SMDSELAKLDFACREWGFF  78



>ref|XP_004233001.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=354

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 50/77 (65%), Gaps = 5/77 (6%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SL VPSVQ+++K+    IP+RYVR   +     P    +   VPVIDLQKL+S +  
Sbjct  10   FGKSLLVPSVQELSKQRLTNIPARYVRSEQE-----PPVINAGEAVPVIDLQKLISGDSM  64

Query  220  DSELQKLHFACKDWGFF  270
            DSELQKLHFAC+ WGF 
Sbjct  65   DSELQKLHFACQQWGFL  81



>ref|XP_006477804.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 4/79 (5%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAV-IPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            + G SL VPSV+++A ENP V +P RY+R   K ++P  ++    S  PVID++ LLSEE
Sbjct  3    KYGGSLLVPSVKELA-ENPMVAVPPRYIRP--KQDAPVISDNTLISKFPVIDMESLLSEE  59

Query  214  WGDSELQKLHFACKDWGFF  270
              DSEL KL FAC++WGFF
Sbjct  60   SMDSELAKLDFACREWGFF  78



>gb|KDP32875.1| hypothetical protein JCGZ_12167 [Jatropha curcas]
Length=359

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 51/80 (64%), Gaps = 8/80 (10%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS-DVPVIDLQKLLSE  210
            + LG+SL VPSVQ++AKE    +P RY+R       P    P  +S  VPVID+ KL S+
Sbjct  7    KTLGSSLIVPSVQELAKEPLTDLPPRYLR-------PDIGSPIISSIQVPVIDMSKLFSQ  59

Query  211  EWGDSELQKLHFACKDWGFF  270
            E+ D EL K H ACKDWGFF
Sbjct  60   EFMDIELDKFHHACKDWGFF  79



>ref|XP_006439037.1| hypothetical protein CICLE_v10031934mg [Citrus clementina]
 gb|ESR52277.1| hypothetical protein CICLE_v10031934mg [Citrus clementina]
Length=358

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME      T  L   LPVPSVQ++A + P  +P RY+R+   G+      P S++ VP+I
Sbjct  1    MEAEAAAATLNLECCLPVPSVQELAIQQPEAVPPRYIRDHVVGDHVITVNP-SSNRVPLI  59

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D+ KL+  +  D+EL++LH ACK WG F
Sbjct  60   DMNKLVDPDSQDAELRRLHSACKHWGLF  87



>ref|XP_011085300.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=356

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG+SLPVP VQ++AKE  A +P RYVR     +    +   S   +PVID+QK      
Sbjct  7    KLGSSLPVPIVQELAKEESATVPPRYVRPDQHQQMTLSSLNSSFPQIPVIDMQKFSDIHT  66

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL  LH AC++WGFF
Sbjct  67   MDSELHALHDACQEWGFF  84



>ref|XP_010057205.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74248.1| hypothetical protein EUGRSUZ_E02888 [Eucalyptus grandis]
Length=370

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            +  +  +LG+SLPVPSVQ+MAKE    +P RYVR              S    PVIDL K
Sbjct  1    MDANLTKLGSSLPVPSVQEMAKEPITEVPPRYVRANQDHPFMHAELGTSLLQAPVIDLSK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  +++ +SEL+KLH AC+DWGFF
Sbjct  61   LSSSNDDFMESELEKLHVACRDWGFF  86



>ref|XP_004232992.1| PREDICTED: protein SRG1 [Solanum lycopersicum]
Length=360

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 55/77 (71%), Gaps = 5/77 (6%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SL VPSVQ++AK++  +IP RY+R   + E+P  +   + ++VPVID+QKL+S +  
Sbjct  10   FGKSLLVPSVQELAKQHLTIIPDRYLR--PEQETPVIS---AGAEVPVIDVQKLISGDSM  64

Query  220  DSELQKLHFACKDWGFF  270
            DSELQKLH AC+ WGF 
Sbjct  65   DSELQKLHSACQQWGFL  81



>gb|KDP22220.1| hypothetical protein JCGZ_26051 [Jatropha curcas]
Length=363

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            RLG+++ VPSV+++AK+    IP RYVR   +  S       S   +PVID+ KL  +++
Sbjct  6    RLGSTVLVPSVKEIAKDQLISIPPRYVRLDHQPPSTV-TNSTSLPQIPVIDMAKLFPQQF  64

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQK H ACKDWGFF
Sbjct  65   LDSELQKFHLACKDWGFF  82



>ref|XP_006442325.1| hypothetical protein CICLE_v10020838mg [Citrus clementina]
 gb|ESR55565.1| hypothetical protein CICLE_v10020838mg [Citrus clementina]
 gb|KDO39141.1| hypothetical protein CISIN_1g018510mg [Citrus sinensis]
Length=355

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 4/79 (5%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAV-IPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            + G SL VPSVQ++A ENP V +P RY+R   + ++P  ++    S  PVID+Q LLSEE
Sbjct  3    KYGGSLLVPSVQELA-ENPMVAVPPRYIR--PEQDAPVISDNTLISKFPVIDMQSLLSEE  59

Query  214  WGDSELQKLHFACKDWGFF  270
              DSEL  L FAC++WGFF
Sbjct  60   SVDSELANLDFACREWGFF  78



>ref|XP_004295415.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=345

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 51/78 (65%), Gaps = 3/78 (4%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVPVIDLQKLLSEEW  216
            +G+SLPVP VQ++ KE    +P RYVR     + P  +E   S   VPVID+ KLLS+E 
Sbjct  21   IGSSLPVPCVQELGKEPFTTVPHRYVRP--DQDPPFVSETATSLLQVPVIDMNKLLSDET  78

Query  217  GDSELQKLHFACKDWGFF  270
              +ELQKLH AC+ WGFF
Sbjct  79   MPAELQKLHLACRQWGFF  96



>gb|KCW74252.1| hypothetical protein EUGRSUZ_E02895 [Eucalyptus grandis]
Length=184

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            +  +  +LG SLPVPSVQ++AKE    +P RYVR              S   VPVIDL K
Sbjct  1    MDANLTKLGGSLPVPSVQELAKEAITEVPPRYVRPDQDHSFMHADLGTSLLQVPVIDLSK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  E+  +SEL+ LH AC+DWGFF
Sbjct  61   LSSSNEDLMESELENLHVACRDWGFF  86



>ref|XP_009610870.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
 ref|XP_009610871.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=364

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G SL VPSVQ++AKE+   IP+RYVR   + ES A ++      VPVIDL+KL+S + 
Sbjct  10   NFGKSLLVPSVQELAKEHLTNIPARYVR--PEQESQAISDEAVGPIVPVIDLKKLISGDS  67

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQKLH  C+ WGF 
Sbjct  68   MDSELQKLHSTCQQWGFL  85



>ref|XP_011085301.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 52/78 (67%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG SLPVP VQ++AKE  A +P RYVR     ++   +   S   +PVID+QKLL +  
Sbjct  4    KLGGSLPVPIVQELAKEKLATVPPRYVRPDQHQQT-ILSTLSSLPQIPVIDMQKLLDKYS  62

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL+ L+ AC++WGFF
Sbjct  63   VDSELEALNHACQEWGFF  80



>ref|XP_004233005.2| PREDICTED: codeine O-demethylase-like [Solanum lycopersicum]
Length=361

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 61/86 (71%), Gaps = 9/86 (10%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKL  201
            ++ ++++G++L VPSV+++AK+  A IPSRY+R+  +  S +   P     VPVID++KL
Sbjct  3    ESSSRKIGSTLKVPSVRELAKQELAAIPSRYIRDDLEKTSCSILMP----QVPVIDMEKL  58

Query  202  LSEEWGD---SELQKLHFACKDWGFF  270
            L    GD   +EL++LHFACK+WGFF
Sbjct  59   LI--IGDHDTAELERLHFACKEWGFF  82



>ref|XP_004301702.1| PREDICTED: S-norcoclaurine synthase 1-like [Fragaria vesca subsp. 
vesca]
Length=360

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 4/89 (4%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            MET V     +LG SLPV +VQ +A  N   IPSRY+R   + E  +  E      +PV+
Sbjct  1    METEVLIRKDQLGGSLPVENVQALASNNLKDIPSRYLRPEAEFEQVSIEESLQ---IPVV  57

Query  187  DLQKLL-SEEWGDSELQKLHFACKDWGFF  270
            D++KL+ +  + D EL KLH ACK+WGFF
Sbjct  58   DMRKLIENSSFRDDELAKLHLACKEWGFF  86



>ref|XP_010057212.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=360

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSA-SDVPVIDLQKLLSEEWG  219
            G SL VP VQ + K NP ++P RY+ +    E P   + CS    VPVIDL +L+SE+  
Sbjct  9    GRSLLVPCVQDILKANPTMVPKRYICDNQ--EHPVIMDACSGLPQVPVIDLGRLVSEDSA  66

Query  220  DSELQKLHFACKDWGFF  270
              EL+KLH ACKDWGFF
Sbjct  67   KPELEKLHQACKDWGFF  83



>ref|XP_006355623.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase-like 
[Solanum tuberosum]
Length=361

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 56/81 (69%), Gaps = 5/81 (6%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            ++ LG +L VPSV ++AK+  A IPSRY+R+  +  S +   P     VPVID++KLL  
Sbjct  6    SRNLGTTLKVPSVCELAKQELATIPSRYIRDDLEKISSSILLP----QVPVIDMEKLLII  61

Query  211  -EWGDSELQKLHFACKDWGFF  270
             +  +SEL++LHFACK+WGFF
Sbjct  62   GDHDNSELERLHFACKEWGFF  82



>ref|XP_008378981.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=196

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 53/94 (56%), Gaps = 6/94 (6%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVR----EGGKGESPAPAEPCSASD  174
            ME          G+SL VPSVQ++ K+    IP RY++    +G +           A  
Sbjct  1    MEEKASAGKSMYGSSLLVPSVQELVKKPVTTIPPRYIQHHHQDGNQEHEMTINSDYHAHQ  60

Query  175  VPVIDLQKLLSEE--WGDSELQKLHFACKDWGFF  270
            +P ID+QKLLS+E    DSEL +LHFACK+WGFF
Sbjct  61   IPSIDVQKLLSQESTISDSELARLHFACKEWGFF  94



>ref|XP_006482819.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=358

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 1/88 (1%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME      T  L   LPVPSVQ++A + P  +P RY+R    G+      P S++ VP+I
Sbjct  1    MEAEAAAATLNLECCLPVPSVQELAIQQPEAVPPRYIRYHVVGDHVITVNP-SSNRVPLI  59

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D+ KL+  +  D+EL++LH ACK WG F
Sbjct  60   DMNKLVDPDSQDAELRRLHSACKHWGLF  87



>ref|XP_006355574.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 52/80 (65%), Gaps = 9/80 (11%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGE--SPAPAEPCSASDVPVIDLQKLLSE  210
              G SL VPSVQ++AK++   IP RYVR   +    SP P+       VPVIDLQKL+S 
Sbjct  9    NFGNSLLVPSVQELAKQHLTNIPDRYVRPQQESPVISPGPS-------VPVIDLQKLISG  61

Query  211  EWGDSELQKLHFACKDWGFF  270
            +  DSELQKLH AC++WGF 
Sbjct  62   DSMDSELQKLHSACQEWGFL  81



>ref|NP_001240998.1| uncharacterized protein LOC100786574 [Glycine max]
 gb|ACU19370.1| unknown [Glycine max]
 gb|KHN28885.1| Protein SRG1 [Glycine soja]
Length=356

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 48/72 (67%), Gaps = 2/72 (3%)
 Frame = +1

Query  55   PVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSELQ  234
            PVP VQ++AKE   ++P RYVR     E P  +      ++PVIDL KLLS++  + EL 
Sbjct  7    PVPYVQEIAKEALTIVPERYVRP--VHERPILSNSTPLPEIPVIDLSKLLSQDHKEHELD  64

Query  235  KLHFACKDWGFF  270
            +LH+ACK+WGFF
Sbjct  65   RLHYACKEWGFF  76



>ref|XP_009799621.1| PREDICTED: protein SRG1-like isoform X2 [Nicotiana sylvestris]
Length=283

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
             +L VPSVQ++AK++   IP+RYVR   + ESPA     +   VPVIDL++L+S +  DS
Sbjct  11   GNLLVPSVQELAKQHLTNIPTRYVRP--EQESPAIFAGTAVPSVPVIDLKELMSGDSMDS  68

Query  226  ELQKLHFACKDWGFF  270
            ELQKLH AC+ WGF 
Sbjct  69   ELQKLHSACQQWGFL  83



>ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101257141 
[Solanum lycopersicum]
Length=1114

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 10/83 (12%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            ++LG SL VP+VQ++AK+  A +PSRY+R+  + +S +   P     VPVID++KLL  E
Sbjct  7    RKLGGSLKVPNVQELAKQQLAAVPSRYMRDDIENQSYSSILP----QVPVIDMKKLL--E  60

Query  214  WG----DSELQKLHFACKDWGFF  270
             G    DSEL +LH ACK+WGFF
Sbjct  61   IGDIDDDSELVRLHLACKEWGFF  83


 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 51/77 (66%), Gaps = 5/77 (6%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SL VPSVQ++AK++   IP+RYVR     E   P     AS VPVIDLQKL+S +  
Sbjct  380  FGKSLLVPSVQELAKQHLTNIPARYVRP----EQETPVISTGAS-VPVIDLQKLISGDSM  434

