BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21697_g1_i2 len=2088 path=[11253:0-182 @7238@!:183-562 6757:563-653
6848:654-1011 4097:1012-1043 4129:1044-1101 4187:1102-1130
4216:1131-1425 4511:1426-1451 7600:1452-1766 4843:1767-1793
10046:1794-1903 7152:1904-2055 13011:2056-2056 6872:2057-2087]

Length=2088
                                                                      Score     E

ref|XP_006362725.1|  PREDICTED: serrate RNA effector molecule-lik...    671   0.0      
ref|XP_006362726.1|  PREDICTED: serrate RNA effector molecule-lik...    671   0.0      
ref|XP_004228474.1|  PREDICTED: serrate RNA effector molecule           666   0.0      
ref|XP_006384745.1|  hypothetical protein POPTR_0004s20730g             642   0.0      
ref|XP_009606604.1|  PREDICTED: serrate RNA effector molecule iso...    642   0.0      
ref|XP_009606605.1|  PREDICTED: serrate RNA effector molecule iso...    641   0.0      
ref|XP_011006396.1|  PREDICTED: serrate RNA effector molecule           640   0.0      
ref|XP_009762196.1|  PREDICTED: serrate RNA effector molecule iso...    640   0.0      
ref|XP_009762203.1|  PREDICTED: serrate RNA effector molecule iso...    640   0.0      
ref|XP_011090242.1|  PREDICTED: serrate RNA effector molecule-like      635   0.0      
ref|XP_002312847.2|  hypothetical protein POPTR_0009s16020g             634   0.0      Populus trichocarpa [western balsam poplar]
gb|KGN66407.1|  hypothetical protein Csa_1G600970                       619   0.0      
ref|XP_011004379.1|  PREDICTED: serrate RNA effector molecule-like      624   0.0      
ref|XP_007016667.1|  C2H2 zinc-finger protein SERRATE isoform 2         621   0.0      
ref|XP_007016666.1|  C2H2 zinc-finger protein SERRATE isoform 1         621   0.0      
ref|XP_008451085.1|  PREDICTED: serrate RNA effector molecule           620   0.0      
gb|KHG13779.1|  Serrate RNA effector molecule                           617   0.0      
ref|XP_004144077.1|  PREDICTED: serrate RNA effector molecule-lik...    617   0.0      
ref|XP_004144078.1|  PREDICTED: serrate RNA effector molecule-lik...    617   0.0      
gb|KHG13780.1|  Serrate RNA effector molecule                           616   0.0      
gb|KHF98250.1|  Serrate RNA effector molecule -like protein             615   0.0      
ref|XP_010093794.1|  hypothetical protein L484_022506                   615   0.0      
ref|XP_002521645.1|  arsenite-resistance protein, putative              615   0.0      Ricinus communis
gb|KHG09660.1|  Serrate RNA effector molecule -like protein             607   0.0      
ref|XP_010659014.1|  PREDICTED: serrate RNA effector molecule-lik...    606   0.0      
ref|XP_010659013.1|  PREDICTED: serrate RNA effector molecule-lik...    606   0.0      
emb|CDP19125.1|  unnamed protein product                                605   0.0      
gb|KHG08489.1|  Serrate RNA effector molecule -like protein             603   0.0      
ref|XP_010685517.1|  PREDICTED: serrate RNA effector molecule           603   0.0      
ref|XP_007208293.1|  hypothetical protein PRUPE_ppa003365mg             595   0.0      
gb|KDP42903.1|  hypothetical protein JCGZ_23845                         601   0.0      
emb|CBI29150.3|  unnamed protein product                                599   0.0      
ref|XP_004295127.1|  PREDICTED: serrate RNA effector molecule-like      597   0.0      
ref|XP_008231073.1|  PREDICTED: serrate RNA effector molecule           593   0.0      
emb|CAN71440.1|  hypothetical protein VITISV_035521                     605   0.0      Vitis vinifera
ref|XP_010034250.1|  PREDICTED: serrate RNA effector molecule           584   0.0      
gb|EYU46136.1|  hypothetical protein MIMGU_mgv1a001592mg                584   0.0      
gb|KDO66405.1|  hypothetical protein CISIN_1g003865mg                   574   0.0      
ref|XP_010651608.1|  PREDICTED: serrate RNA effector molecule           580   0.0      
ref|XP_006470449.1|  PREDICTED: serrate RNA effector molecule-like      580   0.0      
gb|KDO66403.1|  hypothetical protein CISIN_1g003865mg                   578   0.0      
ref|XP_006446370.1|  hypothetical protein CICLE_v10014331mg             579   0.0      
ref|XP_011080508.1|  PREDICTED: serrate RNA effector molecule           563   0.0      
ref|XP_003523929.1|  PREDICTED: serrate RNA effector molecule-like      570   0.0      
ref|XP_010251619.1|  PREDICTED: serrate RNA effector molecule iso...    571   0.0      
gb|KHN48487.1|  Serrate RNA effector molecule                           562   0.0      
ref|XP_009340224.1|  PREDICTED: LOW QUALITY PROTEIN: serrate RNA ...    566   0.0      
ref|XP_010251620.1|  PREDICTED: serrate RNA effector molecule iso...    565   0.0      
ref|XP_008799465.1|  PREDICTED: serrate RNA effector molecule           564   0.0      
ref|XP_006446369.1|  hypothetical protein CICLE_v10014331mg             565   0.0      
gb|KDO66401.1|  hypothetical protein CISIN_1g003865mg                   565   0.0      
ref|XP_010523115.1|  PREDICTED: serrate RNA effector molecule           563   0.0      
ref|XP_010929331.1|  PREDICTED: serrate RNA effector molecule-lik...    557   0.0      
ref|XP_006582397.1|  PREDICTED: serrate RNA effector molecule-like      548   0.0      
ref|XP_010927258.1|  PREDICTED: serrate RNA effector molecule-lik...    551   0.0      
ref|XP_010927259.1|  PREDICTED: serrate RNA effector molecule-lik...    550   0.0      
gb|KHN26439.1|  Serrate RNA effector molecule                           541   0.0      
ref|XP_010557491.1|  PREDICTED: serrate RNA effector molecule-like      548   0.0      
ref|XP_010510813.1|  PREDICTED: serrate RNA effector molecule-like      545   0.0      
ref|XP_009403045.1|  PREDICTED: serrate RNA effector molecule-lik...    542   0.0      
ref|XP_007133532.1|  hypothetical protein PHAVU_011G187000g             536   1e-179   
gb|KDO66404.1|  hypothetical protein CISIN_1g003865mg                   536   4e-179   
gb|EYU35995.1|  hypothetical protein MIMGU_mgv1a001908mg                540   8e-179   
ref|XP_009403044.1|  PREDICTED: serrate RNA effector molecule-lik...    539   2e-178   
ref|XP_009403042.1|  PREDICTED: serrate RNA effector molecule-lik...    539   2e-178   
ref|XP_002879061.1|  hypothetical protein ARALYDRAFT_481593             538   4e-178   
ref|XP_009381593.1|  PREDICTED: serrate RNA effector molecule-like      529   8e-178   
ref|NP_565635.1|  serrate RNA effector molecule                         536   1e-177   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010929332.1|  PREDICTED: serrate RNA effector molecule-lik...    531   2e-176   
ref|XP_009403043.1|  PREDICTED: serrate RNA effector molecule-lik...    533   4e-176   
ref|XP_007148749.1|  hypothetical protein PHAVU_005G010800g             528   2e-174   
ref|XP_010417858.1|  PREDICTED: serrate RNA effector molecule-lik...    525   4e-173   
gb|AET02601.2|  serrate RNA effector molecule-like protein              524   6e-173   
ref|XP_003628125.1|  Serrate RNA effector molecule                      524   6e-173   
ref|XP_010417859.1|  PREDICTED: serrate RNA effector molecule-lik...    524   8e-173   
ref|XP_009401472.1|  PREDICTED: serrate RNA effector molecule-lik...    523   2e-172   
ref|XP_009401471.1|  PREDICTED: serrate RNA effector molecule-lik...    523   2e-172   
ref|XP_006848124.1|  hypothetical protein AMTR_s00029p00219930          522   1e-171   
ref|XP_009410216.1|  PREDICTED: serrate RNA effector molecule-like      506   9e-171   
ref|XP_006293454.1|  hypothetical protein CARUB_v10022734mg             518   2e-170   
ref|XP_010544316.1|  PREDICTED: serrate RNA effector molecule-like      517   6e-170   
ref|XP_006585692.1|  PREDICTED: serrate RNA effector molecule-lik...    510   7e-170   
ref|XP_006293453.1|  hypothetical protein CARUB_v10022733mg             516   7e-170   
gb|KHN38122.1|  Serrate RNA effector molecule                           510   1e-169   
ref|XP_003530368.1|  PREDICTED: serrate RNA effector molecule-lik...    509   1e-169   
ref|XP_006585691.1|  PREDICTED: serrate RNA effector molecule-lik...    509   1e-169   
ref|XP_006585690.1|  PREDICTED: serrate RNA effector molecule-lik...    509   2e-169   
ref|XP_004511156.1|  PREDICTED: serrate RNA effector molecule-lik...    516   2e-169   
ref|XP_006408663.1|  hypothetical protein EUTSA_v10001919mg             514   4e-169   
ref|XP_010473102.1|  PREDICTED: serrate RNA effector molecule-like      513   1e-168   
ref|XP_004511155.1|  PREDICTED: serrate RNA effector molecule-lik...    514   1e-168   
ref|XP_010510811.1|  PREDICTED: serrate RNA effector molecule-like      513   1e-168   
ref|XP_006408653.1|  hypothetical protein EUTSA_v10001921mg             513   1e-168   
ref|XP_010417856.1|  PREDICTED: serrate RNA effector molecule           512   3e-168   
gb|EMT02783.1|  Serrate RNA effector molecule                           507   1e-167   
gb|KFK32423.1|  hypothetical protein AALP_AA6G240000                    510   1e-167   
ref|XP_010227410.1|  PREDICTED: serrate RNA effector molecule iso...    505   1e-167   
ref|XP_004499601.1|  PREDICTED: serrate RNA effector molecule-like      501   9e-167   
ref|XP_004171045.1|  PREDICTED: serrate RNA effector molecule-like      499   1e-166   
ref|XP_004966125.1|  PREDICTED: serrate RNA effector molecule-like      508   2e-166   
ref|XP_003563493.1|  PREDICTED: serrate RNA effector molecule iso...    506   5e-166   
ref|NP_001145860.1|  putative SERRATE-related C2H2 zinc-finger fa...    498   1e-165   Zea mays [maize]
gb|KEH32826.1|  serrate RNA effector molecule-like protein              496   5e-165   
ref|XP_002880880.1|  hypothetical protein ARALYDRAFT_481599             503   1e-164   
ref|XP_009140760.1|  PREDICTED: serrate RNA effector molecule-like      493   2e-161   
ref|XP_006660282.1|  PREDICTED: serrate RNA effector molecule-like      487   3e-160   
emb|CDX77068.1|  BnaC04g38630D                                          490   4e-160   
gb|EMT28210.1|  Serrate RNA effector molecule                           486   1e-159   
gb|EEC81254.1|  hypothetical protein OsI_24338                          483   4e-159   Oryza sativa Indica Group [Indian rice]
ref|XP_002445843.1|  hypothetical protein SORBIDRAFT_07g026820          486   4e-159   Sorghum bicolor [broomcorn]
dbj|BAJ96818.1|  predicted protein                                      486   5e-159   
ref|XP_004973947.1|  PREDICTED: serrate RNA effector molecule-like      484   3e-158   
ref|NP_001062242.1|  Os08g0517300                                       484   4e-158   Oryza sativa Japonica Group [Japonica rice]
pdb|3AX1|A  Chain A, Molecular Insights Into Mirna Processing By ...    472   8e-158   
ref|NP_001174979.1|  Os06g0698859                                       482   2e-157   
gb|AAK63209.1|AF311224_1  C2H2 zinc-finger protein                      477   4e-157   Zea mays [maize]
ref|XP_003574791.1|  PREDICTED: serrate RNA effector molecule-like      481   4e-157   
ref|XP_008663993.1|  PREDICTED: serrate RNA effector molecule iso...    480   7e-157   
ref|XP_006657295.1|  PREDICTED: serrate RNA effector molecule-like      477   1e-156   
gb|KEH32827.1|  serrate RNA effector molecule-like protein              477   2e-156   
ref|XP_008663998.1|  PREDICTED: serrate RNA effector molecule iso...    474   4e-156   
ref|XP_008678364.1|  PREDICTED: serrate RNA effector molecule iso...    476   5e-156   
ref|XP_002438945.1|  hypothetical protein SORBIDRAFT_10g028740          480   6e-156   Sorghum bicolor [broomcorn]
ref|NP_001168339.1|  uncharacterized protein LOC100382107               474   2e-155   Zea mays [maize]
ref|XP_008648070.1|  PREDICTED: uncharacterized protein LOC100382...    479   2e-155   
ref|XP_008648068.1|  PREDICTED: uncharacterized protein LOC100382...    480   2e-155   
ref|XP_008678363.1|  PREDICTED: serrate RNA effector molecule iso...    475   3e-155   
gb|AFW61518.1|  putative SERRATE-related C2H2 zinc-finger family ...    469   4e-154   
gb|EEE66291.1|  hypothetical protein OsJ_22514                          487   1e-152   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62084.1|  Calcium-transporting ATPase 9, plasma membrane-type     492   2e-152   
emb|CDX71472.1|  BnaC04g17070D                                          465   1e-151   
emb|CDY04478.1|  BnaA07g13040D                                          462   9e-151   
ref|XP_009103578.1|  PREDICTED: serrate RNA effector molecule           458   1e-149   
gb|AAK63208.1|AF311223_1  C2H2 zinc-finger protein                      441   1e-143   Zea mays [maize]
ref|XP_008349839.1|  PREDICTED: LOW QUALITY PROTEIN: serrate RNA ...    426   1e-139   
ref|XP_006648306.1|  PREDICTED: serrate RNA effector molecule-like      426   2e-136   
gb|EEE56303.1|  hypothetical protein OsJ_05384                          423   6e-135   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045896.1|  Os02g0149600                                       422   3e-134   Oryza sativa Japonica Group [Japonica rice]
gb|EPS63495.1|  hypothetical protein M569_11289                         408   1e-132   
ref|XP_004954714.1|  PREDICTED: serrate RNA effector molecule-like      416   1e-132   
gb|EMT24215.1|  Serrate RNA effector molecule                           412   4e-131   
ref|XP_002451545.1|  hypothetical protein SORBIDRAFT_04g003540          406   2e-126   Sorghum bicolor [broomcorn]
ref|XP_001768827.1|  predicted protein                                  371   7e-118   
ref|XP_001761709.1|  predicted protein                                  347   5e-110   
ref|XP_002989962.1|  hypothetical protein SELMODRAFT_130620             341   1e-107   
ref|XP_002968914.1|  hypothetical protein SELMODRAFT_90313              340   3e-107   
gb|AAK63207.1|AF311222_1  C2H2 zinc-finger protein SERRATE              302   3e-102   Saccharum hybrid cultivar NCo 376
gb|ACN33226.1|  unknown                                                 272   1e-92    Zea mays [maize]
tpg|DAA38646.1|  TPA: putative SERRATE-related C2H2 zinc-finger f...    250   2e-69    
tpg|DAA38645.1|  TPA: putative SERRATE-related C2H2 zinc-finger f...    209   2e-55    
gb|KEH38883.1|  serrate RNA effector molecule-like protein, putative    192   2e-52    
ref|XP_010093793.1|  Receptor-like protein kinase HERK 1                202   1e-51    
ref|XP_001784098.1|  predicted protein                                  188   2e-47    
ref|XP_010474531.1|  PREDICTED: serrate RNA effector molecule-like      156   3e-39    
ref|XP_008661048.1|  PREDICTED: serrate RNA effector molecule-like      149   1e-37    
ref|XP_008349834.1|  PREDICTED: serrate RNA effector molecule-like      124   3e-29    
gb|ACF81502.1|  unknown                                               91.3    4e-29    Zea mays [maize]
ref|XP_008385647.1|  PREDICTED: serrate RNA effector molecule           124   8e-28    
ref|XP_005643110.1|  hypothetical protein COCSUDRAFT_68267              127   3e-27    
gb|EPS59535.1|  hypothetical protein M569_15270                         122   4e-27    
ref|XP_010473101.1|  PREDICTED: serrate RNA effector molecule-like    96.3    5e-26    
ref|XP_003083474.1|  putative C2H2 zinc-finger protein (ISS)          98.2    3e-18    
ref|XP_004165090.1|  PREDICTED: serrate RNA effector molecule-like    87.8    1e-15    
ref|XP_004336218.1|  hypothetical protein ACA1_138820                 86.7    3e-14    
ref|XP_001421677.1|  predicted protein                                73.6    2e-10    Ostreococcus lucimarinus CCE9901
gb|AFW66323.1|  hypothetical protein ZEAMMB73_651615                  71.6    7e-10    
ref|XP_642791.1|  C2H2-type zinc finger-containing protein            68.9    1e-08    Dictyostelium discoideum AX4
ref|XP_003293253.1|  hypothetical protein DICPUDRAFT_58394            68.6    1e-08    
ref|XP_001693770.1|  predicted protein                                67.0    2e-08    Chlamydomonas reinhardtii
ref|XP_004359066.1|  C2H2-type zinc finger-containing protein         67.8    2e-08    
emb|CDS27738.1|  serrate RNA effector molecule                        67.8    3e-08    
gb|AAM11365.1|  LD27090p                                              62.0    3e-07    Drosophila melanogaster
ref|XP_002949189.1|  zinc finger related protein                      63.9    4e-07    
ref|XP_008495048.1|  PREDICTED: uncharacterized protein LOC103531196  62.4    4e-07    
gb|AAW31949.1|  arsenite-resistance protein                           63.5    5e-07    Volvox carteri f. nagariensis
gb|EGI59578.1|  Serrate RNA effector molecule-like protein            63.2    7e-07    
ref|XP_002026596.1|  GL11804                                          63.2    7e-07    Drosophila persimilis
ref|XP_001362029.2|  GA20626, isoform A                               63.2    7e-07    Drosophila pseudoobscura pseudoobscura
ref|XP_008830547.1|  PREDICTED: serrate RNA effector molecule hom...  63.2    8e-07    
ref|XP_008830546.1|  PREDICTED: serrate RNA effector molecule hom...  63.2    8e-07    
gb|EFN83063.1|  Arsenite-resistance protein 2-like protein            62.0    8e-07    
ref|XP_008830550.1|  PREDICTED: serrate RNA effector molecule hom...  62.8    8e-07    
ref|XP_008830549.1|  PREDICTED: serrate RNA effector molecule hom...  62.8    8e-07    
ref|XP_008830551.1|  PREDICTED: serrate RNA effector molecule hom...  62.8    8e-07    
ref|XP_008830552.1|  PREDICTED: serrate RNA effector molecule hom...  62.8    8e-07    
ref|XP_002006841.1|  GI21286                                          62.8    1e-06    Drosophila mojavensis
ref|XP_001961341.1|  GF13819                                          62.8    1e-06    Drosophila ananassae
gb|EFZ12062.1|  hypothetical protein SINV_04615                       62.8    1e-06    
ref|XP_006764766.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_011063860.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_002049185.1|  GJ20888                                          62.4    1e-06    Drosophila virilis
ref|XP_006504693.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_011063856.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_011063859.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_002502723.1|  predicted protein                                62.4    1e-06    Micromonas commoda
ref|XP_011063858.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080466.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080462.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_011063855.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_011063853.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080465.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_008139649.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_008139648.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_008544778.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005879176.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005879175.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_006081065.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080468.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080463.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080464.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005371483.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_008544777.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005879177.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
gb|KDO29351.1|  hypothetical protein SPRG_05887                       62.0    1e-06    
ref|XP_006971305.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005371484.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_008139651.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005879180.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_008139650.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005879178.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_006971307.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
dbj|GAM17977.1|  hypothetical protein SAMD00019534_011520             62.4    1e-06    
ref|XP_006971306.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005080467.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_005371485.1|  PREDICTED: serrate RNA effector molecule hom...  62.4    1e-06    
ref|XP_006971308.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006764765.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006081068.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006081067.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006764764.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006764763.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006764760.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_005371487.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_006504692.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|XP_005371486.1|  PREDICTED: serrate RNA effector molecule hom...  62.0    1e-06    
ref|NP_113582.1|  serrate RNA effector molecule homolog isoform 1     62.0    2e-06    Mus musculus [mouse]
ref|XP_008609376.1|  hypothetical protein SDRG_05440                  62.0    2e-06    
ref|NP_001103379.1|  serrate RNA effector molecule homolog isoform 2  62.0    2e-06    Mus musculus [mouse]
ref|NP_001103380.1|  serrate RNA effector molecule homolog isoform 3  62.0    2e-06    Mus musculus [mouse]
gb|KHJ41686.1|  Arsenite-resistance protein 2                         62.0    2e-06    
ref|XP_004705662.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
gb|EDM13276.1|  rCG21727                                              60.5    2e-06    
ref|NP_610203.2|  Ars2, isoform A                                     61.6    2e-06    Drosophila melanogaster
gb|KGB37733.1|  Serrate RNA effector molecule-like protein            61.6    2e-06    
ref|XP_010397867.1|  PREDICTED: serrate RNA effector molecule hom...  58.2    2e-06    
ref|XP_008297233.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|XP_008696663.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|XP_006942067.1|  PREDICTED: LOW QUALITY PROTEIN: serrate RNA ...  61.6    2e-06    
ref|XP_004705663.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|XP_004617359.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|XP_005621082.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_008297231.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|NP_724455.2|  Ars2, isoform G                                     61.6    2e-06    
ref|XP_008297232.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|NP_001260719.1|  Ars2, isoform E                                  61.6    2e-06    
ref|XP_004840220.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
gb|KFO36878.1|  Serrate RNA effector molecule like protein            61.6    2e-06    
ref|XP_004630544.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|XP_005413736.1|  PREDICTED: serrate RNA effector molecule hom...  61.6    2e-06    
ref|XP_006627479.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_004881382.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_005413740.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_010951687.1|  PREDICTED: LOW QUALITY PROTEIN: serrate RNA ...  61.2    2e-06    
ref|XP_006180972.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_006180971.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_004881377.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_006219210.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_006219209.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_005413739.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_005661987.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_004630540.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_004386797.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    2e-06    
ref|XP_010607996.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010608012.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006180974.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005661988.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006180973.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003354527.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005413737.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
gb|AIZ09066.1|  serrate RNA effector molecule-like protein            61.2    3e-06    
ref|XP_004881380.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005661986.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004442945.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004268904.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003699267.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003422530.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010608003.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004630542.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010977749.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010977747.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006918663.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004666357.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
gb|EFB16429.1|  hypothetical protein PANDA_017103                     61.2    3e-06    
ref|XP_004881383.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004666355.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006219212.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006219211.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004268905.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004630545.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010600092.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004630541.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_002927339.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003060834.1|  predicted protein                                61.2    3e-06    
ref|XP_004881381.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010600094.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010977746.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010607971.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004761621.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004822985.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004666356.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004386798.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003798884.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_002927338.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004840225.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010607991.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005661985.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005661984.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
emb|CDQ72104.1|  unnamed protein product                              61.2    3e-06    
ref|XP_007468900.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004840226.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010977745.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007073974.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005413738.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004840224.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008696662.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007073973.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006733787.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008591476.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005598703.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004691930.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004630546.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004630543.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005328534.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008525584.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004666358.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004691932.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008591479.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007186675.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008591478.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004399102.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006918664.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007468901.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005598700.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005598704.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004691931.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008525585.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004761620.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006896513.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006896512.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003469972.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
emb|CDQ73884.1|  unnamed protein product                              61.2    3e-06    
ref|XP_004076571.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008591477.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008696661.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004761623.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007110669.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006896514.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004761622.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003469973.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_001505121.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010600095.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007073972.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005598702.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010600093.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004442946.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007954044.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004761619.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004761618.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_005598701.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010891754.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007954047.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007186671.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007110666.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004822986.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006896515.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007954046.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007954043.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_007186674.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004587011.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004587010.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004587009.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_004587008.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_003434817.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_006221478.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    3e-06    
ref|XP_010891753.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_008425853.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_010751796.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    3e-06    
ref|XP_008425854.1|  PREDICTED: serrate RNA effector molecule hom...  61.2    3e-06    
ref|XP_002090089.1|  GE19427                                          60.8    3e-06    
ref|XP_009826806.1|  hypothetical protein H257_04116                  60.8    3e-06    
ref|XP_007563201.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    3e-06    
gb|ELR45222.1|  Serrate RNA effector molecule-like protein            60.8    3e-06    
ref|XP_005922170.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    3e-06    
ref|XP_005735609.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005472091.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005472089.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005472088.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005472090.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006802241.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006859711.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005922172.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005922171.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005735610.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006802242.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_004481884.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_004481882.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_008046546.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005910854.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006859712.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006859713.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006046516.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_006859714.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005225195.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
tpg|DAA15084.1|  TPA: serrate RNA effector molecule homolog           60.8    4e-06    
ref|NP_001077177.1|  serrate RNA effector molecule homolog            60.8    4e-06    
gb|AAM00189.1|AF248955_1  arsenite-resistant protein ASR2             60.8    4e-06    
ref|XP_004481880.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_004481885.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_004481883.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_004481879.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_010836216.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_005910855.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_010836215.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_004481881.1|  PREDICTED: serrate RNA effector molecule hom...  60.8    4e-06    
ref|XP_002160500.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    4e-06    
ref|XP_003971279.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    4e-06    
ref|XP_008046545.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    4e-06    
gb|EAL23816.1|  arsenate resistance protein ARS2                      60.5    4e-06    
ref|XP_002080270.1|  GD10335                                          60.5    5e-06    
ref|XP_003770660.1|  PREDICTED: serrate RNA effector molecule hom...  58.5    5e-06    
gb|EZA52222.1|  Serrate RNA effector molecule-like protein            60.5    5e-06    
gb|AAH69249.1|  SRRT protein                                          60.5    5e-06    
gb|ETP40756.1|  hypothetical protein F442_11968                       60.5    5e-06    
gb|ETI42886.1|  hypothetical protein F443_12057                       60.5    5e-06    
gb|ETI42887.1|  hypothetical protein, variant                         60.1    5e-06    
ref|XP_008908321.1|  hypothetical protein PPTG_13701                  60.1    5e-06    
gb|ETP40757.1|  hypothetical protein, variant                         60.1    5e-06    
ref|NP_001126849.1|  serrate RNA effector molecule homolog            60.5    5e-06    
ref|XP_008963648.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008908322.1|  hypothetical protein, variant                    60.1    5e-06    
ref|XP_005250465.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_005250464.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
gb|EUB58321.1|  Serrate RNA effector molecule                         60.5    5e-06    
gb|EAW76466.1|  ARS2 protein, isoform CRA_b                           60.5    5e-06    
ref|XP_010342997.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_010342994.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|NP_001122324.1|  serrate RNA effector molecule homolog isoform c  60.5    5e-06    
ref|NP_056992.4|  serrate RNA effector molecule homolog isoform a     60.5    5e-06    
ref|XP_005250463.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_005250462.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008980626.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_010342998.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008980622.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_003934212.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008980616.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008963647.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008963645.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_004045972.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008963649.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_003318706.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008980611.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
ref|XP_008980603.1|  PREDICTED: serrate RNA effector molecule hom...  60.5    5e-06    
emb|CAB46374.2|  hypothetical protein                                 60.5    5e-06    
ref|XP_002043397.1|  GM16482                                          60.5    5e-06    
ref|XP_001985710.1|  GH20949                                          60.5    5e-06    
ref|NP_001122326.1|  serrate RNA effector molecule homolog isoform e  60.5    5e-06    
ref|NP_001122325.1|  serrate RNA effector molecule homolog isoform d  60.5    5e-06    
ref|XP_007534862.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    5e-06    
ref|XP_008963644.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    5e-06    
ref|XP_008963643.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    5e-06    
sp|B4II37.2|SRRT_DROSE  RecName: Full=Serrate RNA effector molecu...  60.1    6e-06    
ref|XP_001106388.2|  PREDICTED: serrate RNA effector molecule hom...  60.1    6e-06    
ref|XP_006621479.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    6e-06    
ref|XP_006570448.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    6e-06    
emb|CCD80284.1|  putative arsenite-resistance protein 2               60.1    6e-06    
ref|XP_396542.4|  PREDICTED: serrate RNA effector molecule homolo...  60.1    6e-06    
ref|XP_006570449.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    6e-06    
emb|CDS23688.1|  serrate RNA effector molecule                        60.1    6e-06    
gb|AAH41542.1|  LOC398542 protein                                     58.9    6e-06    
ref|XP_007534863.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    7e-06    
ref|NP_001082532.1|  serrate RNA effector molecule homolog B          60.1    7e-06    
ref|XP_008121745.1|  PREDICTED: serrate RNA effector molecule hom...  60.1    7e-06    
emb|CDJ04327.1|  serrate RNA effector molecule                        60.1    7e-06    
gb|EFA80136.1|  C2H2-type zinc finger-containing protein              60.1    7e-06    
ref|XP_002063599.1|  GK21997                                          60.1    7e-06    
emb|CCD80283.1|  putative arsenite-resistance protein 2               60.1    7e-06    
ref|XP_005549324.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    7e-06    
ref|XP_001970780.1|  GG10831                                          59.7    7e-06    
ref|XP_008016696.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_008016693.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_009200991.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_009200988.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_005549325.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_005549327.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_005549326.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_009200992.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
emb|CCI39508.1|  unnamed protein product                              59.7    8e-06    
ref|XP_005549329.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_009200993.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    
ref|XP_003895857.1|  PREDICTED: serrate RNA effector molecule hom...  59.7    8e-06    



>ref|XP_006362725.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Solanum 
tuberosum]
Length=744

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/468 (78%), Positives = 413/468 (88%), Gaps = 6/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGLKSYKQFIQELEDDILPAEAERRYQEYK+GYIEAQKRAYF+AHKDEEWLKDKYHP+N
Sbjct  206   REGLKSYKQFIQELEDDILPAEAERRYQEYKAGYIEAQKRAYFNAHKDEEWLKDKYHPSN  265

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK AKDFLLDLQSGTLD+GPGVTP P+N +GQSSEPNSD+EAD   KR
Sbjct  266   LISVIERRNELARKSAKDFLLDLQSGTLDIGPGVTPPPTNKSGQSSEPNSDEEADENGKR  325

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+KD  LLS APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSRSDN
Sbjct  326   RRHGRGPTKDPDLLSAAPKAHLVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSRSDN  385

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DRGSRDKS+ S+    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG+ ETNEAK
Sbjct  386   DRGSRDKSHGSTGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGLAETNEAK  443

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R DGK ++ +SNGA+WE K+DS W++RLKG+DPLEVM AKEK+D  A EAL+PYV
Sbjct  444   GLRHVRVDGKASDATSNGAEWETKVDSHWQDRLKGKDPLEVMAAKEKLDAVAAEALDPYV  503

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA+EFVHKHLKLKHP+L ++LT+KVREDLYFQNYM+D
Sbjct  504   RKIRDEKYGWKYGCGAKGCTKLFHASEFVHKHLKLKHPDLSVDLTTKVREDLYFQNYMND  563

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             E++PGGTPVML S+PKEK  RRRP L+ RLKDD      R+GR NG ERFD  ENP S D
Sbjct  564   ENSPGGTPVMLPSVPKEKPLRRRPGLDGRLKDD--RGNRRDGRANGGERFDMSENPQSGD  621

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              QSN+DG  G NPDE+MFD+FGG GIPVA+FPSD+ PPPVLMPVPGAG
Sbjct  622   FQSNNDGASGGNPDEEMFDTFGGQGIPVASFPSDMAPPPVLMPVPGAG  669


 Score =   127 bits (320),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+M+REQGGP  FEGGRNG  GP      PIIALPP  RQDPRR+RS
Sbjct  670  PLGPFVPAPPEVAMRMMREQGGPTAFEGGRNGMSGPA----GPIIALPPGFRQDPRRLRS  725

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  726  YQDLDAPEDEVTVIDYRSL  744



>ref|XP_006362726.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Solanum 
tuberosum]
Length=743

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/468 (78%), Positives = 413/468 (88%), Gaps = 6/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGLKSYKQFIQELEDDILPAEAERRYQEYK+GYIEAQKRAYF+AHKDEEWLKDKYHP+N
Sbjct  205   REGLKSYKQFIQELEDDILPAEAERRYQEYKAGYIEAQKRAYFNAHKDEEWLKDKYHPSN  264

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK AKDFLLDLQSGTLD+GPGVTP P+N +GQSSEPNSD+EAD   KR
Sbjct  265   LISVIERRNELARKSAKDFLLDLQSGTLDIGPGVTPPPTNKSGQSSEPNSDEEADENGKR  324

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+KD  LLS APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSRSDN
Sbjct  325   RRHGRGPTKDPDLLSAAPKAHLVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSRSDN  384

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DRGSRDKS+ S+    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG+ ETNEAK
Sbjct  385   DRGSRDKSHGSTGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGLAETNEAK  442

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R DGK ++ +SNGA+WE K+DS W++RLKG+DPLEVM AKEK+D  A EAL+PYV
Sbjct  443   GLRHVRVDGKASDATSNGAEWETKVDSHWQDRLKGKDPLEVMAAKEKLDAVAAEALDPYV  502

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA+EFVHKHLKLKHP+L ++LT+KVREDLYFQNYM+D
Sbjct  503   RKIRDEKYGWKYGCGAKGCTKLFHASEFVHKHLKLKHPDLSVDLTTKVREDLYFQNYMND  562

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             E++PGGTPVML S+PKEK  RRRP L+ RLKDD      R+GR NG ERFD  ENP S D
Sbjct  563   ENSPGGTPVMLPSVPKEKPLRRRPGLDGRLKDD--RGNRRDGRANGGERFDMSENPQSGD  620

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              QSN+DG  G NPDE+MFD+FGG GIPVA+FPSD+ PPPVLMPVPGAG
Sbjct  621   FQSNNDGASGGNPDEEMFDTFGGQGIPVASFPSDMAPPPVLMPVPGAG  668


 Score =   127 bits (320),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 67/79 (85%), Gaps = 4/79 (5%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+M+REQGGP  FEGGRNG  GP      PIIALPP  RQDPRR+RS
Sbjct  669  PLGPFVPAPPEVAMRMMREQGGPTAFEGGRNGMSGPA----GPIIALPPGFRQDPRRLRS  724

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  725  YQDLDAPEDEVTVIDYRSL  743



>ref|XP_004228474.1| PREDICTED: serrate RNA effector molecule [Solanum lycopersicum]
Length=748

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/468 (79%), Positives = 415/468 (89%), Gaps = 4/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGLKSYKQFIQELEDDILPAEAERRYQEYK+GYIEAQKRAYF+AHKDEEWLKDKYHP+N
Sbjct  208   REGLKSYKQFIQELEDDILPAEAERRYQEYKAGYIEAQKRAYFNAHKDEEWLKDKYHPSN  267

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK AKDFLLDLQSGTLD+GPGV P P+N +GQSSEPNSD+EAD   KR
Sbjct  268   LISVIERRNELARKSAKDFLLDLQSGTLDIGPGVAPPPTNKSGQSSEPNSDEEADENGKR  327

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG +KD  LL  APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSRSDN
Sbjct  328   RRHGRGHNKDPDLLLAAPKAHLVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSRSDN  387

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DRGSRDKS+ S+    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG+ ETNEAK
Sbjct  388   DRGSRDKSHGSTGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGLAETNEAK  445

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R DGK  + +SNGA+WE K+DS W++RLKG+DPLEVM AKEK+D  A EAL+PYV
Sbjct  446   GLRHVRVDGKAADATSNGAEWESKVDSHWQDRLKGKDPLEVMAAKEKLDAVAAEALDPYV  505

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA+EFVHKHLKLKHP+L ++LT+KVREDLYFQNYM+D
Sbjct  506   RKIRDEKYGWKYGCGAKGCTKLFHASEFVHKHLKLKHPDLSVDLTTKVREDLYFQNYMND  565

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             E++PGGTPVML S+PKEK  RRRP L+ RLKDDRGNR++R+GR NG ERFD  ENP S D
Sbjct  566   ENSPGGTPVMLPSVPKEKPLRRRPGLDGRLKDDRGNRKDRDGRANGGERFDMSENPQSGD  625

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              QSN+DG  G NPDE+MFD+FGG GIPVA+FPSD+ PPPVLMPVPGAG
Sbjct  626   FQSNNDGASGGNPDEEMFDTFGGQGIPVASFPSDMAPPPVLMPVPGAG  673


 Score =   132 bits (333),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 69/79 (87%), Gaps = 4/79 (5%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+M+REQGGP PFEGGRNGR GP      PIIALPP  RQDPRR+RS
Sbjct  674  PLGPFVPAPPEVAMRMMREQGGPTPFEGGRNGRSGP----AGPIIALPPGFRQDPRRLRS  729

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  730  YQDLDAPEDEVTVIDYRSL  748



>ref|XP_006384745.1| hypothetical protein POPTR_0004s20730g [Populus trichocarpa]
 gb|ERP62542.1| hypothetical protein POPTR_0004s20730g [Populus trichocarpa]
Length=750

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/474 (76%), Positives = 413/474 (87%), Gaps = 5/474 (1%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
              VS  REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+AHKDEEWLKDK
Sbjct  200   TVSAQREGLMSYKQFIQELEDDILPSEAERRYQEYKSEYISTQKRVFFEAHKDEEWLKDK  259

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNLV+VIERRNE ARK+AKDFLLDLQSGTLDLGPGV  + SN +GQ+S+ NSDDEA+
Sbjct  260   YHPTNLVAVIERRNELARKVAKDFLLDLQSGTLDLGPGVNASSSNKSGQASDLNSDDEAE  319

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
             AG KRRRH R P+KDA LLS APKAHPVSSEP+RI +D+EQ+Q LV KLDSEKG+E+NIL
Sbjct  320   AGGKRRRHGRPPAKDADLLSAAPKAHPVSSEPKRIQVDIEQAQALVCKLDSEKGVEDNIL  379

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
             S SDN++ SR+KS+ SS+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYGMIE
Sbjct  380   SGSDNEKMSREKSHGSSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGLDYYGMIE  438

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             TNEA+GLRH+R +GK++++S++G +WE+KLD RW+ERL+GQDPLE MTAKEKID AAVE 
Sbjct  439   TNEARGLRHVRTEGKSSDSSNSGTEWEKKLDLRWQERLRGQDPLEEMTAKEKIDAAAVEG  498

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHA+EFV KHLKLKHPELV++LT+KVRE+LYFQ
Sbjct  499   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHASEFVQKHLKLKHPELVIDLTAKVREELYFQ  558

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NY++D  APGGTPVM  SLPK+K QRR+   E+RLKD+RGNRRER  R NG ERFDR EN
Sbjct  559   NYLNDPDAPGGTPVMQQSLPKDKPQRRKLGPENRLKDERGNRRERENRANGNERFDRSEN  618

Query  813   PLSSDIQSND--DGGRNPDEQMFDSFGGHGIPV-AAFPSDITPPPVLMPVPGAG  661
             P S D QSND  DGG N DE MFD+FGG GI V   FPSDI PPPVLMPVPGAG
Sbjct  619   PQSGDFQSNDGPDGG-NCDETMFDTFGGQGIRVPPPFPSDIAPPPVLMPVPGAG  671


 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+M R+QGGP PFE GGRN R GPQ+GG API+ L P+ RQDPRRIR
Sbjct  672  PLGPFVPAPPEVAMRMFRDQGGPPPFESGGRNARPGPQLGGPAPIL-LSPAFRQDPRRIR  730

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLD PEDEVTVIDYRSL
Sbjct  731  SYQDLDVPEDEVTVIDYRSL  750



>ref|XP_009606604.1| PREDICTED: serrate RNA effector molecule isoform X1 [Nicotiana 
tomentosiformis]
Length=749

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/472 (79%), Positives = 418/472 (89%), Gaps = 5/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGLKSYKQFIQELEDDILPAEAERRYQEYK GYIEAQKRAYF+AHK+EEWLKDKYH
Sbjct  201   SSQREGLKSYKQFIQELEDDILPAEAERRYQEYKCGYIEAQKRAYFNAHKNEEWLKDKYH  260

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL+SVIERRNE ARK+AKDFLLDLQSGT+D+GPGVTP  +N +GQSS+PNSD+EAD G
Sbjct  261   PTNLISVIERRNELARKLAKDFLLDLQSGTVDIGPGVTPASANKSGQSSDPNSDEEADEG  320

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSR
Sbjct  321   GKRRRHGRGPTKETDLLSVAPKAHQVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSR  380

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDNDRGSRDKS+ SS    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG  ETN
Sbjct  381   SDNDRGSRDKSHGSSGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGTTETN  438

Query  1347  EAKGLRHMRFD-GKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEAL  1171
             EAKGLRH+R D GK ++ +S+GA+WE KLDS W++RLKGQDPLE+M AKEKID AA EAL
Sbjct  439   EAKGLRHVRMDGGKTSDATSSGAEWETKLDSHWQDRLKGQDPLELMAAKEKIDAAAAEAL  498

Query  1170  EPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQN  991
             +PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP+L +++T+KVREDLYFQN
Sbjct  499   DPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPDLAVDVTTKVREDLYFQN  558

Query  990   YMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
             YM+DE+APGGTPVML S+P EK  RRRP L+ RLKDDRG+RR+R+GR NG ERFD  +NP
Sbjct  559   YMNDENAPGGTPVMLPSMPIEKPLRRRPGLDGRLKDDRGSRRDRDGRANGGERFDLSDNP  618

Query  810   LSSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              S D QSN+DG  G NPDE+MFD+FGG GIPVA FPSD+ PPPVLMPVPGAG
Sbjct  619   KSGDFQSNNDGASGGNPDEEMFDTFGGQGIPVAPFPSDMAPPPVLMPVPGAG  670


 Score =   137 bits (345),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPF+PAPP+VAM+M+REQGGP PFEGGRNG  GP I G  PIIALPP+ RQDPRR+RS
Sbjct  671  PLGPFIPAPPDVAMRMMREQGGPGPFEGGRNGMSGPAISGGGPIIALPPAFRQDPRRLRS  730

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  731  YQDLDAPEDEVTVIDYRSL  749



>ref|XP_009606605.1| PREDICTED: serrate RNA effector molecule isoform X2 [Nicotiana 
tomentosiformis]
Length=748

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/472 (79%), Positives = 418/472 (89%), Gaps = 5/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGLKSYKQFIQELEDDILPAEAERRYQEYK GYIEAQKRAYF+AHK+EEWLKDKYH
Sbjct  200   SSQREGLKSYKQFIQELEDDILPAEAERRYQEYKCGYIEAQKRAYFNAHKNEEWLKDKYH  259

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL+SVIERRNE ARK+AKDFLLDLQSGT+D+GPGVTP  +N +GQSS+PNSD+EAD G
Sbjct  260   PTNLISVIERRNELARKLAKDFLLDLQSGTVDIGPGVTPASANKSGQSSDPNSDEEADEG  319

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSR
Sbjct  320   GKRRRHGRGPTKETDLLSVAPKAHQVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSR  379

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDNDRGSRDKS+ SS    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG  ETN
Sbjct  380   SDNDRGSRDKSHGSSGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGTTETN  437

Query  1347  EAKGLRHMRFD-GKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEAL  1171
             EAKGLRH+R D GK ++ +S+GA+WE KLDS W++RLKGQDPLE+M AKEKID AA EAL
Sbjct  438   EAKGLRHVRMDGGKTSDATSSGAEWETKLDSHWQDRLKGQDPLELMAAKEKIDAAAAEAL  497

Query  1170  EPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQN  991
             +PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP+L +++T+KVREDLYFQN
Sbjct  498   DPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPDLAVDVTTKVREDLYFQN  557

Query  990   YMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
             YM+DE+APGGTPVML S+P EK  RRRP L+ RLKDDRG+RR+R+GR NG ERFD  +NP
Sbjct  558   YMNDENAPGGTPVMLPSMPIEKPLRRRPGLDGRLKDDRGSRRDRDGRANGGERFDLSDNP  617

Query  810   LSSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              S D QSN+DG  G NPDE+MFD+FGG GIPVA FPSD+ PPPVLMPVPGAG
Sbjct  618   KSGDFQSNNDGASGGNPDEEMFDTFGGQGIPVAPFPSDMAPPPVLMPVPGAG  669


 Score =   137 bits (345),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPF+PAPP+VAM+M+REQGGP PFEGGRNG  GP I G  PIIALPP+ RQDPRR+RS
Sbjct  670  PLGPFIPAPPDVAMRMMREQGGPGPFEGGRNGMSGPAISGGGPIIALPPAFRQDPRRLRS  729

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  730  YQDLDAPEDEVTVIDYRSL  748



>ref|XP_011006396.1| PREDICTED: serrate RNA effector molecule [Populus euphratica]
Length=750

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/474 (76%), Positives = 410/474 (86%), Gaps = 5/474 (1%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
              VS  REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+AHKDEEWLKDK
Sbjct  200   TVSAQREGLMSYKQFIQELEDDILPSEAERRYQEYKSEYISTQKRVFFEAHKDEEWLKDK  259

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNLV+VIERRNE ARK+AKDFLLDLQSGTLDLGPGV  + SN  GQ+S+ NSDDEA+
Sbjct  260   YHPTNLVAVIERRNELARKVAKDFLLDLQSGTLDLGPGVNASSSNKPGQASDLNSDDEAE  319

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
             AG KRRRH R P+KDA LLS APKAHPVSSE +RI +D+EQ+Q L+ KLDSEKG+E+NIL
Sbjct  320   AGSKRRRHGRPPAKDADLLSAAPKAHPVSSETKRIQVDIEQAQALICKLDSEKGVEDNIL  379

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
             S S N++ SR+KS+ SS+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYGMIE
Sbjct  380   SGSGNEKMSREKSHGSSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGVDYYGMIE  438

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             TNEA+GLRH+R +GK+++TS++G +WE+KLD RW+ERL+GQDPLE MTAKEKID AAVE 
Sbjct  439   TNEARGLRHVRTEGKSSDTSNSGTEWEKKLDLRWQERLRGQDPLEEMTAKEKIDAAAVEG  498

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHA+EFVHKHLKLKHPELV+ELT+KVRE+LYFQ
Sbjct  499   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHASEFVHKHLKLKHPELVIELTAKVREELYFQ  558

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NY++D  APGGTPVM  SL K+K QRR+   E+RLKD+RGNRRER  R NG ERFDR EN
Sbjct  559   NYLNDPDAPGGTPVMQQSLLKDKPQRRKLGPENRLKDERGNRRERENRANGNERFDRSEN  618

Query  813   PLSSDIQSND--DGGRNPDEQMFDSFGGHGIPV-AAFPSDITPPPVLMPVPGAG  661
             P S D QSND  DGG N DE MFD+FGG GI V   FPSDI PPPVLMPVPGAG
Sbjct  619   PQSGDFQSNDGPDGG-NCDETMFDTFGGQGIHVPPPFPSDIAPPPVLMPVPGAG  671


 Score =   125 bits (315),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+M R+QGGP PFE GGRN R GPQ+GG API+ L P+ RQDPRRIR
Sbjct  672  PLGPFVPAPPEVAMRMFRDQGGPPPFESGGRNARPGPQLGGPAPIL-LSPAFRQDPRRIR  730

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLD PEDEVTVIDYRSL
Sbjct  731  SYQDLDVPEDEVTVIDYRSL  750



>ref|XP_009762196.1| PREDICTED: serrate RNA effector molecule isoform X1 [Nicotiana 
sylvestris]
Length=749

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/472 (78%), Positives = 417/472 (88%), Gaps = 5/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGLKSYKQFIQELEDDILPAEAERRYQEYK GYIEAQKRAYF+AHK+EEWLKDKYH
Sbjct  201   SSQREGLKSYKQFIQELEDDILPAEAERRYQEYKCGYIEAQKRAYFNAHKNEEWLKDKYH  260

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL+SVIERRNE ARK+AKDFLLDLQSGT+D+GPGVTP  +N +GQSS+PNSD+EAD G
Sbjct  261   PTNLISVIERRNELARKLAKDFLLDLQSGTVDIGPGVTPASANKSGQSSDPNSDEEADEG  320

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSR
Sbjct  321   GKRRRHGRGPTKETDLLSAAPKAHQVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSR  380

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDNDRGSRDKS+ SS    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG  ETN
Sbjct  381   SDNDRGSRDKSHGSSGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGTTETN  438

Query  1347  EAKGLRHMRFD-GKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEAL  1171
             EAKGLRH+R D GK ++ +S+G +WE KLDS W++RLKGQDPLE+M AKEKID AA EAL
Sbjct  439   EAKGLRHVRVDGGKTSDATSSGVEWETKLDSHWQDRLKGQDPLELMAAKEKIDAAAAEAL  498

Query  1170  EPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQN  991
             +PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP+L +++T+KVREDLYFQN
Sbjct  499   DPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPDLAVDVTTKVREDLYFQN  558

Query  990   YMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
             YM+DE+APGGTPVML S+P EK  RRRP L+ RLKDDRG+RR+R+GR NG ERFD  +NP
Sbjct  559   YMNDENAPGGTPVMLPSMPIEKPLRRRPGLDGRLKDDRGSRRDRDGRANGGERFDLSDNP  618

Query  810   LSSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              S D QSN+DG  G NPDE+MFD+FGG GIPVA FPSD+ PPPVLMPVPGAG
Sbjct  619   KSGDFQSNNDGASGGNPDEEMFDTFGGQGIPVAPFPSDMAPPPVLMPVPGAG  670


 Score =   138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPF+PAPP+VAM+M+REQGGP PFEGGRNG  GP I G APIIALPP  RQDPRR+RS
Sbjct  671  PLGPFIPAPPDVAMRMMREQGGPGPFEGGRNGMSGPAISGGAPIIALPPGFRQDPRRLRS  730

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  731  YQDLDAPEDEVTVIDYRSL  749



>ref|XP_009762203.1| PREDICTED: serrate RNA effector molecule isoform X2 [Nicotiana 
sylvestris]
Length=748

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/472 (78%), Positives = 417/472 (88%), Gaps = 5/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGLKSYKQFIQELEDDILPAEAERRYQEYK GYIEAQKRAYF+AHK+EEWLKDKYH
Sbjct  200   SSQREGLKSYKQFIQELEDDILPAEAERRYQEYKCGYIEAQKRAYFNAHKNEEWLKDKYH  259

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL+SVIERRNE ARK+AKDFLLDLQSGT+D+GPGVTP  +N +GQSS+PNSD+EAD G
Sbjct  260   PTNLISVIERRNELARKLAKDFLLDLQSGTVDIGPGVTPASANKSGQSSDPNSDEEADEG  319

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAH VSS+PRR+ IDVEQ+Q LV KLDSEKGIE+NILSR
Sbjct  320   GKRRRHGRGPTKETDLLSAAPKAHQVSSDPRRVQIDVEQAQALVRKLDSEKGIEDNILSR  379

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDNDRGSRDKS+ SS    V+I+RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYG  ETN
Sbjct  380   SDNDRGSRDKSHGSSGP--VIIIRGLTSVKGLEGTELLDTLLTYLWRIHGVDYYGTTETN  437

Query  1347  EAKGLRHMRFD-GKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEAL  1171
             EAKGLRH+R D GK ++ +S+G +WE KLDS W++RLKGQDPLE+M AKEKID AA EAL
Sbjct  438   EAKGLRHVRVDGGKTSDATSSGVEWETKLDSHWQDRLKGQDPLELMAAKEKIDAAAAEAL  497

Query  1170  EPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQN  991
             +PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP+L +++T+KVREDLYFQN
Sbjct  498   DPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPDLAVDVTTKVREDLYFQN  557

Query  990   YMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
             YM+DE+APGGTPVML S+P EK  RRRP L+ RLKDDRG+RR+R+GR NG ERFD  +NP
Sbjct  558   YMNDENAPGGTPVMLPSMPIEKPLRRRPGLDGRLKDDRGSRRDRDGRANGGERFDLSDNP  617

Query  810   LSSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              S D QSN+DG  G NPDE+MFD+FGG GIPVA FPSD+ PPPVLMPVPGAG
Sbjct  618   KSGDFQSNNDGASGGNPDEEMFDTFGGQGIPVAPFPSDMAPPPVLMPVPGAG  669


 Score =   138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPF+PAPP+VAM+M+REQGGP PFEGGRNG  GP I G APIIALPP  RQDPRR+RS
Sbjct  670  PLGPFIPAPPDVAMRMMREQGGPGPFEGGRNGMSGPAISGGAPIIALPPGFRQDPRRLRS  729

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  730  YQDLDAPEDEVTVIDYRSL  748



>ref|XP_011090242.1| PREDICTED: serrate RNA effector molecule-like [Sesamum indicum]
Length=752

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/467 (78%), Positives = 407/467 (87%), Gaps = 4/467 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REG+ SYKQFIQELEDDILPAEAERRYQEY++ YI  QKR YF+AHKDEEWLKDKYHPTN
Sbjct  210   REGMMSYKQFIQELEDDILPAEAERRYQEYRTEYISTQKRTYFNAHKDEEWLKDKYHPTN  269

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE ARK+AKDF LDLQSGTLDLGP  +P  S+   QSSEPNSDDEAD G KR
Sbjct  270   LVAVIERRNELARKLAKDFQLDLQSGTLDLGPAFSPPSSSKAEQSSEPNSDDEADVGGKR  329

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K++ + S APKAHP+ SEPRRI +DVEQ+Q LV KLD+EKGIE+N+L R+DN
Sbjct  330   RRPGRGGAKESDV-SSAPKAHPICSEPRRIQVDVEQAQALVRKLDAEKGIEDNVLCRADN  388

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DR +RDKS+ SSSGPV++I RGLT++KGLEG ELL+TLLTYLWRIHGVDYYGM+E+NEAK
Sbjct  389   DRMNRDKSHGSSSGPVIII-RGLTTIKGLEGIELLDTLLTYLWRIHGVDYYGMVESNEAK  447

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G RH+R DGK+++T  NG +WE+KLDS W+ERLKG DPLEVMTAKEKID AA EAL+PYV
Sbjct  448   GFRHVRVDGKSSDTIGNGNEWEKKLDSHWQERLKGSDPLEVMTAKEKIDAAAAEALDPYV  507

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNYMSD
Sbjct  508   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREELYFQNYMSD  567

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             E+APGGTPVM  S PKEK QRRRP L++RLKDDRGNRRER+ R NG ERFDR ENP S D
Sbjct  568   ENAPGGTPVMQPSFPKEKPQRRRPGLDNRLKDDRGNRRERDNRTNGNERFDRSENPQSGD  627

Query  798   IQSNDDG-GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               +ND   G NPDEQMFDSFGG GIPVAAF SDI PPPVLMPVPGAG
Sbjct  628   FANNDGASGNNPDEQMFDSFGGQGIPVAAFASDI-PPPVLMPVPGAG  673


 Score =   140 bits (353),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+MLR+QGGP PFEGGRNGR GPQ+ G +PIIALPP+LRQDPRR+RS
Sbjct  674  PLGPFVPAPPEVAMRMLRDQGGPPPFEGGRNGRSGPQLAGPSPIIALPPALRQDPRRLRS  733

Query  391  YQDLDAPEDEVTVIDYRSL  335
            Y DLDAP+DEVTVIDYRSL
Sbjct  734  YNDLDAPDDEVTVIDYRSL  752



>ref|XP_002312847.2| hypothetical protein POPTR_0009s16020g [Populus trichocarpa]
 gb|EEE86802.2| hypothetical protein POPTR_0009s16020g [Populus trichocarpa]
Length=746

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/474 (76%), Positives = 409/474 (86%), Gaps = 9/474 (2%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
             VV   REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+AHKDEEWLKDK
Sbjct  200   VVPAQREGLMSYKQFIQELEDDILPSEAERRYQEYKSEYISTQKRVFFEAHKDEEWLKDK  259

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNLV+VIERRNE ARK+AKDFLLDLQSGTLDLGPGV    SN +GQ+S+PNSDD+A+
Sbjct  260   YHPTNLVAVIERRNELARKVAKDFLLDLQSGTLDLGPGVNAISSNKSGQASDPNSDDDAE  319

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
              G KRRRH R P+KD  L S APKAHPVSSEP+RI +DVEQ+QTLV KLDSEKG+EENIL
Sbjct  320   TGGKRRRHGRPPAKDTDL-SAAPKAHPVSSEPKRIQVDVEQAQTLVRKLDSEKGVEENIL  378

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
             S S+ND+ SR+KS+ SS+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYGMIE
Sbjct  379   SGSENDKMSREKSHGSSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGLDYYGMIE  437

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             TNEAKGLRH+R +GK+++TS++G +WE+KLDS W+ERL+GQDPLE MTAKEKID  AVE 
Sbjct  438   TNEAKGLRHVRAEGKSSDTSNSGTEWEKKLDSHWQERLRGQDPLEKMTAKEKIDATAVEG  497

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKH ELV+ELT+KVRE+LY+Q
Sbjct  498   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHLELVMELTAKVREELYYQ  557

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NYM+D  APGGTPVM  S+PK+K QRRR      LKD+RGNRRER+ R NG ERFDR EN
Sbjct  558   NYMNDSDAPGGTPVMQQSMPKDKPQRRR---LGPLKDERGNRRERDNRANGNERFDRSEN  614

Query  813   PLSSDIQSND--DGGRNPDEQMFDSFGGHGIPV-AAFPSDITPPPVLMPVPGAG  661
             P S D QSND  DGG N DE MFD+FGG GI V + FPSDI PPPVLMPVPGAG
Sbjct  615   PQSGDFQSNDGPDGG-NRDEAMFDTFGGQGIHVPSPFPSDIAPPPVLMPVPGAG  667


 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQ-GGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+M R+Q G P    GGRN R GPQ+GG API+ L P+ RQDPRRIR
Sbjct  668  PLGPFVPAPPEVAMRMFRDQGGPPPFEGGGRNARPGPQLGGPAPIL-LSPAFRQDPRRIR  726

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  727  SYQDLDAPEDEVTVIDYRSL  746



>gb|KGN66407.1| hypothetical protein Csa_1G600970 [Cucumis sativus]
Length=590

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/468 (74%), Positives = 399/468 (85%), Gaps = 4/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+QELEDDILPAEAERRYQEYKS YI  QK+A+FD+HKDEEWL+DKYHPTN
Sbjct  45    REGLMTYKQFMQELEDDILPAEAERRYQEYKSEYITTQKQAFFDSHKDEEWLRDKYHPTN  104

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE A++ AKDFLLDLQSGTLDLGPG++   +N +GQ+SEPNSDDEAD   KR
Sbjct  105   LVTVIERRNELAQRTAKDFLLDLQSGTLDLGPGISAAATNKSGQASEPNSDDEADNDGKR  164

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  LLS APKAHPVSSEPRRI ID+ Q+Q LV KLDSEKGIEENILS SDN
Sbjct  165   RRHGRGPAKEMDLLSAAPKAHPVSSEPRRIQIDIGQAQALVRKLDSEKGIEENILSGSDN  224

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  RDK++  SSGPV++I RGLT+VKGLEG ELL+TLLTYLWRIHG+DYYGM+ET EAK
Sbjct  225   DKLGRDKAHGGSSGPVIII-RGLTTVKGLEGVELLDTLLTYLWRIHGIDYYGMVETREAK  283

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK++  +    +WE+KLD RW+ERL+GQD LEVMTAK+KI+ AA+EA +PYV
Sbjct  284   GLRHVREEGKSSNMAGGADEWEKKLDLRWQERLRGQDLLEVMTAKDKIEAAALEAFDPYV  343

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL LKHPELV+ELTSKVRE+LYFQNYM+D
Sbjct  344   RKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLNLKHPELVMELTSKVREELYFQNYMND  403

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  SLPK+K QRRR +L+ RLKDDRGNRR+R+   NG +RFDR ENP SSD
Sbjct  404   TDAPGGTPVMQQSLPKDKPQRRRMNLDGRLKDDRGNRRDRDNWANGGDRFDRSENPQSSD  463

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               S +DG  G N D+ MFDSFGG G  VA F S+I PPPVLMPVPGAG
Sbjct  464   FPSANDGTDGGNIDDPMFDSFGGQGRHVAPFASEI-PPPVLMPVPGAG  510


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEGG    +   Q+GG API+AL    RQDPRRIR
Sbjct  511  PLGPFVPAPPEVAMRMLREQGGPPPFEGGGRNGRPGPQLGGSAPILALSSGFRQDPRRIR  570

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  571  SYQDLDAPEDEVTVIDYRSL  590



>ref|XP_011004379.1| PREDICTED: serrate RNA effector molecule-like [Populus euphratica]
Length=707

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/474 (75%), Positives = 406/474 (86%), Gaps = 9/474 (2%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
             V+   REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+AHKDEEWLKDK
Sbjct  161   VLPAQREGLMSYKQFIQELEDDILPSEAERRYQEYKSEYISTQKRVFFEAHKDEEWLKDK  220

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNLV+VIERRNE ARK+AKDFLLDLQSGTLDLGPGV    SN +GQ+S+ NSDD+A+
Sbjct  221   YHPTNLVAVIERRNELARKVAKDFLLDLQSGTLDLGPGVNAISSNKSGQASDQNSDDDAE  280

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
              G KRRRH R  +KD  L S APKAHPVSSEP+RI +DVEQ+QTLV KLDSEKG+EENIL
Sbjct  281   TGGKRRRHGRPTAKDTDL-SAAPKAHPVSSEPKRIQVDVEQAQTLVRKLDSEKGVEENIL  339

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
             S SDND+ SR+KS+ SS+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYGMIE
Sbjct  340   SGSDNDKMSREKSHGSSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGLDYYGMIE  398

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             TNEAKGLRH+R +GK+++TS++G +WE+KLDS W+ERL+GQDPLE MTAKEKID  AVE 
Sbjct  399   TNEAKGLRHVRAEGKSSDTSNSGTEWEKKLDSHWQERLRGQDPLEKMTAKEKIDATAVEG  458

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELT+KVRE+LY+ 
Sbjct  459   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTAKVREELYYL  518

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NYM+D  APGGTPVM  S+PK+K QRRR      LKD+RGNRRER+ R NG ERFDR EN
Sbjct  519   NYMNDSDAPGGTPVMQQSMPKDKPQRRR---LGPLKDERGNRRERDNRANGNERFDRSEN  575

Query  813   PLSSDIQSND--DGGRNPDEQMFDSFGGHGIPV-AAFPSDITPPPVLMPVPGAG  661
             P S D QSND  DGG N DE MFD+FG  GI V + FPSDI PPPVLMPVPGAG
Sbjct  576   PQSGDFQSNDGPDGG-NRDEAMFDTFGAQGIHVPSPFPSDIAPPPVLMPVPGAG  628


 Score =   124 bits (312),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+M R+QGGP  FE GGRN R GPQ+GG API+ L P+ RQDPRRIR
Sbjct  629  PLGPFVPAPPEVAMRMFRDQGGPPAFEGGGRNARPGPQLGGPAPIL-LSPAFRQDPRRIR  687

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  688  SYQDLDAPEDEVTVIDYRSL  707



>ref|XP_007016667.1| C2H2 zinc-finger protein SERRATE isoform 2, partial [Theobroma 
cacao]
 gb|EOY34286.1| C2H2 zinc-finger protein SERRATE isoform 2, partial [Theobroma 
cacao]
Length=712

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/472 (76%), Positives = 411/472 (87%), Gaps = 6/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRA+FDAHKDEEWL+DKYH
Sbjct  165   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAFFDAHKDEEWLRDKYH  224

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRNE ARK+AKDFLLDLQSGTL+L PGV    SN +GQ S+PNS+DEAD G
Sbjct  225   PTNLVTVIERRNELARKVAKDFLLDLQSGTLELSPGVNALSSNKSGQISDPNSEDEADIG  284

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  L S APKAHPVSSEPRRI ID+EQ+Q LV KLDSEKGIEENILS 
Sbjct  285   GKRRRHGRGPAKETDL-SAAPKAHPVSSEPRRIQIDIEQAQGLVRKLDSEKGIEENILSG  343

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDND+ +RDKS+   +GPV+ IVRGL SVKGLEG ELL+TL+TYLWR+HG+DYYGMIET+
Sbjct  344   SDNDKINRDKSHGGLTGPVI-IVRGLASVKGLEGVELLDTLITYLWRVHGLDYYGMIETS  402

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GKN++ ++NG++WE+KLDSRW+ERL+GQDPL +MTAK+KID AAVEAL+
Sbjct  403   EAKGLRHVRAEGKNSDVTNNGSEWEKKLDSRWQERLRGQDPLVLMTAKDKIDAAAVEALD  462

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNY
Sbjct  463   PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREELYFQNY  522

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM  S+PK+K QRR+  LE+RLKD+RG RRER+ R NG +R+DR ENP 
Sbjct  523   MNDPDAPGGTPVMQQSVPKDKPQRRK-ILENRLKDERGPRRERDNRANGSDRYDRSENPQ  581

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
             SSD  SN+DG  G N D+ MFD+FGG G+ VAA F SDI PPPVLMPVPGAG
Sbjct  582   SSDFTSNNDGPDGGNRDDTMFDAFGGQGMRVAAPFSSDIAPPPVLMPVPGAG  633


 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE+AMQ+ RE+GGP PFEG  R GR GP + G AP + LPP  RQDPRR+R
Sbjct  634  PLGPFVPAPPELAMQVFRERGGPPPFEGNSRGGRPGPNLSGPAPFL-LPPGFRQDPRRLR  692

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  693  SYQDLDAPEDEVTVIDYRSL  712



>ref|XP_007016666.1| C2H2 zinc-finger protein SERRATE isoform 1 [Theobroma cacao]
 gb|EOY34285.1| C2H2 zinc-finger protein SERRATE isoform 1 [Theobroma cacao]
Length=743

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/472 (76%), Positives = 411/472 (87%), Gaps = 6/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRA+FDAHKDEEWL+DKYH
Sbjct  196   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAFFDAHKDEEWLRDKYH  255

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRNE ARK+AKDFLLDLQSGTL+L PGV    SN +GQ S+PNS+DEAD G
Sbjct  256   PTNLVTVIERRNELARKVAKDFLLDLQSGTLELSPGVNALSSNKSGQISDPNSEDEADIG  315

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  L S APKAHPVSSEPRRI ID+EQ+Q LV KLDSEKGIEENILS 
Sbjct  316   GKRRRHGRGPAKETDL-SAAPKAHPVSSEPRRIQIDIEQAQGLVRKLDSEKGIEENILSG  374

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDND+ +RDKS+   +GPV+ IVRGL SVKGLEG ELL+TL+TYLWR+HG+DYYGMIET+
Sbjct  375   SDNDKINRDKSHGGLTGPVI-IVRGLASVKGLEGVELLDTLITYLWRVHGLDYYGMIETS  433

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GKN++ ++NG++WE+KLDSRW+ERL+GQDPL +MTAK+KID AAVEAL+
Sbjct  434   EAKGLRHVRAEGKNSDVTNNGSEWEKKLDSRWQERLRGQDPLVLMTAKDKIDAAAVEALD  493

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNY
Sbjct  494   PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREELYFQNY  553

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM  S+PK+K QRR+  LE+RLKD+RG RRER+ R NG +R+DR ENP 
Sbjct  554   MNDPDAPGGTPVMQQSVPKDKPQRRK-ILENRLKDERGPRRERDNRANGSDRYDRSENPQ  612

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
             SSD  SN+DG  G N D+ MFD+FGG G+ VAA F SDI PPPVLMPVPGAG
Sbjct  613   SSDFTSNNDGPDGGNRDDTMFDAFGGQGMRVAAPFSSDIAPPPVLMPVPGAG  664


 Score =   117 bits (294),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE+AMQ+ RE+GGP PFEG  R GR GP + G AP + LPP  RQDPRR+R
Sbjct  665  PLGPFVPAPPELAMQVFRERGGPPPFEGNSRGGRPGPNLSGPAPFL-LPPGFRQDPRRLR  723

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  724  SYQDLDAPEDEVTVIDYRSL  743



>ref|XP_008451085.1| PREDICTED: serrate RNA effector molecule [Cucumis melo]
Length=751

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/468 (74%), Positives = 400/468 (85%), Gaps = 4/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+QELEDDILPAEAERRYQEYKS YI  QK+A+FD+HKDEEWL+DKYHPTN
Sbjct  206   REGLMTYKQFMQELEDDILPAEAERRYQEYKSEYITTQKQAFFDSHKDEEWLRDKYHPTN  265

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE A++ AKDFLLDLQSGTLDLGPG++   +N +GQ+SEPNSDDEAD   KR
Sbjct  266   LVTVIERRNELAQRTAKDFLLDLQSGTLDLGPGISAAATNKSGQASEPNSDDEADNDGKR  325

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  LLS APKAHPVSSEPRRI ID+ Q+Q LV KLDSEKGIEENILS SD+
Sbjct  326   RRHGRGPAKEMDLLSAAPKAHPVSSEPRRIQIDIGQAQALVRKLDSEKGIEENILSGSDS  385

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  RDK++  SSGPV++I RGLT+VKGLEG ELL+TLLTYLWRIHG+DYYGM+ET EAK
Sbjct  386   DKLGRDKAHGGSSGPVIII-RGLTTVKGLEGVELLDTLLTYLWRIHGLDYYGMVETREAK  444

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GKN+  +S   +WE+KLD RW+ERL+GQD LEVMTAK+KI+ AA+EA +PYV
Sbjct  445   GLRHVREEGKNSNMASGADEWEKKLDLRWQERLRGQDLLEVMTAKDKIEAAALEAFDPYV  504

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL LKHPELV+ELTSKVRE+LYFQNYM+D
Sbjct  505   RKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLNLKHPELVMELTSKVREELYFQNYMND  564

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  SLPK+K QRRR +L+ RLKDDRGNRR+R+   NG +RFDR ENP SSD
Sbjct  565   ADAPGGTPVMQQSLPKDKPQRRRMNLDGRLKDDRGNRRDRDNWANGGDRFDRSENPQSSD  624

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               S +DG  G N D+ MFDSFGG G  VA F S+I PPPVLMPVPGAG
Sbjct  625   FPSANDGTDGGNIDDPMFDSFGGQGRHVAPFASEI-PPPVLMPVPGAG  671


 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEGG    +   Q+GG API+AL    RQDPRRIR
Sbjct  672  PLGPFVPAPPEVAMRMLREQGGPPPFEGGGRNGRPGPQLGGSAPILALSSGFRQDPRRIR  731

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  732  SYQDLDAPEDEVTVIDYRSL  751



>gb|KHG13779.1| Serrate RNA effector molecule [Gossypium arboreum]
Length=742

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/472 (72%), Positives = 402/472 (85%), Gaps = 5/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             +  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QK+A+FDAHKDEEWL+DKYH
Sbjct  195   NIFREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKQAFFDAHKDEEWLRDKYH  254

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRNE   ++AKDFLLDLQSGTLDL PGV P  S+ +GQ+S+P S+DE D G
Sbjct  255   PTNLVTVIERRNELVCRVAKDFLLDLQSGTLDLNPGVNPLSSSKSGQTSDPISEDETDIG  314

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
             DKRRRH + P+K+  +LS APKAHP+SS+PRRI ID+EQ+Q LV KLDSEKGIEENIL  
Sbjct  315   DKRRRHGKEPAKETDILSAAPKAHPISSDPRRIHIDIEQAQGLVRKLDSEKGIEENILRG  374

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
              DND+ +RDKS  S +GPVV+I RG  SVKGLEG ELL+TL+TYLWR+HG+DYYGMIET+
Sbjct  375   FDNDKVNRDKSRGSLTGPVVII-RGSNSVKGLEGVELLDTLITYLWRVHGLDYYGMIETS  433

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK+++ +++G++WE+K DSRW+ERL+GQDPLE+MTAK+KI+ AAVEAL 
Sbjct  434   EAKGLRHVRPEGKSSDVTNSGSEWEKKFDSRWQERLRGQDPLELMTAKDKIEAAAVEALN  493

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LY+QNY
Sbjct  494   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREELYYQNY  553

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM  SLPK+K  RRR  LE+RLKD+RG RR R+ R NG +R+DR ENP 
Sbjct  554   MNDPDAPGGTPVMQQSLPKDKPPRRR-MLENRLKDERGFRRGRDNRANGSDRYDRSENPQ  612

Query  807   SSDIQSNDDGG--RNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
             SS+  SN DG    N D+ MFD+FGG G+ VAA F SDI PPPVLMPVPGAG
Sbjct  613   SSEFPSNKDGADEGNRDDPMFDAFGGQGMHVAAPFSSDIAPPPVLMPVPGAG  664


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPE+AMQ+ RE+GGP+     R GR GP + G AP + LPP  +QDPRR+RS
Sbjct  665  PLGPFVPAPPELAMQVFRERGGPSYEGNTRGGRPGPNLSGPAPFL-LPPGFQQDPRRLRS  723

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  724  YQDLDAPEDEVTVIDYRSL  742



>ref|XP_004144077.1| PREDICTED: serrate RNA effector molecule-like isoform 1 [Cucumis 
sativus]
Length=755

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/468 (74%), Positives = 399/468 (85%), Gaps = 4/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+QELEDDILPAEAERRYQEYKS YI  QK+A+FD+HKDEEWL+DKYHPTN
Sbjct  210   REGLMTYKQFMQELEDDILPAEAERRYQEYKSEYITTQKQAFFDSHKDEEWLRDKYHPTN  269

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE A++ AKDFLLDLQSGTLDLGPG++   +N +GQ+SEPNSDDEAD   KR
Sbjct  270   LVTVIERRNELAQRTAKDFLLDLQSGTLDLGPGISAAATNKSGQASEPNSDDEADNDGKR  329

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  LLS APKAHPVSSEPRRI ID+ Q+Q LV KLDSEKGIEENILS SDN
Sbjct  330   RRHGRGPAKEMDLLSAAPKAHPVSSEPRRIQIDIGQAQALVRKLDSEKGIEENILSGSDN  389

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  RDK++  SSGPV++I RGLT+VKGLEG ELL+TLLTYLWRIHG+DYYGM+ET EAK
Sbjct  390   DKLGRDKAHGGSSGPVIII-RGLTTVKGLEGVELLDTLLTYLWRIHGIDYYGMVETREAK  448

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK++  +    +WE+KLD RW+ERL+GQD LEVMTAK+KI+ AA+EA +PYV
Sbjct  449   GLRHVREEGKSSNMAGGADEWEKKLDLRWQERLRGQDLLEVMTAKDKIEAAALEAFDPYV  508

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL LKHPELV+ELTSKVRE+LYFQNYM+D
Sbjct  509   RKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLNLKHPELVMELTSKVREELYFQNYMND  568

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  SLPK+K QRRR +L+ RLKDDRGNRR+R+   NG +RFDR ENP SSD
Sbjct  569   TDAPGGTPVMQQSLPKDKPQRRRMNLDGRLKDDRGNRRDRDNWANGGDRFDRSENPQSSD  628

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               S +DG  G N D+ MFDSFGG G  VA F S+I PPPVLMPVPGAG
Sbjct  629   FPSANDGTDGGNIDDPMFDSFGGQGRHVAPFASEI-PPPVLMPVPGAG  675


 Score =   102 bits (253),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEGG    +   Q+GG API+AL    RQDPRRIR
Sbjct  676  PLGPFVPAPPEVAMRMLREQGGPPPFEGGGRNGRPGPQLGGSAPILALSSGFRQDPRRIR  735

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  736  SYQDLDAPEDEVTVIDYRSL  755



>ref|XP_004144078.1| PREDICTED: serrate RNA effector molecule-like isoform 2 [Cucumis 
sativus]
Length=751

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/468 (74%), Positives = 399/468 (85%), Gaps = 4/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+QELEDDILPAEAERRYQEYKS YI  QK+A+FD+HKDEEWL+DKYHPTN
Sbjct  206   REGLMTYKQFMQELEDDILPAEAERRYQEYKSEYITTQKQAFFDSHKDEEWLRDKYHPTN  265

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE A++ AKDFLLDLQSGTLDLGPG++   +N +GQ+SEPNSDDEAD   KR
Sbjct  266   LVTVIERRNELAQRTAKDFLLDLQSGTLDLGPGISAAATNKSGQASEPNSDDEADNDGKR  325

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  LLS APKAHPVSSEPRRI ID+ Q+Q LV KLDSEKGIEENILS SDN
Sbjct  326   RRHGRGPAKEMDLLSAAPKAHPVSSEPRRIQIDIGQAQALVRKLDSEKGIEENILSGSDN  385

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  RDK++  SSGPV++I RGLT+VKGLEG ELL+TLLTYLWRIHG+DYYGM+ET EAK
Sbjct  386   DKLGRDKAHGGSSGPVIII-RGLTTVKGLEGVELLDTLLTYLWRIHGIDYYGMVETREAK  444

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK++  +    +WE+KLD RW+ERL+GQD LEVMTAK+KI+ AA+EA +PYV
Sbjct  445   GLRHVREEGKSSNMAGGADEWEKKLDLRWQERLRGQDLLEVMTAKDKIEAAALEAFDPYV  504

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL LKHPELV+ELTSKVRE+LYFQNYM+D
Sbjct  505   RKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLNLKHPELVMELTSKVREELYFQNYMND  564

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  SLPK+K QRRR +L+ RLKDDRGNRR+R+   NG +RFDR ENP SSD
Sbjct  565   TDAPGGTPVMQQSLPKDKPQRRRMNLDGRLKDDRGNRRDRDNWANGGDRFDRSENPQSSD  624

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               S +DG  G N D+ MFDSFGG G  VA F S+I PPPVLMPVPGAG
Sbjct  625   FPSANDGTDGGNIDDPMFDSFGGQGRHVAPFASEI-PPPVLMPVPGAG  671


 Score =   102 bits (253),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEGG    +   Q+GG API+AL    RQDPRRIR
Sbjct  672  PLGPFVPAPPEVAMRMLREQGGPPPFEGGGRNGRPGPQLGGSAPILALSSGFRQDPRRIR  731

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  732  SYQDLDAPEDEVTVIDYRSL  751