Query  220  DSELQKLHFACKDWGFF  270
            DSELQ+LH AC+ WGF 
Sbjct  435  DSELQELHSACQQWGFL  451


 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 2/82 (2%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDV-PVIDLQKLLS  207
            +++LG SL V +VQ++AK+  A +PSRY+R          +      ++ PVID++KLL 
Sbjct  760  SRKLGGSLKVSNVQELAKQQLAGVPSRYIRVNDDENQLYNSSILLPHELAPVIDMKKLLK  819

Query  208  -EEWGDSELQKLHFACKDWGFF  270
              + GD+EL + H ACK+ GFF
Sbjct  820  IIKDGDTELNRFHLACKEXGFF  841



>ref|XP_003540518.1| PREDICTED: protein SRG1-like [Glycine max]
 gb|KHN19469.1| Protein SRG1 [Glycine soja]
Length=359

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS--DVPVIDLQ  195
            + +T+ L  SL VPSVQ++AK+N + +P RY++   +       E  S S  ++PVID+ 
Sbjct  3    EINTKPLATSLLVPSVQELAKQNFSSVPQRYIQHQHEDMVLICEETNSTSSLEIPVIDMH  62

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
             LLS E  +SEL KLH ACK+WGFF
Sbjct  63   NLLSIEAENSELDKLHLACKEWGFF  87



>ref|XP_006355625.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 60/92 (65%), Gaps = 11/92 (12%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME G    +++LG SL VP+VQ++AK+  A +P RY+R+  + +S +         VPVI
Sbjct  1    MEEG---KSRKLGGSLKVPNVQELAKQQLAAVPPRYIRDDIENQSYSSI--VILPQVPVI  55

Query  187  DLQKLLSEEWG----DSELQKLHFACKDWGFF  270
            D++KLL  E G    DSEL++LH ACK+WGFF
Sbjct  56   DMKKLL--EIGDIDDDSELERLHLACKEWGFF  85



>ref|XP_010057208.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=365

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            +  +  +LG SLPVPSVQ++AKE    +P RYVR              S   VPVIDL K
Sbjct  1    MDANLTKLGGSLPVPSVQELAKEAITEVPPRYVRPDQDHSFMHADLGTSLLQVPVIDLSK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  E+  +SEL+ LH AC+DWGFF
Sbjct  61   LSSSNEDLMESELENLHVACRDWGFF  86



>ref|XP_010272749.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=365

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 52/82 (63%), Gaps = 9/82 (11%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS-----DVPVIDLQKLL  204
            LG+SL VPSVQ++AK+    +P RYV  G +     P+ P S S     D+PVID+Q L 
Sbjct  8    LGSSLLVPSVQELAKDPMNTLPPRYVHPGQE----PPSNPTSTSAPIVQDLPVIDMQALF  63

Query  205  SEEWGDSELQKLHFACKDWGFF  270
            S E  DSEL +L  AC+DWGFF
Sbjct  64   SAESMDSELARLDTACRDWGFF  85



>ref|XP_006355572.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 53/77 (69%), Gaps = 5/77 (6%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SL VPSVQ++AK++   IP+RYV    + ESP  +   + + VPVID+QKL+S +  
Sbjct  10   FGKSLLVPSVQELAKQHLTNIPARYVH--PEEESPVIS---AGASVPVIDVQKLISRDSM  64

Query  220  DSELQKLHFACKDWGFF  270
            DSELQKLH AC+ WGF 
Sbjct  65   DSELQKLHSACQQWGFL  81



>ref|XP_009610868.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana tomentosiformis]
Length=361

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G SL VPSVQ++A E+   IP+RYVR   + ES   ++      VPVIDL+KL+S + 
Sbjct  9    NFGKSLLVPSVQELATEHLTKIPARYVRP--EQESLVISDGAVVPAVPVIDLKKLISGDS  66

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQKLH AC++WGF 
Sbjct  67   MDSELQKLHSACQEWGFL  84



>ref|XP_003638391.1| Protein SRG1, partial [Medicago truncatula]
Length=121

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 50/77 (65%), Gaps = 3/77 (4%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            G SL VPSVQ++AK+   + +P RY++     +    +E  +   +PVID+ KL SEE+G
Sbjct  9    GTSLLVPSVQELAKDGKISTVPPRYIQPNH--QDLILSEVDTNLQIPVIDMYKLHSEEFG  66

Query  220  DSELQKLHFACKDWGFF  270
             SEL K H ACKDWGFF
Sbjct  67   SSELLKFHLACKDWGFF  83



>ref|XP_007025221.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY27843.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 1 [Theobroma cacao]
Length=445

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G S+ VPSVQ++AKE    IP RY+R   +  S    E   +  VP+IDLQKL++ ++ 
Sbjct  91   FGKSIIVPSVQELAKEPITKIPHRYLRPEQEPHSVLGDELLPS--VPIIDLQKLVAGDFV  148

Query  220  DSELQKLHFACKDWGFF  270
            DSEL++LH ACKDWGFF
Sbjct  149  DSELERLHSACKDWGFF  165



>gb|AGL52586.1| 2-oxoglutarate/Fe2+-dependent dioxygenase [Papaver somniferum]
Length=373

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 5/82 (6%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVR--EGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            +LG SL VPSVQ++AK++ A +P+RY+R  +   G++         S VPVIDLQK+LS 
Sbjct  8    KLGGSLLVPSVQELAKQSLAEVPARYIRTDQDTLGDNVTVTSMIDQS-VPVIDLQKVLSP  66

Query  211  E--WGDSELQKLHFACKDWGFF  270
            E   G+ EL++LH ACK+WGFF
Sbjct  67   EPIIGELELERLHSACKEWGFF  88



>ref|XP_004134919.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004155625.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=358

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 48/74 (65%), Gaps = 5/74 (7%)
 Frame = +1

Query  52   LPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS-DVPVIDLQKLLSEEWGDSE  228
            LPVP VQ++ K + + +P RYVR     +   P E   AS +VPVID+ KL S  + +SE
Sbjct  14   LPVPCVQELVKSSLSTVPLRYVRP----DQDPPFEFTDASAEVPVIDMHKLFSNNFENSE  69

Query  229  LQKLHFACKDWGFF  270
            L KLH ACKDWGFF
Sbjct  70   LDKLHHACKDWGFF  83



>ref|XP_004146011.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004169920.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=362

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKL  201
            K  T R G+S+ VPSVQ++AK     IP RY+R      SP  +   +AS +PVID+   
Sbjct  6    KIHTLRFGSSILVPSVQELAKHPITEIPHRYIRPDLLHHSPIAS---AASQIPVIDMSNF  62

Query  202  LSEEWGDSELQKLHFACKDWGFF  270
             S +  DSEL +LH ACK+WGFF
Sbjct  63   RSNDTMDSELSRLHSACKNWGFF  85



>ref|XP_009799618.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009799619.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009799620.1| PREDICTED: protein SRG1-like isoform X1 [Nicotiana sylvestris]
Length=362

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
             +L VPSVQ++AK++   IP+RYVR   + ESPA     +   VPVIDL++L+S +  DS
Sbjct  11   GNLLVPSVQELAKQHLTNIPTRYVRP--EQESPAIFAGTAVPSVPVIDLKELMSGDSMDS  68

Query  226  ELQKLHFACKDWGFF  270
            ELQKLH AC+ WGF 
Sbjct  69   ELQKLHSACQQWGFL  83



>gb|EYU28157.1| hypothetical protein MIMGU_mgv1a016759mg [Erythranthe guttata]
Length=108

 Score = 70.5 bits (171),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++++   +G+S+ VP VQ++AKE  + +PSRY+R         P        +PVID+QK
Sbjct  1    MESNIANIGSSIKVPVVQELAKEKLSTVPSRYLRPDHHL---IPVN-SKRRQIPVIDMQK  56

Query  199  LLSE-EWGDSELQKLHFACKDWGFF  270
            L+S+  + DSEL KLH +C++WGFF
Sbjct  57   LISDPNFMDSELHKLHTSCQEWGFF  81



>ref|XP_009382430.1| PREDICTED: S-norcoclaurine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=356

 Score = 73.6 bits (179),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKE--NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQ  195
            K   QRLG S+ VP+VQ +A    NPA +P RYVR   K +   P      S++PVID  
Sbjct  3    KPSFQRLGTSIDVPNVQALAASIANPADVPPRYVRTEAKAD---PVVSDGDSELPVIDFS  59

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
            +LL   +   E  KLH AC DWGFF
Sbjct  60   RLLHHRFSKEEYAKLHHACADWGFF  84



>gb|KHG25230.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=358

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++++   +G+SL VPSVQ++AK+  + IP+RY+R   + +  A        ++PVID+QK
Sbjct  1    MESEASNVGSSLLVPSVQELAKQPLSGIPNRYLRPELEQDVVADG-GGPVLEIPVIDMQK  59

Query  199  LLSEEWGDSELQKLHFACKDWGFF  270
            L+SEE  +SEL KL FACK+WGFF
Sbjct  60   LVSEEPMNSELDKLDFACKEWGFF  83



>ref|XP_011085299.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG SLPVP VQ++ KE  A +P RYVR   + +    +   S   +PVID+QKL  +  
Sbjct  4    KLGGSLPVPIVQELGKEKLATVPPRYVRPD-QHQQMILSSLSSLPPIPVIDMQKLSDKYS  62

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQ LH AC++WGFF
Sbjct  63   LDSELQALHNACQEWGFF  80



>ref|XP_002528471.1| Naringenin,2-oxoglutarate 3-dioxygenase, putative [Ricinus communis]
 gb|EEF33888.1| Naringenin,2-oxoglutarate 3-dioxygenase, putative [Ricinus communis]
Length=317

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 40/84 (48%), Positives = 57/84 (68%), Gaps = 3/84 (4%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++T+   LG+SL VP VQ++AK +   IP RYVR+    + P   +  +  +VPVID+++
Sbjct  1    METNALSLGSSLLVPCVQELAKLSLESIPPRYVRQ--DQDQPINVQNQNV-EVPVIDMER  57

Query  199  LLSEEWGDSELQKLHFACKDWGFF  270
            LLS+E   SEL KLH AC+DWGFF
Sbjct  58   LLSQESMHSELAKLHCACRDWGFF  81



>ref|XP_011046705.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=85

 Score = 69.7 bits (169),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG SL VP VQ++AKE+PA +P+RY+R           E  S   +PVID+Q+L+S E  
Sbjct  6    LGKSLAVPCVQELAKESPATVPARYLRLDQDPPIINNNEMASLPQIPVIDMQRLVSGEQM  65

Query  220  DSELQKLHFACKDWG  264
            D EL K+  ACK+WG
Sbjct  66   DIELDKMDRACKEWG  80



>ref|XP_004233004.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=350

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SL VPSVQ++AK++   IP+RYVR     E  +P     AS VPVIDLQKL+S    
Sbjct  3    FGKSLLVPSVQELAKQHLTNIPARYVRP----EEESPVIYAGAS-VPVIDLQKLIS---M  54

Query  220  DSELQKLHFACKDWGFF  270
            DSELQKLH AC+ WGF 
Sbjct  55   DSELQKLHSACQQWGFL  71



>ref|XP_009382429.1| PREDICTED: S-norcoclaurine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 5/81 (6%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKE--NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS  207
            QRLG S+ VP+VQ +A    NPA +P RYVR+  K +   P      S++PVID  +LL 
Sbjct  7    QRLGTSIDVPNVQALAASIANPADVPPRYVRQEAKAD---PVVSDGDSELPVIDFSRLLH  63

Query  208  EEWGDSELQKLHFACKDWGFF  270
              +   E  KLH AC DWGFF
Sbjct  64   HRFSREESAKLHHACADWGFF  84



>ref|XP_010057206.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74250.1| hypothetical protein EUGRSUZ_E02891 [Eucalyptus grandis]
Length=370

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            +  +  +LG+SLP PSVQ+MAKE    +P RYVR              S    PVIDL K
Sbjct  1    MDANLTKLGSSLPAPSVQEMAKEPITEVPPRYVRVDQDHPFMHAELGTSLLQAPVIDLSK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  +++ +SEL+KLH AC+DWGFF
Sbjct  61   LSSSNDDFMESELEKLHVACRDWGFF  86



>ref|XP_011005822.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=356

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 0/77 (0%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG SL VP VQ++AKE+PA +P+RY+R           E  S   +PVID+Q+L+S E  
Sbjct  6    LGKSLAVPCVQELAKESPATVPARYLRLDQDPPIINNNEMASLPQIPVIDMQRLVSGEQM  65

Query  220  DSELQKLHFACKDWGFF  270
            D EL K+  ACK+WG F
Sbjct  66   DIELDKMDRACKEWGVF  82



>ref|XP_009610880.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=355

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 54/87 (62%), Gaps = 10/87 (11%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD--VPVIDL  192
            ++  T  L  S+ VPSVQ++AK+    IPSRYVR+             S+SD  VPVIDL
Sbjct  1    MEAHTGELEDSMKVPSVQELAKQKLVTIPSRYVRDDQD-------RSISSSDKEVPVIDL  53

Query  193  QKLLSEEWG-DSELQKLHFACKDWGFF  270
            Q+L S +   + ELQKLHFA KDWGFF
Sbjct  54   QRLNSTDHSMNLELQKLHFAAKDWGFF  80