>gb|KHG13780.1| Serrate RNA effector molecule [Gossypium arboreum]
Length=738

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/472 (73%), Positives = 402/472 (85%), Gaps = 5/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QK+A+FDAHKDEEWL+DKYH
Sbjct  191   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKQAFFDAHKDEEWLRDKYH  250

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRNE   ++AKDFLLDLQSGTLDL PGV P  S+ +GQ+S+P S+DE D G
Sbjct  251   PTNLVTVIERRNELVCRVAKDFLLDLQSGTLDLNPGVNPLSSSKSGQTSDPISEDETDIG  310

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
             DKRRRH + P+K+  +LS APKAHP+SS+PRRI ID+EQ+Q LV KLDSEKGIEENIL  
Sbjct  311   DKRRRHGKEPAKETDILSAAPKAHPISSDPRRIHIDIEQAQGLVRKLDSEKGIEENILRG  370

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
              DND+ +RDKS  S +GPVV+I RG  SVKGLEG ELL+TL+TYLWR+HG+DYYGMIET+
Sbjct  371   FDNDKVNRDKSRGSLTGPVVII-RGSNSVKGLEGVELLDTLITYLWRVHGLDYYGMIETS  429

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK+++ +++G++WE+K DSRW+ERL+GQDPLE+MTAK+KI+ AAVEAL 
Sbjct  430   EAKGLRHVRPEGKSSDVTNSGSEWEKKFDSRWQERLRGQDPLELMTAKDKIEAAAVEALN  489

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LY+QNY
Sbjct  490   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREELYYQNY  549

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM  SLPK+K  RRR  LE+RLKD+RG RR R+ R NG +R+DR ENP 
Sbjct  550   MNDPDAPGGTPVMQQSLPKDKPPRRR-MLENRLKDERGFRRGRDNRANGSDRYDRSENPQ  608

Query  807   SSDIQSNDDGG--RNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
             SS+  SN DG    N D+ MFD+FGG G+ VAA F SDI PPPVLMPVPGAG
Sbjct  609   SSEFPSNKDGADEGNRDDPMFDAFGGQGMHVAAPFSSDIAPPPVLMPVPGAG  660


 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 1/79 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPE+AMQ+ RE+GGP+     R GR GP + G AP + LPP  +QDPRR+RS
Sbjct  661  PLGPFVPAPPELAMQVFRERGGPSYEGNTRGGRPGPNLSGPAPFL-LPPGFQQDPRRLRS  719

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  720  YQDLDAPEDEVTVIDYRSL  738



>gb|KHF98250.1| Serrate RNA effector molecule -like protein [Gossypium arboreum]
Length=737

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/469 (76%), Positives = 407/469 (87%), Gaps = 5/469 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRA+FDAHKDEEWL+DKYHPTN
Sbjct  193   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAFFDAHKDEEWLRDKYHPTN  252

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE ARK+AKDF LDLQSGTLDL PGV    SN +GQ+SEPNS+DE D G KR
Sbjct  253   LVTVIERRNELARKVAKDFFLDLQSGTLDLTPGVNALSSNKSGQTSEPNSEDETDIGGKR  312

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  +LS APKAHPVSS+PRRI ID+ Q+Q LV KLDSEKGIEENILS SDN
Sbjct  313   RRHGRGPTKETDILSLAPKAHPVSSDPRRIQIDIGQAQGLVRKLDSEKGIEENILSGSDN  372

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+ SRDK + S +GPV+ IVRGLTSVKGLEG ELL+TL+TYLWR+HGVDYYGMIET+EAK
Sbjct  373   DKISRDKYHGSFAGPVI-IVRGLTSVKGLEGVELLDTLITYLWRVHGVDYYGMIETSEAK  431

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G RH+R +GK+++ +SNG++WE+KLDS W++RL+GQDPLEVMTAK+K+D AAVE+L+P+V
Sbjct  432   GFRHVRAEGKSSDITSNGSEWEKKLDSYWQDRLRGQDPLEVMTAKDKLDAAAVESLDPFV  491

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNYM+D
Sbjct  492   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNYMND  551

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM   +PK+K QRR+  +E+RLKD+RG RRER+ R NG +RFDR ENP SSD
Sbjct  552   PDAPGGTPVMQQPIPKDKPQRRK-IMENRLKDERGLRRERDNRANGSDRFDRSENPQSSD  610

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
               SN+DG  G N D+ MFDSF G G+ VAA F SDI PPPVLMPVPGAG
Sbjct  611   FPSNNDGPDGGNHDDPMFDSFSGQGMHVAAPFSSDIAPPPVLMPVPGAG  659


 Score =   113 bits (282),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE+AMQ+ RE+GGP PFEG  R+GR GP + G AP + LPP  RQDPR +R
Sbjct  660  PLGPFVPAPPELAMQVFRERGGP-PFEGNSRSGRPGPNLSGPAPFL-LPPGFRQDPRHLR  717

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  718  SYQDLDAPEDEVTVIDYRSL  737



>ref|XP_010093794.1| hypothetical protein L484_022506 [Morus notabilis]
 gb|EXB54645.1| hypothetical protein L484_022506 [Morus notabilis]
Length=746

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/474 (73%), Positives = 395/474 (83%), Gaps = 8/474 (2%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
             V +  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHK+EEWLKDK
Sbjct  198   VGTNQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYITTQKRAYFNAHKEEEWLKDK  257

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNL++VIERRNE ARK+AKDFLLDLQSGTLDLGPG+    SN   Q S+PNS+DE D
Sbjct  258   YHPTNLLAVIERRNELARKVAKDFLLDLQSGTLDLGPGLNALSSNKKEQPSDPNSEDEVD  317

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
              G KRRR  R P+K+  L S APKAHPVSSEPRRI +D+EQ+Q LV KLDSEKGIE NIL
Sbjct  318   VGGKRRRRCRTPTKEGDL-SAAPKAHPVSSEPRRIQLDIEQAQALVRKLDSEKGIEGNIL  376

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
               SDND+        SS    V+IVRGLTSVKGLEG ELL+TL+TYLW IHG+DYYGM+E
Sbjct  377   GGSDNDKSREKSHAGSSGP--VIIVRGLTSVKGLEGVELLDTLITYLWHIHGLDYYGMVE  434

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             T+E KGLRH+R +GK+T+ +SNGA+WE+KLDSRW+ERL+ QDPLE+MTAKEKIDTAAVEA
Sbjct  435   TSEPKGLRHVRVEGKSTDITSNGAEWEKKLDSRWQERLQSQDPLEIMTAKEKIDTAAVEA  494

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP+LV++LT KVREDLYFQ
Sbjct  495   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPDLVMDLTVKVREDLYFQ  554

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NYM+D +APGGTPVM  +  ++KL RRR   + RLKD+RGNRRER+ R NG ERFDR EN
Sbjct  555   NYMNDANAPGGTPVMQQTGQRDKLPRRRLGPDMRLKDERGNRRERDNRANGGERFDRSEN  614

Query  813   PLSSDIQSNDDG--GRNPDEQMFDSFGGHGIPVA-AFPSDITPPPVLMPVPGAG  661
             P  S+ QSN+DG  G N DE M+DSFGG G+ VA  FPSDI  PPVLMPVPGAG
Sbjct  615   P--SEFQSNNDGSDGGNLDESMYDSFGGQGLRVAPPFPSDIPTPPVLMPVPGAG  666


 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/80 (76%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEGG    +   Q+ G  PI+AL  +L QDPRRIR
Sbjct  667  PLGPFVPAPPEVAMRMLREQGGPPPFEGGGRSGRPGPQMSGPTPILALSSALGQDPRRIR  726

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  727  SYQDLDAPEDEVTVIDYRSL  746



>ref|XP_002521645.1| arsenite-resistance protein, putative [Ricinus communis]
 gb|EEF40752.1| arsenite-resistance protein, putative [Ricinus communis]
Length=823

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/473 (74%), Positives = 405/473 (86%), Gaps = 3/473 (1%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
              +S  REGL SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKR +F+AHKDEEWLKDK
Sbjct  273   TMSTQREGLMSYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRVFFEAHKDEEWLKDK  332

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNLV+VIERRNE ARK AKDFLLDLQSGTLDLGPG+    SN +GQ+S+PNSDDE D
Sbjct  333   YHPTNLVAVIERRNELARKAAKDFLLDLQSGTLDLGPGINVLSSNKSGQTSDPNSDDEVD  392

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
                KRRRH R P+K+  +LS APKAHPVSSEPRRI IDVEQ+Q LV KLDSEKGIEENIL
Sbjct  393   TSGKRRRHGRAPAKENDILSAAPKAHPVSSEPRRIQIDVEQAQALVRKLDSEKGIEENIL  452

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
               SDN++ +R+K + SSSGPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYY M+E
Sbjct  453   GGSDNEKMNREKPHGSSSGPVIII-RGLTSVKGLEGIELLDTLITYLWRVHGLDYYRMVE  511

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             T EAKG+RH+R +GK+++ +++G +WE+KLDSRW+ERL+ QDPLEVMTAKEKI+  AVE+
Sbjct  512   TTEAKGVRHVRAEGKSSDVNNSGMEWEKKLDSRWQERLRSQDPLEVMTAKEKIEATAVES  571

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSK+REDLYFQ
Sbjct  572   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKLREDLYFQ  631

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NYM+D  APGGTPVM   LPK+K QRR+   E+RLKD+RGNRRE + R NG ERFDR EN
Sbjct  632   NYMNDPDAPGGTPVMQQPLPKDKPQRRKLGPENRLKDERGNRREHDSRANGSERFDRSEN  691

Query  813   PLSSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             P + D QSN+DG  G N D+ M+D+FGG GI V +FPSDI PPPVLMPVPGAG
Sbjct  692   PQTGDFQSNNDGPDGGNHDDGMYDNFGGQGIHVPSFPSDIPPPPVLMPVPGAG  744


 Score =   127 bits (319),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 71/80 (89%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+M REQGGP PFE GGRNGR GPQ+ G API+ L P+ RQDPRRIR
Sbjct  745  PLGPFVPAPPEVAMRMFREQGGPPPFESGGRNGRPGPQLSGPAPIL-LSPAFRQDPRRIR  803

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAP+DEVTVIDYRSL
Sbjct  804  SYQDLDAPDDEVTVIDYRSL  823



>gb|KHG09660.1| Serrate RNA effector molecule -like protein [Gossypium arboreum]
Length=738

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/472 (71%), Positives = 396/472 (84%), Gaps = 7/472 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRA+FDAHK+E+WLKDKYH
Sbjct  192   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAFFDAHKNEDWLKDKYH  251

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRNE ARK+AKDFLLDLQSGTLDL P V    S  + Q+S+PNS+DEAD G
Sbjct  252   PTNLVTVIERRNEFARKVAKDFLLDLQSGTLDLSPAVNSLSSKKSEQTSDPNSEDEADIG  311

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KR+R+ R P+K+  L S APKAHP SS+PRRI ID+EQ+Q+L+ KLDSEKGI ENILS 
Sbjct  312   GKRKRNAREPAKETDL-SAAPKAHPTSSDPRRISIDIEQAQSLMRKLDSEKGISENILSG  370

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
              DN         SS+    V+IVRGLTSVKGLEG ELL+TL+TYLWR+HG+DYYG+IET+
Sbjct  371   PDNQITRDKSHGSSTGP--VIIVRGLTSVKGLEGVELLDTLITYLWRVHGLDYYGLIETS  428

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK ++ + NG++WE+ LD+RW+ERLKGQDPLE+MTAKEK+D AAVEAL+
Sbjct  429   EAKGLRHVREEGKGSDVTINGSEWEKNLDTRWQERLKGQDPLELMTAKEKLDAAAVEALD  488

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSK+RE+LYFQNY
Sbjct  489   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKMREELYFQNY  548

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM  S+PK+K  RR+  LE+RLKD+RG+RRER+ R NG +R+DR ENP 
Sbjct  549   MNDPGAPGGTPVMQQSVPKDKPLRRK-MLENRLKDERGSRRERDNRANGSDRYDRSENPQ  607

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
             SSD  SN++G  G N D+ MF+SFGG G+ VA  F SD+ PPPVLMPVPGAG
Sbjct  608   SSDFPSNNEGPEGGNRDDLMFESFGGQGMHVATPFSSDMAPPPVLMPVPGAG  659


 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE+AMQ+ REQGGP PFEG  R+GR GP + G AP + LPP  RQDPRR+R
Sbjct  660  PLGPFVPAPPELAMQVFREQGGPLPFEGNSRSGRPGPNLSGPAPFL-LPPGFRQDPRRLR  718

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  719  SYQDLDAPEDEVTVIDYRSL  738



>ref|XP_010659014.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Vitis 
vinifera]
Length=747

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/472 (71%), Positives = 389/472 (82%), Gaps = 8/472 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY+S YI  QKRA+FDAHKDEEWLKDKYHPTN
Sbjct  199   REGLMSYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRAFFDAHKDEEWLKDKYHPTN  258

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR+MAKDFLLDLQSGTLD+GPGV  + SN +GQ+S+PNSDDE + GDKR
Sbjct  259   LLAVIERRNENARRMAKDFLLDLQSGTLDIGPGVNASSSNKSGQTSDPNSDDETETGDKR  318

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP K++ L S A  AHP SSEPRRI  D+EQ+  LV KLDSEKG+E+NIL  ++ 
Sbjct  319   RRHGRGPIKESDL-STAAVAHPNSSEPRRIQADIEQALALVRKLDSEKGVEDNILCSAEQ  377

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              +   DKS+S S GP+++I RGL SVKGLEG ELL+T+LTYLWRIHG+DYYGM+ET+EAK
Sbjct  378   KKTDSDKSHSGSMGPIIII-RGLASVKGLEGIELLDTILTYLWRIHGLDYYGMVETSEAK  436

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R +GK + E S  GADWE+KLDSRW++RL+GQDPLE M AKEKID AAVE L+PY
Sbjct  437   GLRHVRAEGKGHEENSKAGADWEKKLDSRWQDRLRGQDPLETMAAKEKIDAAAVEGLDPY  496

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDE+YGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV++LT+KVREDLYFQNYM+
Sbjct  497   VRKIRDERYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMDLTTKVREDLYFQNYMN  556

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngv--eRFDRPENPL  808
             D  APGGTPVM   L K++LQRRRP L++RLKDDRGNRRE +        ERFDR +N  
Sbjct  557   DPDAPGGTPVMQQQLLKDRLQRRRPGLDNRLKDDRGNRREHDRIERINDGERFDRTDNSP  616

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVA-AFPSDITPPPVLMPVPGAG  661
               D QS   G  G N DE M+D++GG  + V   FPSD+ PPPVLMPVPGAG
Sbjct  617   PHDRQSKGGGLEGGNLDESMYDTYGGKDLGVIPPFPSDMGPPPVLMPVPGAG  668


 Score =   127 bits (320),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+MLREQGG + +EGGR  R GP IGG API+ +  + RQDPRR+RS
Sbjct  669  PLGPFVPAPPEVAMRMLREQGGSSSYEGGRQMRTGPHIGGPAPILGVSSAFRQDPRRLRS  728

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  729  YQDLDAPEDEVTVIDYRSL  747



>ref|XP_010659013.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Vitis 
vinifera]
Length=755

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/472 (71%), Positives = 389/472 (82%), Gaps = 8/472 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY+S YI  QKRA+FDAHKDEEWLKDKYHPTN
Sbjct  207   REGLMSYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRAFFDAHKDEEWLKDKYHPTN  266

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR+MAKDFLLDLQSGTLD+GPGV  + SN +GQ+S+PNSDDE + GDKR
Sbjct  267   LLAVIERRNENARRMAKDFLLDLQSGTLDIGPGVNASSSNKSGQTSDPNSDDETETGDKR  326

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP K++ L S A  AHP SSEPRRI  D+EQ+  LV KLDSEKG+E+NIL  ++ 
Sbjct  327   RRHGRGPIKESDL-STAAVAHPNSSEPRRIQADIEQALALVRKLDSEKGVEDNILCSAEQ  385

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              +   DKS+S S GP+++I RGL SVKGLEG ELL+T+LTYLWRIHG+DYYGM+ET+EAK
Sbjct  386   KKTDSDKSHSGSMGPIIII-RGLASVKGLEGIELLDTILTYLWRIHGLDYYGMVETSEAK  444

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R +GK + E S  GADWE+KLDSRW++RL+GQDPLE M AKEKID AAVE L+PY
Sbjct  445   GLRHVRAEGKGHEENSKAGADWEKKLDSRWQDRLRGQDPLETMAAKEKIDAAAVEGLDPY  504

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDE+YGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV++LT+KVREDLYFQNYM+
Sbjct  505   VRKIRDERYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMDLTTKVREDLYFQNYMN  564

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngv--eRFDRPENPL  808
             D  APGGTPVM   L K++LQRRRP L++RLKDDRGNRRE +        ERFDR +N  
Sbjct  565   DPDAPGGTPVMQQQLLKDRLQRRRPGLDNRLKDDRGNRREHDRIERINDGERFDRTDNSP  624

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVA-AFPSDITPPPVLMPVPGAG  661
               D QS   G  G N DE M+D++GG  + V   FPSD+ PPPVLMPVPGAG
Sbjct  625   PHDRQSKGGGLEGGNLDESMYDTYGGKDLGVIPPFPSDMGPPPVLMPVPGAG  676


 Score =   127 bits (319),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+MLREQGG + +EGGR  R GP IGG API+ +  + RQDPRR+RS
Sbjct  677  PLGPFVPAPPEVAMRMLREQGGSSSYEGGRQMRTGPHIGGPAPILGVSSAFRQDPRRLRS  736

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  737  YQDLDAPEDEVTVIDYRSL  755



>emb|CDP19125.1| unnamed protein product [Coffea canephora]
Length=760

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/452 (76%), Positives = 384/452 (85%), Gaps = 7/452 (2%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR YFDAHKDEEWLKDKYH
Sbjct  207   STQREGLMSYKQFIQELEDDILPSEAERRYQEYKSEYISTQKRTYFDAHKDEEWLKDKYH  266

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL+SVIERRNE ARK+AKDFLLDLQSGT+DLGPGV  + S    QSS+PNS+DE DAG
Sbjct  267   PTNLLSVIERRNEAARKLAKDFLLDLQSGTVDLGPGVNASSSK---QSSDPNSEDETDAG  323

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRR  RGP+K+  LLS APKAHPVSSEPRR+ ID+EQ+Q LV KLDSEKGIE+N+L R
Sbjct  324   GKRRRPGRGPAKETDLLSAAPKAHPVSSEPRRMQIDIEQAQGLVRKLDSEKGIEDNLLCR  383

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             +DN+R +RDKS+  S+GPV++I RGLTSVKGLEG ELL+TLLTYLWRIHGVDYYGM ETN
Sbjct  384   ADNERMNRDKSHGGSTGPVIII-RGLTSVKGLEGIELLDTLLTYLWRIHGVDYYGMSETN  442

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R DGKN + +SNGA+WE+KLD  W+ERLKGQDPLEVMTAKEKID AAVEAL+
Sbjct  443   EAKGLRHVRVDGKNPDVTSNGAEWEKKLDLHWQERLKGQDPLEVMTAKEKIDAAAVEALD  502

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVREDLYFQNY
Sbjct  503   PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREDLYFQNY  562

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+DE+APGGTP+M  S+ KEK  RRRP L++RLK D    R         ERFDR +NP 
Sbjct  563   MNDENAPGGTPIMQPSMQKEKPLRRRPGLDNRLK-DERGGRRERENRANGERFDRSDNPQ  621

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVA  718
               D QSN+DG  G NPDE MFD+FGG GIPVA
Sbjct  622   QVDFQSNNDGAAGGNPDEPMFDTFGGQGIPVA  653


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 56/59 (95%), Gaps = 0/59 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP+PFEGGR+GR GPQ+GG APIIA+PP+ RQDPRR+R
Sbjct  673  PLGPFVPAPPEVAMRMLREQGGPSPFEGGRSGRSGPQLGGPAPIIAMPPAFRQDPRRLR  731



>gb|KHG08489.1| Serrate RNA effector molecule -like protein [Gossypium arboreum]
Length=727

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/472 (71%), Positives = 391/472 (83%), Gaps = 16/472 (3%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILP EAERRYQEYKS YI  QKRAYFDAHKDEEWL+DKYH
Sbjct  191   SAQREGLMSYKQFIQELEDDILPTEAERRYQEYKSEYISTQKRAYFDAHKDEEWLRDKYH  250

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             P  LV+VIERRNE ARK+ KDFLLDLQSGTLDL P V    SN +GQ+S+PNS+DEA+ G
Sbjct  251   PIKLVTVIERRNELARKVVKDFLLDLQSGTLDLSPSVNALSSNKSGQTSDPNSEDEAEVG  310

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRR H RGP+K+  L S APKAHPVS++PRRI ID+EQ+Q+LV KLDSEKGIEENIL  
Sbjct  311   GKRRWHGRGPAKETDL-SAAPKAHPVSADPRRIEIDIEQAQSLVCKLDSEKGIEENILRG  369

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDN++ +RDKS+ S +GPV+ IVRGLT+VKGLEG ELL+TL+TYLWR+HG+DYYGMIETN
Sbjct  370   SDNNKINRDKSHGSLTGPVI-IVRGLTTVKGLEGVELLDTLITYLWRVHGLDYYGMIETN  428

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK ++ +SN ++WE+KLDS W+ERL+ QDPLE+MTAK+KID AA+EA  
Sbjct  429   EAKGLRHVRAEGKRSDVTSNESEWEKKLDSHWQERLRSQDPLELMTAKDKIDAAAIEAFN  488

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKV E+LYFQNY
Sbjct  489   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVVELTSKVSEELYFQNY  548

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM  S+PK+K QRR+  LE+RLKDDR   RER          DR + P 
Sbjct  549   MNDPDAPGGTPVMQQSIPKDKPQRRK-ILENRLKDDRDLHRER----------DRSDIPQ  597

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVAA-FPSDITPPPVLMPVPGAG  661
             +SD   NDDG  G N ++ +FD+FGG G+ VAA F SD+ PPPVLMPVPGAG
Sbjct  598   TSDFSLNDDGLDGGNGNDPIFDAFGGQGMHVAAPFSSDVAPPPVLMPVPGAG  649


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE+AMQ+ RE+G P PFEG GR+GR GP + G  P + LPP  RQDPRR+R
Sbjct  650  PLGPFVPAPPELAMQVFRERGAP-PFEGNGRSGRSGPNLSGPTPFL-LPPGFRQDPRRLR  707

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  708  SYQDLDAPEDEVTVIDYRSL  727



>ref|XP_010685517.1| PREDICTED: serrate RNA effector molecule [Beta vulgaris subsp. 
vulgaris]
Length=744

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/468 (70%), Positives = 383/468 (82%), Gaps = 7/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKR YF+AHKDEEWLK+KYHPTN
Sbjct  209   REGLMSYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRTYFEAHKDEEWLKNKYHPTN  268

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRN+ ARK+AKDFLLDL SG+LD+GPG      N  GQ+SEPNSDDE D G KR
Sbjct  269   LLTVIERRNDLARKVAKDFLLDLHSGSLDMGPGANALSMNKAGQTSEPNSDDETDVGGKR  328

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH R  +K++ + S APKAHPVSSEPRRI ID+E +Q LV KLDSEKGIE+NILS+ D 
Sbjct  329   RRHGRVQAKESDI-SAAPKAHPVSSEPRRIQIDIELAQALVTKLDSEKGIEDNILSKDDT  387

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+ +R++S+S S GPV++I RGLTSVKGLEG ELL+T  TYLWR+HGVDYYGM ET E K
Sbjct  388   DKMNRERSHSGSIGPVIII-RGLTSVKGLEGVELLDTFATYLWRVHGVDYYGMTETAEPK  446

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GKN++ S+N A+WE KLDSRW++RL+ QDPLEVMTAKEKID AAVEAL+P+V
Sbjct  447   GLRHVRSEGKNSDVSTNAAEWEEKLDSRWQDRLRSQDPLEVMTAKEKIDAAAVEALDPFV  506

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAE+VHKHLKLKHPE V++LT KVRED+YFQNYMSD
Sbjct  507   RKIRDEKYGWKYGCGAKGCTKLFHAAEYVHKHLKLKHPEHVMDLTVKVREDIYFQNYMSD  566

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGG PVM   +PK+K+QRRRP  ++R KDD      R    NG ERF+R ENP +  
Sbjct  567   PEAPGGQPVMQQFVPKDKMQRRRPGADNRSKDD--RGNRRERDRNGGERFERSENPQADF  624

Query  798   IQSND--DGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               +ND  D G N DE +FD+FGG G+ VA F +DI PPPVLMPVPGAG
Sbjct  625   PPNNDTQDKG-NADEPIFDNFGGQGMHVAPFAADIAPPPVLMPVPGAG  671


 Score =   101 bits (251),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 67/80 (84%), Gaps = 8/80 (10%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEG  RNGR  P      PII LPPS RQDPRR+R
Sbjct  672  PLGPFVPAPPEVAMRMLREQGGPPPFEGPGRNGRGAP------PII-LPPSFRQDPRRLR  724

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  725  SYQDLDAPEDEVTVIDYRSL  744



>ref|XP_007208293.1| hypothetical protein PRUPE_ppa003365mg [Prunus persica]
 gb|EMJ09492.1| hypothetical protein PRUPE_ppa003365mg [Prunus persica]
Length=581

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/449 (73%), Positives = 379/449 (84%), Gaps = 4/449 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY++ YI  QKRAYF+AHKDE+WLKDKYHPTN
Sbjct  35    REGLMSYKQFIQELEDDILPAEAERRYQEYRTEYITTQKRAYFNAHKDEDWLKDKYHPTN  94

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE ARK+AKDFLL+LQSGTLDLGPGV     N +G +SEPNSDDEAD G KR
Sbjct  95    LLTVIERRNEHARKVAKDFLLELQSGTLDLGPGVNSVAPNKSGHTSEPNSDDEADVGGKR  154

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH R P+K+  LLS APKAHPVSSEPRRI +D+EQ+Q LV KLDSEKGI ENIL+  DN
Sbjct  155   RRHVREPNKENDLLSAAPKAHPVSSEPRRIQVDIEQAQALVRKLDSEKGIVENILAGPDN  214

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+        S+    V+IVRGLTSVKGLEG ELL+TL+TYLWRIHG+DYYGM E+NEAK
Sbjct  215   DKNREKLHGGSTGP--VIIVRGLTSVKGLEGIELLDTLITYLWRIHGLDYYGMSESNEAK  272

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK+++  SNGA+WE+K+D RW+ERL+ QDPLE+MTAKEKID  A E+L+PYV
Sbjct  273   GLRHVRAEGKSSDIISNGAEWEKKMDLRWQERLQSQDPLEIMTAKEKIDATASESLDPYV  332

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+E+TSK+RE+LYFQNYM+D
Sbjct  333   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIEVTSKLREELYFQNYMND  392

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTP+M   + +EK QRRRP +E+RLKD+RGNRRER  RVNG ER+DR +N  SS+
Sbjct  393   ADAPGGTPIMQQPVLREKPQRRRPGVENRLKDERGNRRERENRVNGGERYDRSDNMQSSE  452

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVA  718
              QSN+DG  G N DE MFD+FGG G+ V 
Sbjct  453   FQSNNDGPEGGNLDEPMFDNFGGQGVRVG  481


 Score =   133 bits (334),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQMLREQGGP PFEG GRN   GPQ+ G API+AL P+ RQDPRR+R
Sbjct  502  PLGPFVPAPPEVAMQMLREQGGPPPFEGSGRNVWSGPQMSGPAPILALSPAFRQDPRRLR  561

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  562  SYQDLDAPEDEVTVIDYRSL  581



>gb|KDP42903.1| hypothetical protein JCGZ_23845 [Jatropha curcas]
Length=742

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/452 (74%), Positives = 388/452 (86%), Gaps = 2/452 (0%)
 Frame = -1

Query  2073  VVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDK  1894
              V+  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +F++HKDEEWL+DK
Sbjct  193   TVTAQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFESHKDEEWLRDK  252

Query  1893  YHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEAD  1714
             YHPTNLV+VIERRNE ARK+AKDFLLDLQSGTLDLGPG+    SN +GQ+S+PNSDDE D
Sbjct  253   YHPTNLVAVIERRNELARKVAKDFLLDLQSGTLDLGPGINVLSSNKSGQTSDPNSDDEVD  312

Query  1713  AGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
             AG KRRRH R P+K+  LLS APKAH VSSEPRRI IDV+Q+Q LV KLDSEKGIEEN+L
Sbjct  313   AGGKRRRHGRAPAKETDLLSAAPKAHLVSSEPRRIHIDVDQAQALVRKLDSEKGIEENVL  372

Query  1533  srsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIE  1354
               SDN++  R+KS+SSSSGPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYGMIE
Sbjct  373   GGSDNEKMHREKSHSSSSGPVIII-RGLTSVKGLEGIELLDTLITYLWRVHGLDYYGMIE  431

Query  1353  TNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEA  1174
             T EAKGLRH+R +GK+++ +++G +WE+KLDSRW+ERL+GQDPLE+MTAKEKID AAVE+
Sbjct  432   TAEAKGLRHVRAEGKSSDATNSGNEWEKKLDSRWQERLRGQDPLEIMTAKEKIDAAAVES  491

Query  1173  LEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQ  994
             L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQ
Sbjct  492   LDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREELYFQ  551

Query  993   NYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPEN  814
             NYM+D  APGGTPVM   LPK+K QRR+   E+RLKD+RG RR+R  R NG ER+DR EN
Sbjct  552   NYMNDPDAPGGTPVMQQPLPKDKPQRRKIGQENRLKDERGGRRDRENRANGSERYDRSEN  611

Query  813   PLSSDIQSNDD-GGRNPDEQMFDSFGGHGIPV  721
               S D QS+D     N D+ M+DSFGG G+ V
Sbjct  612   QQSGDFQSSDGPDAVNHDDPMYDSFGGQGMRV  643


 Score =   113 bits (282),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+M REQGGPAPFEGG    +   QI G API+ L P+ RQDPRRIR
Sbjct  664  PLGPFVPAPPEVAMRMFREQGGPAPFEGGGRNGRPGPQISGPAPIL-LSPAFRQDPRRIR  722

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  723  SYQDLDAPEDEVTVIDYRSL  742



>emb|CBI29150.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/468 (69%), Positives = 378/468 (81%), Gaps = 23/468 (5%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY+S YI  QKRA+FDAHKDEEWLKDKYHPTN
Sbjct  199   REGLMSYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRAFFDAHKDEEWLKDKYHPTN  258

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR+MAKDFLLDLQSGTLD+GPGV  + SN +GQ+S+PNSDDE + GDKR
Sbjct  259   LLAVIERRNENARRMAKDFLLDLQSGTLDIGPGVNASSSNKSGQTSDPNSDDETETGDKR  318

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP K++ L S A  AHP SSEPRRI  D+EQ+  LV KLDSEKG+E+NIL  ++ 
Sbjct  319   RRHGRGPIKESDL-STAAVAHPNSSEPRRIQADIEQALALVRKLDSEKGVEDNILCSAEQ  377

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              +   DKS+S S GP+++I RGL SVKGLEG ELL+T+LTYLWRIHG+DYYGM+ET+EAK
Sbjct  378   KKTDSDKSHSGSMGPIIII-RGLASVKGLEGIELLDTILTYLWRIHGLDYYGMVETSEAK  436

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R +GK + E S  GADWE+KLDSRW++RL+GQDPLE M AKEKID AAVE L+PY
Sbjct  437   GLRHVRAEGKGHEENSKAGADWEKKLDSRWQDRLRGQDPLETMAAKEKIDAAAVEGLDPY  496

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDE+YGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV++LT+KVREDLYFQNYM+
Sbjct  497   VRKIRDERYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMDLTTKVREDLYFQNYMN  556

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTPVM   L K++LQRRRP L++RLKDD                 DR       
Sbjct  557   DPDAPGGTPVMQQQLLKDRLQRRRPGLDNRLKDD----------RGNRREHDR-------  599

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVA-AFPSDITPPPVLMPVPGAG  661
              I+  +DGG N DE M+D++GG  + V   FPSD+ PPPVLMPVPGAG
Sbjct  600   -IERINDGG-NLDESMYDTYGGKDLGVIPPFPSDMGPPPVLMPVPGAG  645


 Score =   127 bits (320),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+MLREQGG + +EGGR  R GP IGG API+ +  + RQDPRR+RS
Sbjct  646  PLGPFVPAPPEVAMRMLREQGGSSSYEGGRQMRTGPHIGGPAPILGVSSAFRQDPRRLRS  705

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  706  YQDLDAPEDEVTVIDYRSL  724



>ref|XP_004295127.1| PREDICTED: serrate RNA effector molecule-like [Fragaria vesca 
subsp. vesca]
Length=754

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/469 (71%), Positives = 394/469 (84%), Gaps = 5/469 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYK+ YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  208   REGLMSYKQFIQELEDDILPAEAERRYQEYKAEYISTQKRAYFNAHKDEEWLKDKYHPTN  267

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE ++K AK+FLL+LQSG+LDLGPGV  +  N +G +SEPNSDDEAD   KR
Sbjct  268   LLTVIERRNEISQKTAKEFLLELQSGSLDLGPGVNSSAPNKSGHTSEPNSDDEADVDGKR  327

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH R  +K+  L+S APKAHPVSS+PRRI +DVEQ+Q LV KLDSEKGI ENIL   +N
Sbjct  328   RRHGRELNKENDLISTAPKAHPVSSDPRRIQVDVEQAQALVRKLDSEKGIVENILCAPEN  387

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+ +R+KS+  S+GP VVI+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIE+N+AK
Sbjct  388   DKMNREKSHGGSTGP-VVIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMIESNDAK  446

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R + K ++   NGA+WE+KLD  W+ERL  QDPLEVMTAKEKI+ AA++ L+P+V
Sbjct  447   GLRHVRVEVKGSDI-GNGAEWEKKLDLHWQERLHSQDPLEVMTAKEKIEAAALQGLDPFV  505

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPEL++++T K+REDLYFQNYM+D
Sbjct  506   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELLVDVTVKMREDLYFQNYMND  565

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  S+ ++K QRRRP +E+RLKD+RGNRRER  R NG ER+DR EN    +
Sbjct  566   AEAPGGTPVMQQSILRDKPQRRRPGMENRLKDERGNRRERENRANGGERYDRSENMQQGE  625

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVA-AFPSDITPPPVLMPVPGAG  661
               SN+DG  G N DE M+D+FGG G+     FPSDITPPPVLMPVPGAG
Sbjct  626   FPSNNDGQDGGNHDEPMYDNFGGQGMHGGPPFPSDITPPPVLMPVPGAG  674


 Score =   129 bits (323),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQMLR+QGGP PFEG GRN   GPQ+ G API+AL P+ RQDPRR+R
Sbjct  675  PLGPFVPAPPEVAMQMLRDQGGPPPFEGSGRNMWPGPQMSGPAPILALSPAFRQDPRRLR  734

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  735  SYQDLDAPEDEVTVIDYRSL  754



>ref|XP_008231073.1| PREDICTED: serrate RNA effector molecule [Prunus mume]
Length=750

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/449 (73%), Positives = 379/449 (84%), Gaps = 4/449 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY++ YI  QKRAYF+AHKDE+WLKDKYHPTN
Sbjct  204   REGLMSYKQFIQELEDDILPAEAERRYQEYRTEYITTQKRAYFNAHKDEDWLKDKYHPTN  263

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE ARK+AKDFLL+LQSGTLDLGPGV     N +G +SEPNSDDEAD G KR
Sbjct  264   LLTVIERRNEHARKVAKDFLLELQSGTLDLGPGVNSVAPNKSGHTSEPNSDDEADVGGKR  323

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH R P+K+  LLS APKAHPVSSEPRRI +D+EQ+Q LV KLDSEKGI ENIL+  DN
Sbjct  324   RRHVREPNKENDLLSAAPKAHPVSSEPRRIQVDIEQAQALVRKLDSEKGIVENILAGPDN  383

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+        S+    V+IVRGLTSVKGLEG ELL+TL+TYLWRIHG+DYYGM E+NEAK
Sbjct  384   DKNREKLHGGSTGP--VIIVRGLTSVKGLEGIELLDTLITYLWRIHGLDYYGMSESNEAK  441

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK+++  SNGA+WE+K+D RW+ERL+ QDPLE+MTAKEKID  A E+L+PYV
Sbjct  442   GLRHVRAEGKSSDIMSNGAEWEKKMDLRWQERLQSQDPLEIMTAKEKIDATASESLDPYV  501

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+E+TSK+RE+LYFQNYM+D
Sbjct  502   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIEVTSKLREELYFQNYMND  561

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTP+M   + +EK QRRRP +E+RLKD+RGNRRER  RVNG ER+DR +N  SS+
Sbjct  562   ADAPGGTPIMQQPVLREKPQRRRPGVENRLKDERGNRRERENRVNGGERYDRSDNMQSSE  621

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVA  718
              QSN+DG  G N DE MFD+FGG G+ V 
Sbjct  622   FQSNNDGPEGGNLDEPMFDNFGGQGVRVG  650


 Score =   131 bits (330),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQMLREQGGP PFEG GRN   GPQ+ G API+AL P+ RQDPRR+R
Sbjct  671  PLGPFVPAPPEVAMQMLREQGGPPPFEGSGRNVWSGPQMSGPAPILALSPAFRQDPRRLR  730

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  731  SYQDLDAPEDEVTVIDYRSL  750



>emb|CAN71440.1| hypothetical protein VITISV_035521 [Vitis vinifera]
Length=1184

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/472 (71%), Positives = 389/472 (82%), Gaps = 8/472 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY+S YI  QKRA+FDAHKDEEWLKDKYHPTN
Sbjct  655   REGLMSYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRAFFDAHKDEEWLKDKYHPTN  714

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR+MAKDFLLDLQSGTLD+GPGV  + SN +GQ+S+PNSDDE + GDKR
Sbjct  715   LLAVIERRNENARRMAKDFLLDLQSGTLDIGPGVNASSSNKSGQTSDPNSDDETETGDKR  774

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP K++ L S A  AHP SSEPRRI  D+EQ+  LV KLDSEKG+E+NIL  ++ 
Sbjct  775   RRHGRGPIKESDL-STAAVAHPNSSEPRRIQADIEQALALVRKLDSEKGVEDNILCSAEQ  833

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              +   DKS+S S GP+++I RGL SVKGLEG ELL+T+LTYLWRIHG+DYYGM+ET+EAK
Sbjct  834   KKTDSDKSHSGSMGPIIII-RGLASVKGLEGIELLDTILTYLWRIHGLDYYGMVETSEAK  892

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R +GK + E S  GADWE+KLDSRW++RL+GQDPLE M AKEKID AAVE L+PY
Sbjct  893   GLRHVRAEGKGHEENSKAGADWEKKLDSRWQDRLRGQDPLETMAAKEKIDAAAVEGLDPY  952

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDE+YGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV++LT+KVREDLYFQNYM+
Sbjct  953   VRKIRDERYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMDLTTKVREDLYFQNYMN  1012

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngv--eRFDRPENPL  808
             D  APGGTPVM   L K++LQRRRP L++RLKDDRGNRRE +        ERFDR +N  
Sbjct  1013  DPDAPGGTPVMQQQLLKDRLQRRRPGLDNRLKDDRGNRREHDRIERINDGERFDRTDNSP  1072

Query  807   SSDIQSNDDG--GRNPDEQMFDSFGGHGIPVA-AFPSDITPPPVLMPVPGAG  661
               D QS   G  G N DE M+D++GG  + V   FPSD+ PPPVLMPVPGAG
Sbjct  1073  PHDRQSKGGGLEGGNLDESMYDTYGGKDLGVIPPFPSDMGPPPVLMPVPGAG  1124


 Score = 89.4 bits (220),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -3

Query  571   PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
             PLGPFVPAPPEVAM+MLREQGG + +EGGR  R GP IGG API+ +  + RQDPRR+R
Sbjct  1125  PLGPFVPAPPEVAMRMLREQGGSSSYEGGRQMRTGPHIGGPAPILGVSSAFRQDPRRLR  1183



>ref|XP_010034250.1| PREDICTED: serrate RNA effector molecule [Eucalyptus grandis]
 gb|KCW50997.1| hypothetical protein EUGRSUZ_J00624 [Eucalyptus grandis]
Length=776

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/466 (72%), Positives = 387/466 (83%), Gaps = 5/466 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REG+ SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYFDAHKDEEWLKDKYHPTN
Sbjct  236   REGMMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFDAHKDEEWLKDKYHPTN  295

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE AR++AKDFLLDLQSGTLD+GPG   + ++ +GQ+S+ NSDDE D   KR
Sbjct  296   LVAVIERRNELARRVAKDFLLDLQSGTLDVGPGTNASSTSKSGQASDANSDDEMDTSGKR  355

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+A L S APKAHPVSSEPRR+ +D+EQ+Q LV KLDSEKGIEENIL   D+
Sbjct  356   RRQGRGQTKEADL-SAAPKAHPVSSEPRRVQVDIEQAQALVRKLDSEKGIEENILGGPDD  414

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
                       SS    V+I+RGLTSVKGLEG +LL+TLLTYLWRIHG+DYYGM ET+EAK
Sbjct  415   KINREKSHGGSSGP--VIIIRGLTSVKGLEGTDLLDTLLTYLWRIHGLDYYGMTETSEAK  472

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK+ ++ +NG+DWE KLDSRW+ERLKGQDPLEVMTAKEKID AAVE L+PYV
Sbjct  473   GLRHVRAEGKSADSGNNGSDWENKLDSRWQERLKGQDPLEVMTAKEKIDAAAVEVLDPYV  532

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELT+K+RE+LYFQNYM+D
Sbjct  533   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTAKLREELYFQNYMND  592

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  +L +++ QRRR  LE+RL+DDRG RRER+ R NG ERFDR ENP S+D
Sbjct  593   PDAPGGTPVMQQNLMRDRPQRRRLGLENRLRDDRGIRRERDNRANGGERFDRSENPQSAD  652

Query  798   IQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                 D    + D+ M+DSF G G+ VA F SDI PPPVLMPVPGAG
Sbjct  653   KDGADG--GDGDDPMYDSFSGQGLHVAPFASDIPPPPVLMPVPGAG  696


 Score =   127 bits (319),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM REQG P PFEG GRNGR G Q+ G APIIA  P  RQDPRR+R
Sbjct  697  PLGPFVPAPPEVAMQMFREQGAPPPFEGAGRNGRPGSQLSGPAPIIASFPGFRQDPRRLR  756

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  757  SYQDLDAPEDEVTVIDYRSL  776



>gb|EYU46136.1| hypothetical protein MIMGU_mgv1a001592mg [Erythranthe guttata]
Length=789

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/469 (70%), Positives = 394/469 (84%), Gaps = 6/469 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQF+QELEDDILPAEAERRYQEYK+ YI  QKR YFDAHKDE+WLKDKYHPTN
Sbjct  225   RAGLMSYKQFMQELEDDILPAEAERRYQEYKTEYISTQKRTYFDAHKDEQWLKDKYHPTN  284

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VI+RR E A+K+AKDF  DL SG L+LGPGVTP+  N   Q+S P+ +DE DAG KR
Sbjct  285   LLAVIDRRKELAKKLAKDFQHDLLSGNLNLGPGVTPSSLNKEEQTSGPHLEDEGDAGGKR  344

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +R+ RG ++++ L S APKAHPVSSEPRRI +DVEQ+Q LV KLD EKGIE+N+LSR+DN
Sbjct  345   KRNVRGGTEESDL-SSAPKAHPVSSEPRRIQVDVEQAQALVRKLDLEKGIEDNVLSRADN  403

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DR SRDKS+ SSSGP+V+I RG T+VKGLEG ELL+TLLTYLWRIHGVDYYG++E++EAK
Sbjct  404   DRMSRDKSHGSSSGPIVII-RGSTAVKGLEGIELLDTLLTYLWRIHGVDYYGLVESSEAK  462

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G RH+R DGKN+++++N  +WE KLDS W+ERLKG DPLEVM+AKEKID  A EAL+P+V
Sbjct  463   GFRHVRVDGKNSDSTANANEWENKLDSHWQERLKGSDPLEVMSAKEKIDAVAAEALDPHV  522

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWK+GCGAKGCTKLFHA+EFV KHLKLKHPELV+ELTSK+RE+LY +NYM+D
Sbjct  523   RKIRDEKYGWKFGCGAKGCTKLFHASEFVLKHLKLKHPELVMELTSKLREELYIENYMND  582

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             ++APGGTPVM  S  K+K  RRRP L++R+KDDRGN+RER+ R NG +RF+RPENP S D
Sbjct  583   KNAPGGTPVMQPSFQKDKQLRRRPGLDNRMKDDRGNQRERDNRANGNDRFNRPENPQSDD  642

Query  798   IQSNDDGGR---NPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              QS +DGG    NPDEQMFDSF    + +  F  DI PPPVLMPVPGAG
Sbjct  643   FQSGNDGGAPGDNPDEQMFDSFAAQHMSLGPFSGDI-PPPVLMPVPGAG  690


 Score =   120 bits (302),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQM+R+QGGP+PF+GGRNGR GPQ+GG APIIALP + RQDPRR+RS
Sbjct  691  PLGPFVPAPPEVAMQMMRDQGGPSPFDGGRNGRSGPQLGGPAPIIALPSNFRQDPRRLRS  750

Query  391  YQDLDAPED  365
            Y DLDAP+D
Sbjct  751  YNDLDAPDD  759



>gb|KDO66405.1| hypothetical protein CISIN_1g003865mg [Citrus sinensis]
Length=541

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/444 (73%), Positives = 382/444 (86%), Gaps = 4/444 (1%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEWLKDKYHPTNLV+VI
Sbjct  2     SYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWLKDKYHPTNLVAVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRN+ ARK+AKDFLLDLQSGTLDLGP V  + SN  GQ+SEPNSDD+ D G KRRRH R
Sbjct  62    ERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNGGKRRRHGR  121

Query  1683  GPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsr  1504
             GP+K+  LLS APKAHP+SSEPRRI +D+EQ+Q LV KLDSEKGI ENIL  SDND+ +R
Sbjct  122   GPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCGSDNDKMNR  181

Query  1503  dksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHM  1324
             +KS+ S+    V+I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ET+EAKGLRH+
Sbjct  182   EKSHGSTGP--VIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETSEAKGLRHV  239

Query  1323  RFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRD  1144
             R +GK+++ ++NGA+WE+KLD RW+ERL+ QDPLE+MTAK+KID AAV+AL+P+VRKIRD
Sbjct  240   RAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALDPFVRKIRD  299

Query  1143  EKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPG  964
             EKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNYM+D  APG
Sbjct  300   EKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNYMNDPDAPG  359

Query  963   GTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSND  784
             GTPVM   +PK++  RR+   ++RLKD+RGNRR+R+ R NG +R+DR +N  +SD  SND
Sbjct  360   GTPVMQQPMPKDRPLRRKLGPDNRLKDERGNRRDRDYRANGSDRYDRSDNAQASDFPSND  419

Query  783   D--GGRNPDEQMFDSFGGHGIPVA  718
             D   G N DE MFD+FGG GI VA
Sbjct  420   DVPEGANRDESMFDTFGGQGIRVA  443


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM+R+QGGP PFE GGR+GR GPQI G  PI+ L P+ RQDPRRIR
Sbjct  464  PLGPFVPAPPEVAMQMIRDQGGP-PFEGGGRHGRPGPQISGPGPIL-LSPAFRQDPRRIR  521

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTV+DYRSL
Sbjct  522  SYQDLDAPEDEVTVMDYRSL  541



>ref|XP_010651608.1| PREDICTED: serrate RNA effector molecule [Vitis vinifera]
 emb|CBI24360.3| unnamed protein product [Vitis vinifera]
Length=735

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/449 (74%), Positives = 384/449 (86%), Gaps = 7/449 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR++FD+HKDEEWLKDKYHPTN
Sbjct  192   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRSFFDSHKDEEWLKDKYHPTN  251

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK AKDFLLDLQSGTLDLGPGV  +  N +GQ+S+PNSD+E + G KR
Sbjct  252   LLSVIERRNEVARKTAKDFLLDLQSGTLDLGPGVNASSLNKSGQTSDPNSDEETEMGGKR  311

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  LLS APKAHPVSSEPRRI +D+EQ+Q LV KLDSEKGIEENIL R+DN
Sbjct  312   RRHGRGPTKETDLLSVAPKAHPVSSEPRRIQVDIEQAQALVRKLDSEKGIEENILCRADN  371

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+ +R+KS+  S GPV++I RGLTSVKGLEG ELL+TL+TYLWRIHG+DYYGM+ETNEAK
Sbjct  372   DKLNREKSHGGSIGPVIII-RGLTSVKGLEGIELLDTLITYLWRIHGLDYYGMLETNEAK  430

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK+++ +SNG +WE+K DS W+ERL+ QDPLE+MTAKEKID  A+E+L+PYV
Sbjct  431   GLRHVRVEGKSSDLTSNGVEWEKKFDSHWQERLRSQDPLEIMTAKEKIDATAIESLDPYV  490

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVREDLYF NYMSD
Sbjct  491   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKVREDLYFLNYMSD  550

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTPVM  SL K+K Q+RR   ++RLKD+   RRER  R NG ER+DR +N  S+D
Sbjct  551   ADAPGGTPVMQQSLLKDKTQKRRLGPDNRLKDN---RRERENRANGSERYDRSDNHQSND  607

Query  798   IQSND--DGGRNPDEQMFDSFGGHGIPVA  718
              Q ND  DGG NP E MFD+FGG G+ VA
Sbjct  608   FQPNDGPDGG-NPGEGMFDTFGGQGMHVA  635


 Score =   138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 74/80 (93%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP+PFEGG RNGR GPQ+ G AP++AL P LRQDPRR+R
Sbjct  656  PLGPFVPAPPEVAMRMLREQGGPSPFEGGGRNGRSGPQLSGPAPVLALSPGLRQDPRRLR  715

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  716  SYQDLDAPEDEVTVIDYRSL  735



>ref|XP_006470449.1| PREDICTED: serrate RNA effector molecule-like [Citrus sinensis]
 gb|KDO66402.1| hypothetical protein CISIN_1g003865mg [Citrus sinensis]
Length=766

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/452 (73%), Positives = 387/452 (86%), Gaps = 4/452 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEWLKDKYH
Sbjct  219   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWLKDKYH  278

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRN+ ARK+AKDFLLDLQSGTLDLGP V  + SN  GQ+SEPNSDD+ D G
Sbjct  279   PTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNG  338

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAHP+SSEPRRI +D+EQ+Q LV KLDSEKGI ENIL  
Sbjct  339   GKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCG  398

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDND+ +R+KS+ S+    V+I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ET+
Sbjct  399   SDNDKMNREKSHGSTGP--VIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETS  456

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK+++ ++NGA+WE+KLD RW+ERL+ QDPLE+MTAK+KID AAV+AL+
Sbjct  457   EAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALD  516

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNY
Sbjct  517   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNY  576

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM   +PK++  RR+   ++RLKD+RGNRR+R+ R NG +R+DR +N  
Sbjct  577   MNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGNRRDRDYRANGSDRYDRSDNAQ  636

Query  807   SSDIQSNDD--GGRNPDEQMFDSFGGHGIPVA  718
             +SD  SNDD   G N DE MFD+FGG GI VA
Sbjct  637   ASDFPSNDDVPEGANRDESMFDTFGGQGIRVA  668


 Score =   104 bits (260),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM+R+QGGP PFE GGR+GR GPQI G  PI+ L P+ RQDPRRIR
Sbjct  689  PLGPFVPAPPEVAMQMIRDQGGP-PFEGGGRHGRPGPQISGPGPIL-LSPAFRQDPRRIR  746

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTV+DYRSL
Sbjct  747  SYQDLDAPEDEVTVMDYRSL  766



>gb|KDO66403.1| hypothetical protein CISIN_1g003865mg [Citrus sinensis]
Length=753

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/452 (73%), Positives = 387/452 (86%), Gaps = 4/452 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEWLKDKYH
Sbjct  219   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWLKDKYH  278

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRN+ ARK+AKDFLLDLQSGTLDLGP V  + SN  GQ+SEPNSDD+ D G
Sbjct  279   PTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNG  338

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAHP+SSEPRRI +D+EQ+Q LV KLDSEKGI ENIL  
Sbjct  339   GKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCG  398

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDND+ +R+KS+ S+    V+I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ET+
Sbjct  399   SDNDKMNREKSHGSTGP--VIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETS  456

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK+++ ++NGA+WE+KLD RW+ERL+ QDPLE+MTAK+KID AAV+AL+
Sbjct  457   EAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALD  516

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNY
Sbjct  517   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNY  576

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM   +PK++  RR+   ++RLKD+RGNRR+R+ R NG +R+DR +N  
Sbjct  577   MNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGNRRDRDYRANGSDRYDRSDNAQ  636

Query  807   SSDIQSNDD--GGRNPDEQMFDSFGGHGIPVA  718
             +SD  SNDD   G N DE MFD+FGG GI VA
Sbjct  637   ASDFPSNDDVPEGANRDESMFDTFGGQGIRVA  668


 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 52/62 (84%), Gaps = 3/62 (5%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM+R+QGGP PFE GGR+GR GPQI G  PI+ L P+ RQDPRRIR
Sbjct  689  PLGPFVPAPPEVAMQMIRDQGGP-PFEGGGRHGRPGPQISGPGPIL-LSPAFRQDPRRIR  746

Query  394  SY  389
             Y
Sbjct  747  RY  748



>ref|XP_006446370.1| hypothetical protein CICLE_v10014331mg [Citrus clementina]
 gb|ESR59610.1| hypothetical protein CICLE_v10014331mg [Citrus clementina]
Length=766

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/452 (73%), Positives = 387/452 (86%), Gaps = 4/452 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEWLKDKYH
Sbjct  219   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWLKDKYH  278

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRN+ ARK+AKDFLLDLQSGTLDLGP V  + SN  GQ+SEPNSDD+ D G
Sbjct  279   PTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNG  338

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAHP+SSEPRRI +D+EQ+Q LV KLDSEKGI ENIL  
Sbjct  339   GKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCG  398

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDND+ +R+KS+ S+    V+I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ET+
Sbjct  399   SDNDKMNREKSHGSTGP--VIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETS  456

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK+++ ++NGA+WE+KLD RW+ERL+ QDPLE+MTAK+KID AAV+AL+
Sbjct  457   EAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALD  516

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNY
Sbjct  517   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNY  576

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGGTPVM   +PK++  RR+   ++RLKD+RGNRR+R+ R NG +R+DR +N  
Sbjct  577   MNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGNRRDRDYRPNGSDRYDRSDNAQ  636

Query  807   SSDIQSNDD--GGRNPDEQMFDSFGGHGIPVA  718
             +SD  SNDD   G N DE MFD+FGG GI VA
Sbjct  637   ASDFPSNDDVPEGANRDESMFDTFGGQGIRVA  668


 Score =   104 bits (260),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM+R+QGGP PFE GGR+GR GPQI G  PI+ L P+ RQDPRRIR
Sbjct  689  PLGPFVPAPPEVAMQMIRDQGGP-PFEGGGRHGRPGPQISGPGPIL-LSPAFRQDPRRIR  746

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTV+DYRSL
Sbjct  747  SYQDLDAPEDEVTVMDYRSL  766



>ref|XP_011080508.1| PREDICTED: serrate RNA effector molecule [Sesamum indicum]
Length=743

 Score =   563 bits (1451),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 334/469 (71%), Positives = 380/469 (81%), Gaps = 11/469 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REG+ SYKQFIQELEDD+LPAEAERRYQEY++ YI  QKR YF+AHKDEEWLKDKYHPTN
Sbjct  204   REGMMSYKQFIQELEDDVLPAEAERRYQEYRTEYISTQKRTYFNAHKDEEWLKDKYHPTN  263

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE ARK AK+F LDLQ GTLDLGPGV P+ S N  Q SE NSD+EAD   KR
Sbjct  264   LLAVIERRNEVARKSAKNFQLDLQRGTLDLGPGVMPS-SLNEEQISEANSDEEADVDGKR  322

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG +K++ LLS APKAHPV SE RRI +DVEQ+Q LV KLD EKGIE+N+L R DN
Sbjct  323   RRHGRGGTKESDLLS-APKAHPVFSESRRIQVDVEQAQALVRKLDLEKGIEDNVLCRDDN  381

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DR  RDKS+ SSSGPV++I RGLT++KGLEG ELL+TLLTYLWRIHGVDYYGM+E+NEAK
Sbjct  382   DRMGRDKSHGSSSGPVIII-RGLTTIKGLEGIELLDTLLTYLWRIHGVDYYGMVESNEAK  440

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R DGKN+E + N  +WE+KLDS W++RLKG DPLEVM AKEKID AA EAL+PYV
Sbjct  441   GLRHVRVDGKNSEANGNANEWEKKLDSHWQKRLKGLDPLEVMAAKEKIDAAAAEALDPYV  500

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPEL +ELTSKVRE+LYF+NYM+D
Sbjct  501   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELAMELTSKVREELYFENYMND  560

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             E+APGG PVM  S PKE+  R RP  ++R+KD+      R       ERFDR ENP S D
Sbjct  561   ENAPGGRPVMQPSFPKER-PRHRPGPDNRIKDE--RGNRRERDYRANERFDRSENPQSGD  617

Query  798   IQSNDDG--GRNPDEQMFDSFGG-HGIPVAAFPSDITPPPVLMPVPGAG  661
               S++DG  G NPDE MFD+FG         F SDI PPPVLMPVPGAG
Sbjct  618   FTSSNDGPPGENPDE-MFDTFGAXXXXXXXXFASDI-PPPVLMPVPGAG  664


 Score =   138 bits (347),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAM+MLR+QGGP+PFEGGRNG  GPQI G APIIALPP+ RQDPRR+RS
Sbjct  665  PLGPFVPAPPEVAMRMLRDQGGPSPFEGGRNGIPGPQISGPAPIIALPPTFRQDPRRLRS  724

Query  391  YQDLDAPEDEVTVIDYRSL  335
            Y DLDAP+DEVTVIDYRSL
Sbjct  725  YNDLDAPDDEVTVIDYRSL  743



>ref|XP_003523929.1| PREDICTED: serrate RNA effector molecule-like [Glycine max]
Length=711

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/467 (68%), Positives = 369/467 (79%), Gaps = 15/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  179   REGLMSYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  238

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTLDL PG+  T S  +GQ+SEPNS++E D   KR
Sbjct  239   LLTVIERRNENARRLAKDFLLDLQSGTLDLNPGLNSTSSGKSGQASEPNSEEETDG--KR  296

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+KD    S APKAH +SSEPRRI  D++Q+Q +V KLD EKGI++NIL  SD+
Sbjct  297   RRHGRGPNKDNDF-SAAPKAHTISSEPRRIQTDIQQAQAVVRKLDREKGIDDNILCTSDH  355

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++      + S     +VIVRGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIETNEAK
Sbjct  356   NKNDDKAHSGSVGP--IVIVRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMIETNEAK  413

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G R++R +G  + ET  +G+DWE+KLDS W+ RL GQDPLEVMTAKEKID AA + L+P+
Sbjct  414   GFRYVRPEGTGHEETRKSGSDWEKKLDSFWQGRLNGQDPLEVMTAKEKIDAAATDVLDPH  473

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSK+REDLYFQNYM+
Sbjct  474   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKLREDLYFQNYMN  533

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTPVM        L+RR   LE RLKDDRGNRR+++         DRP+   S 
Sbjct  534   DPDAPGGTPVMQQPQKDRPLKRRLGGLEGRLKDDRGNRRDQDRSDRING--DRPDGSPSH  591

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + Q       N DE M+D++GG G+P   F SD+ PPPVLMPVPGAG
Sbjct  592   ERQMG-----NHDEAMYDAYGGLGVP--QFTSDMAPPPVLMPVPGAG  631


 Score =   124 bits (311),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM REQGGP+ ++  GR  R GP +GG APIIA+PPS R DPR++R
Sbjct  632  PLGPFVPAPPEVAMQMFREQGGPSSYDASGRKIRSGPHMGGPAPIIAVPPSFRPDPRQMR  691

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  692  SYQDLDAPEDEVTVIDYRSL  711



>ref|XP_010251619.1| PREDICTED: serrate RNA effector molecule isoform X1 [Nelumbo 
nucifera]
Length=749

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/451 (71%), Positives = 371/451 (82%), Gaps = 9/451 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQFIQELEDDILPAEAERRYQEY+S YI  QKR +FDAHKDEEWL+DKYHPTN
Sbjct  203   REGLMTYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRTFFDAHKDEEWLRDKYHPTN  262

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK++KDFLLDLQSGTLDLGPG+    SN +GQ+S+PNS+DEAD G KR
Sbjct  263   LLSVIERRNENARKISKDFLLDLQSGTLDLGPGINALSSNKSGQASDPNSEDEADGGGKR  322

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP K+  LLS APKAHP+SSE RRI +D+EQ+Q LV KLD+EKGIEENIL  SD+
Sbjct  323   RRHGRGPVKENDLLSAAPKAHPISSELRRIQVDIEQAQALVRKLDTEKGIEENILGSSDH  382

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+       ++IVRGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIETN+AK
Sbjct  383   DKMDGEKSHGGP----IIIVRGLTSVKGLEGIELLDTLITYLWRIHGVDYYGMIETNDAK  438

Query  1338  GLRHMRFDGKN-TETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R +GK+  ET++N +DWE+KLDS W+ RL+ QDPLE+MTAKEKID AAVEAL+PY
Sbjct  439   GLRHVRAEGKSYDETNTNASDWEKKLDSFWQGRLRSQDPLEIMTAKEKIDAAAVEALDPY  498

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  499   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVMELTSKVREDLYFQNYMN  558

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDr-gnrrerngrvngveRFDRPENPLS  805
             D  APGGTPVM   LPK+KLQRRR   ++R +DDR   R          ER+DR EN  S
Sbjct  559   DPDAPGGTPVMQQPLPKDKLQRRRTGSDNRFRDDRGSRREHDRADRGDDERYDRSENSPS  618

Query  804   SDIQSND--DGGRNPDEQMFDSFGGHGIPVA  718
              D QS    +GG NPDE MFD+FG  G+  A
Sbjct  619   RDFQSTGGMEGG-NPDEPMFDTFGAQGMRTA  648


 Score =   114 bits (286),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP+P+EG GR GR GPQIGG  P++A+ P+ RQDPRRIR
Sbjct  670  PLGPFVPAPPEVAMRMLREQGGPSPYEGSGRKGRPGPQIGGPGPLLAVSPAFRQDPRRIR  729

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  730  SYQDLDAPEDEVTVIDYRSL  749



>gb|KHN48487.1| Serrate RNA effector molecule [Glycine soja]
Length=529

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/462 (68%), Positives = 365/462 (79%), Gaps = 15/462 (3%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTNL++VI
Sbjct  2     SYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTNLLTVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRNE AR++AKDFLLDLQSGTLDL PG+  T S  +GQ+SEPNS++E D   KRRRH R
Sbjct  62    ERRNENARRLAKDFLLDLQSGTLDLNPGLNSTSSGKSGQASEPNSEEETDG--KRRRHGR  119

Query  1683  GPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsr  1504
             GP+KD    S APKAH +SSEPRRI  D++Q+Q +V KLD EKGI++NIL  SD+++   
Sbjct  120   GPNKDNDF-SAAPKAHTISSEPRRIQADIQQAQAVVRKLDREKGIDDNILCTSDHNKNDD  178

Query  1503  dksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHM  1324
                + S     +VIVRGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIETNEAKG R++
Sbjct  179   KAHSGSVGP--IVIVRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMIETNEAKGFRYV  236

Query  1323  RFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIR  1147
             R +G  + ET  +G+DWE+KLDS W+ RL GQDPLEVMTAKEKID AA + L+P+VRKIR
Sbjct  237   RPEGTGHEETRKSGSDWEKKLDSFWQGRLNGQDPLEVMTAKEKIDAAATDVLDPHVRKIR  296

Query  1146  DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAP  967
             DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSK+REDLYFQNYM+D  AP
Sbjct  297   DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTSKLREDLYFQNYMNDPDAP  356

Query  966   GGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSN  787
             GGTPVM        L+RR   LE RLKDDRGNRR+++         DRP+   S + Q  
Sbjct  357   GGTPVMQQPQKDRPLKRRLGGLEGRLKDDRGNRRDQDRSDRING--DRPDGSPSHERQMG  414

Query  786   DDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                  N DE M+D++GG G+P   F SD+ PPPVLMPVPGAG
Sbjct  415   -----NHDEAMYDAYGGPGVP--QFTSDMAPPPVLMPVPGAG  449


 Score =   124 bits (312),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM REQGGP+ ++  GR  R GP +GG APIIA+PPS R DPR++R
Sbjct  450  PLGPFVPAPPEVAMQMFREQGGPSSYDASGRKIRSGPHMGGPAPIIAVPPSFRPDPRQMR  509

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  510  SYQDLDAPEDEVTVIDYRSL  529



>ref|XP_009340224.1| PREDICTED: LOW QUALITY PROTEIN: serrate RNA effector molecule 
[Pyrus x bretschneideri]
Length=750

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 361/449 (80%), Gaps = 6/449 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP+EAERRYQEYK+ YI  QKRAYF+AHKDE+WLKDKYHPTN
Sbjct  206   REGLMSYKQFIQELEDDILPSEAERRYQEYKTEYISTQKRAYFNAHKDEDWLKDKYHPTN  265

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE ARK+AKDFLLDLQSGTLDLGPGV P   N  G +SEPNS+DE D GDKR
Sbjct  266   LLTVIERRNELARKVAKDFLLDLQSGTLDLGPGVNPAAPNKPGHNSEPNSEDETDVGDKR  325

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  R P+K+   LS APKAHPVSSEPRRI +DVEQ+Q LV KLDSEKGI ENIL   DN
Sbjct  326   RRPGREPNKENDHLSAAPKAHPVSSEPRRIQVDVEQAQALVRKLDSEKGIVENILYGPDN  385

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+        S     V+I+RGLTSVKGLEG ELL+TL+TYLWRIHG+DYYGM E+NEAK
Sbjct  386   DKNREKLHGGSGGP--VIIIRGLTSVKGLEGIELLDTLITYLWRIHGLDYYGMSESNEAK  443

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R  GK+++ +SNG +WE+KLD  W+ERL+ QDPLE+ TA+EKIDT A E+L+PYV
Sbjct  444   GLRHVRAGGKSSDLTSNGNEWEKKLDLCWKERLQSQDPLEIRTAREKIDTTASESLDPYV  503

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHA+EFVHKHLKLKHPELV+E+TSK+RE+LYFQNYM+D
Sbjct  504   RKIRDEKYGWKYGCGAKGCTKLFHASEFVHKHLKLKHPELVMEVTSKLREELYFQNYMND  563

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGGTP+M   + ++K QRRRP LE+RLK D    R         ERFDR EN  SS+
Sbjct  564   VDAPGGTPIMQQPVLRDKPQRRRP-LENRLK-DERGNRRERENRVNGERFDRSENMQSSE  621

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVA  718
              Q N+DG  G N D+ MF++FGG G+ V 
Sbjct  622   FQPNNDGPDGGNHDDPMFENFGGQGMRVG  650


 Score =   126 bits (316),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGG-RNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQMLR+QGGP PFEG  RN   GPQ+ G API+AL P+ RQDPRR+R
Sbjct  671  PLGPFVPAPPEVAMQMLRDQGGPPPFEGSSRNVWPGPQMSGPAPILALSPAFRQDPRRLR  730

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  731  SYQDLDAPEDEVTVIDYRSL  750



>ref|XP_010251620.1| PREDICTED: serrate RNA effector molecule isoform X2 [Nelumbo 
nucifera]
Length=748

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/451 (71%), Positives = 370/451 (82%), Gaps = 10/451 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQFIQELEDDILPAEAERRYQEY+S YI  QKR +FDAHKDEEWL+DKYHPTN
Sbjct  203   REGLMTYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRTFFDAHKDEEWLRDKYHPTN  262

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK++KDFLLDLQSGTLDLGPG+    SN +GQ+S+PNS+DEAD G KR
Sbjct  263   LLSVIERRNENARKISKDFLLDLQSGTLDLGPGINALSSNKSGQASDPNSEDEADGGGKR  322

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP K+  LLS APKAHP+SSE RRI +D+EQ+Q LV KLD+EKGIEENIL  SD+
Sbjct  323   RRHGRGPVKENDLLSAAPKAHPISSELRRIQVDIEQAQALVRKLDTEKGIEENILGSSDH  382

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+       ++IVRGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIETN+AK
Sbjct  383   DKMDGEKSHGGP----IIIVRGLTSVKGLEGIELLDTLITYLWRIHGVDYYGMIETNDAK  438

Query  1338  GLRHMRFDGKN-TETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R +GK+  ET++N +DWE+KLDS W+ RL+ QDPLE+MTAKEKID AAVEAL+PY
Sbjct  439   GLRHVRAEGKSYDETNTNASDWEKKLDSFWQGRLRSQDPLEIMTAKEKIDAAAVEALDPY  498

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  499   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVMELTSKVREDLYFQNYMN  558

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDr-gnrrerngrvngveRFDRPENPLS  805
             D  APGGTPVM   LP +KLQRRR   ++R +DDR   R          ER+DR EN  S
Sbjct  559   DPDAPGGTPVMQQPLP-DKLQRRRTGSDNRFRDDRGSRREHDRADRGDDERYDRSENSPS  617

Query  804   SDIQSND--DGGRNPDEQMFDSFGGHGIPVA  718
              D QS    +GG NPDE MFD+FG  G+  A
Sbjct  618   RDFQSTGGMEGG-NPDEPMFDTFGAQGMRTA  647


 Score =   114 bits (286),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 73/80 (91%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP+P+EG GR GR GPQIGG  P++A+ P+ RQDPRRIR
Sbjct  669  PLGPFVPAPPEVAMRMLREQGGPSPYEGSGRKGRPGPQIGGPGPLLAVSPAFRQDPRRIR  728

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  729  SYQDLDAPEDEVTVIDYRSL  748



>ref|XP_008799465.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera]
 ref|XP_008799466.1| PREDICTED: serrate RNA effector molecule [Phoenix dactylifera]
Length=747

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/445 (71%), Positives = 372/445 (84%), Gaps = 3/445 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRY+EY+S YI  QKR YFD HKDEEWLKDKYHPTN
Sbjct  199   REGLMSYKQFIQELEDDILPAEAERRYEEYRSEYISTQKRTYFDTHKDEEWLKDKYHPTN  258

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNERAR  AK+FLLDLQSGTLDLGPG+T    + +G  S+PNS+DE D+  KR
Sbjct  259   LVTVIERRNERARSTAKEFLLDLQSGTLDLGPGLTAPVVSKSGNGSDPNSEDEMDSSGKR  318

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  LLS AP+AHPVSSEPRRI ID+EQ+Q LV KLD+EKGIE+N+LS SD+
Sbjct  319   RRHGRGPAKENDLLSAAPRAHPVSSEPRRIQIDIEQAQALVRKLDTEKGIEDNVLSSSDH  378

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP ++I+RGLT+VKGLEG ELL+TL+TYLWR+HGVDYYGM ETNEAK
Sbjct  379   DKLDGEKSHGGSMGP-IIIIRGLTTVKGLEGFELLDTLITYLWRVHGVDYYGMSETNEAK  437

Query  1338  GLRHMRFDGKNTETS-SNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K+ + S ++GADWE KLDS W+ERL G+DPLE++TAK+KID AAVEAL+P+
Sbjct  438   GLRHVRADSKSFDGSNTSGADWENKLDSFWQERLHGRDPLEILTAKDKIDAAAVEALDPH  497

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  498   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVMELTSKVREDLYFQNYMN  557

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D SAPGGTPVM  S PK K  RRRP LE+RL+D+RGNRRE +      +R+DR ++  S 
Sbjct  558   DPSAPGGTPVMQQSAPKVKAPRRRPVLENRLRDERGNRREHDRADRDDDRYDRADHSPSH  617

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGI  727
             D     + GR+ DE MFD+FG  G+
Sbjct  618   DANGAPE-GRSHDETMFDAFGVQGL  641


 Score =   129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 69/84 (82%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVAM+MLREQGGP+ FE      GR G   PQ+GG API+A PP+ R DP
Sbjct  664  PLGPFVPAPPEVAMRMLREQGGPSSFEANGGPRGRKGWLSPQVGGSAPILAAPPAFRHDP  723

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPEDEVTVIDYRSL
Sbjct  724  RRIRSYQDLDAPEDEVTVIDYRSL  747



>ref|XP_006446369.1| hypothetical protein CICLE_v10014331mg [Citrus clementina]
 gb|ESR59609.1| hypothetical protein CICLE_v10014331mg [Citrus clementina]
Length=790

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/473 (70%), Positives = 386/473 (82%), Gaps = 28/473 (6%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEW---------  1906
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEW         
Sbjct  222   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWYFSSFTLFL  281

Query  1905  ---------------LKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTP  1771
                            LKDKYHPTNLV+VIERRN+ ARK+AKDFLLDLQSGTLDLGP V  
Sbjct  282   LCTLRCSYYMCFVCRLKDKYHPTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNA  341

Query  1770  TPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQ  1591
             + SN  GQ+SEPNSDD+ D G KRRRH RGP+K+  LLS APKAHP+SSEPRRI +D+EQ
Sbjct  342   SSSNKLGQTSEPNSDDDVDNGGKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQ  401

Query  1590  SQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelle  1411
             +Q LV KLDSEKGI ENIL  SDND+ +R+KS+ S+    V+I+RGLTSVKGLEG ELL+
Sbjct  402   AQALVRKLDSEKGITENILCGSDNDKMNREKSHGSTGP--VIIIRGLTSVKGLEGVELLD  459

Query  1410  tlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQ  1231
             TL+TYLWRIHGVDYYGM+ET+EAKGLRH+R +GK+++ ++NGA+WE+KLD RW+ERL+ Q
Sbjct  460   TLITYLWRIHGVDYYGMVETSEAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQ  519

Query  1230  DPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLK  1051
             DPLE+MTAK+KID AAV+AL+P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLK
Sbjct  520   DPLEIMTAKDKIDAAAVDALDPFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLK  579

Query  1050  HPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgn  871
             HPELV+ELTSKVRE+LYFQNYM+D  APGGTPVM   +PK++  RR+   ++RLKD+RGN
Sbjct  580   HPELVIELTSKVREELYFQNYMNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGN  639

Query  870   rrerngrvngveRFDRPENPLSSDIQSNDD--GGRNPDEQMFDSFGGHGIPVA  718
             RR+R+ R NG +R+DR +N  +SD  SNDD   G N DE MFD+FGG GI VA
Sbjct  640   RRDRDYRPNGSDRYDRSDNAQASDFPSNDDVPEGANRDESMFDTFGGQGIRVA  692


 Score =   104 bits (260),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM+R+QGGP PFE GGR+GR GPQI G  PI+ L P+ RQDPRRIR
Sbjct  713  PLGPFVPAPPEVAMQMIRDQGGP-PFEGGGRHGRPGPQISGPGPIL-LSPAFRQDPRRIR  770

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTV+DYRSL
Sbjct  771  SYQDLDAPEDEVTVMDYRSL  790



>gb|KDO66401.1| hypothetical protein CISIN_1g003865mg [Citrus sinensis]
Length=790

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/473 (70%), Positives = 386/473 (82%), Gaps = 28/473 (6%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEW---------  1906
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEW         
Sbjct  222   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWYFSSFTLFL  281

Query  1905  ---------------LKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTP  1771
                            LKDKYHPTNLV+VIERRN+ ARK+AKDFLLDLQSGTLDLGP V  
Sbjct  282   LCTLRCSYYMCFVCRLKDKYHPTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNA  341

Query  1770  TPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQ  1591
             + SN  GQ+SEPNSDD+ D G KRRRH RGP+K+  LLS APKAHP+SSEPRRI +D+EQ
Sbjct  342   SSSNKLGQTSEPNSDDDVDNGGKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQ  401

Query  1590  SQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelle  1411
             +Q LV KLDSEKGI ENIL  SDND+ +R+KS+ S+    V+I+RGLTSVKGLEG ELL+
Sbjct  402   AQALVRKLDSEKGITENILCGSDNDKMNREKSHGSTGP--VIIIRGLTSVKGLEGVELLD  459

Query  1410  tlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQ  1231
             TL+TYLWRIHGVDYYGM+ET+EAKGLRH+R +GK+++ ++NGA+WE+KLD RW+ERL+ Q
Sbjct  460   TLITYLWRIHGVDYYGMVETSEAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQ  519

Query  1230  DPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLK  1051
             DPLE+MTAK+KID AAV+AL+P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLK
Sbjct  520   DPLEIMTAKDKIDAAAVDALDPFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLK  579

Query  1050  HPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgn  871
             HPELV+ELTSKVRE+LYFQNYM+D  APGGTPVM   +PK++  RR+   ++RLKD+RGN
Sbjct  580   HPELVIELTSKVREELYFQNYMNDPDAPGGTPVMQQPMPKDRPLRRKLGPDNRLKDERGN  639

Query  870   rrerngrvngveRFDRPENPLSSDIQSNDD--GGRNPDEQMFDSFGGHGIPVA  718
             RR+R+ R NG +R+DR +N  +SD  SNDD   G N DE MFD+FGG GI VA
Sbjct  640   RRDRDYRANGSDRYDRSDNAQASDFPSNDDVPEGANRDESMFDTFGGQGIRVA  692


 Score =   104 bits (260),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 71/80 (89%), Gaps = 3/80 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM+R+QGGP PFE GGR+GR GPQI G  PI+ L P+ RQDPRRIR
Sbjct  713  PLGPFVPAPPEVAMQMIRDQGGP-PFEGGGRHGRPGPQISGPGPIL-LSPAFRQDPRRIR  770

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTV+DYRSL
Sbjct  771  SYQDLDAPEDEVTVMDYRSL  790



>ref|XP_010523115.1| PREDICTED: serrate RNA effector molecule [Tarenaya hassleriana]
Length=735

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/467 (72%), Positives = 389/467 (83%), Gaps = 10/467 (2%)
 Frame = -1

Query  2061  CREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
              REGL SYKQFIQELEDD+LP+EAE RYQEYKS YI  QKR +FDAHK+EEWLKDKYHPT
Sbjct  199   AREGLMSYKQFIQELEDDVLPSEAEHRYQEYKSEYITTQKRVFFDAHKEEEWLKDKYHPT  258