>ref|XP_007149498.1| hypothetical protein PHAVU_005G075400g [Phaseolus vulgaris]
 gb|ESW21492.1| hypothetical protein PHAVU_005G075400g [Phaseolus vulgaris]
Length=357

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 0/76 (0%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ+++K+N   +P RY++          ++   + ++PVID+  LLS E   
Sbjct  10   GTSLLVPSVQELSKQNLRTVPQRYIQPHHDQHMLLISQEAHSLEIPVIDMHNLLSAESKS  69

Query  223  SELQKLHFACKDWGFF  270
             EL+KLH ACKDWGFF
Sbjct  70   LELEKLHLACKDWGFF  85



>ref|XP_009382428.1| PREDICTED: S-norcoclaurine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=354

 Score = 72.8 bits (177),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKE--NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQ  195
            K+  QR+G+S+ VPSVQ +A    NPA +P R+VR   K +   P      S++PVID  
Sbjct  3    KSSFQRMGSSIHVPSVQALAASIANPADVPPRFVRPEAKAD---PVASDGESELPVIDFS  59

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
            +LL   +   E  KLH AC DWGFF
Sbjct  60   RLLHHRFSREESAKLHHACADWGFF  84



>ref|XP_010057210.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74255.1| hypothetical protein EUGRSUZ_E02899 [Eucalyptus grandis]
Length=367

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +1

Query  28   DTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS  207
            +  +LG+SLPVP+VQ++AKE  A +P RYVR                 +VPVIDL  L S
Sbjct  4    NLTKLGSSLPVPNVQELAKEVIAEVPPRYVRTDQDHPLMDDDHGTLLLEVPVIDLNNLSS  63

Query  208  EEWG--DSELQKLHFACKDWGFF  270
             +    +SEL+KLH ACKDWGFF
Sbjct  64   SDGNLRESELEKLHTACKDWGFF  86



>gb|KEH19984.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=362

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 3/79 (4%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            ++LG SL VPSVQ++ K+  A +P RYV++    E    +   S   VPVIDL+KLLSEE
Sbjct  12   KKLGTSLLVPSVQELVKQPIAKVPERYVQQ--NQEPSVVSSTISLPQVPVIDLKKLLSEE  69

Query  214  WGDSELQKLHFACKDWGFF  270
             G +EL+K   ACK+WGFF
Sbjct  70   DG-TELEKFDHACKEWGFF  87



>ref|XP_007214442.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
 gb|EMJ15641.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
Length=362

 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AK++   IP RY++              S +++P ID+ KLLS++  D
Sbjct  11   GGSLIVPSVQELAKKHIITIPPRYIQPHHHHHQQDQVIFNSDAEIPFIDMHKLLSQDSID  70

Query  223  SE--LQKLHFACKDWGFF  270
            SE  L KLHFACK+WGFF
Sbjct  71   SESELAKLHFACKEWGFF  88



>ref|XP_010057196.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=279

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++ +  +LG SLPVP VQ++AKE    +P RYVR                  VPVID+ K
Sbjct  1    MEVNLMKLGGSLPVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  ++  +SEL+KLH AC+DWGFF
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFF  86



>ref|XP_006355570.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 52/78 (67%), Gaps = 5/78 (6%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
              G SL VPSVQ++AK++   IP RY+    + ESP  +   + + VPVID+QKL+S + 
Sbjct  9    NFGKSLLVPSVQELAKQHLTNIPDRYLHP--EQESPVIS---TGASVPVIDIQKLISGDA  63

Query  217  GDSELQKLHFACKDWGFF  270
             DSELQKLH AC+ WGF 
Sbjct  64   MDSELQKLHSACQQWGFL  81



>gb|KEH19983.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=357

 Score = 72.4 bits (176),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 3/79 (4%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            ++LG SL VPSVQ++ K+  A +P RYV++    E    +   S   VPVIDL+KLLSEE
Sbjct  7    KKLGTSLLVPSVQELVKQPIAKVPERYVQQ--NQEPSVVSSTISLPQVPVIDLKKLLSEE  64

Query  214  WGDSELQKLHFACKDWGFF  270
             G +EL+K   ACK+WGFF
Sbjct  65   DG-TELEKFDHACKEWGFF  82



>ref|XP_010057209.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74253.1| hypothetical protein EUGRSUZ_E02897 [Eucalyptus grandis]
Length=371

 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +1

Query  28   DTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS  207
            +  +LG+SL VPSV ++AKE  + +P+RYVR           +  S+  VPVIDL KL S
Sbjct  4    NLTKLGSSLLVPSVLELAKEAISEVPTRYVRTDQDYMFMHDDQATSSLQVPVIDLSKLSS  63

Query  208  --EEWGDSELQKLHFACKDWGFF  270
              +   +SEL+KLH AC+DWGFF
Sbjct  64   SNDHTMESELEKLHAACRDWGFF  86



>gb|KCW74247.1| hypothetical protein EUGRSUZ_E02887 [Eucalyptus grandis]
Length=311

 Score = 71.2 bits (173),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 50/82 (61%), Gaps = 9/82 (11%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG SLPVPSVQ++AKE    +P RY+R      +       S   VPVIDL KL S 
Sbjct  17   VNKLGGSLPVPSVQELAKEAITELPPRYIRTDLDHGT-------SVLQVPVIDLSKLSSS  69

Query  211  --EWGDSELQKLHFACKDWGFF  270
              +  +SEL+KLH AC+DWGFF
Sbjct  70   DGDLTESELEKLHSACRDWGFF  91



>ref|XP_002314207.1| hypothetical protein POPTR_0009s03100g [Populus trichocarpa]
 gb|EEE88162.1| hypothetical protein POPTR_0009s03100g [Populus trichocarpa]
Length=363

 Score = 72.0 bits (175),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME+ ++ +    G S+ +PSVQ+MAKE+   IP RY R        +       S +PVI
Sbjct  1    MESSLELEAVNFGKSIIIPSVQEMAKESMTKIPPRYERPDQDPPIISTDASLLLSSIPVI  60

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            DL++L  E+  DSEL  LH AC++WGFF
Sbjct  61   DLERLAIEDSMDSELDILHSACREWGFF  88



>ref|XP_010057201.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74244.1| hypothetical protein EUGRSUZ_E02881 [Eucalyptus grandis]
Length=359

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++ +  +LG SLPVP VQ++AKE    +P RYVR                  VPVID+ K
Sbjct  1    MEVNLMKLGGSLPVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  ++  +SEL+KLH AC+DWGFF
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFF  86



>ref|XP_010057195.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74240.1| hypothetical protein EUGRSUZ_E02879 [Eucalyptus grandis]
Length=359

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++ +  +LG SLPVP VQ++AKE    +P RYVR                  VPVID+ K
Sbjct  1    MEVNLMKLGGSLPVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  ++  +SEL+KLH AC+DWGFF
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFF  86



>gb|KDP21185.1| hypothetical protein JCGZ_21656 [Jatropha curcas]
Length=299

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +1

Query  94   AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            A +PSRYVR     + P  ++ C    VPVID+ KLLS+E+ DSEL+KLH AC+D+GFF
Sbjct  54   ATVPSRYVRIDQDPQIPTTSDACPPPQVPVIDMLKLLSQEFSDSELEKLHTACRDFGFF  112



>sp|D4N502.1|DIOX3_PAPSO RecName: Full=Codeine O-demethylase [Papaver somniferum]
 gb|ADD85331.1| codeine O-demethylase [Papaver somniferum]
Length=360

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 45/83 (54%), Positives = 51/83 (61%), Gaps = 8/83 (10%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD---VPVIDLQKLLS  207
            +LG  L +PSVQ++AK   A IPSRY      GESP      S +D   VPVIDLQ LLS
Sbjct  8    KLGNGLSIPSVQELAKLTLAEIPSRYT---CTGESPLNNIGASVTDDETVPVIDLQNLLS  64

Query  208  EE--WGDSELQKLHFACKDWGFF  270
             E   G  EL KLH ACK+WGFF
Sbjct  65   PEPVVGKLELDKLHSACKEWGFF  87



>ref|XP_003524845.1| PREDICTED: protein SRG1-like [Glycine max]
Length=359

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
             SL VP VQ++AK+    +P RYVR   +      A       VPVIDL KLLS++  + 
Sbjct  4    TSLTVPFVQEIAKDALTRVPERYVRPLHERPILLSATTTPLPQVPVIDLSKLLSQDLKEP  63

Query  226  ELQKLHFACKDWGFF  270
            EL+KLH+ACK+WGFF
Sbjct  64   ELEKLHYACKEWGFF  78



>ref|XP_010057204.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=372

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG SLPVPSVQ++AKE    +P RY+R              S   VPVIDL KL S 
Sbjct  17   VNKLGGSLPVPSVQELAKEAITELPPRYIRTDLD-------HGTSVLQVPVIDLSKLSSS  69

Query  211  --EWGDSELQKLHFACKDWGFF  270
              +  +SEL+KLH AC+DWGFF
Sbjct  70   DGDLTESELEKLHSACRDWGFF  91



>gb|KDO54069.1| hypothetical protein CISIN_1g023533mg [Citrus sinensis]
Length=281

 Score = 70.5 bits (171),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 8/80 (10%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD---VPVIDLQKLLSE  210
            +G+SL VP +Q++AK  P ++PSR+       E   P    S+S+   +PVID+QKLLS 
Sbjct  8    MGSSLVVPLIQELAKNTPTIVPSRFTV---NDEDHVPL--ISSSEQVLIPVIDMQKLLSG  62

Query  211  EWGDSELQKLHFACKDWGFF  270
            ++ DSEL KL  AC++WGFF
Sbjct  63   DFMDSELGKLDHACREWGFF  82



>gb|AGL52587.1| 2-oxoglutarate/Fe2+-dependent dioxygenase [Papaver somniferum]
Length=378

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 59/91 (65%), Gaps = 6/91 (7%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGE-SPAPAEPCSASDVPV  183
            MET   +   +LG +L VPSVQ++AK++ A +P+RY+R+      +   A       VPV
Sbjct  1    MET---SKLMKLGGTLFVPSVQELAKQSLAEVPARYIRDDHDTLGNNVTATSMMDQSVPV  57

Query  184  IDLQKLLSEE--WGDSELQKLHFACKDWGFF  270
            I+LQK+LS E   G+ EL++LH ACK+WGFF
Sbjct  58   INLQKVLSPEPIIGELELERLHSACKEWGFF  88



>gb|KCW74242.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=346

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG+SLPVPSVQ+ AKE    +P RY+R              S   VPVIDL KL S 
Sbjct  17   VNKLGSSLPVPSVQEFAKEAITELPPRYIRTDLD-------HGTSLLQVPVIDLSKLSSS  69

Query  211  --EWGDSELQKLHFACKDWGFF  270
              +  +SEL+KLH AC+DWGFF
Sbjct  70   DGDLTESELEKLHSACRDWGFF  91



>ref|XP_007022024.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13549.1| Senescence-related gene 1 [Theobroma cacao]
Length=351

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG SL VP VQ++AKE    +P RY+R   + ++  PA+     ++PVID++ LL +E  
Sbjct  7    LGNSLLVPCVQELAKETMTTLPPRYLRPDLE-QTTVPAD---GLEIPVIDMKSLLCDESM  62

Query  220  DSELQKLHFACKDWGFF  270
            DSEL KL +ACK+WGFF
Sbjct  63   DSELAKLDYACKEWGFF  79



>gb|KDP23860.1| hypothetical protein JCGZ_27165 [Jatropha curcas]
Length=362

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +1

Query  58   VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSELQK  237
            VPSVQ++AKE    +P RY+R        +  E  S  D+PVID+ KL  +E  DSEL K
Sbjct  14   VPSVQELAKEPLVSVPQRYIRPDQNHSIVSANEDGSLPDIPVIDMSKLTHQESMDSELAK  73

Query  238  LHFACKDWGFF  270
            LH AC +WGFF
Sbjct  74   LHSACTEWGFF  84



>ref|XP_010273389.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=363

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 52/77 (68%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SL VPSVQ++ K+    +P RY+R   + + P  ++  S   VP+ID+Q LLS ++ 
Sbjct  9    FGKSLLVPSVQELVKQPIVEVPPRYIR--VRQDPPIISDDSSFPAVPIIDIQSLLSGDFV  66

Query  220  DSELQKLHFACKDWGFF  270
            +SEL+++H ACK+WGFF
Sbjct  67   NSELERMHSACKEWGFF  83



>ref|XP_002519765.1| hypothetical protein RCOM_0635410 [Ricinus communis]
 gb|EEF42738.1| hypothetical protein RCOM_0635410 [Ricinus communis]
Length=89

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 7/81 (9%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKEN---PAVIPSRYVREGGKGESPAPA-EPCSASDVPVIDLQKLLS  207
            LG SL VPSV+ +        + IPS+YVR     + P    +  S  DVPVID+ KL S
Sbjct  7    LGTSLLVPSVKDLISNKEQLTSAIPSKYVRHD---QDPVSVLDKNSLPDVPVIDMAKLFS  63

Query  208  EEWGDSELQKLHFACKDWGFF  270
            E++ D EL+K   ACKDWGFF
Sbjct  64   EKFMDLELKKFDHACKDWGFF  84



>gb|KHF98196.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=362

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 52/82 (63%), Gaps = 2/82 (2%)
 Frame = +1