Query  1881  NLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDK  1702
             NL+SVIERRNE ARK+AKDFLL+LQSGTLDLGPGVT    N  GQ+SEPNS+DEAD G K
Sbjct  259   NLLSVIERRNELARKVAKDFLLELQSGTLDLGPGVTAL--NKPGQTSEPNSEDEADGGGK  316

Query  1701  RRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsd  1522
             RRRH RGP K+   LS APKAH VSSE RR+ +D+EQ+Q LV KLDSEKGIEEN+LS SD
Sbjct  317   RRRHARGPVKETDPLSAAPKAHSVSSEQRRVIVDIEQAQALVRKLDSEKGIEENVLSGSD  376

Query  1521  ndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEA  1342
             ND+  RDK +S SSGPVV+I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG  ETNEA
Sbjct  377   NDKAGRDKLHSGSSGPVVII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGTNETNEA  435

Query  1341  KGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             KGLRH+R +GK ++  +NG +WE+KLDS W+ERLKGQDP+EVM AKEKID AAVE L+P+
Sbjct  436   KGLRHVRAEGKGSD--ANGDEWEKKLDSHWQERLKGQDPMEVMAAKEKIDAAAVEVLDPH  493

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELT+KVRE+LYFQNYM+
Sbjct  494   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMELTTKVREELYFQNYMN  553

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGG PVM    P+++  RR+P + +RL+ D   RR+R+GR NG +RFDR +NP S 
Sbjct  554   DPNAPGGQPVM--QQPRDRPIRRKPGIGNRLR-DDRGRRDRDGRTNGNDRFDRSDNPQSG  610

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D ++ + G   PDE  +DSFGG G+ V  F SDI PPPVLMPVPGAG
Sbjct  611   DSEAPEGG--KPDEAEYDSFGGQGVHVPPFSSDIPPPPVLMPVPGAG  655


 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+Q GP P FEG       P  G       L PS RQDPRR+R
Sbjct  656  PLGPFVPAPPEVAMQMFRDQNGPPPPFEGRGGRSGPPLGGPGPAPFLLQPSFRQDPRRLR  715

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  716  SYQDLDAPEEEVTVIDYRSL  735



>ref|XP_010929331.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Elaeis 
guineensis]
Length=740

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/445 (69%), Positives = 366/445 (82%), Gaps = 3/445 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRY+EY+S YI  QKR YFD HK+EEWLKDKYHPTN
Sbjct  194   REGLMSYKQFIQELEDDILPAEAERRYEEYRSEYISTQKRTYFDTHKEEEWLKDKYHPTN  253

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LVSVIERRNE AR +AK+FLLDLQSGTLDLGPG T      +G  S+PNS+DE D+  KR
Sbjct  254   LVSVIERRNEHARSIAKEFLLDLQSGTLDLGPGATAAVVTQSGNGSDPNSEDEMDSSGKR  313

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+   LS APKAHPVSSE RRI +D+EQ+Q LV KLD+EKGIE+N+LS SD+
Sbjct  314   RRHGRGPAKENNPLSAAPKAHPVSSELRRIQVDIEQAQALVHKLDTEKGIEDNVLSSSDH  373

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP ++I+RGLT+VKGLEG ELL+TL+TYLWRIHGVDYYGM E NEAK
Sbjct  374   DKLDGEKSHGGSMGP-IIIIRGLTTVKGLEGVELLDTLITYLWRIHGVDYYGMSEINEAK  432

Query  1338  GLRHMRFDGKNTETS-SNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K+ + S ++GADWE+KLD+ W++RL+GQDPLE++TAK+KID AAVEAL+PY
Sbjct  433   GLRHVRADSKSFDGSNTSGADWEKKLDAFWQKRLQGQDPLEILTAKDKIDAAAVEALDPY  492

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  493   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVMELTSKVREDLYFQNYMN  552

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S  K K  R R   ++RL+D+RGNRRE +      +R+DR ++  S 
Sbjct  553   DPNAPGGTPVMQQSALKVKAPRYRLLSDNRLRDERGNRREHDRANRNDDRYDRTDHSPSH  612

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGI  727
             D     +GG N DE M+D+FGG G+
Sbjct  613   DANGGSEGG-NHDETMYDAFGGQGL  636


 Score =   124 bits (311),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 69/84 (82%), Gaps = 8/84 (10%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVAM+MLREQGGP+ FE      GR GR GP   G API+A+PP+ R DP
Sbjct  660  PLGPFVPAPPEVAMRMLREQGGPSSFEANGGPRGRKGRLGP---GSAPILAVPPAFRHDP  716

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPEDEVTVIDYRSL
Sbjct  717  RRIRSYQDLDAPEDEVTVIDYRSL  740



>ref|XP_006582397.1| PREDICTED: serrate RNA effector molecule-like [Glycine max]
Length=714

 Score =   548 bits (1412),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 319/467 (68%), Positives = 370/467 (79%), Gaps = 15/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  182   REGLMSYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  241

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTLDL PG+  T S  +GQ+SEPNS++E D   KR
Sbjct  242   LLTVIERRNENARRLAKDFLLDLQSGTLDLNPGLNSTSSGKSGQASEPNSEEETDG--KR  299

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+KD    S APKAHP+SSEPRRI  D++Q+Q +V KLD EKGIE+NIL  SD+
Sbjct  300   RRHVRGPNKDNDF-SAAPKAHPISSEPRRIQADIQQAQAVVRKLDREKGIEDNILCTSDH  358

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++      + S     +VI+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ETNEAK
Sbjct  359   NKNDDKAHSGSVGP--IVIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETNEAK  416

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +G  + ETS +G+DWE+KLDS W  RL GQDPLEVMTAKEKID AA + L+P+
Sbjct  417   GFRHVRPEGAGHEETSKSGSDWEKKLDSFWHGRLNGQDPLEVMTAKEKIDAAATDVLDPH  476

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPE+V+ELTSK+REDLYFQNYM+
Sbjct  477   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPEIVMELTSKMREDLYFQNYMN  536

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGG PVM        L+RR   LE RLKDDRGNRR+++         DRP+   S 
Sbjct  537   DPDAPGGMPVMQQPQKDRPLKRRLGGLEGRLKDDRGNRRDQDRSDRMNG--DRPDGSPSH  594

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + Q       N DE M+D++GG G+P  AF SD+ PPPVLMPVPGAG
Sbjct  595   ERQMG-----NHDEAMYDAYGGPGVP--AFTSDMPPPPVLMPVPGAG  634


 Score =   126 bits (317),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM REQGGP  F+  GR  R GP +GG APIIA+PPS R DPRR+R
Sbjct  635  PLGPFVPAPPEVAMQMFREQGGPTSFDASGRKMRSGPHMGGPAPIIAVPPSFRPDPRRMR  694

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SY+DLDAPEDEVTVIDYRSL
Sbjct  695  SYEDLDAPEDEVTVIDYRSL  714



>ref|XP_010927258.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Elaeis 
guineensis]
Length=751

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/445 (69%), Positives = 368/445 (83%), Gaps = 3/445 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRY+EY+S YI  QKR YFD HKDEEWLKDKYHPTN
Sbjct  203   REGLMSYKQFIQELEDDILPAEAERRYEEYRSEYISTQKRTYFDTHKDEEWLKDKYHPTN  262

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV VIERRNE AR  AK+FLLDLQSGTLDLGPG+T    + +G  S+PNS+DE D+  KR
Sbjct  263   LVMVIERRNEHARSTAKEFLLDLQSGTLDLGPGLTSPVVSKSGNGSDPNSEDEMDSSGKR  322

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  L+S AP+AHP+SSEP+RI ID+EQ+Q LV KLD+EKGI +N+LS SD+
Sbjct  323   RRHARGPAKENDLVSAAPRAHPISSEPQRIQIDIEQAQALVRKLDTEKGIVDNVLSSSDH  382

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP ++I+RGLT+VKGLEG ELL+TL+TYLWR+HG+DYYGM ETNEAK
Sbjct  383   DKLDGEKSHGGSMGP-IIIIRGLTTVKGLEGVELLDTLITYLWRVHGIDYYGMSETNEAK  441

Query  1338  GLRHMRFDGKNTETS-SNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K+ + S ++GADWE+KLDS W+ERL G DPLEV+TAK+KID AAVEAL+PY
Sbjct  442   GLRHVRADSKSFDGSNTSGADWEKKLDSLWQERLCGWDPLEVLTAKDKIDAAAVEALDPY  501

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  502   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVVELTSKVREDLYFQNYMN  561

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S PK K  RRR  L++RL+D+RGNRRE +      +R+DR ++  S 
Sbjct  562   DPNAPGGTPVMQQSAPKAKAPRRRSVLDNRLRDERGNRREHDRADRDDDRYDRADHSPSH  621

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGI  727
             D     +GG + DE M+D+FG  G+
Sbjct  622   DANGGAEGGSH-DEPMYDAFGVQGL  645


 Score =   130 bits (326),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 70/84 (83%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVAM+MLREQGGP+ FE      GR G  GPQ GG API+A+PP+ R DP
Sbjct  668  PLGPFVPAPPEVAMRMLREQGGPSSFEANGGPRGRKGLLGPQAGGSAPILAVPPAFRHDP  727

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPEDEVTVIDYRSL
Sbjct  728  RRIRSYQDLDAPEDEVTVIDYRSL  751



>ref|XP_010927259.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Elaeis 
guineensis]
Length=746

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/445 (69%), Positives = 368/445 (83%), Gaps = 3/445 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRY+EY+S YI  QKR YFD HKDEEWLKDKYHPTN
Sbjct  198   REGLMSYKQFIQELEDDILPAEAERRYEEYRSEYISTQKRTYFDTHKDEEWLKDKYHPTN  257

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV VIERRNE AR  AK+FLLDLQSGTLDLGPG+T    + +G  S+PNS+DE D+  KR
Sbjct  258   LVMVIERRNEHARSTAKEFLLDLQSGTLDLGPGLTSPVVSKSGNGSDPNSEDEMDSSGKR  317

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+  L+S AP+AHP+SSEP+RI ID+EQ+Q LV KLD+EKGI +N+LS SD+
Sbjct  318   RRHARGPAKENDLVSAAPRAHPISSEPQRIQIDIEQAQALVRKLDTEKGIVDNVLSSSDH  377

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP ++I+RGLT+VKGLEG ELL+TL+TYLWR+HG+DYYGM ETNEAK
Sbjct  378   DKLDGEKSHGGSMGP-IIIIRGLTTVKGLEGVELLDTLITYLWRVHGIDYYGMSETNEAK  436

Query  1338  GLRHMRFDGKNTETS-SNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K+ + S ++GADWE+KLDS W+ERL G DPLEV+TAK+KID AAVEAL+PY
Sbjct  437   GLRHVRADSKSFDGSNTSGADWEKKLDSLWQERLCGWDPLEVLTAKDKIDAAAVEALDPY  496

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  497   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVVELTSKVREDLYFQNYMN  556

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S PK K  RRR  L++RL+D+RGNRRE +      +R+DR ++  S 
Sbjct  557   DPNAPGGTPVMQQSAPKAKAPRRRSVLDNRLRDERGNRREHDRADRDDDRYDRADHSPSH  616

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGI  727
             D     +GG + DE M+D+FG  G+
Sbjct  617   DANGGAEGGSH-DEPMYDAFGVQGL  640


 Score =   130 bits (326),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 70/84 (83%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVAM+MLREQGGP+ FE      GR G  GPQ GG API+A+PP+ R DP
Sbjct  663  PLGPFVPAPPEVAMRMLREQGGPSSFEANGGPRGRKGLLGPQAGGSAPILAVPPAFRHDP  722

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPEDEVTVIDYRSL
Sbjct  723  RRIRSYQDLDAPEDEVTVIDYRSL  746



>gb|KHN26439.1| Serrate RNA effector molecule [Glycine soja]
Length=529

 Score =   541 bits (1393),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 315/462 (68%), Positives = 366/462 (79%), Gaps = 15/462 (3%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTNL++VI
Sbjct  2     SYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTNLLTVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRNE AR++AKDFLLDLQSGTLDL PG+  T S  +GQ+SEPNS++E D   KRRRH R
Sbjct  62    ERRNENARRLAKDFLLDLQSGTLDLNPGLNSTSSGKSGQASEPNSEEETDG--KRRRHVR  119

Query  1683  GPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsr  1504
             GP+KD    S APKAHP+SSEPRRI  D++Q+Q +V KLD EKGIE+NIL  SD+++   
Sbjct  120   GPNKDNDF-SAAPKAHPISSEPRRIQADIQQAQAVVRKLDREKGIEDNILCTSDHNKNDD  178

Query  1503  dksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHM  1324
                + S     +VI+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ETNEAKG RH+
Sbjct  179   KAHSGSVGP--IVIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETNEAKGFRHV  236

Query  1323  RFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIR  1147
             R +G  + ETS +G+DWE+KLDS W  RL GQDPLEVMTAKEKID AA + L+P+VRKIR
Sbjct  237   RPEGAGHEETSKSGSDWEKKLDSFWHGRLNGQDPLEVMTAKEKIDAAATDVLDPHVRKIR  296

Query  1146  DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAP  967
             DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPE+V+ELTSK+REDLYFQNYM+D  AP
Sbjct  297   DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPEIVMELTSKMREDLYFQNYMNDPDAP  356

Query  966   GGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSN  787
             GG PVM        L+RR   LE RLKDDRGNRR+++         DRP+   S + Q  
Sbjct  357   GGMPVMQQPQKDRPLKRRLGGLEGRLKDDRGNRRDQDRSDRMNG--DRPDGSPSHERQMG  414

Query  786   DDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                  N DE M+D++GG G+P  AF SD+ PPPVLMPVPGAG
Sbjct  415   -----NHDEAMYDAYGGPGVP--AFTSDMPPPPVLMPVPGAG  449


 Score =   127 bits (319),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 68/80 (85%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM REQGGP  F+  GR  R GP +GG APIIA+PPS R DPRR+R
Sbjct  450  PLGPFVPAPPEVAMQMFREQGGPTSFDASGRKMRSGPHMGGPAPIIAVPPSFRPDPRRMR  509

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SY+DLDAPEDEVTVIDYRSL
Sbjct  510  SYEDLDAPEDEVTVIDYRSL  529



>ref|XP_010557491.1| PREDICTED: serrate RNA effector molecule-like [Tarenaya hassleriana]
Length=725

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/467 (70%), Positives = 384/467 (82%), Gaps = 16/467 (3%)
 Frame = -1

Query  2061  CREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
              REGL SYKQFIQELEDD+LP+EAE RYQEYKS +I  QKR +FDAHK+EEWLKDKYHPT
Sbjct  195   AREGLMSYKQFIQELEDDVLPSEAEHRYQEYKSEFITTQKRVFFDAHKEEEWLKDKYHPT  254

Query  1881  NLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDK  1702
             NL+SVIERRNE ARK+AKDFLLDLQSG LDLGPGVT    N +GQ+SEPNS+DEAD G K
Sbjct  255   NLLSVIERRNELARKVAKDFLLDLQSGKLDLGPGVTAL--NKSGQTSEPNSEDEADGGSK  312

Query  1701  RRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsd  1522
             RRRH RGP+K+  LLS APKAH VSS+ RR+ +D+EQ+Q LV KLDSEKGI EN+LS SD
Sbjct  313   RRRHARGPAKETDLLSAAPKAHSVSSDQRRVLVDIEQAQVLVRKLDSEKGIVENVLSGSD  372

Query  1521  ndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEA  1342
             N++  RDK +S SSGPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYGM ETNEA
Sbjct  373   NEKSGRDKLHSGSSGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGMNETNEA  431

Query  1341  KGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             KGLRH+R +GK ++   NG +WE+KLDS W+ERLKGQDP+EVM AKEKID AAVE L+PY
Sbjct  432   KGLRHVRAEGKGSDV--NGDEWEKKLDSHWQERLKGQDPMEVMAAKEKIDAAAVEVLDPY  489

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAA+FVHKHLKLKHPELV+ELT+KVR++LYFQNYM+
Sbjct  490   VRKIRDEKYGWKYGCGAKGCTKLFHAADFVHKHLKLKHPELVMELTAKVRDELYFQNYMN  549

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGG PVM     +++  RR+P +ESRL+ D   RRER G+ NG +RFD+ +N    
Sbjct  550   DPNAPGGQPVMQQQ--RDRPFRRKPGIESRLR-DDRGRREREGQANGNDRFDQSDNHRPD  606

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D  + D G  NPDE  +D+FGG       F SDI PPPVLMPVPGAG
Sbjct  607   DGDAPDGG--NPDEAGYDAFGG------PFSSDIPPPPVLMPVPGAG  645


 Score = 94.7 bits (234),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP--FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRI  398
            PLGPFVPAPPEVAMQM R+Q GP P     GR GR GP +GG AP + L PS RQDPRR+
Sbjct  646  PLGPFVPAPPEVAMQMFRDQSGPPPPLEGSGRGGRSGPPVGGPAPFL-LQPSFRQDPRRL  704

Query  397  RSYQDLDAPEDEVTVIDYRSL  335
            RSYQDLD PE+EVTVIDYR+L
Sbjct  705  RSYQDLDVPEEEVTVIDYRTL  725



>ref|XP_010510813.1| PREDICTED: serrate RNA effector molecule-like [Camelina sativa]
Length=715

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/467 (68%), Positives = 374/467 (80%), Gaps = 8/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F++HKDE+WLK+KYHPTN
Sbjct  186   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNSHKDEDWLKNKYHPTN  245

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK+AKDFLLDLQSG +DLGP VT   S+ + ++SEPNS+DEA  G KR
Sbjct  246   LLSVIERRNELARKVAKDFLLDLQSGAIDLGPAVTA--SDKSSRASEPNSEDEAAGGGKR  303

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH R  SK+  LLS APKA   +S+P+RI IDVEQ+Q LV KLDSEKGIEEN+LS S+ 
Sbjct  304   KRHGRWESKETELLSAAPKAPNFTSDPKRILIDVEQAQALVRKLDSEKGIEENLLSGSET  363

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +   R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG  ETNEAK
Sbjct  364   ENSGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKFETNEAK  422

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  423   GLRHVRAEGKGSD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  480

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  481   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMND  540

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P M  S P+++  RR+P +E RL+DDR  RRER+GR NG +R DR E+ L  D
Sbjct  541   PNAPGGQPAMQQSGPRDRPMRRKPGMEHRLRDDRSGRRERDGRANGNDRNDRSEDQLGGD  600

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D    N  E  +D+FGG  G+ V  F SDI  PPVLMPVPGAG
Sbjct  601   GDGPDG--GNSVEGRYDAFGGQGGVHVPPFSSDINAPPVLMPVPGAG  645


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 11/80 (14%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM     GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  646  PLGPFVPAPPEFAMQMF--PSGPNPSFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  695

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  696  SYQDLDAPEEEVTVIDYRSL  715



>ref|XP_009403045.1| PREDICTED: serrate RNA effector molecule-like isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=648

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/454 (66%), Positives = 368/454 (81%), Gaps = 5/454 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAERRY+EY+S YI  QKRAYF+AHK+E WLKDKYHPTN
Sbjct  103   RGGLMSYKQFIQELEDDIFPAEAERRYEEYRSEYISTQKRAYFEAHKEERWLKDKYHPTN  162

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSGTLDLGPGVT + ++ +G  SEPNS+DEAD   KR
Sbjct  163   LVAVIERRKEQARSVAKEFLLDLQSGTLDLGPGVTVSSTSKSGNGSEPNSEDEADTNGKR  222

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH++GP+K+  L S A KAHPVSSEPRRI  D+EQ+Q LV KLD EKGI++N+LS S +
Sbjct  223   RRHNKGPAKENDLHSAALKAHPVSSEPRRIQADIEQAQALVRKLDMEKGIQDNVLSSSGH  282

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS   S G  ++I+RGLT+VKGLEG ELL+TL+T+LWRIHG+DYYGM ET+E K
Sbjct  283   DKLDAEKSRGGSMG-RIIIIRGLTTVKGLEGVELLDTLITFLWRIHGLDYYGMSETSELK  341

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++G+DWE+KLDS W  RL+GQDPLE +TAK+KID AA EAL+P+
Sbjct  342   GLRHVRADNKTHDGTNASGSDWEKKLDSFWLARLQGQDPLETLTAKDKIDAAATEALDPF  401

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA E+VHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  402   VRKIRDEKYGWKYGCGAKGCTKLFHAPEYVHKHLRLKHPDLVIELTSKVREDLYFQNYMN  461

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S  K K+QRRRP L++RL+D+RGNRR+ +      +R DR +N    
Sbjct  462   DPNAPGGTPVMQQSALKVKMQRRRPLLDNRLRDERGNRRDLDRNDRYDDRHDRSDNSPRD  521

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDI  700
                S +  G N ++ ++D++GG G+   AFPSDI
Sbjct  522   GNGSLE--GENHEKLLYDAYGGQGLH-GAFPSDI  552


 Score =   119 bits (299),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPF+PAPPE+AM MLRE GG + FE      GR GR GPQ+ G API+ +P + R DP
Sbjct  565  PLGPFIPAPPEIAMHMLRETGGSSSFESNGGSRGRKGRLGPQVSGPAPILPIPSAFRHDP  624

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAP+DEVTV+DYRSL
Sbjct  625  RRIRSYQDLDAPDDEVTVVDYRSL  648



>ref|XP_007133532.1| hypothetical protein PHAVU_011G187000g [Phaseolus vulgaris]
 gb|ESW05526.1| hypothetical protein PHAVU_011G187000g [Phaseolus vulgaris]
Length=728

 Score =   536 bits (1381),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 324/467 (69%), Positives = 380/467 (81%), Gaps = 10/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  192   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  251

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTL+L PG+  + S+ +GQ+SEPNS++E D G KR
Sbjct  252   LLTVIERRNENARQLAKDFLLDLQSGTLELNPGLDASISSKSGQASEPNSEEEGDTGGKR  311

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG +KD    S APKAHP+SSEPRRI  DV+Q+Q LV KLD+EKGIE+NIL  S +
Sbjct  312   RRHGRGSNKDNDF-SAAPKAHPISSEPRRIQADVQQAQVLVRKLDAEKGIEDNILCSSSD  370

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
                + DK++S S GP+V+I RGLTSVKGLEG ELL+TL+T+LWRIHGVDYYGMIETNEAK
Sbjct  371   HNKNDDKAHSGSVGPIVII-RGLTSVKGLEGVELLDTLITFLWRIHGVDYYGMIETNEAK  429

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +G  + ET  +G+DWE+KLD  W+ RL G DPLE+MTAKEKID AA+E L+PY
Sbjct  430   GFRHVRPEGTGHEETGKSGSDWEKKLDLFWQGRLNGLDPLEIMTAKEKIDAAAMEVLDPY  489

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+E T+KVREDLYFQNYM+
Sbjct  490   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMEQTTKVREDLYFQNYMN  549

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M  S  +++  +RR  LE RL+DDRGNRR+ +         DRP+N  S+
Sbjct  550   DPDAPGGTPIMQQSQ-RDRPMKRRLGLEGRLRDDRGNRRDHDRNDRMNG--DRPDNSPSN  606

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + QS + G R  DE M+DS+ G G+P   F SDI PPPVLMPVPGAG
Sbjct  607   ERQSLEMGNR--DETMYDSYAGAGVP--PFASDIPPPPVLMPVPGAG  649


 Score =   124 bits (310),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQMLR+QGGP+    GR  R GP + G APIIA+PP+ R DPRR+RS
Sbjct  650  PLGPFVPAPPEVAMQMLRDQGGPSYDASGRKMRGGPHMSGAAPIIAVPPNFRPDPRRMRS  709

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  710  YQDLDAPEDEVTVIDYRSL  728



>gb|KDO66404.1| hypothetical protein CISIN_1g003865mg [Citrus sinensis]
Length=595

 Score =   536 bits (1380),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 290/378 (77%), Positives = 334/378 (88%), Gaps = 2/378 (1%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKR +FDAHKDEEWLKDKYH
Sbjct  219   STQREGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRVFFDAHKDEEWLKDKYH  278

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNLV+VIERRN+ ARK+AKDFLLDLQSGTLDLGP V  + SN  GQ+SEPNSDD+ D G
Sbjct  279   PTNLVAVIERRNDLARKVAKDFLLDLQSGTLDLGPSVNASSSNKLGQTSEPNSDDDVDNG  338

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KRRRH RGP+K+  LLS APKAHP+SSEPRRI +D+EQ+Q LV KLDSEKGI ENIL  
Sbjct  339   GKRRRHGRGPAKETDLLSAAPKAHPISSEPRRIQVDIEQAQALVRKLDSEKGITENILCG  398

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             SDND+ +R+KS+ S+    V+I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGM+ET+
Sbjct  399   SDNDKMNREKSHGSTGP--VIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMVETS  456

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK+++ ++NGA+WE+KLD RW+ERL+ QDPLE+MTAK+KID AAV+AL+
Sbjct  457   EAKGLRHVRAEGKSSDITNNGAEWEKKLDFRWQERLRSQDPLEIMTAKDKIDAAAVDALD  516

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+ELTSKVRE+LYFQNY
Sbjct  517   PFVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVIELTSKVREELYFQNY  576

Query  987   MSDESAPGGTPVMLSSLP  934
             M+D  APGGTPVM   +P
Sbjct  577   MNDPDAPGGTPVMQQPMP  594



>gb|EYU35995.1| hypothetical protein MIMGU_mgv1a001908mg [Erythranthe guttata]
Length=741

 Score =   540 bits (1391),  Expect = 8e-179, Method: Compositional matrix adjust.
 Identities = 311/449 (69%), Positives = 364/449 (81%), Gaps = 7/449 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REG+ SYKQFIQELEDDILPAEAERRYQEYK+ YI  QK  +F+AHKDEEWLKDKYHPTN
Sbjct  209   REGMMSYKQFIQELEDDILPAEAERRYQEYKTEYISTQKTNFFNAHKDEEWLKDKYHPTN  268

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE A+K+AKDF  DLQSG LDLGPG  P+  N   QSS+P SDDE +AG KR
Sbjct  269   LLAVIERRNELAQKLAKDFQADLQSGNLDLGPGFNPSSLNKAEQSSDPKSDDEENAGGKR  328

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             ++  R  +KD+   S APKAHPV SEP+RI ID+EQ+  LV KLD+EKGIE+N+L R++N
Sbjct  329   KQPGRSGAKDSDH-SSAPKAHPVCSEPKRILIDIEQALALVQKLDTEKGIEDNVLFRAEN  387

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DR SRDKS+ SSSGPVV+I RGLT+VKGLEG ELL+TLLTYLWRIHGVDYYG++E+NEAK
Sbjct  388   DRMSRDKSHGSSSGPVVII-RGLTTVKGLEGTELLDTLLTYLWRIHGVDYYGLVESNEAK  446

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R + KN++  +N  DWE KL+S W+ERLKG DPLE+MT KEKID AA EAL P+V
Sbjct  447   GLRHVRVEVKNSDAIANANDWENKLNSHWQERLKGSDPLEIMTGKEKIDAAANEALNPHV  506

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWK+GCGAKGCTKLFHAAEFVHKHLKLKHPEL +ELT+KVRE+LY QNYM D
Sbjct  507   RKIRDEKYGWKFGCGAKGCTKLFHAAEFVHKHLKLKHPELAVELTTKVREELYLQNYMKD  566

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
             E+APGG PVM  SL KEKL RRRP  ++  + +   R +RN R NG E FDRPEN  S D
Sbjct  567   ENAPGGKPVMQPSL-KEKLLRRRPGPDNNNRMN-NERGDRNYRANGNEHFDRPENSQSGD  624

Query  798   IQSNDDG--GRNPDEQMFDSFGGHGIPVA  718
               +N DG  G N D+ M+DSFGG GIP+ 
Sbjct  625   F-ANQDGASGNNADDPMYDSFGGQGIPLT  652


 Score =   113 bits (283),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 66/80 (83%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGG-PAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            P+GPFVPAPPEVAMQM+R++GG P+PFEGGRNG         +PIIALPP  RQDPR +R
Sbjct  670  PMGPFVPAPPEVAMQMMRDRGGGPSPFEGGRNG--------PSPIIALPPRHRQDPRSLR  721

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SY DLDAP+DEVTVIDYRSL
Sbjct  722  SYNDLDAPDDEVTVIDYRSL  741



>ref|XP_009403044.1| PREDICTED: serrate RNA effector molecule-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=728

 Score =   539 bits (1388),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 299/454 (66%), Positives = 368/454 (81%), Gaps = 5/454 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAERRY+EY+S YI  QKRAYF+AHK+E WLKDKYHPTN
Sbjct  190   RGGLMSYKQFIQELEDDIFPAEAERRYEEYRSEYISTQKRAYFEAHKEERWLKDKYHPTN  249

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSGTLDLGPGVT + ++ +G  SEPNS+DEAD   KR
Sbjct  250   LVAVIERRKEQARSVAKEFLLDLQSGTLDLGPGVTVSSTSKSGNGSEPNSEDEADTNGKR  309

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH++GP+K+  L S A KAHPVSSEPRRI  D+EQ+Q LV KLD EKGI++N+LS S +
Sbjct  310   RRHNKGPAKENDLHSAALKAHPVSSEPRRIQADIEQAQALVRKLDMEKGIQDNVLSSSGH  369

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS   S G  ++I+RGLT+VKGLEG ELL+TL+T+LWRIHG+DYYGM ET+E K
Sbjct  370   DKLDAEKSRGGSMG-RIIIIRGLTTVKGLEGVELLDTLITFLWRIHGLDYYGMSETSELK  428

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++G+DWE+KLDS W  RL+GQDPLE +TAK+KID AA EAL+P+
Sbjct  429   GLRHVRADNKTHDGTNASGSDWEKKLDSFWLARLQGQDPLETLTAKDKIDAAATEALDPF  488

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA E+VHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  489   VRKIRDEKYGWKYGCGAKGCTKLFHAPEYVHKHLRLKHPDLVIELTSKVREDLYFQNYMN  548

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S  K K+QRRRP L++RL+D+RGNRR+ +      +R DR +N    
Sbjct  549   DPNAPGGTPVMQQSALKVKMQRRRPLLDNRLRDERGNRRDLDRNDRYDDRHDRSDNSPRD  608

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDI  700
                S +  G N ++ ++D++GG G+   AFPSDI
Sbjct  609   GNGSLE--GENHEKLLYDAYGGQGL-HGAFPSDI  639


 Score = 82.0 bits (201),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 5/66 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPF+PAPPE+AM MLRE GG + FE      GR GR GPQ+ G API+ +P + R DP
Sbjct  652  PLGPFIPAPPEIAMHMLRETGGSSSFESNGGSRGRKGRLGPQVSGPAPILPIPSAFRHDP  711

Query  406  RRIRSY  389
            RRIR Y
Sbjct  712  RRIRRY  717



>ref|XP_009403042.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=735

 Score =   539 bits (1388),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 299/454 (66%), Positives = 368/454 (81%), Gaps = 5/454 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAERRY+EY+S YI  QKRAYF+AHK+E WLKDKYHPTN
Sbjct  190   RGGLMSYKQFIQELEDDIFPAEAERRYEEYRSEYISTQKRAYFEAHKEERWLKDKYHPTN  249

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSGTLDLGPGVT + ++ +G  SEPNS+DEAD   KR
Sbjct  250   LVAVIERRKEQARSVAKEFLLDLQSGTLDLGPGVTVSSTSKSGNGSEPNSEDEADTNGKR  309

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH++GP+K+  L S A KAHPVSSEPRRI  D+EQ+Q LV KLD EKGI++N+LS S +
Sbjct  310   RRHNKGPAKENDLHSAALKAHPVSSEPRRIQADIEQAQALVRKLDMEKGIQDNVLSSSGH  369

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS   S G  ++I+RGLT+VKGLEG ELL+TL+T+LWRIHG+DYYGM ET+E K
Sbjct  370   DKLDAEKSRGGSMG-RIIIIRGLTTVKGLEGVELLDTLITFLWRIHGLDYYGMSETSELK  428

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++G+DWE+KLDS W  RL+GQDPLE +TAK+KID AA EAL+P+
Sbjct  429   GLRHVRADNKTHDGTNASGSDWEKKLDSFWLARLQGQDPLETLTAKDKIDAAATEALDPF  488

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA E+VHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  489   VRKIRDEKYGWKYGCGAKGCTKLFHAPEYVHKHLRLKHPDLVIELTSKVREDLYFQNYMN  548

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S  K K+QRRRP L++RL+D+RGNRR+ +      +R DR +N    
Sbjct  549   DPNAPGGTPVMQQSALKVKMQRRRPLLDNRLRDERGNRRDLDRNDRYDDRHDRSDNSPRD  608

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDI  700
                S +  G N ++ ++D++GG G+   AFPSDI
Sbjct  609   GNGSLE--GENHEKLLYDAYGGQGL-HGAFPSDI  639


 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPF+PAPPE+AM MLRE GG + FE      GR GR GPQ+ G API+ +P + R DP
Sbjct  652  PLGPFIPAPPEIAMHMLRETGGSSSFESNGGSRGRKGRLGPQVSGPAPILPIPSAFRHDP  711

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAP+DEVTV+DYRSL
Sbjct  712  RRIRSYQDLDAPDDEVTVVDYRSL  735



>ref|XP_002879061.1| hypothetical protein ARALYDRAFT_481593 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55320.1| hypothetical protein ARALYDRAFT_481593 [Arabidopsis lyrata subsp. 
lyrata]
Length=718

 Score =   538 bits (1385),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 377/467 (81%), Gaps = 11/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRA+F+ HK+E+WLK+KYHPTN
Sbjct  189   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEDWLKNKYHPTN  248

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRN+ A+K+AKDFLLDLQSGTLDLGP VT    N +G++SEPNS+DEA  G KR
Sbjct  249   LLSVIERRNDLAQKVAKDFLLDLQSGTLDLGPAVTAL--NKSGRTSEPNSEDEAAGGGKR  306

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH  G SK+  LLS APKA   +S+P+RI  DVEQ+Q LV KLD EK IEEN+L  S+ 
Sbjct  307   KRHGMGGSKETELLSAAPKAPSFTSDPKRILTDVEQTQALVRKLDFEKKIEENVLQGSET  366

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPVV+I RGLTSVKGLEG ELL+TL+TYLW +HGVDYYG +ETNEAK
Sbjct  367   EKSGREKLHSGSTGPVVII-RGLTSVKGLEGVELLDTLVTYLWLVHGVDYYGKVETNEAK  425

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  426   GLRHVRAEGKGSD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  483

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  484   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMND  543

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P    S P+++  RR+PS+E+RL+DDRG RRER+GR NG +R +R     S D
Sbjct  544   PNAPGGQPATQQSGPRDRPIRRKPSMENRLRDDRGGRRERDGRANGNDRNER-----SED  598

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
              Q  D+ G NP E  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  599   QQRGDNDGGNPGELGYDAFGGQGGVHVPPFLSDINPPPMLMPVPGAG  645


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 63/81 (78%), Gaps = 10/81 (12%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPA--PFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRI  398
            PLGPFVPAPPEVAMQM R+  GP   PFEG  +GR GP     AP + L P+ RQDPRR+
Sbjct  646  PLGPFVPAPPEVAMQMFRDPSGPNNPPFEG--SGRGGP-----APFL-LSPAFRQDPRRL  697

Query  397  RSYQDLDAPEDEVTVIDYRSL  335
            RSYQDLDAPE+EVTVIDYRSL
Sbjct  698  RSYQDLDAPEEEVTVIDYRSL  718



>ref|XP_009381593.1| PREDICTED: serrate RNA effector molecule-like [Musa acuminata 
subsp. malaccensis]
Length=734

 Score =   529 bits (1363),  Expect(2) = 8e-178, Method: Compositional matrix adjust.
 Identities = 309/468 (66%), Positives = 380/468 (81%), Gaps = 7/468 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAERRY+EY+S YI  QKRAYF+AHK+E+WLKDKYHPTN
Sbjct  188   RGGLMSYKQFIQELEDDISPAEAERRYEEYRSEYISTQKRAYFEAHKEEQWLKDKYHPTN  247

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSGTLDLGPG+TP+ ++ +G  SEPNS+DEAD   +R
Sbjct  248   LVAVIERRKEQARTVAKEFLLDLQSGTLDLGPGLTPSLASKSGNDSEPNSEDEADPHGER  307

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG +K   LLS APK+HPVSSEPRRI +D+EQ+Q LV KLD EKGI++N+LS S +
Sbjct  308   RRHGRGNAKGHDLLSAAPKSHPVSSEPRRIQVDIEQAQALVHKLDMEKGIQDNVLSYSGH  367

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP +VI+RG T+VKGLEG ELL+TL+TYLWR+HG+DYYGM ET+EAK
Sbjct  368   DKLDAEKSHGGSMGP-IVIIRGPTTVKGLEGVELLDTLITYLWRVHGLDYYGMSETSEAK  426

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++G++WE+KLD  W+ RL+GQDPLE +TAK+KID AA EAL+P 
Sbjct  427   GLRHVRADNKTHDGTNASGSNWEKKLDIFWQARLEGQDPLETLTAKDKIDAAATEALDPL  486

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+LV+ELTSKVRE+LYFQNYM+
Sbjct  487   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLVMELTSKVREELYFQNYMN  546

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S PK K QRR P L +RL+D+RG RRE +       R D+ +N   S
Sbjct  547   DPNAPGGTPVMQQSAPKVKSQRRGPPLGNRLRDERGYRRESDRNDRDDNRHDKTDN---S  603

Query  801   DIQSNDD-GGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                +ND   G + ++ + +++GG G+   AFPSD+ PPPVLMPVPGAG
Sbjct  604   PRDANDGLEGDDNEKPLHEAYGGQGL-HGAFPSDVPPPPVLMPVPGAG  650


 Score =   124 bits (312),  Expect(2) = 8e-178, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 70/84 (83%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPP+VAM+MLRE GGP+ +E      GR GR GPQ+ G API+++PP+ R DP
Sbjct  651  PLGPFVPAPPDVAMRMLRETGGPSSYEATAGSRGRTGRLGPQVSGPAPILSMPPAFRHDP  710

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAP+DEVTVIDYRSL
Sbjct  711  RRIRSYQDLDAPDDEVTVIDYRSL  734



>ref|NP_565635.1| serrate RNA effector molecule [Arabidopsis thaliana]
 sp|Q9ZVD0.2|SRRT_ARATH RecName: Full=Serrate RNA effector molecule [Arabidopsis thaliana]
 gb|AAK63206.1|AF311221_1 C2H2 zinc-finger protein SERRATE [Arabidopsis thaliana]
 gb|AAL16137.1|AF428305_1 At2g27100/T20P8.15 [Arabidopsis thaliana]
 gb|AAK64019.1| unknown protein [Arabidopsis thaliana]
 gb|AAC77868.2| expressed protein [Arabidopsis thaliana]
 gb|AAN13138.1| unknown protein [Arabidopsis thaliana]
 gb|AAN28876.1| At2g27100/T20P8.15 [Arabidopsis thaliana]
 gb|AEC07936.1| serrate RNA effector molecule [Arabidopsis thaliana]
Length=720