Query  25   TDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLL  204
            T+   LG S+ VPSVQ++AK     IP+RY+R   +  S +P     +  VP+IDL KL 
Sbjct  3    TEFVNLGKSMIVPSVQELAKYPLTKIPARYLRMHEELHSISPNHHLPS--VPIIDLHKLA  60

Query  205  SEEWGDSELQKLHFACKDWGFF  270
            + ++ DSELQ LH AC+ WGFF
Sbjct  61   AGDFVDSELQTLHAACRHWGFF  82



>ref|XP_006489681.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=362

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 53/80 (66%), Gaps = 8/80 (10%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD---VPVIDLQKLLSE  210
            +G+SL VP +Q++AK  P ++PSR+       E   P    S+S+   +PVID+QKLLS 
Sbjct  8    MGSSLVVPLIQELAKNTPTIVPSRFTV---NDEDHVPL--ISSSEQVLIPVIDMQKLLSG  62

Query  211  EWGDSELQKLHFACKDWGFF  270
            ++ DSEL KL  AC++WGFF
Sbjct  63   DFMDSELGKLDHACREWGFF  82



>sp|D4N500.1|DIOX1_PAPSO RecName: Full=Thebaine 6-O-demethylase [Papaver somniferum]
 gb|ADD85329.1| thebaine 6-O-demethylase [Papaver somniferum]
Length=364

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD-VPVIDLQK  198
            K    +LG  + +PSVQ++AK   A IPSRYV        P  A   +  + +PVID++ 
Sbjct  3    KAKLMKLGNGMEIPSVQELAKLTLAEIPSRYVCANENLLLPMGASVINDHETIPVIDIEN  62

Query  199  LLSEE--WGDSELQKLHFACKDWGFF  270
            LLS E   G  EL +LHFACK+WGFF
Sbjct  63   LLSPEPIIGKLELDRLHFACKEWGFF  88



>ref|XP_006579891.1| PREDICTED: codeine O-demethylase-like [Glycine max]
Length=258

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 48/72 (67%), Gaps = 3/72 (4%)
 Frame = +1

Query  55   PVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSELQ  234
            PVP VQ++AK    ++P RYVR     E P  +      ++PVIDL KLLS++  + EL+
Sbjct  7    PVPYVQEIAKA-LTIVPERYVRP--VHEHPILSNSTPLPEIPVIDLSKLLSQDHKEHELE  63

Query  235  KLHFACKDWGFF  270
            +LH+ACK+WGFF
Sbjct  64   RLHYACKEWGFF  75



>gb|KCW74251.1| hypothetical protein EUGRSUZ_E02892 [Eucalyptus grandis]
Length=359

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++ +  +LG+SLPVP VQ++AK+    +P RYVR                  VPVID+ K
Sbjct  1    MEVNLMKLGSSLPVPCVQELAKDAITEVPPRYVRTDQDHPFMGDDHGSLLLQVPVIDMTK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  ++  +SEL+KLH AC+DWGFF
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFF  86



>ref|XP_009382431.1| PREDICTED: S-norcoclaurine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=355

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 47/81 (58%), Gaps = 5/81 (6%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKE--NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS  207
            QRLG S+ VP+VQ +A    NPA +P RYVR   K +   P      S++PVID  +LL 
Sbjct  7    QRLGTSIDVPNVQALAASIANPADVPPRYVRPEAKAD---PVVSDGDSELPVIDFSRLLH  63

Query  208  EEWGDSELQKLHFACKDWGFF  270
              +   E  KLH AC DWGFF
Sbjct  64   RRFSREESAKLHHACADWGFF  84



>ref|XP_007211481.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
 gb|EMJ12680.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
Length=362

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 4/80 (5%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYV--REGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            G SL VPSVQ++AK+    IP+RY+  R   + +          +++P ID+QKLLS+E 
Sbjct  11   GGSLIVPSVQELAKKPITAIPARYIQTRHHEQQDDVMFNPDHGQAEIPFIDMQKLLSQES  70

Query  217  GDSE--LQKLHFACKDWGFF  270
             DSE  L  LHFACK+WGFF
Sbjct  71   TDSESELAMLHFACKEWGFF  90



>ref|XP_009799622.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=360

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 5/80 (6%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            ++++G++L VPSVQ++ K+  AV P RY+R+    +   P        VPVID++KLL+ 
Sbjct  7    SRKIGSTLKVPSVQELIKQQVAV-PPRYIRD----DIEMPMTSSILPQVPVIDMEKLLAI  61

Query  211  EWGDSELQKLHFACKDWGFF  270
                SEL++LHFAC DWGFF
Sbjct  62   GNDGSELERLHFACVDWGFF  81



>ref|XP_009106564.1| PREDICTED: protein SRG1 [Brassica rapa]
Length=358

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 52/75 (69%), Gaps = 3/75 (4%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
            +SL VPSV ++AKEN   +P RY+R   + ++   A+ C +S +PVID+Q+L S    D+
Sbjct  10   SSLLVPSVLEIAKEN--TVPPRYLR-SEQDKTETLADSCLSSKLPVIDMQRLCSVSAMDT  66

Query  226  ELQKLHFACKDWGFF  270
            EL+KL  AC+DWGFF
Sbjct  67   ELEKLDLACQDWGFF  81



>gb|KHN25971.1| Protein SRG1 [Glycine soja]
Length=483

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 47/75 (63%), Gaps = 0/75 (0%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
             SL VP VQ++AK+    +P RYVR   +      A       VPVIDL KLLS++  + 
Sbjct  128  TSLTVPFVQEIAKDALTRVPERYVRPLHERPILLSATTTPLPQVPVIDLSKLLSQDLKEP  187

Query  226  ELQKLHFACKDWGFF  270
            EL+KLH+ACK+WGFF
Sbjct  188  ELEKLHYACKEWGFF  202



>ref|XP_007211480.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
 gb|EMJ12679.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
Length=362

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 2/78 (3%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SL VPSVQ++AK+    IP RY++              S +++P ID+ KLLS++  D
Sbjct  11   GGSLIVPSVQELAKKPVITIPPRYIQPHHHHHQQDQVIFNSDAEIPFIDMHKLLSQDSID  70

Query  223  SE--LQKLHFACKDWGFF  270
            SE  L KLHFACK+WGFF
Sbjct  71   SESELAKLHFACKEWGFF  88



>ref|XP_010057202.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Eucalyptus grandis]
 gb|KCW74241.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=372

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG+SLPVPSVQ+ AKE    +P RY+R              S   VPVIDL KL S 
Sbjct  17   VNKLGSSLPVPSVQEFAKEAITELPPRYIRTDLD-------HGTSLLQVPVIDLSKLSSS  69

Query  211  --EWGDSELQKLHFACKDWGFF  270
              +  +SEL+KLH AC+DWGFF
Sbjct  70   DGDLTESELEKLHSACRDWGFF  91



>ref|XP_003518803.1| PREDICTED: protein SRG1-like [Glycine max]
 gb|KHN29929.1| Protein SRG1-like protein [Glycine soja]
Length=358

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 53/81 (65%), Gaps = 5/81 (6%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESP-APAEPCSASDVPVIDLQKLLS  207
             ++LG+SL VPSVQ++AK+    +P RYVR     E P    +  S   VPVIDL KLLS
Sbjct  6    VKKLGSSLLVPSVQELAKQGITKVPERYVR---PNEDPCVEYDTTSLPQVPVIDLSKLLS  62

Query  208  EEWGDSELQKLHFACKDWGFF  270
            E+   +EL+KL  ACK+WGFF
Sbjct  63   ED-DAAELEKLDHACKEWGFF  82



>emb|CDX86869.1| BnaA09g22590D [Brassica napus]
Length=238

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
            +SL VPSV ++AKEN   +P RY+R   + ++    + C +S +PVID+Q+L S    D+
Sbjct  10   SSLLVPSVLEIAKEN--TVPPRYLR-SDQDKTDTLDDSCLSSKLPVIDMQRLCSVSAMDT  66

Query  226  ELQKLHFACKDWGFF  270
            EL+KL  AC+DWGFF
Sbjct  67   ELEKLDLACQDWGFF  81



>ref|XP_006301213.1| hypothetical protein CARUB_v10021617mg [Capsella rubella]
 gb|EOA34111.1| hypothetical protein CARUB_v10021617mg [Capsella rubella]
Length=356

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKE-NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            +R  +SL VPSV +M K+ N   +P RYV    + ++    + C  S++PVID+++L S 
Sbjct  6    ERQWSSLGVPSVLEMVKDKNVTTVPPRYVV-SDQDKTEILDDSCLNSEIPVIDMKRLCSV  64

Query  211  EWGDSELQKLHFACKDWGFF  270
             + DSEL+KL FAC+DWGFF
Sbjct  65   SYMDSELKKLDFACQDWGFF  84



>ref|XP_006355573.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 53/77 (69%), Gaps = 5/77 (6%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG SL VPSVQ++A+++   IP RY+R   + E+P  +   + ++VPVI LQK +S +  
Sbjct  10   LGKSLLVPSVQELAEQHLTNIPDRYLR--PEQETPVIS---AGAEVPVIHLQKFISGDSM  64

Query  220  DSELQKLHFACKDWGFF  270
            DSELQKLH AC+ WGF 
Sbjct  65   DSELQKLHSACQQWGFL  81



>ref|XP_009376708.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=367

 Score = 70.5 bits (171),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVR----EGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            G SL VPSVQ+  K+    IP+RY++    +G +           A  +P ID+QKLLS+
Sbjct  13   GGSLHVPSVQEFVKKPILTIPTRYLQPHDQDGNQEHEMIINSDHHAPQIPSIDMQKLLSQ  72

Query  211  EWGDSE--LQKLHFACKDWGFF  270
            E  DSE  L +LHFACK+WGFF
Sbjct  73   ESTDSEAELARLHFACKEWGFF  94



>emb|CDP18686.1| unnamed protein product [Coffea canephora]
Length=418

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/65 (49%), Positives = 43/65 (66%), Gaps = 5/65 (8%)
 Frame = +1

Query  76   MAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSELQKLHFACK  255
            +AKE  A +P RY+R       P      S  ++PVID+Q+LLS+E  + EL+KLHFACK
Sbjct  27   LAKEKFASVPPRYIRP-----DPTKLHGVSTEEIPVIDMQRLLSDESVNPELEKLHFACK  81

Query  256  DWGFF  270
            +WGFF
Sbjct  82   EWGFF  86



>gb|KEH27885.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=358

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 39/78 (50%), Positives = 53/78 (68%), Gaps = 2/78 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG+SL VPSVQ++ K+    +P RY+++  +  S   +   S   VPVIDL KLLSEE 
Sbjct  8    KLGSSLLVPSVQELVKQPITKVPERYLQQN-QDPSLVVSSTKSLPQVPVIDLSKLLSEE-  65

Query  217  GDSELQKLHFACKDWGFF  270
             ++ELQKL  ACK+WGFF
Sbjct  66   DETELQKLDHACKEWGFF  83



>gb|KDO52128.1| hypothetical protein CISIN_1g035879mg [Citrus sinensis]
Length=356

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +   SL VP VQ++AK    V+P RY+R   +  +   ++    S +PVID+Q LLSEE 
Sbjct  3    KFRGSLSVPCVQELAKNPTLVVPPRYIRPD-QDATTIISDDALVSKLPVIDMQSLLSEES  61

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACK+WGFF
Sbjct  62   MDSELAKLDSACKEWGFF  79



>gb|KEH38517.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=359

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 38/77 (49%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +1

Query  43   GASLPVPSVQQMAKE-NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            G SL VPSVQ+++K+ N + +P RY++     +    +E  +   +PVID+ KL SEE G
Sbjct  9    GTSLLVPSVQELSKDGNISTVPPRYIQP--NHQDLILSEVDTNLQIPVIDMYKLHSEELG  66

Query  220  DSELQKLHFACKDWGFF  270
             SEL KLH ACKDWGFF
Sbjct  67   SSELVKLHLACKDWGFF  83



>ref|XP_007013636.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY31255.1| Senescence-related gene 1 [Theobroma cacao]
Length=356

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 2/79 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKL-LSEE  213
            +LG SL VP VQQ++KE    +P +YVR        + +  C A  VPVID+QKL  S++
Sbjct  7    KLGGSLLVPCVQQLSKEPLVKVPPQYVRTDEDPSFISNSSSCLAQ-VPVIDMQKLHYSKD  65

Query  214  WGDSELQKLHFACKDWGFF  270
              D+EL++LH ACK WGFF
Sbjct  66   LKDTELEQLHHACKHWGFF  84



>ref|XP_006477805.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=431

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +   SL VP VQ++AK    V+P RY+R   +  +   ++    S +PVID+Q LLSEE 
Sbjct  78   KFRGSLSVPCVQELAKNPTLVVPPRYIRPD-QDATTIISDDALVSKLPVIDMQSLLSEES  136

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACK+WGFF
Sbjct  137  MDSELAKLDSACKEWGFF  154



>ref|XP_009383076.1| PREDICTED: S-norcoclaurine synthase 1-like [Musa acuminata subsp. 
malaccensis]
Length=186

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 47/85 (55%), Gaps = 5/85 (6%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKE--NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQ  195
            K   Q LG S+ VP+VQ +A    NPA +P RYVR   K +   P      S++PVID  
Sbjct  3    KPSFQCLGTSIDVPNVQALAASIANPADVPPRYVRPEAKAD---PVVSDGDSELPVIDFS  59

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
            +LL   +   E  KLH AC DWGFF
Sbjct  60   RLLHHRFSREESAKLHHACADWGFF  84



>ref|XP_010057198.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=346

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +1

Query  25   TDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLL  204
             +  +LG+SL VP VQ++AKE    +P RYVR                  VPVID+ KL 
Sbjct  3    VNLMKLGSSLLVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNKLS  62

Query  205  S--EEWGDSELQKLHFACKDWGFF  270
            S  E+  +SEL+KLH AC+DWGFF
Sbjct  63   SSHEDLVESELEKLHVACRDWGFF  86



>ref|XP_002528475.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF33892.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=364

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 3/71 (4%)
 Frame = +1

Query  58   VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSELQK  237
            VP VQ++ KE  A +P RY+R     +  + A P    +VPVID+Q+L   +  DSEL K
Sbjct  19   VPCVQELVKEPMATVPPRYIR---PDQDYSIAAPGDDGEVPVIDMQRLYDPDSIDSELAK  75

Query  238  LHFACKDWGFF  270
            LH ACKDWGFF
Sbjct  76   LHLACKDWGFF  86



>ref|XP_008226353.1| PREDICTED: protein SRG1-like [Prunus mume]
Length=363

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 54/87 (62%), Gaps = 4/87 (5%)
 Frame = +1

Query  22   KTDTQRLGASLPVPSVQQMAKENPAVIPSRYVR-EGGKGESPAPAEP-CSASDVPVIDLQ  195
            KT     G SL VPSVQ++AK+    IP RY++    + +      P    +++P ID+Q
Sbjct  4    KTSGSFYGGSLIVPSVQELAKKPITAIPPRYIQPHHPEQQDHVMFNPDHDHAEMPFIDMQ  63

Query  196  KLLSEEWGDSE--LQKLHFACKDWGFF  270
            KLLS+E  DSE  L +LHFACK+WGFF
Sbjct  64   KLLSQESTDSESELARLHFACKEWGFF  90



>ref|XP_003638405.1| Protein SRG1 [Medicago truncatula]
Length=359

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 51/77 (66%), Gaps = 3/77 (4%)
 Frame = +1

Query  43   GASLPVPSVQQMAKE-NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            G SL VPSVQ+++K+ N + +P RY++     +    +E  +   +PVID+ KL SEE+G
Sbjct  9    GTSLLVPSVQELSKDGNISTVPPRYIQP--NHQDLILSEVDTNLQIPVIDMYKLHSEEFG  66

Query  220  DSELQKLHFACKDWGFF  270
             SEL K H ACKDWGFF
Sbjct  67   SSELLKFHLACKDWGFF  83



>ref|XP_010057197.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=357

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 49/84 (58%), Gaps = 2/84 (2%)
 Frame = +1

Query  25   TDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLL  204
             +  +LG+SL VP VQ++AKE    +P RYVR                  VPVID+ KL 
Sbjct  3    VNLMKLGSSLLVPCVQELAKEAITEVPPRYVRTDQDHPFMRDDHGSLLLQVPVIDMNKLS  62

Query  205  S--EEWGDSELQKLHFACKDWGFF  270
            S  E+  +SEL+KLH AC+DWGFF
Sbjct  63   SSHEDLVESELEKLHVACRDWGFF  86



>gb|KHG24159.1| S-norcoclaurine synthase 1 [Gossypium arboreum]
Length=333

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 53/88 (60%), Gaps = 8/88 (9%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            METGV  + +  G SLPV +VQ +A +N   IPSRY+R   + +  +  E   +  +PVI
Sbjct  1    METGV-INREGFGGSLPVENVQALASKNLKDIPSRYIRPEVEFDVVSIDE---SYQIPVI  56

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            D+ KL      D E QKLH ACKDWGFF
Sbjct  57   DMSKL----GHDDEQQKLHLACKDWGFF  80



>ref|XP_010057199.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
isoform X1 [Eucalyptus grandis]
 gb|KCW74245.1| hypothetical protein EUGRSUZ_E02882 [Eucalyptus grandis]
Length=372

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG SLPVPSVQ++AK+    +P RY+R              S   VPVIDL KL S 
Sbjct  17   VNKLGGSLPVPSVQELAKKAITELPPRYIRTDLD-------HGTSLLQVPVIDLSKLSSS  69

Query  211  --EWGDSELQKLHFACKDWGFF  270
              +  +SEL+KLH AC+DWGFF
Sbjct  70   DGDLTESELEKLHSACRDWGFF  91



>ref|XP_010059078.1| PREDICTED: uncharacterized protein LOC104446988 [Eucalyptus grandis]
Length=741

 Score = 70.9 bits (172),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++ +  +LG+SLPVP VQ++AK+    +P RYVR                  VPVID+ K
Sbjct  1    MEVNLMKLGSSLPVPCVQELAKDAITEVPPRYVRTDQDHPFMGDDHGSLLLQVPVIDMTK  60

Query  199  LLS--EEWGDSELQKLHFACKDWGFF  270
            L S  ++  +SEL+KLH AC+DWGFF
Sbjct  61   LSSSHDDLVESELEKLHVACRDWGFF  86


 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/83 (49%), Positives = 49/83 (59%), Gaps = 12/83 (14%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE-  213
            +LG SLPVPSVQ++AKE    +P RY+R              S   VPVIDL KL S + 
Sbjct  381  KLGGSLPVPSVQELAKEAITKLPPRYIRTDLD-------HGTSLLQVPVIDLSKLSSSDG  433

Query  214  ----WGDSELQKLHFACKDWGFF  270
                  +SEL+KLH ACKDWGFF
Sbjct  434  NLGALTESELEKLHSACKDWGFF  456



>ref|XP_010057200.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=364

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 49/82 (60%), Gaps = 9/82 (11%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG SLPVPSVQ++AK+    +P RY+R              S   VPVIDL KL S 
Sbjct  17   VNKLGGSLPVPSVQELAKKAITELPPRYIRTDLD-------HGTSLLQVPVIDLSKLSSS  69

Query  211  --EWGDSELQKLHFACKDWGFF  270
              +  +SEL+KLH AC+DWGFF
Sbjct  70   DGDLTESELEKLHSACRDWGFF  91



>ref|XP_009757204.1| PREDICTED: thebaine 6-O-demethylase-like isoform X1 [Nicotiana 
sylvestris]
Length=77

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 12/80 (15%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            ++++G++L VPSVQ++ K+  AV P RY+R+    +   P        VPVID++KLL+ 
Sbjct  6    SRKIGSTLKVPSVQELVKQQIAV-PLRYIRD----DIEMPMTSSILPQVPVIDMEKLLA-  59

Query  211  EWGDSELQKLHFACKDWGFF  270
                  +Q+LHFAC DWGFF
Sbjct  60   ------IQRLHFACIDWGFF  73



>ref|XP_009757210.1| PREDICTED: thebaine 6-O-demethylase-like isoform X2 [Nicotiana 
sylvestris]
Length=77

 Score = 65.9 bits (159),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 12/80 (15%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            ++++G++L VPSVQ++ K+  AV P RY+R+    +   P        VPVID++KLL+ 
Sbjct  6    SRKIGSTLKVPSVQELVKQQIAV-PLRYIRD----DIEMPMTSSILPQVPVIDMEKLLA-  59

Query  211  EWGDSELQKLHFACKDWGFF  270
                  +Q+LHFAC DWGFF
Sbjct  60   ------IQRLHFACIDWGFF  73



>ref|XP_002889198.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65457.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata]
Length=357

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (68%), Gaps = 2/80 (3%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKE-NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            +R  +SL VPSV ++ KE N   +P RYVR   +G++    +   +S++PVID+++L S 
Sbjct  7    ERQWSSLIVPSVLEIVKEKNFTTVPPRYVR-PDQGKTEILNDSSLSSEIPVIDMKRLCSV  65

Query  211  EWGDSELQKLHFACKDWGFF  270
               DSEL+KL FAC+DWGFF
Sbjct  66   SAMDSELKKLDFACQDWGFF  85



>ref|XP_003517890.1| PREDICTED: protein SRG1-like isoform X1 [Glycine max]
 gb|KHN15647.1| Protein SRG1 [Glycine soja]
Length=354

 Score = 69.3 bits (168),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 37/78 (47%), Positives = 51/78 (65%), Gaps = 5/78 (6%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG SL VPSV ++AK+    +P RYVR     + P  ++  S   VPVIDL KL SE+ 
Sbjct  7    KLGTSLLVPSVHELAKQPMTKVPERYVR---LNQDPVVSDTISLPQVPVIDLNKLFSED-  62

Query  217  GDSELQKLHFACKDWGFF  270
              +E++KL+ ACK+WGFF
Sbjct  63   -GTEVEKLNQACKEWGFF  79



>ref|XP_002519762.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF42735.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=188

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 54/77 (70%), Gaps = 4/77 (5%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG+SL VP   ++AK++ A +P+RYVR   +     P    S+  VPVID++KLLSE++ 
Sbjct  10   LGSSLRVP---ELAKKSLASVPTRYVR-SDQDPPFIPTSSSSSPQVPVIDMEKLLSEQFM  65

Query  220  DSELQKLHFACKDWGFF  270
            D+EL+K H ACKDWGFF
Sbjct  66   DTELEKFHNACKDWGFF  82



>ref|XP_009376718.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=363

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 54/95 (57%), Gaps = 13/95 (14%)
 Frame = +1

Query  4    SMETGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSA----S  171
            SME          G SLPVPSVQ++ ++    IP RYV+       P   E  S+     
Sbjct  3    SMEEKAFAGKSVYGGSLPVPSVQELVQKPILTIPPRYVQ-------PLHQEIISSDHHTH  55

Query  172  DVPVIDLQKLLSEE--WGDSELQKLHFACKDWGFF  270
             +P ID+QKLLS+E    +SEL +LHFAC++WGFF
Sbjct  56   QIPSIDMQKLLSQESTISESELARLHFACQEWGFF  90



>ref|XP_002532986.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF29394.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=368

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAV-IPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            LG S+ VPSVQ++AK+   V IPSRY R   +       +  S   VPVIDL++L++ + 
Sbjct  13   LGNSILVPSVQELAKDQSLVKIPSRYERLNQEDSLNIADDGSSLLSVPVIDLERLVAGDP  72

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL+KLH AC +WGFF
Sbjct  73   MDSELEKLHSACIEWGFF  90



>ref|XP_006389976.1| hypothetical protein EUTSA_v10018772mg [Eutrema salsugineum]
 gb|ESQ27262.1| hypothetical protein EUTSA_v10018772mg [Eutrema salsugineum]
Length=356

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKE-NPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            +R  +SL VP V +M KE N   +P RYVR   +  S    +   +S++PVID+++L S 
Sbjct  6    ERQWSSLIVPCVLEMVKEQNLTTVPPRYVR-SDQETSENLDDSSMSSEIPVIDMKRLYSV  64

Query  211  EWGDSELQKLHFACKDWGFF  270
               DSEL+KL FAC+DWGFF
Sbjct  65   STMDSELEKLDFACQDWGFF  84



>emb|CDY52434.1| BnaA07g39110D [Brassica napus]
Length=358

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 51/75 (68%), Gaps = 3/75 (4%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
            +SL VPSV ++AKEN   +P RY+R   + ++    + C +S +PVID+Q+L S    D+
Sbjct  10   SSLLVPSVLEIAKEN--TVPPRYLR-SDQDKTDTLDDSCLSSKLPVIDMQRLCSVSAMDT  66

Query  226  ELQKLHFACKDWGFF  270
            EL+KL  AC+DWGFF
Sbjct  67   ELEKLDLACQDWGFF  81



>ref|XP_006355576.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=216

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  58   VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS---E  228
            VPSVQ++AK+    IPSRYVR+     S A +   +  +VPVID+Q+L++    D    E
Sbjct  11   VPSVQELAKKKLVTIPSRYVRDDHDNSSIA-SNDRNNKEVPVIDMQRLVNSNDHDIMNLE  69

Query  229  LQKLHFACKDWGFF  270
            L KLHFA + WGFF
Sbjct  70   LNKLHFAAQHWGFF  83



>gb|KDP21186.1| hypothetical protein JCGZ_21657 [Jatropha curcas]
Length=364

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = +1

Query  28   DTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLS  207
            +  +LG SL VP VQ++AKE    +P RY+R     +SP  +       VP+ID+ KL S
Sbjct  6    ELTKLGTSLLVPCVQELAKEPLTNVPPRYLR--LDQDSPIVSNSAYLPQVPIIDMSKLFS  63

Query  208  EEWGDSELQKLHFACKDWGFF  270
            +E  D EL +L  ACK+WGFF
Sbjct  64   QESMDFELDRLDRACKEWGFF  84



>ref|XP_009376719.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 13/82 (16%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSA----SDVPVIDLQKLLSE  210
            G SLPVPSVQ++ ++    IP RYV+       P   E  S+      +P ID+QKLLS+
Sbjct  13   GGSLPVPSVQELVQKPILTIPPRYVQ-------PLHQEIISSDHHTHQIPSIDMQKLLSQ  65

Query  211  E--WGDSELQKLHFACKDWGFF  270
            E    +SEL +LHFAC++WGFF
Sbjct  66   ESTISESELARLHFACQEWGFF  87



>ref|XP_010089186.1| Protein SRG1 [Morus notabilis]
 gb|EXC36144.1| Protein SRG1 [Morus notabilis]
Length=293