 Score =   536 bits (1382),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 378/467 (81%), Gaps = 11/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRA+F+ HK+E+WLK+KYHPTN
Sbjct  192   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEDWLKNKYHPTN  251

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRN+ A+K+AKDFLLDLQSGTLDLGP VT    N +G++SEPNS+DEA    KR
Sbjct  252   LLSVIERRNDLAQKVAKDFLLDLQSGTLDLGPAVTAL--NKSGRTSEPNSEDEAAGVGKR  309

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH  G +K+  LLS APKA   +S+P+RI  DVEQ+Q LV KLDSEK IEEN+L  S+ 
Sbjct  310   KRHGMGGAKENELLSAAPKAPSFTSDPKRILTDVEQTQALVRKLDSEKKIEENVLQGSET  369

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPVV+I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYG +ETNEAK
Sbjct  370   EKSGREKLHSGSTGPVVII-RGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGKVETNEAK  428

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  429   GLRHVRAEGKVSD--AKGDENESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  486

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  487   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMND  546

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P    S P+++  RR+PS+E+RL+DDRG RRER+GR NG +R DR     S D
Sbjct  547   PNAPGGQPATQQSGPRDRPIRRKPSMENRLRDDRGGRRERDGRANGNDRNDR-----SED  601

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
              Q  D+ G NP E  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  602   QQRGDNDGGNPGEVGYDAFGGQGGVHVPPFLSDINPPPMLMPVPGAG  648


 Score = 99.8 bits (247),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  649  PLGPFVPAPPEVAMQMFRDPSGPNPPFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  700

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  701  SYQDLDAPEEEVTVIDYRSL  720



>ref|XP_010929332.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Elaeis 
guineensis]
Length=656

 Score =   531 bits (1368),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 281/384 (73%), Positives = 327/384 (85%), Gaps = 2/384 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRY+EY+S YI  QKR YFD HK+EEWLKDKYHPTN
Sbjct  194   REGLMSYKQFIQELEDDILPAEAERRYEEYRSEYISTQKRTYFDTHKEEEWLKDKYHPTN  253

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LVSVIERRNE AR +AK+FLLDLQSGTLDLGPG T      +G  S+PNS+DE D+  KR
Sbjct  254   LVSVIERRNEHARSIAKEFLLDLQSGTLDLGPGATAAVVTQSGNGSDPNSEDEMDSSGKR  313

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+K+   LS APKAHPVSSE RRI +D+EQ+Q LV KLD+EKGIE+N+LS SD+
Sbjct  314   RRHGRGPAKENNPLSAAPKAHPVSSELRRIQVDIEQAQALVHKLDTEKGIEDNVLSSSDH  373

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP ++I+RGLT+VKGLEG ELL+TL+TYLWRIHGVDYYGM E NEAK
Sbjct  374   DKLDGEKSHGGSMGP-IIIIRGLTTVKGLEGVELLDTLITYLWRIHGVDYYGMSEINEAK  432

Query  1338  GLRHMRFDGKNTETS-SNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K+ + S ++GADWE+KLD+ W++RL+GQDPLE++TAK+KID AAVEAL+PY
Sbjct  433   GLRHVRADSKSFDGSNTSGADWEKKLDAFWQKRLQGQDPLEILTAKDKIDAAAVEALDPY  492

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  493   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHPDLVMELTSKVREDLYFQNYMN  552

Query  981   DESAPGGTPVMLSSLPKEKLQRRR  910
             D +APGGTPVM  S     L R R
Sbjct  553   DPNAPGGTPVMQQSALVGLLLRSR  576



>ref|XP_009403043.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=734

 Score =   533 bits (1373),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 298/454 (66%), Positives = 367/454 (81%), Gaps = 6/454 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAERRY+EY+S YI  QKRAYF+AHK+E WLKDKYHPTN
Sbjct  190   RGGLMSYKQFIQELEDDIFPAEAERRYEEYRSEYISTQKRAYFEAHKEERWLKDKYHPTN  249

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSGTLDLGPGVT + ++ +G  SEPNS+DEAD   KR
Sbjct  250   LVAVIERRKEQARSVAKEFLLDLQSGTLDLGPGVTVSSTSKSGNGSEPNSEDEADTNGKR  309

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH++GP+K+  L S A KAHPVSSEPRRI  D+EQ+Q LV KLD EKGI++N+LS S +
Sbjct  310   RRHNKGPAKENDLHSAALKAHPVSSEPRRIQADIEQAQALVRKLDMEKGIQDNVLSSSGH  369

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS   S G  ++I+RGLT+VKGLEG ELL+TL+T+LWRIHG+DYYGM ET+E K
Sbjct  370   DKLDAEKSRGGSMG-RIIIIRGLTTVKGLEGVELLDTLITFLWRIHGLDYYGMSETSELK  428

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++G+DWE+KLDS W  RL+GQDPLE +TAK+KID AA EAL+P+
Sbjct  429   GLRHVRADNKTHDGTNASGSDWEKKLDSFWLARLQGQDPLETLTAKDKIDAAATEALDPF  488

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA E+VHKHL+LKHP+LV+ELTSKVREDLYFQNYM+
Sbjct  489   VRKIRDEKYGWKYGCGAKGCTKLFHAPEYVHKHLRLKHPDLVIELTSKVREDLYFQNYMN  548

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S    K+QRRRP L++RL+D+RGNRR+ +      +R DR +N    
Sbjct  549   DPNAPGGTPVMQQSA-LVKMQRRRPLLDNRLRDERGNRRDLDRNDRYDDRHDRSDNSPRD  607

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDI  700
                S +  G N ++ ++D++GG G+   AFPSDI
Sbjct  608   GNGSLE--GENHEKLLYDAYGGQGL-HGAFPSDI  638


 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 66/84 (79%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPF+PAPPE+AM MLRE GG + FE      GR GR GPQ+ G API+ +P + R DP
Sbjct  651  PLGPFIPAPPEIAMHMLRETGGSSSFESNGGSRGRKGRLGPQVSGPAPILPIPSAFRHDP  710

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAP+DEVTV+DYRSL
Sbjct  711  RRIRSYQDLDAPDDEVTVVDYRSL  734



>ref|XP_007148749.1| hypothetical protein PHAVU_005G010800g [Phaseolus vulgaris]
 gb|ESW20743.1| hypothetical protein PHAVU_005G010800g [Phaseolus vulgaris]
Length=700

 Score =   528 bits (1359),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 280/394 (71%), Positives = 328/394 (83%), Gaps = 4/394 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+LPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  170   REGLMSYKQFIQELEDDVLPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  229

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTLDL PG++ + S+ +GQ+SEPNS++E D G KR
Sbjct  230   LLTVIERRNENARRLAKDFLLDLQSGTLDLNPGLSSSSSSKSGQASEPNSEEETDGGIKR  289

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP+KD    S APKAHP+SSEPRRI  D+ ++Q +V KLD+EKGIE+NIL  SD+
Sbjct  290   RRHGRGPNKDNDF-SAAPKAHPISSEPRRIQTDIVKAQAVVRKLDTEKGIEDNILCTSDH  348

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +R      + S     ++I+RGLTSVKGLEG ELL+TL+TYLWRIHG+DYYGMIE NEAK
Sbjct  349   NRSDDKSHSGSVGP--IIIIRGLTSVKGLEGVELLDTLITYLWRIHGIDYYGMIEVNEAK  406

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +G  + ETS +G++WE+KLD  W+ RL GQDPLE+M+AKEKID AA + L+PY
Sbjct  407   GFRHVRPEGAGHEETSKSGSEWEKKLDQFWQGRLNGQDPLELMSAKEKIDAAAADVLDPY  466

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKHPELV+ELTSK+REDLYFQNYM+
Sbjct  467   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHPELVMELTSKLREDLYFQNYMN  526

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDD  880
             D  APGGTPVM        L+RR   LE RLKDD
Sbjct  527   DPDAPGGTPVMQQPQKDRGLKRRLGGLEGRLKDD  560


 Score = 98.6 bits (244),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 67/82 (82%), Gaps = 3/82 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGP-APFE-GGRNGRQGPQIGGQAP-IIALPPSLRQDPRR  401
            PLGPFVPAPPEVAMQMLREQGG  A ++  GR  R GP +GG    IIA+PPS R DPR+
Sbjct  619  PLGPFVPAPPEVAMQMLREQGGGGASYDPSGRKMRSGPHMGGGPGPIIAVPPSFRPDPRQ  678

Query  400  IRSYQDLDAPEDEVTVIDYRSL  335
            +RSY+DLDAPEDEVTVIDYRSL
Sbjct  679  MRSYEDLDAPEDEVTVIDYRSL  700



>ref|XP_010417858.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Camelina 
sativa]
Length=716

 Score =   525 bits (1351),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 372/467 (80%), Gaps = 8/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+ HK+E+WLK+KYHPTN
Sbjct  187   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNTHKEEDWLKNKYHPTN  246

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERR E ARK+AKDFLLDLQSG LDLGP VT    + + + SEPNS+DEA  G KR
Sbjct  247   LLSVIERRVELARKVAKDFLLDLQSGALDLGPAVTAL--DKSSRPSEPNSEDEAAGGGKR  304

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH R  +K+  LLS APKA   +S+P+RI IDVEQ+Q LV KLDSEKGIEEN+LS S+ 
Sbjct  305   KRHGRWEAKETELLSAAPKAPSFTSDPKRILIDVEQAQALVRKLDSEKGIEENLLSGSET  364

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG  ETNEAK
Sbjct  365   EKSGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKFETNEAK  423

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK  +  + G + E K D  W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  424   GLRHVRAEGKVYD--AKGDESESKFDFHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  481

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  482   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVAELTTKVREELYFQNYMND  541

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P M  S P+++  RR+P +E RL+DDRG RRER+GRVNG +R DR E+ L  D
Sbjct  542   PNAPGGQPAMQQSGPRDRPMRRKPGMEHRLRDDRGGRRERDGRVNGNDRNDRSEDQLGGD  601

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D    NP E  +D+FGG  G+ V  F SDI  PPVLMPVPGAG
Sbjct  602   GDGTDG--GNPVEGRYDAFGGQGGVHVPPFSSDINAPPVLMPVPGAG  646


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 59/80 (74%), Gaps = 11/80 (14%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM     GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  647  PLGPFVPAPPEFAMQMF--PSGPNPSFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  696

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE EVTVIDYRSL
Sbjct  697  SYQDLDAPEKEVTVIDYRSL  716



>gb|AET02601.2| serrate RNA effector molecule-like protein [Medicago truncatula]
Length=746

 Score =   524 bits (1349),  Expect(2) = 6e-173, Method: Compositional matrix adjust.
 Identities = 303/467 (65%), Positives = 350/467 (75%), Gaps = 30/467 (6%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP EAERRYQEYKS YI  QKRAYF AHKDEEWLKDKYHPTN
Sbjct  228   REGLMSYKQFIQELEDDILPTEAERRYQEYKSEYISTQKRAYFSAHKDEEWLKDKYHPTN  287

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTLD  PG++ + S+ +GQ+SEPNS++EA+  D+R
Sbjct  288   LLTVIERRNESARQLAKDFLLDLQSGTLDPNPGLSASLSSKSGQASEPNSEEEAE--DQR  345

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR   G +K +   S APKAHPVSSEPRRI  DV+Q+Q LV KLD+EK I +NIL     
Sbjct  346   RRDGWGSNKKSDF-SAAPKAHPVSSEPRRIQADVQQAQALVRKLDTEKRIGDNIL-----  399

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
                              +I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIETNEAK
Sbjct  400   ---------------CSIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMIETNEAK  444

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R + K + ET  +G++WE+KLDS W+ RL GQDPLEV+ AKEK+D AA+E L+PY
Sbjct  445   GFRHVRPERKGHEETGKSGSEWEKKLDSFWQGRLNGQDPLEVLAAKEKMDAAAIEVLDPY  504

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKHPEL LE TSK+REDLY QNYM+
Sbjct  505   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHPELALEQTSKLREDLYTQNYMN  564

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGG PVM       +   +R   E RL+DDRGNRR+           DR  +P S 
Sbjct  565   DPDAPGGKPVMQQPQKDNRPLNQRLGFEGRLRDDRGNRRDHERYDRMNG--DRANSP-SR  621

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + QS      N DE M D+F G G+P   F SDI PPPVLMPVPGAG
Sbjct  622   ERQSKALEMGNHDETMQDTFAGPGVP--PFSSDI-PPPVLMPVPGAG  665


 Score =   113 bits (283),  Expect(2) = 6e-173, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQ-IGGQAPIIALPPSLRQDPRRI  398
            PLGPFVPAPPEVAMQM R+QGGP+ F+G G N   GP  +GG APII LPP  R DPR++
Sbjct  666  PLGPFVPAPPEVAMQMFRDQGGPSSFDGSGINMLSGPHHMGGPAPIITLPPGFRPDPRKM  725

Query  397  RSYQDLDAPEDEVTVIDYRSL  335
            RSYQDLDAP++EVTVIDYRSL
Sbjct  726  RSYQDLDAPDEEVTVIDYRSL  746



>ref|XP_003628125.1| Serrate RNA effector molecule [Medicago truncatula]
Length=745

 Score =   524 bits (1349),  Expect(2) = 6e-173, Method: Compositional matrix adjust.
 Identities = 303/467 (65%), Positives = 350/467 (75%), Gaps = 31/467 (7%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP EAERRYQEYKS YI  QKRAYF AHKDEEWLKDKYHPTN
Sbjct  228   REGLMSYKQFIQELEDDILPTEAERRYQEYKSEYISTQKRAYFSAHKDEEWLKDKYHPTN  287

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTLD  PG++ + S+ +GQ+SEPNS++EA+  D+R
Sbjct  288   LLTVIERRNESARQLAKDFLLDLQSGTLDPNPGLSASLSSKSGQASEPNSEEEAE--DQR  345

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR   G +K +   S APKAHPVSSEPRRI  DV+Q+Q LV KLD+EK I +NIL     
Sbjct  346   RRDGWGSNKKSDF-SAAPKAHPVSSEPRRIQADVQQAQALVRKLDTEKRIGDNIL-----  399

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
                              +I+RGLTSVKGLEG ELL+TL+TYLWRIHGVDYYGMIETNEAK
Sbjct  400   ----------------CIIIRGLTSVKGLEGVELLDTLITYLWRIHGVDYYGMIETNEAK  443

Query  1338  GLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R + K + ET  +G++WE+KLDS W+ RL GQDPLEV+ AKEK+D AA+E L+PY
Sbjct  444   GFRHVRPERKGHEETGKSGSEWEKKLDSFWQGRLNGQDPLEVLAAKEKMDAAAIEVLDPY  503

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKHPEL LE TSK+REDLY QNYM+
Sbjct  504   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHPELALEQTSKLREDLYTQNYMN  563

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGG PVM       +   +R   E RL+DDRGNRR+           DR  +P S 
Sbjct  564   DPDAPGGKPVMQQPQKDNRPLNQRLGFEGRLRDDRGNRRDHERYDRMNG--DRANSP-SR  620

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + QS      N DE M D+F G G+P   F SDI PPPVLMPVPGAG
Sbjct  621   ERQSKALEMGNHDETMQDTFAGPGVP--PFSSDI-PPPVLMPVPGAG  664


 Score =   113 bits (283),  Expect(2) = 6e-173, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-GRNGRQGPQ-IGGQAPIIALPPSLRQDPRRI  398
            PLGPFVPAPPEVAMQM R+QGGP+ F+G G N   GP  +GG APII LPP  R DPR++
Sbjct  665  PLGPFVPAPPEVAMQMFRDQGGPSSFDGSGINMLSGPHHMGGPAPIITLPPGFRPDPRKM  724

Query  397  RSYQDLDAPEDEVTVIDYRSL  335
            RSYQDLDAP++EVTVIDYRSL
Sbjct  725  RSYQDLDAPDEEVTVIDYRSL  745



>ref|XP_010417859.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Camelina 
sativa]
Length=724

 Score =   524 bits (1350),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 315/467 (67%), Positives = 372/467 (80%), Gaps = 8/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+ HK+E+WLK+KYHPTN
Sbjct  187   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNTHKEEDWLKNKYHPTN  246

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERR E ARK+AKDFLLDLQSG LDLGP VT    + + + SEPNS+DEA  G KR
Sbjct  247   LLSVIERRVELARKVAKDFLLDLQSGALDLGPAVTAL--DKSSRPSEPNSEDEAAGGGKR  304

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH R  +K+  LLS APKA   +S+P+RI IDVEQ+Q LV KLDSEKGIEEN+LS S+ 
Sbjct  305   KRHGRWEAKETELLSAAPKAPSFTSDPKRILIDVEQAQALVRKLDSEKGIEENLLSGSET  364

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG  ETNEAK
Sbjct  365   EKSGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKFETNEAK  423

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK  +  + G + E K D  W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  424   GLRHVRAEGKVYD--AKGDESESKFDFHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  481

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  482   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVAELTTKVREELYFQNYMND  541

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P M  S P+++  RR+P +E RL+DDRG RRER+GRVNG +R DR E+ L  D
Sbjct  542   PNAPGGQPAMQQSGPRDRPMRRKPGMEHRLRDDRGGRRERDGRVNGNDRNDRSEDQLGGD  601

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D    NP E  +D+FGG  G+ V  F SDI  PPVLMPVPGAG
Sbjct  602   GDGTDG--GNPVEGRYDAFGGQGGVHVPPFSSDINAPPVLMPVPGAG  646


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 57/83 (69%), Positives = 62/83 (75%), Gaps = 9/83 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQ---IGGQAPIIALPPSLRQDPR  404
            PLGPFVPAPPE AMQM     GP P FEG  +GR GP    +GG AP + L P+ RQDPR
Sbjct  647  PLGPFVPAPPEFAMQMF--PSGPNPSFEG--SGRGGPAPFLLGGPAPFL-LSPAFRQDPR  701

Query  403  RIRSYQDLDAPEDEVTVIDYRSL  335
            R+RSYQDLDAPE EVTVIDYRSL
Sbjct  702  RLRSYQDLDAPEKEVTVIDYRSL  724



>ref|XP_009401472.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=730

 Score =   523 bits (1348),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 302/470 (64%), Positives = 372/470 (79%), Gaps = 11/470 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAE RY+EY+S YI  QK+AYF+AHK+E+WLKDKYHPTN
Sbjct  185   RGGLMSYKQFIQELEDDISPAEAECRYKEYRSEYISTQKQAYFEAHKEEQWLKDKYHPTN  244

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSG LDLGPG T + ++ +G  SEPNS+DEA    KR
Sbjct  245   LVAVIERRKEQARSIAKEFLLDLQSGILDLGPGSTASSASKSGNGSEPNSEDEAGPSGKR  304

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRHDRGP+K+  LLS  PKAHPVSSEPRRI  DVEQ+Q LV KLD EKGI++N+LS S +
Sbjct  305   RRHDRGPAKENELLSATPKAHPVSSEPRRIQSDVEQAQALVRKLDIEKGIQDNVLSSSGH  364

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP +VI+RGL +VKGLEG ELL+TL+TYLWR+HG+DYYGM E +EAK
Sbjct  365   DKLDAEKSHGGSMGP-IVIIRGLATVKGLEGVELLDTLITYLWRVHGLDYYGMSEASEAK  423

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++ +DWE+KLDS W  RL+GQDPLE +TAK+KID AA EALEP+
Sbjct  424   GLRHVRADNKTHDGTNASASDWEKKLDSFWLARLQGQDPLETLTAKDKIDAAATEALEPF  483

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+L +ELTSKVREDLYFQNYM+
Sbjct  484   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLAIELTSKVREDLYFQNYMN  543

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D SAPGGTPVM  S  K K+QRR+  L  RL+D+ GNRR+ +         D   + ++ 
Sbjct  544   DPSAPGGTPVMQQSASKVKIQRRKALLGDRLRDEHGNRRDLDRNHR-----DGDRDDMTG  598

Query  801   DIQSNDDG---GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             +   + +G   G N ++  +D++GG G+   +FPSD+ PPP+L+PVPGAG
Sbjct  599   NSPRDANGAMEGENHEKSPYDTYGGQGL-HGSFPSDVPPPPLLVPVPGAG  647


 Score =   108 bits (269),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 65/84 (77%), Gaps = 6/84 (7%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVA++MLRE GGP+ FE      G  GR GPQ+   API+   P+ R DP
Sbjct  648  PLGPFVPAPPEVAIRMLRETGGPSSFESNGGPRGIKGRLGPQVSVPAPILP-SPAFRHDP  706

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPED+VTVIDYRSL
Sbjct  707  RRIRSYQDLDAPEDDVTVIDYRSL  730



>ref|XP_009401471.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=735

 Score =   523 bits (1348),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 302/470 (64%), Positives = 372/470 (79%), Gaps = 11/470 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDI PAEAE RY+EY+S YI  QK+AYF+AHK+E+WLKDKYHPTN
Sbjct  190   RGGLMSYKQFIQELEDDISPAEAECRYKEYRSEYISTQKQAYFEAHKEEQWLKDKYHPTN  249

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSG LDLGPG T + ++ +G  SEPNS+DEA    KR
Sbjct  250   LVAVIERRKEQARSIAKEFLLDLQSGILDLGPGSTASSASKSGNGSEPNSEDEAGPSGKR  309

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRHDRGP+K+  LLS  PKAHPVSSEPRRI  DVEQ+Q LV KLD EKGI++N+LS S +
Sbjct  310   RRHDRGPAKENELLSATPKAHPVSSEPRRIQSDVEQAQALVRKLDIEKGIQDNVLSSSGH  369

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   +KS+  S GP +VI+RGL +VKGLEG ELL+TL+TYLWR+HG+DYYGM E +EAK
Sbjct  370   DKLDAEKSHGGSMGP-IVIIRGLATVKGLEGVELLDTLITYLWRVHGLDYYGMSEASEAK  428

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T+++ +DWE+KLDS W  RL+GQDPLE +TAK+KID AA EALEP+
Sbjct  429   GLRHVRADNKTHDGTNASASDWEKKLDSFWLARLQGQDPLETLTAKDKIDAAATEALEPF  488

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+L +ELTSKVREDLYFQNYM+
Sbjct  489   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLAIELTSKVREDLYFQNYMN  548

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D SAPGGTPVM  S  K K+QRR+  L  RL+D+ GNRR+ +         D   + ++ 
Sbjct  549   DPSAPGGTPVMQQSASKVKIQRRKALLGDRLRDEHGNRRDLDRNHR-----DGDRDDMTG  603

Query  801   DIQSNDDG---GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             +   + +G   G N ++  +D++GG G+   +FPSD+ PPP+L+PVPGAG
Sbjct  604   NSPRDANGAMEGENHEKSPYDTYGGQGL-HGSFPSDVPPPPLLVPVPGAG  652


 Score =   108 bits (269),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 65/84 (77%), Gaps = 6/84 (7%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVA++MLRE GGP+ FE      G  GR GPQ+   API+   P+ R DP
Sbjct  653  PLGPFVPAPPEVAIRMLRETGGPSSFESNGGPRGIKGRLGPQVSVPAPILP-SPAFRHDP  711

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPED+VTVIDYRSL
Sbjct  712  RRIRSYQDLDAPEDDVTVIDYRSL  735



>ref|XP_006848124.1| hypothetical protein AMTR_s00029p00219930 [Amborella trichopoda]
 gb|ERN09705.1| hypothetical protein AMTR_s00029p00219930 [Amborella trichopoda]
Length=739

 Score =   522 bits (1344),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 313/461 (68%), Positives = 365/461 (79%), Gaps = 11/461 (2%)
 Frame = -1

Query  2061  CREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
              REGL SYKQFIQELEDDILPAEAERRYQEY++ YI  QKR +FDAHK+EEWLKDKYHPT
Sbjct  183   LREGLMSYKQFIQELEDDILPAEAERRYQEYRTEYITTQKRTFFDAHKEEEWLKDKYHPT  242

Query  1881  NLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDK  1702
             NLV+VIERRNE AR  AK+FLLDLQ+GTLDLGP + P  SN  GQ S+ NS+DEAD   K
Sbjct  243   NLVTVIERRNEHARSTAKEFLLDLQNGTLDLGPSINPMASNKAGQGSDQNSEDEADPTGK  302

Query  1701  RRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsd  1522
             RRRH RGP+K+  L S APKAHP++SEPRRI  D+E++  L+ KLD EKGIE ++LS +D
Sbjct  303   RRRHGRGPTKENELFSAAPKAHPIASEPRRIQSDLEEALALLRKLDFEKGIEPHLLSTAD  362

Query  1521  ndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEA  1342
              ++   +K    S GP +VIVRG++ VKGLEG ELL+T+LTYLWR+HGVDYYGM ETNEA
Sbjct  363   QEKQEGEKPRGGSMGP-IVIVRGVSIVKGLEGLELLDTILTYLWRVHGVDYYGMSETNEA  421

Query  1341  KGLRHMRFDGK-NTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEP  1165
             KGLRH+R + K   E +  G +WE+KLDS W+ RL GQDPLEVMTAK+KID AAVEAL+P
Sbjct  422   KGLRHVRGENKGLEEGNGGGLEWEKKLDSFWQGRLHGQDPLEVMTAKDKIDAAAVEALDP  481

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
              VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHL+LKH +LVLELTSKVREDLYFQNYM
Sbjct  482   LVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLRLKHADLVLELTSKVREDLYFQNYM  541

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLE--SRLKDDrgnrr--erngrvngveRFDRPE  817
             SD +APGGTPV+    PK++  RRRP L+  SRL+DDRG+RR  +R  R N  ERFDR E
Sbjct  542   SDANAPGGTPVIQQPGPKDRPPRRRPGLDVSSRLRDDRGSRRDHDRADRANIEERFDRSE  601

Query  816   NPLSSDIQSNDDG--GRNPDEQMFDSF-GGHGIPVAAFPSD  703
             N  S D+Q N  G  G NPD  MFD++ GG G+P   F SD
Sbjct  602   NSPSRDLQPNAGGAEGANPDSPMFDAYGGGQGMP--PFSSD  640


 Score =   129 bits (324),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 71/84 (85%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEG-----GRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVAM+MLREQGGP P+EG     GR GR GP +GG APIIA+ P+ R DP
Sbjct  656  PLGPFVPAPPEVAMRMLREQGGPGPYEGNGGPRGRKGRPGPSVGGPAPIIAVNPAFRHDP  715

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSYQDLDAPEDEVTVIDYRSL
Sbjct  716  RRMRSYQDLDAPEDEVTVIDYRSL  739



>ref|XP_009410216.1| PREDICTED: serrate RNA effector molecule-like [Musa acuminata 
subsp. malaccensis]
Length=724

 Score =   506 bits (1302),  Expect(2) = 9e-171, Method: Compositional matrix adjust.
 Identities = 307/468 (66%), Positives = 375/468 (80%), Gaps = 8/468 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL +YKQFIQELEDDI P EAE RY+EY+S YI  QKRAYF+AHK+++WLKDKYHPTN
Sbjct  179   RGGLMTYKQFIQELEDDISPTEAEYRYEEYRSEYISTQKRAYFEAHKEKQWLKDKYHPTN  238

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERR E+AR +AK+FLLDLQSGTLDLGPG+T + ++ +G  SEPNS+DEA  G KR
Sbjct  239   LVAVIERRKEQARTLAKEFLLDLQSGTLDLGPGLTSSSASKSGNGSEPNSEDEAGPGGKR  298

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG  K+  LLS  PK HPVSSEPRRI +D+EQ+Q LV KLD EKGIE+N+LS S +
Sbjct  299   RRHGRGTEKENDLLSATPKVHPVSSEPRRIQVDIEQAQALVRKLDMEKGIEDNVLSSSGH  358

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              +   +KS+  S GP +VI+RGL ++KGLEG ELL+TL+TYLWR+HG+DYYGM E++EAK
Sbjct  359   GKLEVEKSHGGSMGP-IVIIRGLNAIKGLEGVELLDTLITYLWRVHGLDYYGMSESSEAK  417

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K  + T ++G+DWE+KLDS W+ RL+GQDPLE +TAK+KID AA EAL+P 
Sbjct  418   GLRHVRADNKTHDGTDASGSDWEKKLDSFWQARLEGQDPLETLTAKDKIDAAATEALDPL  477

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKH +LV+ELTSKVREDLYFQNYM+
Sbjct  478   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHLDLVMELTSKVREDLYFQNYMN  537

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S  K K+Q++R  L+ RL+D+RGNRRE N      +R DR +N   S
Sbjct  538   DPNAPGGTPVMQQSASKVKMQKKR-LLDGRLRDERGNRREPNRNDGDDDRHDRTDN---S  593

Query  801   DIQSNDDGG-RNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                +ND     N D+ ++D++GG G+   AFPSDI PPPVLMPVPGAG
Sbjct  594   PRDANDGSEVENHDKPLYDAYGGQGL-HGAFPSDIPPPPVLMPVPGAG  640


 Score =   124 bits (312),  Expect(2) = 9e-171, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGR---NGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPEVAM+MLR+  GP+ FE  GGR    GR GPQ+ G AP++A+PP+ R DP
Sbjct  641  PLGPFVPAPPEVAMRMLRDTSGPSSFEATGGRRGIKGRLGPQVSGSAPVLAMPPAFRHDP  700

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RRIRSYQDLDAPEDEVTVIDYRSL
Sbjct  701  RRIRSYQDLDAPEDEVTVIDYRSL  724



>ref|XP_006293454.1| hypothetical protein CARUB_v10022734mg [Capsella rubella]
 gb|EOA26352.1| hypothetical protein CARUB_v10022734mg [Capsella rubella]
Length=717

 Score =   518 bits (1334),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 308/467 (66%), Positives = 375/467 (80%), Gaps = 8/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+AHK+E+WLK+KYHPTN
Sbjct  188   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNAHKEEDWLKNKYHPTN  247

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIE RNE ARK+AKDFLLDLQSG +DLGP VT    + + ++SEPNS+DEA  G KR
Sbjct  248   LLSVIEGRNELARKVAKDFLLDLQSGAIDLGPAVTAV--DKSSRASEPNSEDEAAGGGKR  305

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH R   K+  LLS AP+A   +S+P+RI  D+EQ+Q LV KLDSEK IEEN+LS S+ 
Sbjct  306   KRHGRWEGKETELLSAAPQAPSFTSDPKRILTDIEQAQALVRKLDSEKRIEENLLSGSET  365

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ET EAK
Sbjct  366   EKSGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKVETTEAK  424

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK+++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  425   GLRHVRAEGKSSD--AKGDENESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  482

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT KVRE+LYFQNYM+D
Sbjct  483   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTIKVREELYFQNYMND  542

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P M  S P+++  RR+PS+E+RL+DDRG RRER+GR NG +R DR E+ +  +
Sbjct  543   PNAPGGQPAMQQSGPRDRPMRRKPSMENRLRDDRGGRRERDGRANGDDRNDRSEDQVRGE  602

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D    NP +  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  603   GDGPDG--GNPGDVGYDAFGGQGGVHVPPFSSDINPPPMLMPVPGAG  647


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 11/80 (14%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM     GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  648  PLGPFVPAPPEFAMQMF--PSGPNPTFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  697

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  698  SYQDLDAPEEEVTVIDYRSL  717



>ref|XP_010544316.1| PREDICTED: serrate RNA effector molecule-like [Tarenaya hassleriana]
Length=739

 Score =   517 bits (1332),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 322/467 (69%), Positives = 387/467 (83%), Gaps = 10/467 (2%)
 Frame = -1

Query  2061  CREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
              REGL SYKQFIQELEDD+LP++AERRYQEYKS YI  QKR +FDAHK+EEWLKDKYHPT
Sbjct  203   AREGLMSYKQFIQELEDDVLPSDAERRYQEYKSEYITTQKRVFFDAHKEEEWLKDKYHPT  262

Query  1881  NLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDK  1702
             NL++VIERRNE A+K+AKDFL DLQ+G LDLGPGVT    +  GQ+SEPNS+DEAD G K
Sbjct  263   NLLTVIERRNELAQKVAKDFLFDLQNGKLDLGPGVTTL--SKPGQTSEPNSEDEADGGGK  320

Query  1701  RRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsd  1522
             RRR  RGP+K+  LL  APKAH VSSEPRR+ +D+EQ+Q LV KLDSEKGIEEN+LS SD
Sbjct  321   RRRRARGPAKENDLLLAAPKAHSVSSEPRRVLVDIEQAQALVRKLDSEKGIEENVLSGSD  380

Query  1521  ndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEA  1342
              ++  RDK +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYGMIETNEA
Sbjct  381   KEKSGRDKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGMIETNEA  439

Query  1341  KGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             KGLRH+R +GK  ++  +  +WE+KLDSRW++RLKGQDP+EVM AKEKI+ AAVE L+P+
Sbjct  440   KGLRHVRAEGKGLDSKED--EWEKKLDSRWQDRLKGQDPMEVMAAKEKIEAAAVEVLDPH  497

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP+LV+ELT+KVRE+LYFQNYM+
Sbjct  498   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPDLVMELTAKVREELYFQNYMN  557

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGG PVM    P+++  RR+P +E+RL+ D   RR+R+GR N  +RFDR +NP   
Sbjct  558   DPNAPGGQPVM--QQPRDRPFRRKPGIENRLR-DDRGRRDRDGRANVNDRFDRSDNPQPG  614

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             +  + D  G NPDE  +D+FG  G+ V  F SDI PPPVLMPVPGAG
Sbjct  615   EGDAPD--GCNPDEAGYDAFGEQGVHVPPFSSDIPPPPVLMPVPGAG  659


 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQ-IGGQAPIIALPPSLRQDPRRI  398
            PLGPF+PAPPEVAMQM R+Q GP P FEG   G +    +GG AP + L PS RQDPRR+
Sbjct  660  PLGPFIPAPPEVAMQMFRDQSGPPPPFEGSGRGGRSGPPLGGPAPFL-LQPSFRQDPRRL  718

Query  397  RSYQDLDAPEDEVTVIDYRSL  335
            RSYQDLDAPE+EVTVIDYRSL
Sbjct  719  RSYQDLDAPEEEVTVIDYRSL  739



>ref|XP_006585692.1| PREDICTED: serrate RNA effector molecule-like isoform X4 [Glycine 
max]
Length=710

 Score =   510 bits (1314),  Expect(2) = 7e-170, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 366/468 (78%), Gaps = 17/468 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  179   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  238

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE AR++AKDFLLDLQSGTL+L PG+  + S  +GQ+SEPNS++EAD G KR
Sbjct  239   LVTVIERRNENARQLAKDFLLDLQSGTLELNPGLNASISK-SGQASEPNSEEEADTGGKR  297

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+    S APKAHP+S+EPRRI  DV+Q+Q LV KLD+EKGIE+NIL  SD+
Sbjct  298   RRQGRGSNKENDF-SAAPKAHPISTEPRRIQADVQQAQALVRKLDTEKGIEDNILCISDH  356

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +R      ++S +   +VI+RGLTSVKGLEG ELL+TL+TYLW+IHGVDYYGMIETNEAK
Sbjct  357   NRNDDKAHSASVAP--IVIIRGLTSVKGLEGDELLDTLVTYLWQIHGVDYYGMIETNEAK  414

Query  1338  GLRHMRFDGKNTETSS--NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEP  1165
             G RH+R +G   E  +  +G++WE+KLD  W+ RL GQDPLEVMTAKEKID AA+E L+P
Sbjct  415   GFRHVRPEGTAHEVVAGKSGSEWEKKLDLFWQGRLNGQDPLEVMTAKEKIDAAAMEVLDP  474

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YVRKIRDEKYGWKYGCGA GCTKLFHA EFV KHLKLKHPELV+E TSKVREDLYFQNYM
Sbjct  475   YVRKIRDEKYGWKYGCGAMGCTKLFHATEFVLKHLKLKHPELVVEQTSKVREDLYFQNYM  534

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D+ APGG P+M        L+RR   LE RL+DDRGNRR+ +         DRP+N  S
Sbjct  535   NDKDAPGGMPIMQQPQKGRPLKRR--GLEGRLRDDRGNRRDHDQSDRMNG--DRPDNSPS  590

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              +         N DE M+DS+ G G+P   F SDI PPPVLMPVPGAG
Sbjct  591   HEAMMG-----NRDETMYDSYAGPGVP--PFASDIPPPPVLMPVPGAG  631


 Score =   117 bits (293),  Expect(2) = 7e-170, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQMLR+QGG +    GR    GP +GG + IIA+PP+ R DPRR+RS
Sbjct  632  PLGPFVPAPPEVAMQMLRDQGGSSYDASGRKMHSGPPMGGGSSIIAVPPTFRPDPRRMRS  691

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  692  YQDLDAPEDEVTVIDYRSL  710



>ref|XP_006293453.1| hypothetical protein CARUB_v10022733mg [Capsella rubella]
 gb|EOA26351.1| hypothetical protein CARUB_v10022733mg [Capsella rubella]
Length=718

 Score =   516 bits (1330),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 312/467 (67%), Positives = 373/467 (80%), Gaps = 12/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRA+F+ HK+EEWLK+KYHPTN
Sbjct  191   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEEWLKNKYHPTN  250

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRN+ ARK+AKDFLLDLQ G LDLGP VT    N +GQ++E NSDDEA AG KR
Sbjct  251   LLSVIERRNDLARKVAKDFLLDLQGGALDLGPAVTAL--NKSGQATEQNSDDEA-AGGKR  307

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RHDR    D    S APKA   +S+P+RI  D+EQ+Q LV KLDSEK IEEN+LS S+ 
Sbjct  308   KRHDRANEAD---FSAAPKAPSFTSDPKRILTDIEQAQALVRKLDSEKRIEENLLSGSET  364

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RDK +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG++ETNEAK
Sbjct  365   EKSGRDKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGLVETNEAK  423

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  424   GLRHVRAEGKGSD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  481

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  482   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMND  541

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P    S P+++  RR+P +E+RL+DDRG RRER+GR NG +R DR ++    +
Sbjct  542   PNAPGGQPATQQSGPRDRPMRRKPGMENRLRDDRGGRRERDGRANGNDRNDRSDDRQRGE  601

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D    NP E  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  602   GDGPDG--GNPGEVGYDAFGGQGGVHVPPFLSDINPPPMLMPVPGAG  646


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  647  PLGPFVPAPPEVAMQMFRDPSGPNPPFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  698

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  699  SYQDLDAPEEEVTVIDYRSL  718



>gb|KHN38122.1| Serrate RNA effector molecule [Glycine soja]
Length=707

 Score =   510 bits (1314),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 368/468 (79%), Gaps = 18/468 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  44    REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  103

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE AR++AKDFLLDLQSGTL+L PG+  + S  +GQ+SEPNS++EAD G KR
Sbjct  104   LVTVIERRNENARQLAKDFLLDLQSGTLELNPGLNASISK-SGQASEPNSEEEADTGGKR  162

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+    S APKAHP+S+EPRRI  DV+Q+Q LV KLD+EKGIE+NIL  SD+
Sbjct  163   RRQGRGSNKENDF-SAAPKAHPISTEPRRIQADVQQAQALVRKLDTEKGIEDNILCISDH  221

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +R      ++S +   +VI+RGLTSVKGLEG ELL+TL+TYLW+IHGVDYYGMIETNEAK
Sbjct  222   NRNDDKAHSASVAP--IVIIRGLTSVKGLEGDELLDTLVTYLWQIHGVDYYGMIETNEAK  279

Query  1338  GLRHMRFDGKNTETSS--NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEP  1165
             G RH+R +G   E  +  +G++WE+KLD  W+ RL GQDPLEVMTAKEKID AA+E L+P
Sbjct  280   GFRHVRPEGTAHEVVAGKSGSEWEKKLDLFWQGRLNGQDPLEVMTAKEKIDAAAMEVLDP  339

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YVRKIRDEKYGWKYGCGA GCTKLFHA EFV KHLKLKHPELV+E TSKVREDLYFQNYM
Sbjct  340   YVRKIRDEKYGWKYGCGAMGCTKLFHATEFVLKHLKLKHPELVVEQTSKVREDLYFQNYM  399

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D+ APGG P+M    P+ +  +RR  LE RL+DDRGNRR+ +         DRP+N  S
Sbjct  400   NDKDAPGGMPIM--QQPQGRPLKRR-VLEGRLRDDRGNRRDHDQSDRMNG--DRPDNSPS  454

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              +         N DE M+DS+ G G+P   F SDI PPPVLMPVPGAG
Sbjct  455   HEAMMG-----NRDETMYDSYAGPGVP--PFASDIPPPPVLMPVPGAG  495


 Score =   116 bits (291),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQMLR+QGG +    GR    GP +GG + IIA+PP+ R DPRR+RS
Sbjct  496  PLGPFVPAPPEVAMQMLRDQGGSSYDASGRKMHSGPPMGGGSSIIAVPPTFRPDPRRMRS  555

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRS 
Sbjct  556  YQDLDAPEDEVTVIDYRSF  574



>ref|XP_003530368.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Glycine 
max]
Length=717

 Score =   509 bits (1312),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 366/468 (78%), Gaps = 17/468 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  186   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  245

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE AR++AKDFLLDLQSGTL+L PG+  + S  +GQ+SEPNS++EAD G KR
Sbjct  246   LVTVIERRNENARQLAKDFLLDLQSGTLELNPGLNASISK-SGQASEPNSEEEADTGGKR  304

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+    S APKAHP+S+EPRRI  DV+Q+Q LV KLD+EKGIE+NIL  SD+
Sbjct  305   RRQGRGSNKENDF-SAAPKAHPISTEPRRIQADVQQAQALVRKLDTEKGIEDNILCISDH  363

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +R      ++S +   +VI+RGLTSVKGLEG ELL+TL+TYLW+IHGVDYYGMIETNEAK
Sbjct  364   NRNDDKAHSASVAP--IVIIRGLTSVKGLEGDELLDTLVTYLWQIHGVDYYGMIETNEAK  421

Query  1338  GLRHMRFDGKNTETSS--NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEP  1165
             G RH+R +G   E  +  +G++WE+KLD  W+ RL GQDPLEVMTAKEKID AA+E L+P
Sbjct  422   GFRHVRPEGTAHEVVAGKSGSEWEKKLDLFWQGRLNGQDPLEVMTAKEKIDAAAMEVLDP  481

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YVRKIRDEKYGWKYGCGA GCTKLFHA EFV KHLKLKHPELV+E TSKVREDLYFQNYM
Sbjct  482   YVRKIRDEKYGWKYGCGAMGCTKLFHATEFVLKHLKLKHPELVVEQTSKVREDLYFQNYM  541

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D+ APGG P+M        L+RR   LE RL+DDRGNRR+ +         DRP+N  S
Sbjct  542   NDKDAPGGMPIMQQPQKGRPLKRR--GLEGRLRDDRGNRRDHDQSDRMNG--DRPDNSPS  597

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              +         N DE M+DS+ G G+P   F SDI PPPVLMPVPGAG
Sbjct  598   HEAMMG-----NRDETMYDSYAGPGVP--PFASDIPPPPVLMPVPGAG  638


 Score =   117 bits (292),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQMLR+QGG +    GR    GP +GG + IIA+PP+ R DPRR+RS
Sbjct  639  PLGPFVPAPPEVAMQMLRDQGGSSYDASGRKMHSGPPMGGGSSIIAVPPTFRPDPRRMRS  698

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  699  YQDLDAPEDEVTVIDYRSL  717



>ref|XP_006585691.1| PREDICTED: serrate RNA effector molecule-like isoform X3 [Glycine 
max]
Length=711

 Score =   509 bits (1311),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 366/468 (78%), Gaps = 17/468 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  180   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  239

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE AR++AKDFLLDLQSGTL+L PG+  + S  +GQ+SEPNS++EAD G KR
Sbjct  240   LVTVIERRNENARQLAKDFLLDLQSGTLELNPGLNASISK-SGQASEPNSEEEADTGGKR  298

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+    S APKAHP+S+EPRRI  DV+Q+Q LV KLD+EKGIE+NIL  SD+
Sbjct  299   RRQGRGSNKENDF-SAAPKAHPISTEPRRIQADVQQAQALVRKLDTEKGIEDNILCISDH  357

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +R      ++S +   +VI+RGLTSVKGLEG ELL+TL+TYLW+IHGVDYYGMIETNEAK
Sbjct  358   NRNDDKAHSASVAP--IVIIRGLTSVKGLEGDELLDTLVTYLWQIHGVDYYGMIETNEAK  415

Query  1338  GLRHMRFDGKNTETSS--NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEP  1165
             G RH+R +G   E  +  +G++WE+KLD  W+ RL GQDPLEVMTAKEKID AA+E L+P
Sbjct  416   GFRHVRPEGTAHEVVAGKSGSEWEKKLDLFWQGRLNGQDPLEVMTAKEKIDAAAMEVLDP  475

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YVRKIRDEKYGWKYGCGA GCTKLFHA EFV KHLKLKHPELV+E TSKVREDLYFQNYM
Sbjct  476   YVRKIRDEKYGWKYGCGAMGCTKLFHATEFVLKHLKLKHPELVVEQTSKVREDLYFQNYM  535

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D+ APGG P+M        L+RR   LE RL+DDRGNRR+ +         DRP+N  S
Sbjct  536   NDKDAPGGMPIMQQPQKGRPLKRR--GLEGRLRDDRGNRRDHDQSDRMNG--DRPDNSPS  591

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              +         N DE M+DS+ G G+P   F SDI PPPVLMPVPGAG
Sbjct  592   HEAMMG-----NRDETMYDSYAGPGVP--PFASDIPPPPVLMPVPGAG  632


 Score =   117 bits (292),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQMLR+QGG +    GR    GP +GG + IIA+PP+ R DPRR+RS
Sbjct  633  PLGPFVPAPPEVAMQMLRDQGGSSYDASGRKMHSGPPMGGGSSIIAVPPTFRPDPRRMRS  692

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  693  YQDLDAPEDEVTVIDYRSL  711



>ref|XP_006585690.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Glycine 
max]
Length=716

 Score =   509 bits (1311),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 366/468 (78%), Gaps = 17/468 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEYKS YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  185   REGLMSYKQFIQELEDDILPAEAERRYQEYKSEYISTQKRAYFNAHKDEEWLKDKYHPTN  244

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LV+VIERRNE AR++AKDFLLDLQSGTL+L PG+  + S  +GQ+SEPNS++EAD G KR
Sbjct  245   LVTVIERRNENARQLAKDFLLDLQSGTLELNPGLNASISK-SGQASEPNSEEEADTGGKR  303

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+    S APKAHP+S+EPRRI  DV+Q+Q LV KLD+EKGIE+NIL  SD+
Sbjct  304   RRQGRGSNKENDF-SAAPKAHPISTEPRRIQADVQQAQALVRKLDTEKGIEDNILCISDH  362

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             +R      ++S +   +VI+RGLTSVKGLEG ELL+TL+TYLW+IHGVDYYGMIETNEAK
Sbjct  363   NRNDDKAHSASVAP--IVIIRGLTSVKGLEGDELLDTLVTYLWQIHGVDYYGMIETNEAK  420

Query  1338  GLRHMRFDGKNTETSS--NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEP  1165
             G RH+R +G   E  +  +G++WE+KLD  W+ RL GQDPLEVMTAKEKID AA+E L+P
Sbjct  421   GFRHVRPEGTAHEVVAGKSGSEWEKKLDLFWQGRLNGQDPLEVMTAKEKIDAAAMEVLDP  480

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YVRKIRDEKYGWKYGCGA GCTKLFHA EFV KHLKLKHPELV+E TSKVREDLYFQNYM
Sbjct  481   YVRKIRDEKYGWKYGCGAMGCTKLFHATEFVLKHLKLKHPELVVEQTSKVREDLYFQNYM  540

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D+ APGG P+M        L+RR   LE RL+DDRGNRR+ +         DRP+N  S
Sbjct  541   NDKDAPGGMPIMQQPQKGRPLKRR--GLEGRLRDDRGNRRDHDQSDRMNG--DRPDNSPS  596

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
              +         N DE M+DS+ G G+P   F SDI PPPVLMPVPGAG
Sbjct  597   HEAMMG-----NRDETMYDSYAGPGVP--PFASDIPPPPVLMPVPGAG  637


 Score =   117 bits (292),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQMLR+QGG +    GR    GP +GG + IIA+PP+ R DPRR+RS
Sbjct  638  PLGPFVPAPPEVAMQMLRDQGGSSYDASGRKMHSGPPMGGGSSIIAVPPTFRPDPRRMRS  697

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPEDEVTVIDYRSL
Sbjct  698  YQDLDAPEDEVTVIDYRSL  716



>ref|XP_004511156.1| PREDICTED: serrate RNA effector molecule-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   516 bits (1329),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 289/446 (65%), Positives = 352/446 (79%), Gaps = 9/446 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY+S YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  206   REGLMSYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRAYFNAHKDEEWLKDKYHPTN  265

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSG LDL PG++ + S+  GQ+SEPNS++E DAG KR
Sbjct  266   LLTVIERRNESARQLAKDFLLDLQSGALDLNPGLSASSSSKLGQASEPNSEEEEDAGGKR  325

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH +G +K+   L+ APKA+P+SSEPRRI  D++Q+Q LV KLD EK IE+NIL  SD+
Sbjct  326   RRHGKGWNKENDFLA-APKANPISSEPRRIQTDIQQAQALVRKLDREKKIEDNILCSSDH  384

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++      + S      VI+RGLTSVKGLEG ELL+T +TYLWRIHGVDYYGMIETNEAK
Sbjct  385   NKNDDKAHSGSVGP--TVIIRGLTSVKGLEGVELLDTFITYLWRIHGVDYYGMIETNEAK  442

Query  1338  GLRHMRFD-GKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +   + ET  +G++WE+KLDS W+ RL GQDPLE+MTAK+KID AAVE L+PY
Sbjct  443   GFRHVRPERTGHGETGKSGSEWEKKLDSFWQSRLNGQDPLEIMTAKDKIDAAAVEILDPY  502

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKHPEL++E TSK+ +DLY QNYM 
Sbjct  503   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHPELLVEQTSKLCDDLYIQNYMH  562

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGG PVM    P+++  ++R  LE RL+DDRGNRR+        +  DRP++P   
Sbjct  563   DPDAPGGKPVM--QQPQDRPLKQRLGLEGRLRDDRGNRRDHERNDIINDG-DRPDSPSRE  619

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIP  724
               ++ + G  N DE M+D++ G G+P
Sbjct  620   RPKALEMG--NHDETMYDTYAGPGVP  643


 Score =   114 bits (286),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQM REQG P+    GR  R G  +GG  PIIA+PP+ R DPR++RS
Sbjct  662  PLGPFVPAPPEVAMQMFREQGQPSYDPSGRKMRSGTHMGGPTPIIAVPPAFRPDPRQMRS  721

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAP+DEVTVIDYRSL
Sbjct  722  YQDLDAPDDEVTVIDYRSL  740



>ref|XP_006408663.1| hypothetical protein EUTSA_v10001919mg [Eutrema salsugineum]
 gb|ESQ50116.1| hypothetical protein EUTSA_v10001919mg [Eutrema salsugineum]
Length=716

 Score =   514 bits (1324),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 309/473 (65%), Positives = 375/473 (79%), Gaps = 15/473 (3%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+ HK+EEWLKDKYH
Sbjct  183   STQRDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNTHKEEEWLKDKYH  242

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL+SVIERRNE ARK+AKDFLLDLQSGTLDLGP VT    N +G++SEPNS+DEA  G
Sbjct  243   PTNLLSVIERRNELARKVAKDFLLDLQSGTLDLGPAVTSL--NKSGRTSEPNSEDEAANG  300

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
              KR+R  +G +K+    S APKA   +S+P+RI  D++Q+Q LV KLD+EKGI EN+LS 
Sbjct  301   GKRKRPGKGGAKEIEH-SAAPKAPSFTSDPKRILTDIDQAQALVRKLDTEKGIVENVLSG  359

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             S++++  RDK  + S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETN
Sbjct  360   SESEKSGRDKLPTGSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGVDYYGKVETN  418

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             E+KGLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA+E L+
Sbjct  419   ESKGLRHVRAEGKGSD--AEGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAALEVLD  476

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV++LT KVRE+LYFQNY
Sbjct  477   PHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVVDLTGKVREELYFQNY  536

Query  987   MSDESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
              SD +APGG P    S P+++ + RR+P +E+RL+DDRG RRER+GR NG +R DR    
Sbjct  537   TSDPNAPGGQPATQQSGPRDRPMMRRKPGMENRLRDDRGGRRERDGRANGNDRVDR----  592

Query  810   LSSDIQSNDDGGRNPDEQ--MFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
              S D Q  D  G N   Q   +++FGG  G+ V  + SDI PPPVLMPVPGAG
Sbjct  593   -SEDQQRGDGDGPNGANQEGGYEAFGGQAGVHVPPYSSDINPPPVLMPVPGAG  644


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM R+  GP P FEG  +GR     GG AP + + P+ RQDPRR+R
Sbjct  645  PLGPFVPAPPEFAMQMFRDPSGPNPSFEG--SGR-----GGAAPFL-MSPAFRQDPRRLR  696

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  697  SYQDLDAPEEEVTVIDYRSL  716



>ref|XP_010473102.1| PREDICTED: serrate RNA effector molecule-like [Camelina sativa]
Length=710

 Score =   513 bits (1321),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 312/467 (67%), Positives = 371/467 (79%), Gaps = 12/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+ HK+E+WLK+KY+PTN
Sbjct  185   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNTHKEEDWLKNKYYPTN  244

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK+AKDFLLDLQ G LDLGP VTP   + + + SE NS+DE+ AG KR
Sbjct  245   LLSVIERRNELARKVAKDFLLDLQRGALDLGPAVTPL--DKSSRPSEQNSEDES-AGGKR  301

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RHDR  +K+A LLS APKA    S P+RI  D+EQ+Q LV KLDSEK IEEN+L+ S+ 
Sbjct  302   KRHDRVGAKEADLLSAAPKAPSFISHPKRILTDIEQAQALVHKLDSEKRIEENLLTSSET  361

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETNEAK
Sbjct  362   DKSGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKVETNEAK  420

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK  +  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  421   GLRHVRAEGKGYD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  478

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  479   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHIELVAELTTKVREELYFQNYMND  538

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P M    P+++  RR+P +E RL+DDRG RRER+GR NG +R DR E+ L  D
Sbjct  539   PNAPGGQPAM---GPRDRPMRRKPGMEHRLRDDRGGRRERDGRANGNDRNDRSEDQLGGD  595

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D    NP E  +D+FGG  G+ V  F SDI  PPVLMPVPGAG
Sbjct  596   GDGTDG--GNPVEGRYDAFGGQGGVHVPPFSSDINAPPVLMPVPGAG  640


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 60/80 (75%), Gaps = 11/80 (14%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM     GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  641  PLGPFVPAPPEFAMQMF--PSGPNPSFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  690

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  691  SYQDLDAPEEEVTVIDYRSL  710



>ref|XP_004511155.1| PREDICTED: serrate RNA effector molecule-like isoform X1 [Cicer 
arietinum]
Length=741

 Score =   514 bits (1324),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 289/446 (65%), Positives = 351/446 (79%), Gaps = 8/446 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILPAEAERRYQEY+S YI  QKRAYF+AHKDEEWLKDKYHPTN
Sbjct  206   REGLMSYKQFIQELEDDILPAEAERRYQEYRSEYISTQKRAYFNAHKDEEWLKDKYHPTN  265

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSG LDL PG++ + S+  GQ+SEPNS++E DAG KR
Sbjct  266   LLTVIERRNESARQLAKDFLLDLQSGALDLNPGLSASSSSKLGQASEPNSEEEEDAGGKR  325

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH +G +K+   L+ APKA+P+SSEPRRI  D++Q+Q LV KLD EK IE+NIL  SD+
Sbjct  326   RRHGKGWNKENDFLA-APKANPISSEPRRIQTDIQQAQALVRKLDREKKIEDNILCSSDH  384

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++      + S      VI+RGLTSVKGLEG ELL+T +TYLWRIHGVDYYGMIETNEAK
Sbjct  385   NKNDDKAHSGSVGP--TVIIRGLTSVKGLEGVELLDTFITYLWRIHGVDYYGMIETNEAK  442

Query  1338  GLRHMRFD-GKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +   + ET  +G++WE+KLDS W+ RL GQDPLE+MTAK+KID AAVE L+PY
Sbjct  443   GFRHVRPERTGHGETGKSGSEWEKKLDSFWQSRLNGQDPLEIMTAKDKIDAAAVEILDPY  502

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKHPEL++E TSK+ +DLY QNYM 
Sbjct  503   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHPELLVEQTSKLCDDLYIQNYMH  562

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGG PVM     K++  ++R  LE RL+DDRGNRR+        +  DRP++P   
Sbjct  563   DPDAPGGKPVMQQPQ-KDRPLKQRLGLEGRLRDDRGNRRDHERNDIINDG-DRPDSPSRE  620

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIP  724
               ++ + G  N DE M+D++ G G+P
Sbjct  621   RPKALEMG--NHDETMYDTYAGPGVP  644


 Score =   114 bits (286),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQM REQG P+    GR  R G  +GG  PIIA+PP+ R DPR++RS
Sbjct  663  PLGPFVPAPPEVAMQMFREQGQPSYDPSGRKMRSGTHMGGPTPIIAVPPAFRPDPRQMRS  722

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAP+DEVTVIDYRSL
Sbjct  723  YQDLDAPDDEVTVIDYRSL  741



>ref|XP_010510811.1| PREDICTED: serrate RNA effector molecule-like [Camelina sativa]
Length=719

 Score =   513 bits (1322),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 312/467 (67%), Positives = 376/467 (81%), Gaps = 10/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYK+ YI  QKRAYF+ HK+EEWLK+KYHPTN
Sbjct  190   RDGLMSYKQFIQELEDDILPSEAERRYQEYKAEYITTQKRAYFNTHKEEEWLKNKYHPTN  249

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRN+ ARK+AKD LLDLQSG LDLGP VT    N + Q+SE NS+DE+ AG KR
Sbjct  250   LLSVIERRNDLARKVAKDLLLDLQSGALDLGPAVTAL--NKSSQTSEQNSEDES-AGGKR  306

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RHDR  +K+A L S APKA   +S+P+RI  D+EQ+Q LV KLDSEK IEEN+LS S++
Sbjct  307   KRHDRVGAKEADL-SAAPKAPSFTSDPKRILTDIEQAQALVRKLDSEKRIEENLLSGSES  365

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETNEAK
Sbjct  366   EKTDREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKVETNEAK  424

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  425   GLRHVRAEGKVSD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  482

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNYM+D
Sbjct  483   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYMND  542

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P    S P+++  RR+P +E+RL+DDRG RRER+GR NG +R DR E+     
Sbjct  543   PNAPGGQPATQQSGPRDRPMRRKPGMENRLRDDRGGRRERDGRNNGNDRNDRSED--QQR  600

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                +   G NP E  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  601   GDGDGPDGGNPGEGGYDAFGGQAGVHVPPFLSDINPPPMLMPVPGAG  647


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  648  PLGPFVPAPPEVAMQMFRDPSGPNPPFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  699

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  700  SYQDLDAPEEEVTVIDYRSL  719



>ref|XP_006408653.1| hypothetical protein EUTSA_v10001921mg [Eutrema salsugineum]
 gb|ESQ50106.1| hypothetical protein EUTSA_v10001921mg [Eutrema salsugineum]
Length=715

 Score =   513 bits (1321),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 307/468 (66%), Positives = 374/468 (80%), Gaps = 11/468 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F+ HK+EEWLKDKYHPTN
Sbjct  185   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNTHKEEEWLKDKYHPTN  244

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK+AKDFLLDLQ+GT+DLGP VT    N +G++SEPNS+DEA  G KR
Sbjct  245   LLSVIERRNELARKVAKDFLLDLQNGTVDLGPAVTSL--NKSGRTSEPNSEDEAANGGKR  302

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +R  +G SK+    S APKA   +S+P+RI  D++Q+Q LV KLD+EKGI EN+LS S++
Sbjct  303   KRPGKGGSKETEH-SAAPKAPSFTSDPKRILTDIDQAQALVRKLDTEKGIVENVLSGSES  361

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RDK  + S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETNEAK
Sbjct  362   EKSGRDKLPTGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKVETNEAK  420

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKG DPLEVM AKEKID AA+E L+P+V
Sbjct  421   GLRHVRAEGKGSD--AKGDESESKFDSHWKERLKGLDPLEVMAAKEKIDAAALEVLDPHV  478

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV++LT KVRE+LYFQNYMSD
Sbjct  479   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVVDLTGKVREELYFQNYMSD  538

Query  978   ESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
              +APGG P    S P+++ + RR+P +E+RL+DDRG RRER+GR NG +R DR E+    
Sbjct  539   PNAPGGQPATQQSGPRDRPMMRRKPGMENRLRDDRGGRRERDGRANGNDRVDRSEDQQRG  598

Query  801   DIQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
             D    D  G N  E  +++FGG  G+ V  + SDI PPPVLMPVPGAG
Sbjct  599   DGDGPD--GAN-QEGGYEAFGGQAGVHVPPYSSDINPPPVLMPVPGAG  643


 Score = 97.8 bits (242),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 62/80 (78%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM R+  GP P FEG  +GR     GG AP + + P+ RQDPRR+R
Sbjct  644  PLGPFVPAPPEFAMQMFRDPSGPNPSFEG--SGR-----GGAAPFL-MSPAFRQDPRRLR  695

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  696  SYQDLDAPEEEVTVIDYRSL  715



>ref|XP_010417856.1| PREDICTED: serrate RNA effector molecule [Camelina sativa]
Length=720

 Score =   512 bits (1319),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 309/467 (66%), Positives = 371/467 (79%), Gaps = 10/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRAYF+ HK+EEWLK+KYHPTN
Sbjct  191   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAYFNTHKEEEWLKNKYHPTN  250

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRN+ ARK+AKDFLLDLQSG LDLGP VT    N + Q+SE NS+DE+ AG KR
Sbjct  251   LLSVIERRNDLARKVAKDFLLDLQSGALDLGPAVTAL--NKSSQTSEQNSEDES-AGGKR  307

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RHDR  +K+  LLS APKA   +S+P+RI  D+EQ+  LV KLDSEK IEEN+LS S+ 
Sbjct  308   KRHDRVGAKETDLLSAAPKAPSFASDPKRILTDIEQAHALVRKLDSEKRIEENLLSGSET  367

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYG +ETNEAK
Sbjct  368   EKSGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGKVETNEAK  426

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  427   GLRHVRAEGKVSD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  484

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNY++D
Sbjct  485   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYIND  544

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P    S P++   RR+P +E+RL+DDRG RRER+GR NG +R DR E+    D
Sbjct  545   PNAPGGQPATQQSGPRDGPVRRKPGMENRLRDDRGGRRERDGRANGNDRNDRSEDQQRGD  604

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                 D          +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  605   GDGPDG---GNPGGGYDAFGGQAGVHVPPFLSDINPPPMLMPVPGAG  648


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  649  PLGPFVPAPPEVAMQMFRDPSGPNPPFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  700

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  701  SYQDLDAPEEEVTVIDYRSL  720



>gb|EMT02783.1| Serrate RNA effector molecule [Aegilops tauschii]
Length=604

 Score =   507 bits (1305),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 291/476 (61%), Positives = 356/476 (75%), Gaps = 15/476 (3%)
 Frame = -1

Query  2082  YPCVVSFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWL  1903
             +  V    REGL +YKQFIQ LEDD+ PAEAE RYQEYK+ YI  QKRAYFD HK+E+WL
Sbjct  58    FLIVEGIRREGLMTYKQFIQVLEDDVSPAEAESRYQEYKTEYITTQKRAYFDLHKNEDWL  117

Query  1902  KDKYHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDD  1723
             KDKYHPTNL+SVIERRNER + +AKDF LDLQ+GTLDLGPG+  + +N +   ++ NS+D
Sbjct  118   KDKYHPTNLLSVIERRNERCKVVAKDFFLDLQNGTLDLGPGIIASAANKSENGNDGNSED  177

Query  1722  EADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEE  1543
             +AD GDKRR+  RG SK+   LS APKAHPVSSEPRRI  D+E++  LV +LD+EKGI+ 
Sbjct  178   DAD-GDKRRKQSRGSSKETDPLSAAPKAHPVSSEPRRIQTDIERTLGLVRRLDTEKGIQG  236

Query  1542  NILsrsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYG  1363
             N+LS  D+++   DKS+  S GP+V IVRGLT+VKGLEG ELL+TLLTYLWRIHGVDYYG
Sbjct  237   NVLSSGDHEKSDVDKSHMGSMGPIV-IVRGLTTVKGLEGVELLDTLLTYLWRIHGVDYYG  295

Query  1362  MIETNEAKGLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTA  1186
             M ETNEAKGLRH+R D K   T++ N ADWE+KLD+ W+ERL GQDP+ ++TAK+KID A
Sbjct  296   MSETNEAKGLRHVRTDNKTPSTTNINAADWEKKLDTYWQERLTGQDPMVILTAKDKIDAA  355

Query  1185  AVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVRED  1006
             A E LEP+VRKIRDEKYGWKYGCGAKGCTKLFHA EFV+KHL+LKHPE+VLE+TS +RED
Sbjct  356   AAEVLEPHVRKIRDEKYGWKYGCGAKGCTKLFHAPEFVYKHLRLKHPEIVLEVTSNLRED  415

Query  1005  LYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFD  826
             +Y QNYMSD +APGGTPVM  S   +  +R    ++SRL+ D                +D
Sbjct  416   IYSQNYMSDPNAPGGTPVMQQSAADKSRRRSDNGMDSRLRYD----------RGNRREYD  465

Query  825   RPENPLSSDIQSNDDGGRN-PDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             R +       + +    R+ PD QMFDSF G G   A F ++   PP+LMPVPGAG
Sbjct  466   RADRDGGRHGRGDGSPSRDGPDNQMFDSFRGRG-SNAPFSAEFPAPPILMPVPGAG  520


 Score =   108 bits (271),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 66/85 (78%), Gaps = 7/85 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQ-APIIALPPSLRQD  410
            PLGPFVPAPPE+AM MLREQG P+PFE      G +G  G  +GG  APIIA+PPS   D
Sbjct  521  PLGPFVPAPPEIAMHMLREQG-PSPFEPNGGPHGNSGVLGSMMGGGPAPIIAMPPSFHHD  579

Query  409  PRRIRSYQDLDAPEDEVTVIDYRSL  335
            PRR+RSY DLDAP++EVTV+DYRSL
Sbjct  580  PRRLRSYNDLDAPDEEVTVLDYRSL  604



>gb|KFK32423.1| hypothetical protein AALP_AA6G240000 [Arabis alpina]
Length=697

 Score =   510 bits (1313),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 314/468 (67%), Positives = 376/468 (80%), Gaps = 9/468 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS Y+  QKR YF+ HK+EEWLK+KYHPTN
Sbjct  165   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYVTTQKRVYFNTHKEEEWLKNKYHPTN  224

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK+AKDFLLDLQSG LDLGP +T    N +G +SEPNS+DEA  G KR
Sbjct  225   LLSVIERRNELARKVAKDFLLDLQSGALDLGPALTAV--NKSGLTSEPNSEDEAADGGKR  282

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  RG +K+  L+S APKA   +S+P+RI  D+EQ+Q LV KLD+EKGIEEN+LS S+N
Sbjct  283   RRPGRGEAKETELVSAAPKAPSFTSDPKRIITDIEQAQALVRKLDAEKGIEENVLSGSEN  342

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++ SR+KS+S SSGPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG IET EAK
Sbjct  343   EKSSREKSHSGSSGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKIETKEAK  401

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             GLRH+R +G  ++  S G + E K DS W+ERLKGQDPLEVM AKEKID  A+E L+P+V
Sbjct  402   GLRHVRAEGSGSD--SKGDESETKFDSYWQERLKGQDPLEVMAAKEKIDAVAIEVLDPHV  459

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKH+KLKH ELV++LT KVRE++YFQNYM+D
Sbjct  460   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHIKLKHSELVVDLTGKVREEVYFQNYMND  519

Query  978   ESAPGGTPVMLSSLPKE-KLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
              +APGG P    S P++ +  RR+P +E+RL+DDRG RRER+GR NG +R DR E+    
Sbjct  520   PNAPGGQPATQQSGPRDNRPLRRKPGMENRLRDDRGGRRERDGRANGNDRMDRLEDQQRG  579

Query  801   DIQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
             D    D  G N  E  +D+FGG  G+ V +F SDI PPPVLMPVPGAG
Sbjct  580   DGDGPD--GANSGEVGYDAFGGQGGMHVPSFSSDINPPPVLMPVPGAG  625


 Score = 98.2 bits (243),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 62/80 (78%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM R+  GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  626  PLGPFVPAPPEFAMQMFRDPSGPNPPFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  677

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  678  SYQDLDAPEEEVTVIDYRSL  697



>ref|XP_010227410.1| PREDICTED: serrate RNA effector molecule isoform X2 [Brachypodium 
distachyon]
Length=578

 Score =   505 bits (1301),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 302/477 (63%), Positives = 363/477 (76%), Gaps = 19/477 (4%)
 Frame = -1

Query  2082  YPCVVSFCR--EGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEE  1909
             + CV ++ +  EGL +YKQFIQ LEDDI PAEAE RYQEYK+ YI  QKRAYFD HK+E+
Sbjct  34    WSCVGTWHQILEGLMTYKQFIQVLEDDISPAEAESRYQEYKTEYITTQKRAYFDLHKNED  93

Query  1908  WLKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNS  1729
             WLKDKYHPTNL+SVIERRNER + +AKDF LDLQ+GTLDLGPG+T    + +   S+ NS
Sbjct  94    WLKDKYHPTNLLSVIERRNERCKVVAKDFFLDLQNGTLDLGPGITAAAPSKSENGSDVNS  153

Query  1728  DDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGI  1549
             +D+ D GDKRR+H RG SK+   LS APKAHPVSSEPRRI  D+EQ+  LV +LD+EKGI
Sbjct  154   EDDGD-GDKRRKHIRGSSKEKDPLSAAPKAHPVSSEPRRIQTDIEQTLGLVRRLDTEKGI  212

Query  1548  EENILsrsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDY  1369
               NILS  D+++   DKS+  S GP+++I RGLT+VKGLEG ELL+TLLTYLWR+HGVDY
Sbjct  213   LGNILSSGDHEKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTLLTYLWRVHGVDY  271

Query  1368  YGMIETNEAKGLRHMRFDGKNTET-SSNGADWERKLDSRWEERLKGQDPLEVMTAKEKID  1192
             YGM ETNEAKG RH+R D KN+ T + N  DWE+KLD+ W+ERL GQDP+ ++TAK+KID
Sbjct  272   YGMSETNEAKGPRHVRADSKNSSTINVNAVDWEKKLDTFWQERLSGQDPMVILTAKDKID  331

Query  1191  TAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVR  1012
              AA E LEP+VRKIRDEKYGWKYGCGAKGCTKLFHA EFV+KHL+LKHPELVLE+TSKVR
Sbjct  332   AAAAEVLEPHVRKIRDEKYGWKYGCGAKGCTKLFHAPEFVYKHLRLKHPELVLEVTSKVR  391

Query  1011  EDLYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveR  832
             EDLYFQNYM+D +APGGTPVM  S P     + R  ++SRL+ DR NRR+ +       R
Sbjct  392   EDLYFQNYMNDPNAPGGTPVMQQSAP----DKSRRGMDSRLRYDRTNRRDYDRADRDGGR  447

Query  831   FDRPENPLSSDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             +         D   N DG   PD+QMFD+F G G   A F S+   PP+LMPVPGAG
Sbjct  448   YG------RGDGSPNRDG---PDDQMFDAFRGRG-SNAPFGSEFPAPPILMPVPGAG  494


 Score =   105 bits (261),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 63/85 (74%), Gaps = 7/85 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQI------GGQAPIIALPPSLRQD  410
            PLGPFVPAPPE+AM MLREQG P PFE        PQ+      GG APIIA+PPS   D
Sbjct  495  PLGPFVPAPPEIAMHMLREQG-PPPFEPNGAPHGNPQVLGQMMGGGPAPIIAMPPSFHHD  553

Query  409  PRRIRSYQDLDAPEDEVTVIDYRSL  335
            PRR+RSY DLDAP++EVTV+DYRSL
Sbjct  554  PRRLRSYNDLDAPDEEVTVLDYRSL  578



>ref|XP_004499601.1| PREDICTED: serrate RNA effector molecule-like [Cicer arietinum]
Length=700

 Score =   501 bits (1290),  Expect(2) = 9e-167, Method: Compositional matrix adjust.
 Identities = 309/467 (66%), Positives = 363/467 (78%), Gaps = 15/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRAYF+AHK EEWLKDKYHPTN
Sbjct  169   REGLMSYKQFIQELEDDILPSEAERRYQEYKSEYISTQKRAYFNAHKGEEWLKDKYHPTN  228

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AKDFLLDLQSGTLDL PG+  T S  + Q+SEPNS++E DAG KR
Sbjct  229   LLTVIERRNENARRLAKDFLLDLQSGTLDLNPGLNSTASIRSEQASEPNSEEETDAGGKR  288

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR+ RG +KD+   S APKAHPVSSEPRRI  D++Q Q +V KLD EKGIE+NIL  SD+
Sbjct  289   RRYGRGSNKDSD-FSAAPKAHPVSSEPRRIQADIQQVQAVVRKLDKEKGIEDNILCTSDH  347

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++      + S     V+I+RGLTS+KGLEG ELL+TL+TYLWRIHGVDYYGM+ETNEAK
Sbjct  348   NKNGDKAHSGSVGP--VIIIRGLTSIKGLEGVELLDTLITYLWRIHGVDYYGMLETNEAK  405

Query  1338  GLRHMRFDG-KNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +G ++ ET   G++WE  LDS W+ RL GQDPLEVMTAKEKID AA + L+P+
Sbjct  406   GFRHVRPEGARHEETGKLGSEWETNLDSFWQRRLDGQDPLEVMTAKEKIDAAAADVLDPH  465

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFV+KHLKLKH ELVLELTSK+REDLYFQNYM+
Sbjct  466   VRKIRDEKYGWKYGCGAKGCTKLFHAVEFVYKHLKLKHTELVLELTSKLREDLYFQNYMN  525

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APG  PVM        L+RR   L+ RLKDDRGNRR+++         DRP++  S 
Sbjct  526   DPVAPGSMPVMQQPQKDTSLKRR--LLDGRLKDDRGNRRDQDRNDRTNG--DRPDSSPSR  581

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + Q       N DE M+D++GG  +P   F SD+ PPPVLMPVPGAG
Sbjct  582   EKQLG-----NRDETMYDTYGGPALP--PFNSDMPPPPVLMPVPGAG  621


 Score =   115 bits (289),  Expect(2) = 9e-167, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEVAMQM R+QG  +    G   R GP +GGQA IIA+PP+ R DPRR+RS
Sbjct  622  PLGPFVPAPPEVAMQMFRDQGSSSFDPSGMMMRAGPHMGGQASIIAVPPAFRSDPRRMRS  681

Query  391  YQDLDAPEDEVTVIDYRSL  335
            YQDLDAPE+EVTVIDYRSL
Sbjct  682  YQDLDAPEEEVTVIDYRSL  700



>ref|XP_004171045.1| PREDICTED: serrate RNA effector molecule-like, partial [Cucumis 
sativus]
Length=479

 Score =   499 bits (1286),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 291/401 (73%), Positives = 336/401 (84%), Gaps = 4/401 (1%)
 Frame = -1

Query  1857  RNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDRGP  1678
             RNE A++ AKDFLLDLQSGTLDLGPG++   +N +GQ+SEPNSDDEAD   KRRRH RGP
Sbjct  1     RNELAQRTAKDFLLDLQSGTLDLGPGISAAATNKSGQASEPNSDDEADNDGKRRRHGRGP  60

Query  1677  SKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdk  1498
             +K+  LLS APKAHPVSSEPRRI ID+ Q+Q LV KLDSEKGIEENILS SDND+  RDK
Sbjct  61    AKEMDLLSAAPKAHPVSSEPRRIQIDIGQAQALVRKLDSEKGIEENILSGSDNDKLGRDK  120

Query  1497  snssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRF  1318
             ++  SSGPV++I RGLT+VKGLEG ELL+TLLTYLWRIHG+DYYGM+ET EAKGLRH+R 
Sbjct  121   AHGGSSGPVIII-RGLTTVKGLEGVELLDTLLTYLWRIHGIDYYGMVETREAKGLRHVRE  179

Query  1317  DGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEK  1138
             +GK++  +    +WE+KLD RW+ERL+GQD LEVMTAK+KI+ AA+EA +PYVRKIRDEK
Sbjct  180   EGKSSNMAGGADEWEKKLDLRWQERLRGQDLLEVMTAKDKIEAAALEAFDPYVRKIRDEK  239

Query  1137  YGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGT  958
             YGWKYGCGAKGCTKLFHA EFVHKHL LKHPELV+ELTSKVRE+LYFQNYM+D  APGGT
Sbjct  240   YGWKYGCGAKGCTKLFHAPEFVHKHLNLKHPELVMELTSKVREELYFQNYMNDTDAPGGT  299

Query  957   PVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSNDDG  778
             PVM  SLPK+K QRRR +L+ RLKDDRGNRR+R+   NG +RFDR ENP SSD  S +DG
Sbjct  300   PVMQQSLPKDKPQRRRMNLDGRLKDDRGNRRDRDNWANGGDRFDRSENPQSSDFPSANDG  359

Query  777   --GRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               G N D+ MFDSFGG G  VA F S+I PPPVLMPVPGAG
Sbjct  360   TDGGNIDDPMFDSFGGQGRHVAPFASEI-PPPVLMPVPGAG  399


 Score =   102 bits (255),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 67/80 (84%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGP-QIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAM+MLREQGGP PFEGG    +   Q+GG API+AL    RQDPRRIR
Sbjct  400  PLGPFVPAPPEVAMRMLREQGGPPPFEGGGRNGRPGPQLGGSAPILALSSGFRQDPRRIR  459

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  460  SYQDLDAPEDEVTVIDYRSL  479



>ref|XP_004966125.1| PREDICTED: serrate RNA effector molecule-like [Setaria italica]
Length=716

 Score =   508 bits (1307),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 288/457 (63%), Positives = 340/457 (74%), Gaps = 42/457 (9%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+Q LEDDI P+EAERRYQEY++ YI  QKRAYF+ HK+E+WLKDKYHPTN
Sbjct  183   REGLMTYKQFMQVLEDDISPSEAERRYQEYRTEYITTQKRAYFELHKNEDWLKDKYHPTN  242