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 47/77 (61%), Gaps = 3/77 (4%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE-EWG  219
            G+SL VPSVQ++ KE    +PSRY+R     ++       S S++PVI+ Q LL   E  
Sbjct  4    GSSLLVPSVQELVKEPIITVPSRYIRPDQYDKTSNKI--ISVSEIPVINFQNLLCHGELS  61

Query  220  DSELQKLHFACKDWGFF  270
            +SEL   H AC+DWGFF
Sbjct  62   ESELASFHSACRDWGFF  78



>ref|XP_009376717.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=363

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 13/95 (14%)
 Frame = +1

Query  4    SMETGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCS----AS  171
            SME          G SLPVPSVQ++ ++    IP RYV+       P   E  S    A 
Sbjct  3    SMEEKAFAGKSLYGGSLPVPSVQELVQKPILTIPPRYVQ-------PLHQEIISSDHHAH  55

Query  172  DVPVIDLQKLLSEE--WGDSELQKLHFACKDWGFF  270
             +P ID+QKLLS+E    + EL +LHFAC++WGFF
Sbjct  56   QIPSIDMQKLLSQESTISEPELARLHFACQEWGFF  90



>ref|XP_010540138.1| PREDICTED: protein SRG1-like [Tarenaya hassleriana]
Length=387

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 56/96 (58%), Gaps = 17/96 (18%)
 Frame = +1

Query  13   TGVKTDTQRLGASLPVPSVQQMAK--ENPAVIPSRYVR--------EGGKGESPAPAEPC  162
              ++ + +R  +SL VPSVQ++ K  EN A +P RYVR        E   G  P P    
Sbjct  27   VAMEVEGKRQWSSLIVPSVQELVKDHENNADVPPRYVRWSDPDKADEIVDGFGPRP----  82

Query  163  SASDVPVIDLQKLLSEEWGDSELQKLHFACKDWGFF  270
               ++P+ID+ +L SE   DSE+QKL FAC++WGFF
Sbjct  83   ---EIPIIDMNRLCSESAMDSEIQKLDFACREWGFF  115



>gb|AFK39688.1| unknown [Lotus japonicus]
Length=356

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG SL VPSVQ++AK+    +P +YVR     E P  +   S   VPVID  KL S+
Sbjct  6    VMKLGTSLAVPSVQELAKQPITKVPEQYVRPN--QEPPVISNTTSLPQVPVIDFNKLFSD  63

Query  211  EWGDSELQKLHFACKDWGFF  270
            +   +EL+KL  ACK+WGFF
Sbjct  64   D--GAELEKLDHACKEWGFF  81



>gb|KDO39453.1| hypothetical protein CISIN_1g046251mg [Citrus sinensis]
Length=74

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            ++G SL VP VQ+  K    V+P RY+R     +SP  ++    S +P+ID+Q LLSEE 
Sbjct  3    KIGGSLLVPCVQEWVKNPMLVVPPRYIRPDE--DSPLNSDDTLISQIPIIDMQSLLSEES  60

Query  217  GDSELQKLHFACKD  258
             DSEL KL FACK+
Sbjct  61   MDSELAKLDFACKE  74



>ref|XP_008366518.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=365

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 6/93 (6%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVR---EGGKGESPAPAEPCSASDV  177
            ME          G SL VPSVQ+  K+    IP RY++   + G+ E    ++   A  +
Sbjct  1    MEKTTSARKSLYGGSLHVPSVQEFVKKPILTIPPRYLQPHYQDGEHEMIINSD-HHAHQI  59

Query  178  PVIDLQKLLSEEWGDSE--LQKLHFACKDWGFF  270
            P ID+QKLLS++  +SE  L +LHFACK+WGFF
Sbjct  60   PSIDMQKLLSQZSTNSEAELARLHFACKEWGFF  92



>ref|XP_006575845.1| PREDICTED: protein SRG1-like [Glycine max]
Length=316

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 6/79 (8%)
 Frame = +1

Query  37   RLGASLP-VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            +LG SL  VPSV ++AK+   ++P RY+      + P   E  ++  VPVIDL KLLSE+
Sbjct  8    KLGTSLLLVPSVHELAKQPMTIVPERYIH---PNQDPPSVEFATSHQVPVIDLNKLLSED  64

Query  214  WGDSELQKLHFACKDWGFF  270
              ++EL+K   ACK+WGFF
Sbjct  65   --ENELEKFDLACKEWGFF  81



>ref|XP_010096601.1| Protein SRG1 [Morus notabilis]
 gb|EXB65269.1| Protein SRG1 [Morus notabilis]
Length=359

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREG-GKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            G SLPVPSVQ++ + +P  +P RY+++   +    +      +SD+PVID   L+S +  
Sbjct  10   GKSLPVPSVQEIVRNDPKFVPERYIQDHKNRPVLDSTTFGSDSSDIPVIDFSLLISGD--  67

Query  220  DSELQKLHFACKDWGFF  270
            + EL KL FACK+WGFF
Sbjct  68   EDELNKLDFACKEWGFF  84



>ref|XP_010498039.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=361

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M KE     +PSRYVR               ++++P+ID+++L S    D
Sbjct  12   SSIIVPSVQEMVKEKIITTVPSRYVRSDQDKTDVVDDSGRLSTEIPIIDMKRLCSSTAMD  71

Query  223  SELQKLHFACKDWGFF  270
            SE++KL FACK+WGFF
Sbjct  72   SEVEKLDFACKEWGFF  87



>ref|XP_002278096.3| PREDICTED: protein SRG1-like [Vitis vinifera]
 emb|CBI31645.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = +1

Query  10   ETGVKTDTQRLG--ASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVP  180
            E GV  + Q LG   SLPVPSVQ++ K +   +P RY++E      P  ++ C  +S +P
Sbjct  6    ENGVMQEHQELGWGKSLPVPSVQEIVKNDSQSVPERYIQE--HKNRPLGSDSCPVSSQIP  63

Query  181  VIDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            +IDL  L   +  + E  KL+FACK+WGFF
Sbjct  64   IIDLHLLACGD--EDERTKLNFACKEWGFF  91



>ref|XP_010540139.1| PREDICTED: protein SRG1-like [Tarenaya hassleriana]
Length=381

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENP-AVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDL  192
            ++ +  R  +SLPVPSVQ+M KE     +P RYVR +  K E      P     +PV+D+
Sbjct  24   MEANVARRWSSLPVPSVQEMVKEKKFTTVPPRYVRSDLDKAEIEDEFGP--KLKIPVVDV  81

Query  193  QKLLSEEWGDSELQKLHFACKDWGFF  270
            ++L S+   DSEL+KL FAC++WGFF
Sbjct  82   ERLRSDTIMDSELEKLDFACREWGFF  107



>ref|XP_008238358.1| PREDICTED: S-norcoclaurine synthase 1-like [Prunus mume]
Length=369

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            MET V +  + LG SLPV +VQ +A  N   IP RY+R   + E  +  +      +PV+
Sbjct  12   METEVLS-RKDLGGSLPVENVQALASNNLKEIPPRYIRPEIEHEEVSMEDSLQ---IPVV  67

Query  187  DLQKLLSEEWGD-SELQKLHFACKDWGFF  270
            D+ KL+ +  G   EL KLH ACKDWGFF
Sbjct  68   DMSKLMGDPLGHGDELAKLHLACKDWGFF  96



>gb|AFK41350.1| unknown [Lotus japonicus]
Length=356

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 4/80 (5%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
              +LG SL VPSVQ++AK+    +P +YVR     E P  +   S   VPVID  KL S+
Sbjct  6    VMKLGTSLAVPSVQELAKQPITKVPEQYVRPN--QEPPVISNTTSLPQVPVIDFNKLFSD  63

Query  211  EWGDSELQKLHFACKDWGFF  270
            +    EL+KL  ACK+WGFF
Sbjct  64   D--GVELEKLDHACKEWGFF  81



>ref|XP_007158816.1| hypothetical protein PHAVU_002G184400g [Phaseolus vulgaris]
 gb|ESW30810.1| hypothetical protein PHAVU_002G184400g [Phaseolus vulgaris]
Length=359

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/74 (49%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = +1

Query  49   SLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSE  228
            SL VP VQ++AKE    +P RYVR     E P  +       VP+IDL KL S +  ++E
Sbjct  7    SLTVPFVQEIAKEALTSVPERYVRP--LHERPILSTTTPLPQVPIIDLSKLFSPDLKETE  64

Query  229  LQKLHFACKDWGFF  270
            LQ LH ACK+WGFF
Sbjct  65   LQNLHCACKEWGFF  78



>gb|AFK33687.1| unknown [Lotus japonicus]
Length=113

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 3/74 (4%)
 Frame = +1

Query  52   LPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS-DVPVIDLQKLLSEEWGDSE  228
            L VP VQ++AKE    +P RYVR     E PA     +    +P+IDL KLLS++    E
Sbjct  6    LAVPFVQELAKEKLTRVPERYVR--LHNERPALYNSSTTPLPLPIIDLSKLLSKDHKVPE  63

Query  229  LQKLHFACKDWGFF  270
            L++LH ACK+WGFF
Sbjct  64   LERLHQACKEWGFF  77



>ref|XP_006442327.1| hypothetical protein CICLE_v10020829mg [Citrus clementina]
 gb|ESR55567.1| hypothetical protein CICLE_v10020829mg [Citrus clementina]
Length=356

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +   SL V  VQ++AK    V+P RY+R   +  +   ++    S +PVID+Q LLSEE 
Sbjct  3    KFRGSLSVHCVQELAKNPTLVVPPRYIR-PDQDATTIISDDALVSKLPVIDMQSLLSEES  61

Query  217  GDSELQKLHFACKDWGFF  270
             DSEL KL  ACK+WGFF
Sbjct  62   MDSELAKLDSACKEWGFF  79



>ref|XP_010476833.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M +E     +P RYVR   + ++    +   ++++P+ID+++L S    D
Sbjct  10   SSIIVPSVQEMVEEKMITTVPPRYVRYDHEDKTEVLDDSGLSTEIPIIDMKRLCSSTAVD  69

Query  223  SELQKLHFACKDWGFF  270
            SE++KL FACK+WGFF
Sbjct  70   SEVEKLDFACKEWGFF  85



>ref|XP_007209291.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
 gb|EMJ10490.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
Length=358

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 52/89 (58%), Gaps = 5/89 (6%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            MET V +  + LG SLPV +VQ +A  N   IP RY+R   + E  +  +      +PV+
Sbjct  1    METEVLS-RKDLGGSLPVENVQALASNNLKEIPPRYIRPEIEHEEVSMEDSLQ---IPVV  56

Query  187  DLQKLLSEEWGD-SELQKLHFACKDWGFF  270
            D+ KL+ +  G   EL KLH ACKDWGFF
Sbjct  57   DMSKLIGDPLGHGEELAKLHLACKDWGFF  85



>ref|XP_011028238.1| PREDICTED: S-norcoclaurine synthase 1-like isoform X2 [Populus 
euphratica]
Length=357

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +1

Query  22   KTDTQR-LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            + D +R LG SLPV ++Q +A  N   +PSRY+R   + +  +  E      +PVID+ K
Sbjct  4    EVDRRRDLGGSLPVENMQALASRNLKDVPSRYIRPELQFDEVSVDESLH---IPVIDMSK  60

Query  199  LLSEEWGD-SELQKLHFACKDWGFF  270
            L++++ G   EL KLH ACK+WGFF
Sbjct  61   LVADQLGQQDELAKLHLACKEWGFF  85



>ref|XP_011028237.1| PREDICTED: S-norcoclaurine synthase 1-like isoform X1 [Populus 
euphratica]
Length=358

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +1

Query  22   KTDTQR-LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            + D +R LG SLPV ++Q +A  N   +PSRY+R   + +  +  E      +PVID+ K
Sbjct  4    EVDRRRDLGGSLPVENMQALASRNLKDVPSRYIRPELQFDEVSVDESLH---IPVIDMSK  60

Query  199  LLSEEWGD-SELQKLHFACKDWGFF  270
            L++++ G   EL KLH ACK+WGFF
Sbjct  61   LVADQLGQQDELAKLHLACKEWGFF  85



>ref|XP_006489639.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG+SL VP VQ++ KE    IP RY+R     + P       +  +P+ID+ KLLS+  G
Sbjct  8    LGSSLAVPYVQELVKEPLTAIPPRYLRP--DQDPPFACNTNLSQQLPIIDMDKLLSDS-G  64

Query  220  DS---ELQKLHFACKDWGFF  270
            DS   EL+ LH AC+DWGFF
Sbjct  65   DSTHSELENLHMACRDWGFF  84



>emb|CDP18687.1| unnamed protein product [Coffea canephora]
Length=172

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 50/78 (64%), Gaps = 3/78 (4%)
 Frame = +1

Query  31   TQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSE  210
            T++LG SL VP VQ++AKENP+ +P+RY+R   K + P  +       + V+D+Q L + 
Sbjct  5    TRKLGGSLKVPFVQELAKENPSSVPTRYIRP-DKDQYPTISNGGFFHQIQVVDMQCLFNS  63

Query  211  --EWGDSELQKLHFACKD  258
              E  D ELQKLH ACK+
Sbjct  64   TVEITDLELQKLHSACKE  81



>ref|XP_002279625.1| PREDICTED: S-norcoclaurine synthase 1 [Vitis vinifera]
 emb|CBI33969.3| unnamed protein product [Vitis vinifera]
Length=349

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 6/77 (8%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G SLPV +VQ +A +N   IP R +R   + E     E   +  +P+ID++KL+ +   
Sbjct  7    FGGSLPVANVQALASDNSGDIPIRDLRAELQSEEVLVDE---SPHIPIIDMRKLMVD---  60

Query  220  DSELQKLHFACKDWGFF  270
            D E++KLHFACKDWGFF
Sbjct  61   DDEMEKLHFACKDWGFF  77



>ref|XP_006355575.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=358

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 6/74 (8%)
 Frame = +1

Query  58   VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS---E  228
            VPSVQ+MAK     IPSRYVR+       A +   +  +VPVID+Q+L++    DS   E
Sbjct  16   VPSVQEMAKNKLVTIPSRYVRDNQDRSFVASS---NNKEVPVIDMQRLINSSDHDSMNLE  72

Query  229  LQKLHFACKDWGFF  270
            L KLHFA K+WGFF
Sbjct  73   LNKLHFAAKEWGFF  86



>gb|AFN53719.1| putative Fe(II) oxygenase superfamily protein [Linum usitatissimum]
Length=1022

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 56/94 (60%), Gaps = 12/94 (13%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKE--NPAVIPSRYVREGGKGESPAPAEPCSASDVP  180
            ME   K    +LG  LPVP VQ++AK+    A +P RY+R+      P  A   SA +VP
Sbjct  1    MEEEQKELPNKLGKCLPVPWVQELAKDPLFAAAVPPRYIRQ------PHDAIVSSAVEVP  54

Query  181  VIDLQKLL----SEEWGDSELQKLHFACKDWGFF  270
            VIDL+K++    +++  D EL +LH ACK WGFF
Sbjct  55   VIDLRKIVCPPSTDDVADDELGRLHEACKHWGFF  88



>ref|XP_002268288.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=364

 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 3/72 (4%)
 Frame = +1

Query  58   VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVPVIDLQKLLSEEWGDSELQ  234
            VP VQ++ KE    +P RYVR   + +SP  +    S   VP+IDL +LLS ++  SEL+
Sbjct  14   VPCVQELVKEPLTAVPHRYVRP--EQDSPVLSNATDSMPHVPIIDLHRLLSADFTHSELE  71

Query  235  KLHFACKDWGFF  270
            KLH AC++WGFF
Sbjct  72   KLHRACQEWGFF  83



>ref|XP_010095129.1| Protein SRG1 [Morus notabilis]
 gb|EXB58295.1| Protein SRG1 [Morus notabilis]
Length=367

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 42/87 (48%), Positives = 51/87 (59%), Gaps = 8/87 (9%)
 Frame = +1

Query  25   TDTQRLGASLPVPSVQQMAKENPAV--IPSRYVREGGKGESPA-PAEPCSASDVPVIDLQ  195
            T   +LG SL VPSVQ++AKE   +  +P RYVR   + + P       S   VPVID+ 
Sbjct  5    TSIAKLGGSLAVPSVQELAKETTTLKAVPERYVR---RDQDPTFIPNITSLPQVPVIDMN  61

Query  196  KLLSEEWG--DSELQKLHFACKDWGFF  270
             LLS E     SELQKLH A K+WGFF
Sbjct  62   NLLSLEKDVLQSELQKLHLASKEWGFF  88



>ref|XP_010459259.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M +E     +P RYVR   + ++    +   ++++P+ID+++L +    D
Sbjct  10   SSIIVPSVQEMVEEKMITTVPPRYVRYDHEDKTEVLDDSGLSTEIPIIDMKRLCASTAVD  69

Query  223  SELQKLHFACKDWGFF  270
            SE++KL FACK+WGFF
Sbjct  70   SEIEKLDFACKEWGFF  85



>ref|XP_009376721.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 13/82 (16%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCS----ASDVPVIDLQKLLSE  210
            G SL VPSVQ++ K+    IP RY++       P   E  S    A  +P ID+QKLLS+
Sbjct  13   GGSLLVPSVQELVKKPILTIPPRYIQ-------PHHQEIISSDHHAHQIPSIDMQKLLSQ  65

Query  211  E--WGDSELQKLHFACKDWGFF  270
            E    ++EL +LHFAC++WGFF
Sbjct  66   ESTISEAELARLHFACQEWGFF  87



>ref|XP_009376720.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=360

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 50/82 (61%), Gaps = 13/82 (16%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCS----ASDVPVIDLQKLLSE  210
            G SL VPSVQ++ K+    IP RY++       P   E  S    A  +P ID+QKLLS+
Sbjct  13   GGSLLVPSVQELVKKPILTIPPRYIQ-------PHHQEIISSDHHAHQIPSIDMQKLLSQ  65

Query  211  E--WGDSELQKLHFACKDWGFF  270
            E    ++EL +LHFAC++WGFF
Sbjct  66   ESTISEAELARLHFACQEWGFF  87



>ref|XP_006378698.1| hypothetical protein POPTR_0010s20860g [Populus trichocarpa]
 gb|ERP56495.1| hypothetical protein POPTR_0010s20860g [Populus trichocarpa]
Length=299

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 51/77 (66%), Gaps = 5/77 (6%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVPVIDLQKLLSEEWG  219
            G SLPVPSVQ+M +++   +P RY++E    + P   E C ++S++PVI+   L++ +  
Sbjct  19   GKSLPVPSVQEMVRKDSQCVPERYIQE--HKDRPVETEMCPTSSEIPVINFSLLVNGD--  74

Query  220  DSELQKLHFACKDWGFF  270
            + E +KL  ACK+WGFF
Sbjct  75   EDERRKLDLACKEWGFF  91



>ref|XP_002890198.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66457.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M KE     +P RYVR   + ++    +    +++P+IDL++L S    D
Sbjct  10   SSILVPSVQEMVKEKTITTVPPRYVR-SDQDKTKVDDDFDVKTEIPIIDLKRLCSSTTMD  68

Query  223  SELQKLHFACKDWGFF  270
            SE++KL FACK+WGFF
Sbjct  69   SEVEKLDFACKEWGFF  84



>gb|KCW54631.1| hypothetical protein EUGRSUZ_I00575 [Eucalyptus grandis]
Length=295

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 7/83 (8%)
 Frame = +1

Query  25   TDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLL  204
            T     G S+ VPSVQ++A++    +P RYVR     E P   +  ++  VPV+D+Q+L 
Sbjct  12   TVAVNFGRSIIVPSVQELARKPIVNLPPRYVR-CSDDEDPVSGD--ASESVPVVDVQRLA  68

Query  205  SEEWGD-SELQKLHFACKDWGFF  270
                GD  EL+KLHFACKDWGFF
Sbjct  69   R---GDPVELEKLHFACKDWGFF  88



>ref|XP_006355577.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=359

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 7/76 (9%)
 Frame = +1

Query  52   LPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS--  225
            + VPSVQ++AK+    IPSRYVR+    +        +   VPVID+Q+L++    DS  
Sbjct  9    MEVPSVQELAKKKLMTIPSRYVRD----DQDRSIATSNYKQVPVIDMQRLINSNDHDSMN  64

Query  226  -ELQKLHFACKDWGFF  270
             EL KLHFA KDWGFF
Sbjct  65   LELNKLHFAAKDWGFF  80



>gb|KHM98992.1| Codeine O-demethylase [Glycine soja]
Length=298

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +1

Query  19   VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQK  198
            ++ +T +LG+SL V SV+++AKE    +P RYV      E P      +   +P+IDL K
Sbjct  1    MEPETAKLGSSLLVDSVKELAKEALIKVPERYVHP--NIEPPILFHKDTLPQLPIIDLNK  58

Query  199  LLSEEWGDSELQKLHFACKDWGFF  270
            LLSE+   +EL+KL FACK+WGFF
Sbjct  59   LLSEDV--TELEKLDFACKEWGFF  80



>ref|XP_006355578.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 4/79 (5%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG SLPVPSVQQ+AK +P  +P+RY+R+        P       ++P+I+++ LL    
Sbjct  11   KLGGSLPVPSVQQLAKGSPENVPARYLRDDDHLLLVPPMMKFDHYNIPIINMESLLR---  67

Query  217  GDS-ELQKLHFACKDWGFF  270
            GD  E  KL  AC++WGFF
Sbjct  68   GDEFEFNKLDSACREWGFF  86



>ref|XP_010476836.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 50/76 (66%), Gaps = 2/76 (3%)
 Frame = +1

Query  46   ASLPVPSVQQMAKEN-PAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M KE     +PSRYVR   + ++    +     ++P+ID+++L S    D
Sbjct  10   SSIIVPSVQEMVKEKMITTVPSRYVR-SVEDKTEVADDSGLNVEIPIIDMKRLCSPTAMD  68

Query  223  SELQKLHFACKDWGFF  270
            SE+QKL FACK+WGFF
Sbjct  69   SEVQKLDFACKEWGFF  84



>ref|XP_002519769.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42742.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=363

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 5/89 (6%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPA-PAEPCSASDVPV  183
            MET ++ D    G S+ VPSVQ++AK +   IP+RY R     +SP    +  S   VPV
Sbjct  1    METSLEADN--FGKSIIVPSVQELAKASLIEIPTRYARL--NQDSPIISGDGLSHLCVPV  56

Query  184  IDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            IDL +L + +  D EL++LH AC++WGFF
Sbjct  57   IDLDRLNAGDSVDLELERLHLACREWGFF  85



>ref|XP_011042009.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=354

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSAS-DVPVIDLQKLLSE  210
            + L +S+PVPSVQ++A      +PSRY+RE    +S     P   +  VP+ID+ KL+  
Sbjct  6    KNLESSIPVPSVQELASLKLETVPSRYIREDM--DSIIGTVPSDRTLRVPLIDMAKLVDS  63

Query  211  EWGDSELQKLHFACKDWGFF  270
            E  ++ELQK H ACK+WG F
Sbjct  64   ESQETELQKFHAACKEWGVF  83



>ref|XP_007149079.1| hypothetical protein PHAVU_005G039300g [Phaseolus vulgaris]
 gb|ESW21073.1| hypothetical protein PHAVU_005G039300g [Phaseolus vulgaris]
Length=355

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVRE--GGKGESPAPAEPCSASDVPVIDLQKLLSE  210
             L +S+ VPSVQ++A + P  +P RY+R+  G     P P++P  +  VP ID+ KL++ 
Sbjct  7    NLESSVSVPSVQELAFQRPEKVPPRYIRDEDGDDIIGPYPSDP--SLHVPCIDMAKLVNA  64

Query  211  EWGDSELQKLHFACKDWGFF  270
                 ELQKL  ACKDWG F
Sbjct  65   HTHQLELQKLFLACKDWGVF  84



>ref|XP_004490337.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=348

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/78 (46%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = +1

Query  37   RLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEW  216
            +LG SL VPSV ++AK++   IP +Y++     +    +   S   VPVIDL KLL E+ 
Sbjct  3    KLGTSLLVPSVHELAKQSILEIPEQYLQS--NQDPIVISNTTSLPQVPVIDLSKLLHED-  59

Query  217  GDSELQKLHFACKDWGFF  270
             ++EL+KLH ACK+WGFF
Sbjct  60   -ETELEKLHHACKEWGFF  76



>emb|CDX94460.1| BnaC01g17240D [Brassica napus]
Length=108

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 6/77 (8%)
 Frame = +1

Query  46   ASLPVPSVQQMAKEN-PAVIPSRYVR-EGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            +S+ VPSVQ+M +EN    +P RY+R +  K E  +       +++P++D+  L S    
Sbjct  10   SSIIVPSVQEMVEENLITTVPPRYLRSDLDKAEIDSDLR----TEIPIVDMNLLCSSTSM  65

Query  220  DSELQKLHFACKDWGFF  270
            DSE++KL FACK+WGFF
Sbjct  66   DSEIEKLDFACKEWGFF  82



>ref|XP_010027975.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW54630.1| hypothetical protein EUGRSUZ_I00575 [Eucalyptus grandis]
Length=364

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 50/78 (64%), Gaps = 7/78 (9%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
             G S+ VPSVQ++A++    +P RYVR     E P   +  ++  VPV+D+Q+L     G
Sbjct  17   FGRSIIVPSVQELARKPIVNLPPRYVR-CSDDEDPVSGD--ASESVPVVDVQRLAR---G  70

Query  220  D-SELQKLHFACKDWGFF  270
            D  EL+KLHFACKDWGFF
Sbjct  71   DPVELEKLHFACKDWGFF  88



>gb|AFK47220.1| unknown [Lotus japonicus]
Length=317

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEE  213
            + LG SL VPSVQ++AK+    +P RY+R     E P  +   S   VPVI+LQKLLSE+
Sbjct  7    KNLGTSLVVPSVQELAKQPMTKVPERYLRP--IQEQPRLSNTHSLPQVPVINLQKLLSED  64

Query  214  WGDSELQKLHFACKDWGFF  270
               +EL+KL  A K+WGFF
Sbjct  65   --ATELEKLDCAGKEWGFF  81



>gb|KDP20395.1| hypothetical protein JCGZ_05278 [Jatropha curcas]
Length=345

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 48/85 (56%), Gaps = 13/85 (15%)
 Frame = +1

Query  34   QRLGASLPVPSVQQMAKENPAVIPSRYVRE------GGKGESPAPAEPCSASDVPVIDLQ  195
            + L  SLPVPSVQ++  +    +P RY+R+           SP P        VP+ID+ 
Sbjct  4    ENLQWSLPVPSVQELVLQQIQTVPPRYIRDDLFIYPSDDHHSPRPR-------VPLIDMT  56

Query  196  KLLSEEWGDSELQKLHFACKDWGFF  270
            KL++ +   SELQKLH ACKDWG F
Sbjct  57   KLVNPDSQSSELQKLHSACKDWGLF  81



>emb|CAN72414.1| hypothetical protein VITISV_032872 [Vitis vinifera]
Length=395

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = +1

Query  58   VPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPC-SASDVPVIDLQKLLSEEWGDSELQ  234
            VP VQ++ KE    +P RYVR   + +SP  +    S   VP+IDL +LLS  +  SEL+
Sbjct  14   VPCVQELVKEPLTAVPHRYVRP--EQDSPVLSNATDSMPHVPIIDLHRLLSAAFTHSELE  71

Query  235  KLHFACKDWGFF  270
            KLH AC++WGFF
Sbjct  72   KLHRACQEWGFF  83



>sp|A2A1A0.1|NCS1_COPJA RecName: Full=S-norcoclaurine synthase 1; Short=CjNCS1 [Coptis 
japonica]
 dbj|BAF45337.1| norcoclaurine synthase [Coptis japonica var. dissecta]
 gb|ADK56103.1| 2OG/Fe(II)-dependent dioxygenase-like protein [synthetic construct]
Length=352

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/77 (42%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            +G SLPV +VQ +A +    +P+RYVR   + +   P +  ++ ++PVIDL +LL +++ 
Sbjct  8    VGGSLPVENVQVLAGKELKNLPNRYVRPELEHDDVVPID--NSLEIPVIDLSRLLDQQYA  65

Query  220  DSELQKLHFACKDWGFF  270
              EL K H AC DWGFF
Sbjct  66   CDELAKFHSACLDWGFF  82



>ref|XP_006435684.1| hypothetical protein CICLE_v10033625mg [Citrus clementina]
 ref|XP_006486532.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR48924.1| hypothetical protein CICLE_v10033625mg [Citrus clementina]
Length=368

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAE---PCSASDVPVIDLQKLLSEE  213
            G SLPVPSVQ++ + +P  +P R+++E  K + P  +E   P  +S++P+I+   + + +
Sbjct  19   GKSLPVPSVQEIVRNDPQCVPERFIQE--KKDRPLDSELYIPADSSEIPIINFSLIANGD  76

Query  214  WGDSELQKLHFACKDWGFF  270
              + EL+KL  ACKDWGFF
Sbjct  77   --EDELKKLDSACKDWGFF  93



>ref|XP_010476835.1| PREDICTED: protein SRG1 [Camelina sativa]
Length=359

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M KE     +PSRYVR                +++P+ID+++L +    D
Sbjct  10   SSIIVPSVQEMVKEKIITTVPSRYVRSDQDKTDVVDDSGRLNTEIPIIDMKRLSTSTDMD  69

Query  223  SELQKLHFACKDWGFF  270
            SE++KL FACK+WGFF
Sbjct  70   SEVEKLDFACKEWGFF  85



>gb|KDO69078.1| hypothetical protein CISIN_1g046496mg [Citrus sinensis]
Length=368

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAE---PCSASDVPVIDLQKLLSEE  213
            G SLPVPSVQ++ + +P  +P R+++E  K + P  +E   P  +S++P+I+   + + +
Sbjct  19   GKSLPVPSVQEIVRNDPQCVPERFIQE--KKDRPLDSELYIPADSSEIPIINFSLIANGD  76

Query  214  WGDSELQKLHFACKDWGFF  270
              + EL+KL  ACKDWGFF
Sbjct  77   --EDELKKLDSACKDWGFF  93



>ref|XP_009772022.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=365

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 5/79 (6%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD-VPVIDLQKLLSEEW  216
            LG +L VPSVQ++A ++P  +P+RYVR+         +   S SD +P+I+++ LL    
Sbjct  10   LGGTLAVPSVQELATDSPEKVPARYVRDDQDFSPIKSSTSISFSDNIPIINMESLL---L  66

Query  217  GDS-ELQKLHFACKDWGFF  270
            GD  EL+KL  ACKDWGFF
Sbjct  67   GDEIELKKLDSACKDWGFF  85



>ref|XP_004233006.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=359

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 7/76 (9%)
 Frame = +1

Query  52   LPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS--  225
            + VPSVQ++AK+    IPSRYVR+    +           +VPVID+Q+L++    DS  
Sbjct  9    MEVPSVQELAKKKLVSIPSRYVRD----DQDRSIASSIYKEVPVIDMQRLINFNDHDSMN  64

Query  226  -ELQKLHFACKDWGFF  270
             EL KLH A KDWGFF
Sbjct  65   LELNKLHLAAKDWGFF  80



>gb|KEH22931.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=358

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = +1

Query  49   SLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDSE  228
            SLPVP+VQ+M K NP+ +P RYVR   + E      P  +S++PVIDL  L +      E
Sbjct  14   SLPVPNVQEMVKINPSQVPKRYVRNQEEMEK-VHYTPHLSSEIPVIDLTLLSNGNM--EE  70

Query  229  LQKLHFACKDWGFF  270
            L+KL  AC++WGFF
Sbjct  71   LRKLEIACREWGFF  84



>ref|XP_009371222.1| PREDICTED: S-norcoclaurine synthase 1-like [Pyrus x bretschneideri]
Length=356

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 7/89 (8%)
 Frame = +1

Query  7    METG-VKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPV  183
            MET  V    + LG SLPV +VQ +A      IP RY+R   + E   PA   ++  +PV
Sbjct  1    METDEVVFSRKDLGGSLPVENVQALASNTLKEIPPRYIRPEIEHE---PASVENSLQIPV  57

Query  184  IDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            +D+ KL  +   D EL KLH ACK+WGFF
Sbjct  58   VDINKLNDD---DDELAKLHLACKEWGFF  83



>ref|XP_006420337.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
 gb|ESR33577.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
Length=356

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 6/80 (8%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
            LG+SL VP VQ++ KE    IP +Y+R     + P       +  +P+ID+ KLLS+  G
Sbjct  8    LGSSLEVPYVQELVKEPLTAIPPQYLRP--DQDPPFACNTNLSQQLPIIDMDKLLSDS-G  64

Query  220  DS---ELQKLHFACKDWGFF  270
            DS   EL+ LH AC+DWGFF
Sbjct  65   DSTHSELENLHMACRDWGFF  84



>ref|XP_006467559.1| PREDICTED: protein SRG1-like isoform X2 [Citrus sinensis]
 gb|KDO78010.1| hypothetical protein CISIN_1g017887mg [Citrus sinensis]
Length=337

 Score = 64.3 bits (155),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 50/88 (57%), Gaps = 3/88 (3%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME   +  T   G S+ VPSVQ++  E    +P RYVR     + P+         VP+I
Sbjct  1    MEFEAEATTVNFGRSIIVPSVQELTNETIINVPPRYVR--TDQDPPSVTADTWLPSVPLI  58

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            DLQKL+ +   D EL++LH +C++WGFF
Sbjct  59   DLQKLVDDVRAD-ELERLHSSCREWGFF  85



>gb|KEH33163.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=285

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGE-SPAPAEPCSASDVPV  183
            +E  +  +++ L +SL VPSVQ+++ ++   +P RY+R+ G    S  P+   S + +P+
Sbjct  4    LEQNLTMESKTLESSLSVPSVQELSLKSSQKVPQRYIRDDGDDVFSTFPSSDPSLT-IPL  62

Query  184  IDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            ID  KL++ +    EL KLH ACK+WG F
Sbjct  63   IDKAKLVNADTQQDELHKLHLACKNWGVF  91



>ref|XP_010104366.1| S-norcoclaurine synthase 1 [Morus notabilis]
 gb|EXB99786.1| S-norcoclaurine synthase 1 [Morus notabilis]
Length=371

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = +1

Query  43   GASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            G SLPV +VQ +A EN   IPSRYVR   + +  +  +   + ++P ID+ KLL E+   
Sbjct  12   GGSLPVENVQALASENLKEIPSRYVRPEAEFDQVSVED--HSLEIPTIDMSKLLDEKHPL  69

Query  223  S---ELQKLHFACKDWGFF  270
            S   EL +LH AC+DWGFF
Sbjct  70   SPHEELARLHSACRDWGFF  88



>ref|XP_003552186.2| PREDICTED: protein SRG1-like [Glycine max]
Length=374

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +1

Query  40   LGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWG  219
              +SLPVP+VQ+M + NP  +P RY R   + E      P  +S+VPVIDL  LLS    
Sbjct  20   FASSLPVPNVQEMVRNNPLQVPERYARSQEELEK-VNHMPHLSSEVPVIDL-ALLS-NGN  76

Query  220  DSELQKLHFACKDWGFF  270
              EL KL  ACK+WGFF
Sbjct  77   KEELLKLDVACKEWGFF  93



>ref|XP_010498038.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=358

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = +1

Query  46   ASLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGD  222
            +S+ VPSVQ+M +E     +P RYVR   +  +    +   ++++P+ID+++L +    D
Sbjct  10   SSIIVPSVQEMVEEKMITTVPPRYVRYDREDITEVLDDSGLSTEIPIIDMKRLCASTAVD  69

Query  223  SELQKLHFACKDWGFF  270
            SE++KL FACK+WGFF
Sbjct  70   SEVEKLDFACKEWGFF  85



>ref|XP_008345138.1| PREDICTED: protein SRG1-like, partial [Malus domestica]
Length=368

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 52/96 (54%), Gaps = 7/96 (7%)
 Frame = +1

Query  4    SMETGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVR----EGGKGESPAPAEPCSAS  171
            +ME          G SL VPSVQ++ K+    IP RY++    +G   E          +
Sbjct  8    TMEEKAXAGKSMYGGSLLVPSVQELVKKPIVKIPPRYIQPHHQDGNYQEHDMNINSEHLA  67

Query  172  D-VPVIDLQKLLSEE--WGDSELQKLHFACKDWGFF  270
            D +P ID+ KLLS E    ++EL +LHFACK+WGFF
Sbjct  68   DQIPSIDMHKLLSXESTXSEAELARLHFACKEWGFF  103



>ref|XP_010433658.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=353

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 49/75 (65%), Gaps = 5/75 (7%)
 Frame = +1

Query  49   SLPVPSVQQMAKENP-AVIPSRYVREGGKGESPAPAEPCSASDVPVIDLQKLLSEEWGDS  225
            S+ VPSVQ+M KEN    +P RYVR  G+ ++   +E    + +P+ID+  L S    DS
Sbjct  10   SIIVPSVQEMVKENIITAVPPRYVR-SGQDKAEISSETGLRNQIPIIDMSLLSS---LDS  65

Query  226  ELQKLHFACKDWGFF  270
            E++KL FACK+WGFF
Sbjct  66   EIEKLDFACKEWGFF  80



>gb|KEH33162.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=360

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGE-SPAPAEPCSASDVPV  183
            +E  +  +++ L +SL VPSVQ+++ ++   +P RY+R+ G    S  P+   S + +P+
Sbjct  4    LEQNLTMESKTLESSLSVPSVQELSLKSSQKVPQRYIRDDGDDVFSTFPSSDPSLT-IPL  62

Query  184  IDLQKLLSEEWGDSELQKLHFACKDWGFF  270
            ID  KL++ +    EL KLH ACK+WG F
Sbjct  63   IDKAKLVNADTQQDELHKLHLACKNWGVF  91



>ref|XP_006449603.1| hypothetical protein CICLE_v10015853mg [Citrus clementina]
 gb|ESR62843.1| hypothetical protein CICLE_v10015853mg [Citrus clementina]
Length=337

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 49/88 (56%), Gaps = 3/88 (3%)
 Frame = +1

Query  7    METGVKTDTQRLGASLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASDVPVI  186
            ME   +  T   G S+ VPSVQ++  E    +P RYVR     + P+         VP+I
Sbjct  1    MEFEAEATTVNFGRSIIVPSVQELTNETIINVPPRYVR--TDQDPPSVTADTWLPSVPLI  58

Query  187  DLQKLLSEEWGDSELQKLHFACKDWGFF  270
            DLQKL+     D EL++LH AC++WGFF
Sbjct  59   DLQKLVDGVHAD-ELERLHSACREWGFF  85



>gb|EPS65204.1| hypothetical protein M569_09574, partial [Genlisea aurea]
Length=280

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  49   SLPVPSVQQMAKENPAVIPSRYVREGGKGESPAPAEPCSASD-VPVIDLQKLLSEEWGDS  225
            SL VP+VQ++AK  P  +P RYVR      + + +        VP+ID QKL      DS
Sbjct  12   SLLVPNVQELAKTKPTAVPPRYVRSDLPPPASSSSSSSIDDASVPIIDFQKLSDPNHADS  71

Query  226  ELQKLHFACKDWGFF  270
            EL+ LH AC++WGFF
Sbjct  72   ELRLLHEACREWGFF  86



Lambda      K        H        a         alpha
   0.313    0.131    0.397    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518068334520