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             LVSVIERRNER + M+KDF LDLQ+GTLDLGPG+T   ++  G   + NSDD+ D GDKR
Sbjct  243   LVSVIERRNERCKVMSKDFFLDLQNGTLDLGPGITAGAASKPGSGGDGNSDDDMD-GDKR  301

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+  +  SK    LS APKAHPVSSE RRI  D+EQ+  LV KLD+EKGIE N+L   D+
Sbjct  302   RKQGKDSSKGTDSLSGAPKAHPVSSESRRIQADIEQTLALVRKLDAEKGIEGNVLLSGDH  361

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+T+LTYLWRIHGVDYYG  E++EAK
Sbjct  362   DKSDGDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTILTYLWRIHGVDYYGTSESHEAK  420

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K + TS  N ADWE+KLD+ W+ERL GQDPL ++TAK+KID AAVE LEPY
Sbjct  421   GLRHVRVDNKTSSTSDVNAADWEKKLDTFWQERLNGQDPLVILTAKDKIDAAAVEVLEPY  480

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHPELVLE TSKVREDLYFQNYM+
Sbjct  481   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPELVLESTSKVREDLYFQNYMN  540

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P     RR+P ++SRL+                  FDR  N    
Sbjct  541   DPNAPGGTPVMQQSAPDRG--RRKPGMDSRLR------------------FDRGNN----  576

Query  801   DIQSND--DGGR-----------NPDEQMFDSFGGHG  730
               + ND  +GGR            PD+QMFD+F G G
Sbjct  577   --KDNDKAEGGRYGRGDRSPSRDGPDDQMFDAFRGRG  611


 Score =   110 bits (276),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 6/84 (7%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM M+REQG P PFE      G  G  GP +GG APII +PP+ R DP
Sbjct  634  PLGPFVPAPPEIAMHMMREQG-PPPFEPNGAPHGNTGMLGPMMGGPAPIITMPPNFRHDP  692

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  693  RRLRSYNDLDAPDEEVTVLDYRSL  716



>ref|XP_003563493.1| PREDICTED: serrate RNA effector molecule isoform X1 [Brachypodium 
distachyon]
Length=701

 Score =   506 bits (1302),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 301/469 (64%), Positives = 358/469 (76%), Gaps = 17/469 (4%)
 Frame = -1

Query  2064  FCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHP  1885
               REGL +YKQFIQ LEDDI PAEAE RYQEYK+ YI  QKRAYFD HK+E+WLKDKYHP
Sbjct  165   ITREGLMTYKQFIQVLEDDISPAEAESRYQEYKTEYITTQKRAYFDLHKNEDWLKDKYHP  224

Query  1884  TNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGD  1705
             TNL+SVIERRNER + +AKDF LDLQ+GTLDLGPG+T    + +   S+ NS+D+ D GD
Sbjct  225   TNLLSVIERRNERCKVVAKDFFLDLQNGTLDLGPGITAAAPSKSENGSDVNSEDDGD-GD  283

Query  1704  KRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrs  1525
             KRR+H RG SK+   LS APKAHPVSSEPRRI  D+EQ+  LV +LD+EKGI  NILS  
Sbjct  284   KRRKHIRGSSKEKDPLSAAPKAHPVSSEPRRIQTDIEQTLGLVRRLDTEKGILGNILSSG  343

Query  1524  dndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNE  1345
             D+++   DKS+  S GP+++I RGLT+VKGLEG ELL+TLLTYLWR+HGVDYYGM ETNE
Sbjct  344   DHEKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTLLTYLWRVHGVDYYGMSETNE  402

Query  1344  AKGLRHMRFDGKNTET-SSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             AKG RH+R D KN+ T + N  DWE+KLD+ W+ERL GQDP+ ++TAK+KID AA E LE
Sbjct  403   AKGPRHVRADSKNSSTINVNAVDWEKKLDTFWQERLSGQDPMVILTAKDKIDAAAAEVLE  462

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHA EFV+KHL+LKHPELVLE+TSKVREDLYFQNY
Sbjct  463   PHVRKIRDEKYGWKYGCGAKGCTKLFHAPEFVYKHLRLKHPELVLEVTSKVREDLYFQNY  522

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D +APGGTPVM  S P     + R  ++SRL+ DR NRR+ +       R+       
Sbjct  523   MNDPNAPGGTPVMQQSAP----DKSRRGMDSRLRYDRTNRRDYDRADRDGGRY------G  572

Query  807   SSDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
               D   N DG   PD+QMFD+F G G   A F S+   PP+LMPVPGAG
Sbjct  573   RGDGSPNRDG---PDDQMFDAFRGRG-SNAPFGSEFPAPPILMPVPGAG  617


 Score =   105 bits (261),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 63/85 (74%), Gaps = 7/85 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQI------GGQAPIIALPPSLRQD  410
            PLGPFVPAPPE+AM MLREQG P PFE        PQ+      GG APIIA+PPS   D
Sbjct  618  PLGPFVPAPPEIAMHMLREQG-PPPFEPNGAPHGNPQVLGQMMGGGPAPIIAMPPSFHHD  676

Query  409  PRRIRSYQDLDAPEDEVTVIDYRSL  335
            PRR+RSY DLDAP++EVTV+DYRSL
Sbjct  677  PRRLRSYNDLDAPDEEVTVLDYRSL  701



>ref|NP_001145860.1| putative SERRATE-related C2H2 zinc-finger family protein [Zea 
mays]
 gb|ACL52741.1| unknown [Zea mays]
 gb|AFW69313.1| putative SERRATE-related C2H2 zinc-finger family protein [Zea 
mays]
Length=742

 Score =   498 bits (1281),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 297/467 (64%), Positives = 356/467 (76%), Gaps = 16/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+Q LEDDI P+EAERRYQEY++ YI  QKRAYFD HK+E+WLKDKYHPTN
Sbjct  207   REGLMTYKQFMQVLEDDISPSEAERRYQEYRTEYITTQKRAYFDLHKNEDWLKDKYHPTN  266

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNER + +AKDF LDLQ+GTLDLGPG+T   ++  G  S+ NS+D+ D  DKR
Sbjct  267   LLSVIERRNERCKVIAKDFFLDLQNGTLDLGPGITAGAASKLG-GSDGNSEDDMD-NDKR  324

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H +  SK    LS APKAHPVSSE RR+  D+EQ+  LV KLD+EKGI+ N+LS  D+
Sbjct  325   RKHGKDSSKATDSLSGAPKAHPVSSESRRVQADIEQTLALVRKLDAEKGIDGNVLSSGDH  384

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+V+I RGLT+VKGLEG ELL+T+LTYLWRIHGVDYYG  E++EAK
Sbjct  385   DKSDVDKSHIGSMGPIVII-RGLTTVKGLEGVELLDTILTYLWRIHGVDYYGTSESHEAK  443

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K + TS  + ADWE+KLD+ W+ERL GQD L ++TAK+KID AA E LEP 
Sbjct  444   GLRHVRVDSKTSSTSDVSSADWEKKLDTFWQERLNGQDQLVILTAKDKIDAAAAEVLEPL  503

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHLKLKHP+LVLE TSKVREDLYFQNYM+
Sbjct  504   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLKLKHPDLVLESTSKVREDLYFQNYMN  563

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P     RRRPS++SRLK DRG+ R+ +       R+ R ++  S 
Sbjct  564   DPNAPGGTPVMQQSAPDRG--RRRPSMDSRLKFDRGSNRDHDKADRDGVRYGRGDHSPSR  621

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D          PD+QMFD F G     A F ++   PP+LMPVPGAG
Sbjct  622   D---------GPDDQMFDGFRGR-PSNAPFVAEFPAPPILMPVPGAG  658


 Score =   115 bits (287),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE      G  G  GP +GG APIIA+PP+ R DP
Sbjct  659  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGAPHGNAGMLGPMMGGPAPIIAMPPNFRHDP  718

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  719  RRLRSYNDLDAPDEEVTVLDYRSL  742



>gb|KEH32826.1| serrate RNA effector molecule-like protein [Medicago truncatula]
Length=704

 Score =   496 bits (1276),  Expect(2) = 5e-165, Method: Compositional matrix adjust.
 Identities = 310/467 (66%), Positives = 366/467 (78%), Gaps = 18/467 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRAYF+ HKD EWLKDKYHPTN
Sbjct  176   REGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAYFNTHKDAEWLKDKYHPTN  235

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AK+FLLDLQSGTLD+ PG+  + S  + Q++EPNS++E DAG KR
Sbjct  236   LLTVIERRNENARRLAKEFLLDLQSGTLDINPGLN-SASTKSEQATEPNSEEETDAGGKR  294

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG +KD    S APKAHPVSSEPRRI  D+ Q Q +V KLD EKGIE+NIL  +D+
Sbjct  295   RRHGRGSNKDNDF-SAAPKAHPVSSEPRRIQEDIHQVQAVVRKLDKEKGIEDNILCTNDH  353

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              + S    + S     VVI+RGLTS+KGLEG ELL+TL+TYLWRIHGVDYYGM+ET++AK
Sbjct  354   SKNSDKARSGSVGP--VVIIRGLTSIKGLEGVELLDTLITYLWRIHGVDYYGMLETSDAK  411

Query  1338  GLRHMRFDG-KNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +G ++ ET+ +G++WE+KLDS W+ RL G DPLEV TAKEKID AA + L+PY
Sbjct  412   GFRHVRPEGARHEETAKSGSEWEKKLDSFWQRRLDGLDPLEVRTAKEKIDAAAADMLDPY  471

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAK CTKLFHA EFV+KHLKLKHPELVLELTSK+REDLYFQNYM+
Sbjct  472   VRKIRDEKYGWKYGCGAKSCTKLFHAVEFVYKHLKLKHPELVLELTSKLREDLYFQNYMN  531

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTPVM  S  K  L+RR   LE RLKDDRGNRR+++         DRP++  S 
Sbjct  532   DPDAPGGTPVMQQSQDK-PLKRR--LLEGRLKDDRGNRRDQDRSDRTNG--DRPDSSPSH  586

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             + Q       N DE MFD++GG   P  +F SD+ PPPVLMPVPGAG
Sbjct  587   ERQLG-----NRDETMFDAYGG---PAVSFNSDMPPPPVLMPVPGAG  625


 Score =   115 bits (288),  Expect(2) = 5e-165, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 67/80 (84%), Gaps = 2/80 (3%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+Q GP+ ++  G   R GP IGGQA +IA+PP+ R DPRR+R
Sbjct  626  PLGPFVPAPPEVAMQMFRDQ-GPSSYDPSGMTMRSGPHIGGQASMIAVPPTFRPDPRRMR  684

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  685  SYQDLDAPEEEVTVIDYRSL  704



>ref|XP_002880880.1| hypothetical protein ARALYDRAFT_481599 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57139.1| hypothetical protein ARALYDRAFT_481599 [Arabidopsis lyrata subsp. 
lyrata]
Length=720

 Score =   503 bits (1295),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 308/467 (66%), Positives = 371/467 (79%), Gaps = 8/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR +F++HK+EEWLK+KYHPTN
Sbjct  191   RNGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVFFNSHKEEEWLKNKYHPTN  250

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE ARK+AKDFLLDLQSG +DLGP VT    + + ++SE  SDD+A  G KR
Sbjct  251   LLSVIERRNELARKVAKDFLLDLQSGAIDLGPAVTAL--DKSSRASEQISDDDAAGGGKR  308

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +RH  G +K+  LLS APKA   +S+P+RI  D+EQ+  LV KLDSEKGIEEN+LS S+N
Sbjct  309   KRHGSGEAKETELLSAAPKAPSFTSDPKRILTDIEQAHALVRKLDSEKGIEENVLSGSEN  368

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  R+K +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ET EAK
Sbjct  369   DKLGREKLHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKVETYEAK  427

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G+RH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+V
Sbjct  428   GMRHVRAEGKGSD--AKGDESESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHV  485

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LY QNYM+D
Sbjct  486   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYLQNYMND  545

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
              +APGG P    S P+++  RRRP +E+RL+DDRG RRER+GR NG +R DR E+     
Sbjct  546   PNAPGGQPATQQSGPRDRPMRRRPGMENRLRDDRGGRRERDGRANGNDRNDRSED--QQR  603

Query  798   IQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                +   G NP E  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  604   GDGDGPDGGNPREVGYDAFGGQGGVHVPPFSSDINPPPMLMPVPGAG  650


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 60/80 (75%), Gaps = 11/80 (14%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM     GP P FEG  NGR GP     AP + L P+ RQDPRR+R
Sbjct  651  PLGPFVPAPPEFAMQMF--PSGPNPPFEG--NGRGGP-----APFL-LSPAFRQDPRRLR  700

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  701  SYQDLDAPEEEVTVIDYRSL  720



>ref|XP_009140760.1| PREDICTED: serrate RNA effector molecule-like [Brassica rapa]
Length=692

 Score =   493 bits (1270),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 288/471 (61%), Positives = 355/471 (75%), Gaps = 25/471 (5%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR YF+ HK+EEWLKDKYH
Sbjct  173   STQRDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVYFNTHKEEEWLKDKYH  232

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL++VIE+RNE ARK+AKDF LDLQSG LDLGP VT        ++SEP S+DEA  G
Sbjct  233   PTNLLTVIEKRNEHARKLAKDFSLDLQSGNLDLGPAVT-----ALNKTSEPKSEDEAGGG  287

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
                +             S APKA   +S+P+RI  D+EQ+Q LV KLDSEKGI EN+LS 
Sbjct  288   GGGK------RGKEIDFSAAPKAPSFTSDPKRILTDIEQAQALVRKLDSEKGIVENVLSG  341

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             S+ ++  +DKS+S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ET+
Sbjct  342   SETEKSDKDKSHSGSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGVDYYGKVETS  400

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK ++  + G + E K DS W++RLKGQDPLEVM AKEK+D AA+EAL+
Sbjct  401   EAKGLRHVRAEGKGSD--AKGDEGEDKFDSHWQQRLKGQDPLEVMAAKEKLDAAAIEALD  458

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKH EL++++T KVREDLYFQNY
Sbjct  459   PHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHAELIVDMTVKVREDLYFQNY  518

Query  987   MSDESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
             M+D +APGG P      P+++ + RR+PS+ESRL+       +  G     +R DR E+ 
Sbjct  519   MNDPNAPGGQPATQQPGPRDRPMMRRKPSMESRLR-------DDRGGRRERDRIDRSEDQ  571

Query  810   LSSDIQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                D   N   G NP+E  +D+FGG  G+ V ++ +D+  PPVLMPVPGAG
Sbjct  572   QRGD--GNGPNGPNPEEGGYDAFGGQGGVHVPSYSADMNAPPVLMPVPGAG  620


 Score = 98.2 bits (243),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM R+  GP P  EGG  GR GP     AP + L P+ RQDPRR+R
Sbjct  621  PLGPFVPAPPEFAMQMFRDPSGPNPPLEGG--GRGGP-----APFL-LSPAFRQDPRRLR  672

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  673  SYQDLDAPEEEVTVIDYRSL  692



>ref|XP_006660282.1| PREDICTED: serrate RNA effector molecule-like, partial [Oryza 
brachyantha]
Length=586

 Score =   487 bits (1253),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 285/469 (61%), Positives = 350/469 (75%), Gaps = 34/469 (7%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQF+QELEDD+ P EA+RRY+EYKS YI  QK+AYFD HK E+WL++KYHPTN
Sbjct  61    REGLMSYKQFMQELEDDVSPDEAQRRYEEYKSEYITTQKKAYFDLHKHEDWLRNKYHPTN  120

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L S +E RNE AR +A +F  DLQSGTLD+GPG+T T +N +G S      D+ADA  K+
Sbjct  121   LESAMEGRNEVARTIANEFFQDLQSGTLDIGPGLTSTATNKSGTSV-----DDADANGKK  175

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +          L   APKAHPVSSEPRRI ID+E +Q L+ KLDSEKGIE N+LS SD+
Sbjct  176   GKLG---KGQDDLYYAAPKAHPVSSEPRRIRIDIELAQALICKLDSEKGIENNVLSGSDH  232

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DR  +DKS+ S     +VI+RG ++VKGLEGAELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  233   DRADKDKSHGSMGP--IVIIRGSSAVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPK  290

Query  1338  GLRHMRFDGKN-TETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SSN A+WE+KLDS W++R++GQDP+E++ AKEKID AA E L+P+
Sbjct  291   GLRHVKADSRTFNGASSNAAEWEKKLDSFWQDRIQGQDPMEILKAKEKIDAAASEVLDPH  350

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFV KHLKLKH +LV+ELTSKVRE++YF+NYMS
Sbjct  351   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVLKHLKLKHTDLVVELTSKVRENIYFENYMS  410

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M  S P+EK+ R+RP +ESRL+D+            G  RFDR ++P   
Sbjct  411   DPKAPGGTPIMQQSAPREKV-RQRPPIESRLRDE-----------RGNRRFDRNDSP---  455

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPV--AAFPSDITPPPVLMPVPGAG  661
                ++D    NPD+ ++ S+G    PV   AFP DI  PPVLMPVPGAG
Sbjct  456   ---THDGSSDNPDDPVYGSYGD---PVMHGAFPPDIPAPPVLMPVPGAG  498


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 63/90 (70%), Gaps = 13/90 (14%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIAL-----------PP  425
            PLGPF+PAPPEVAM+M+R+QGGP PFE    G Q P+  G+  ++ +           PP
Sbjct  499  PLGPFIPAPPEVAMRMMRDQGGPPPFES--TGGQRPRRAGRGGVLPMGGPSPILAAPLPP  556

Query  424  SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                DPR+IRSYQDLDAPEDEVTV+DYRSL
Sbjct  557  PHMHDPRKIRSYQDLDAPEDEVTVMDYRSL  586



>emb|CDX77068.1| BnaC04g38630D [Brassica napus]
Length=690

 Score =   490 bits (1262),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 287/471 (61%), Positives = 355/471 (75%), Gaps = 25/471 (5%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR YF+ HK+EEWLKDKYH
Sbjct  171   STQRDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVYFNTHKEEEWLKDKYH  230

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAG  1708
             PTNL++VIE+RNE ARK+AKDFLL+LQSG LDLGP VT        ++SEP S+DEA  G
Sbjct  231   PTNLLTVIEKRNEHARKVAKDFLLELQSGNLDLGPAVT-----ALNKTSEPKSEDEAGGG  285

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsr  1528
                +R            S APKA   +S+P+RI  D+EQ+Q LV KLDSEKGI +N+LS 
Sbjct  286   GGGKRGKESD------FSAAPKAPSFTSDPKRILTDIEQAQALVRKLDSEKGIVDNVLSS  339

Query  1527  sdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETN  1348
             S+ +   +DKS+S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ET+
Sbjct  340   SETETSGKDKSHSGSTGPVIII-RGLTSVKGLEGVELLDTLITYLWRVHGVDYYGKVETS  398

Query  1347  EAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALE  1168
             EAKGLRH+R +GK  +  + G + E K DS W++RLKGQDPLEVM AKEK+D AA+EAL+
Sbjct  399   EAKGLRHVRAEGKGPD--AKGDEGEDKFDSHWQQRLKGQDPLEVMAAKEKLDAAAIEALD  456

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
             P+VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKH EL++++T KVRE+LYFQNY
Sbjct  457   PHVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHAELIVDMTVKVREELYFQNY  516

Query  987   MSDESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENP  811
             M+D +APGG P      P+++ + RR+PS+ESRL+       +  G     +R DR E+ 
Sbjct  517   MNDPNAPGGQPATQQPGPRDRPMMRRKPSMESRLR-------DDRGGRRERDRIDRSEDQ  569

Query  810   LSSDIQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                D   N   G NP+E  +D+FGG  G+ V ++ +D+  PPVLMPVPGAG
Sbjct  570   QRGD--GNGPNGPNPEEGGYDAFGGQGGVHVPSYSADMNAPPVLMPVPGAG  618


 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPE AMQM R+  GP P  EGG  GR GP     AP + L P+ RQDPRR+R
Sbjct  619  PLGPFVPAPPEFAMQMFRDPSGPNPPLEGG--GRGGP-----APFL-LSPAFRQDPRRLR  670

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  671  SYQDLDAPEEEVTVIDYRSL  690



>gb|EMT28210.1| Serrate RNA effector molecule [Aegilops tauschii]
Length=604

 Score =   486 bits (1252),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 269/467 (58%), Positives = 339/467 (73%), Gaps = 33/467 (7%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQF+QELEDD+ P EA+ RY+EYKS YI  QK+AYFD HK+++WL++KYHPTN
Sbjct  74    REGLMSYKQFMQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFDLHKNDDWLRNKYHPTN  133

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SV++RRNE AR  A +F  DLQSG  D GPG+T + +N +G       +++ +   K+
Sbjct  134   LESVMKRRNELARATANEFFQDLQSGNFDTGPGLTSSAANKSG-------NNDVNVNGKK  186

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +  + P     L   APKAHPVSSEPRRI ID+EQ+Q L+ KLDSEKGIE N+LS SD+
Sbjct  187   GKLGKDPDD---LYYSAPKAHPVSSEPRRISIDIEQAQALICKLDSEKGIENNVLSSSDD  243

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+       S      +VI+RG ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  244   DKAGSGSHGSMGP---IVIIRGASTVKGLEGVELLDTLVTYLWRIHGVDYYGMSETNEPK  300

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +  +  SSN A+WE KLDS W++R++GQDPLE++ AK+KID AA E L+P+
Sbjct  301   GLRHVKADSRTYDGPSSNTAEWEEKLDSFWQDRIQGQDPLEILKAKDKIDAAASEVLDPH  360

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA+EFV KHLKLKH + V+ELTSKVRED+YF+NYM+
Sbjct  361   VRKIRDEKYGWKYGCGAKGCTKLFHASEFVTKHLKLKHTDFVVELTSKVREDIYFENYMN  420

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M  S P+EK  R+RP +ESRL+D+               RFDR     + 
Sbjct  421   DPKAPGGTPIMQQSAPREK-GRQRPPIESRLRDE------------RGRRFDR-----NI  462

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D  + D    NPD+ M+DS+G   +   AFP D+  PP+LMPVPGAG
Sbjct  463   DSSNPDGSSENPDDPMYDSYGDPAV-HGAFPPDVPAPPMLMPVPGAG  508


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 64/99 (65%), Gaps = 23/99 (23%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQA----------------PI  440
            PLGPF+PAPPEVAM+MLREQGGP PFE     R  P+  G+A                PI
Sbjct  509  PLGPFIPAPPEVAMRMLREQGGPPPFEPNAGPR--PRKAGRAGGPPMGGPSPILNAPLPI  566

Query  439  IALP----PSLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
            +  P    P + QDPR+IRSYQDLDAP DEVTV+DYRSL
Sbjct  567  MHDPRMQDPRM-QDPRKIRSYQDLDAPGDEVTVLDYRSL  604



>gb|EEC81254.1| hypothetical protein OsI_24338 [Oryza sativa Indica Group]
Length=572

 Score =   483 bits (1244),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 287/472 (61%), Positives = 351/472 (74%), Gaps = 29/472 (6%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQFIQ LEDDI PAEAE+RYQEY++ YI  QKRAYFD +K+++ LKDKYHPTN
Sbjct  40    REGLMTYKQFIQVLEDDISPAEAEKRYQEYRTEYITTQKRAYFDLNKNDDRLKDKYHPTN  99

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SVI+RRN+  +  AKDF  DLQ+GTLDLGPG+T   ++ +  +S+     +    DKR
Sbjct  100   LSSVIDRRNDSCKATAKDFFHDLQNGTLDLGPGITAAAASGSDGNSD-----DDGDSDKR  154

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H RG SK+   LS AP AHPVSSE RR+ +D+EQ+  LV KLD+EKGI  NILS  D+
Sbjct  155   RKHGRGSSKETDPLSGAPVAHPVSSESRRVQVDIEQALALVRKLDTEKGIVGNILSSGDH  214

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+TLLTYLWRIHGVDYYGM ETNEAK
Sbjct  215   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTLLTYLWRIHGVDYYGMSETNEAK  273

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R D K + T++ N ADWE+K+D+ W+ERL+GQDP+ ++ AK+KID AAVE LEPY
Sbjct  274   GSRHVRADNKTSNTTNINAADWEKKVDTFWQERLRGQDPMVILAAKDKIDAAAVEVLEPY  333

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHPELVLELTSKVREDLYFQNYM+
Sbjct  334   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPELVLELTSKVREDLYFQNYMN  393

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P +   R+RP +++RL+ D                +DR E     
Sbjct  394   DPNAPGGTPVMQQSAPDK--SRQRPGMDNRLRYD----------RANRREYDRAER----  437

Query  801   DIQSNDDGGRNP-----DEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D      G R+P     D+QMFD+F G G P A F  ++  PP+LMP+PGAG
Sbjct  438   DGSRYGRGDRSPSLDGADDQMFDAFRGRG-PNAPFVPELPAPPILMPIPGAG  488


 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRN-----GRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE         G  GP +GG APII +PPS RQDP
Sbjct  489  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGPPHANPGVLGPMMGGPAPIITMPPSFRQDP  548

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  549  RRLRSYNDLDAPDEEVTVLDYRSL  572



>ref|XP_002445843.1| hypothetical protein SORBIDRAFT_07g026820 [Sorghum bicolor]
 gb|EES15338.1| hypothetical protein SORBIDRAFT_07g026820 [Sorghum bicolor]
Length=642

 Score =   486 bits (1251),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 282/467 (60%), Positives = 342/467 (73%), Gaps = 25/467 (5%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+ P EA+ RY+EYKS YI  QK+AYFD HKDE+WL++KYHPTN
Sbjct  113   REGLMSYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFDLHKDEDWLRNKYHPTN  172

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L +VIERRNE AR  A DF L LQSG+LD GPG+  +  N +G +S  N     DA +  
Sbjct  173   LENVIERRNELARTTANDFFLQLQSGSLDTGPGLMGSAVNKSGNNSSKN----LDAVEGD  228

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +  +           APKAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE ++LS SD+
Sbjct  229   GKKGKLGKGPDDSYYAAPKAHPVSSEVRRIRIDIEQAQALICKLDSEKGIENSVLSSSDH  288

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RDKS+ S     +VI+RG ++VKGLEGAELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  289   EKSDRDKSHGSMGP--IVIIRGSSTVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPK  346

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SSNGA+WE KLDS W++R++GQDPLE++ AKEKID AA E L+PY
Sbjct  347   GLRHVKADARTYNGASSNGAEWENKLDSFWQDRIQGQDPLEMLKAKEKIDGAATEVLDPY  406

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KHLKLKH +LV++LTSK RED+YF+NYM+
Sbjct  407   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHLKLKHADLVVDLTSKAREDIYFENYMN  466

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+ K  R+RP +ESRL+D+            G  RFDR     + 
Sbjct  467   DPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRDE-----------RGNHRFDR-----NV  509

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D  ++D    NPD+ ++DSF G  I   AFP DI  PPVLMPVPGAG
Sbjct  510   DSPTHDGSSENPDDPIYDSF-GDPIMHGAFPPDIPAPPVLMPVPGAG  555


 Score =   104 bits (259),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 66/87 (76%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQ-----GPQIGGQAPII-ALPPSLR  416
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+     GPQI G +PI  A PP   
Sbjct  556  PLGPFIPAPPEVAMHMLRDQGAPPPFEPTGGPHPRKAGRGVGPQIRGPSPIFTAPPPHQM  615

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  616  HDPRRIRSYQDLDAPEDEVTVMDYRSL  642



>dbj|BAJ96818.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=643

 Score =   486 bits (1250),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 271/467 (58%), Positives = 336/467 (72%), Gaps = 33/467 (7%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQF+QELEDD+ P EA+ RY+EYKS YI  QK+AYFD HK+E+WL++KYHPTN
Sbjct  113   REGLMSYKQFMQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFDLHKNEDWLRNKYHPTN  172

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SV ERRNE AR  A +F  DLQSG  D GPG+T + +N +G S       + +   K+
Sbjct  173   LESVTERRNELARATANEFFQDLQSGNFDTGPGLTSSAANKSGNS-------DMNVNGKK  225

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +  + P     L   A KAHPVSSEPRRI ID+EQ+Q L+ KLDSEKGIE N+LS SD+
Sbjct  226   GKLGKDPDD---LYYSATKAHPVSSEPRRISIDIEQAQALICKLDSEKGIENNVLSSSDD  282

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+       S      +VI+RG ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  283   DKAGSGSHGSMGP---IVIIRGASTVKGLEGVELLDTLVTYLWRIHGVDYYGMSETNEPK  339

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +  +  SSN A+WE KLDS W++R++GQDPLE++ AK+KID AA E L+P+
Sbjct  340   GLRHVKADSRTYDGASSNTAEWEEKLDSFWQDRIQGQDPLEILKAKDKIDAAASEVLDPH  399

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA+EFV KHLKLKH + V+ELTS VRED+YF+NYM+
Sbjct  400   VRKIRDEKYGWKYGCGAKGCTKLFHASEFVTKHLKLKHTDFVVELTSNVREDIYFENYMN  459

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M  S P+EK  R+RP +ESRL+D+               RFDR     ++
Sbjct  460   DPKAPGGTPIMQQSAPREK-GRQRPPIESRLRDE------------RGRRFDR-----NA  501

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D  + D    NPD+ M+DS+G   +   AFP DI  PP+LMPVPGAG
Sbjct  502   DSSNPDGSSENPDDPMYDSYGDPAV-HGAFPPDIPAPPMLMPVPGAG  547


 Score = 85.1 bits (209),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 65/96 (68%), Gaps = 17/96 (18%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGG----------QAPI-IAL  431
            PLGPF+PAPPEVAM+MLREQGGP PFE   G   R+  + GG           AP+ I  
Sbjct  548  PLGPFIPAPPEVAMRMLREQGGPPPFEPNAGPRPRKAGRGGGPPVGGPSPILSAPLPIMH  607

Query  430  PPSLR----QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             P ++    QDPR+IRSYQDLDAP DEVTV+DYRSL
Sbjct  608  DPRMQDPRMQDPRKIRSYQDLDAPGDEVTVLDYRSL  643



>ref|XP_004973947.1| PREDICTED: serrate RNA effector molecule-like [Setaria italica]
Length=641

 Score =   484 bits (1245),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 282/467 (60%), Positives = 342/467 (73%), Gaps = 27/467 (6%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+ P EA+ RY+EYKS YI  QK+AYFD HKDE+WL++KY+PTN
Sbjct  114   REGLMSYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFDLHKDEDWLRNKYNPTN  173

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L  VIERRNE AR  A +F  DLQSG+LD GPG+T + ++ +G +S  N  D     D +
Sbjct  174   LEGVIERRNELARTTANEFFQDLQSGSLDTGPGLTGSAASKSGNNSSKNLVD----ADGK  229

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +      S D  L   APKAHPVSSE RRI  D+EQ+Q L+ KLDSEKGIE N+LS SD+
Sbjct  230   KGKLGKGSDD--LYYAAPKAHPVSSEARRIRSDIEQAQALICKLDSEKGIENNVLSSSDH  287

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+  RDKS+ S     +VI+RG ++VKGLEGAELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  288   DKTDRDKSHGSMGP--IVIIRGSSTVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPK  345

Query  1338  GLRHMRFDGKNTET-SSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SSN  +WE KLDS W++R++GQDPLE++ AKEKID AA E L+PY
Sbjct  346   GLRHVKADARTYNGDSSNATEWENKLDSFWQDRIQGQDPLEILKAKEKIDAAATEVLDPY  405

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KHLKLKH ++V+ELTSKVRED+YF+NYM+
Sbjct  406   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHLKLKHADVVVELTSKVREDIYFENYMN  465

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+ K  R+RP +ESRL+D+            G  RFD      + 
Sbjct  466   DPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRDE-----------RGNRRFD-----TNV  508

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D   +D  G NPD+ ++DSF G  I   AFP DI  PP+LMPVPGAG
Sbjct  509   DSPPHDGSGENPDDAIYDSF-GDPIMHGAFPPDIPAPPILMPVPGAG  554


 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 62/87 (71%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGGQAP------IIALPPSLR  416
            PLGPF+PAPPEVAM M+R+QGGP  FE  GG + R+  + GG           A PP+  
Sbjct  555  PLGPFIPAPPEVAMHMMRDQGGPPHFEPAGGPHPRKAGRGGGPPMRGPSPIFSAPPPTHM  614

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  615  HDPRRIRSYQDLDAPEDEVTVMDYRSL  641



>ref|NP_001062242.1| Os08g0517300 [Oryza sativa Japonica Group]
 dbj|BAD09973.1| putative C2H2 zinc-finger protein [Oryza sativa Japonica Group]
 dbj|BAD09995.1| putative C2H2 zinc-finger protein [Oryza sativa Japonica Group]
 dbj|BAF24156.1| Os08g0517300 [Oryza sativa Japonica Group]
 dbj|BAG91299.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83884.1| hypothetical protein OsI_29889 [Oryza sativa Indica Group]
 gb|EEE68996.1| hypothetical protein OsJ_27936 [Oryza sativa Japonica Group]
Length=647

 Score =   484 bits (1245),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 284/469 (61%), Positives = 349/469 (74%), Gaps = 35/469 (7%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQF+QELEDD+ P EA+ RY+EYKS YI  QK+AYFD HK+++WLK+KYHPTN
Sbjct  124   REGLMSYKQFMQELEDDVSPDEAQHRYEEYKSEYITTQKKAYFDLHKNDDWLKNKYHPTN  183

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L  V+ERRNE AR  A  FL DLQ+G+LD+GPG+T + +N +G     NS D+ DA  K+
Sbjct  184   LEIVMERRNELARTAANQFLQDLQNGSLDIGPGLTSSATNKSG-----NSVDDTDANGKK  238

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +   G S+D  L   APKAHPVSSEPRRI IDVE +Q L+ KLDSEKGIE N+LS SD+
Sbjct  239   GK--LGKSQDD-LYYAAPKAHPVSSEPRRIRIDVELAQALICKLDSEKGIENNVLSGSDH  295

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             DR  +DKS+ S     +VI+RG ++VKGLEGAELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  296   DRAEKDKSHGSMGP--IVIIRGSSAVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPK  353

Query  1338  GLRHMRFDGKN-TETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SSN A+WE+KLDS W++R++GQDP+E++ AK+KID AA E L+P+
Sbjct  354   GLRHVKADSRTFNGASSNAAEWEKKLDSFWQDRIQGQDPMEILKAKDKIDAAASEVLDPH  413

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFV KHLKLKH +LV ELTSKVRE++YF NYMS
Sbjct  414   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVQKHLKLKHADLVRELTSKVRENIYFDNYMS  473

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGG P+M    P+EK+ R+RP +ESRL+D+            G  RFDR ++P   
Sbjct  474   DPKAPGGMPIMQQPAPREKV-RQRPPIESRLRDE-----------RGNRRFDRNDSP---  518

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPV--AAFPSDITPPPVLMPVPGAG  661
                ++D    NPD    D++  +G PV   AFP DI  PPVLMPVPGAG
Sbjct  519   ---THDGSSDNPD----DAYDSYGDPVMHGAFPPDIPAPPVLMPVPGAG  560


 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 59/87 (68%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQ------IGG--QAPIIALPPSLR  416
            PLGPF+PAPPEVAM+M+R+QGGP PFE     R          +GG        LPP   
Sbjct  561  PLGPFIPAPPEVAMRMMRDQGGPPPFEPTGGPRPRRPGRGGLPMGGPSPILAAPLPPPHM  620

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPR+IRSYQDLDAPEDEVTV+DYRSL
Sbjct  621  HDPRKIRSYQDLDAPEDEVTVMDYRSL  647



>pdb|3AX1|A Chain A, Molecular Insights Into Mirna Processing By Arabidopsis 
Serrate
Length=358

 Score =   472 bits (1215),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 254/356 (71%), Positives = 301/356 (85%), Gaps = 5/356 (1%)
 Frame = -1

Query  2052  GLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLV  1873
             GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRA+F+ HK+E+WLK+KYHPTNL+
Sbjct  1     GLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAFFNTHKEEDWLKNKYHPTNLL  60

Query  1872  SVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRR  1693
             SVIERRN+ A+K+AKDFLLDLQSGTLDLGP VT    N +G++SEPNS+DEA    KR+R
Sbjct  61    SVIERRNDLAQKVAKDFLLDLQSGTLDLGPAVTAL--NKSGRTSEPNSEDEAAGVGKRKR  118

Query  1692  HDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndr  1513
             H  G +K+  LLS APKA   +S+P+RI  DVEQ+Q LV KLDSEK IEEN+L  S+ ++
Sbjct  119   HGMGGAKENELLSAAPKAPSFTSDPKRILTDVEQTQALVRKLDSEKKIEENVLQGSETEK  178

Query  1512  gsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGL  1333
               R+K +S S+GPVV+I RGLTSVKGLEG ELL+TL+TYLWR+HG+DYYG +ETNEAKGL
Sbjct  179   SGREKLHSGSTGPVVII-RGLTSVKGLEGVELLDTLVTYLWRVHGLDYYGKVETNEAKGL  237

Query  1332  RHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRK  1153
             RH+R +GK ++  + G + E K DS W+ERLKGQDPLEVM AKEKID AA EAL+P+VRK
Sbjct  238   RHVRAEGKVSD--AKGDENESKFDSHWQERLKGQDPLEVMAAKEKIDAAATEALDPHVRK  295

Query  1152  IRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             IRDEKYGWKYGCGAKGCTKLFHAAEFV+KHLKLKH ELV ELT+KVRE+LYFQNY+
Sbjct  296   IRDEKYGWKYGCGAKGCTKLFHAAEFVYKHLKLKHTELVTELTTKVREELYFQNYL  351



>ref|NP_001174979.1| Os06g0698859 [Oryza sativa Japonica Group]
 dbj|BAD54671.1| putative C2H2 zinc-finger protein [Oryza sativa Japonica Group]
 dbj|BAH93707.1| Os06g0698859 [Oryza sativa Japonica Group]
Length=723

 Score =   482 bits (1240),  Expect(2) = 2e-157, Method: Compositional matrix adjust.
 Identities = 289/467 (62%), Positives = 354/467 (76%), Gaps = 19/467 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQFIQ LEDDI PAEAE+RYQEY++ YI  QKRAYFD +K+++ LKDKYHPTN
Sbjct  191   REGLMTYKQFIQVLEDDISPAEAEKRYQEYRTEYITTQKRAYFDLNKNDDRLKDKYHPTN  250

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SVI+RRN+  +  AKDF  DLQ+GTLDLGPG+T   ++ +  +S+     +    DKR
Sbjct  251   LSSVIDRRNDSCKATAKDFFHDLQNGTLDLGPGITAAAASGSDGNSD-----DDGDSDKR  305

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H RG SK+   LS AP AHPVSSE RR+ +D+EQ+  LV KLD+EKGI  NILS  D+
Sbjct  306   RKHGRGSSKETDPLSGAPVAHPVSSESRRVQVDIEQALALVRKLDTEKGIVGNILSSGDH  365

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+TLLTYLWRIHGVDYYGM ETNEAK
Sbjct  366   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTLLTYLWRIHGVDYYGMSETNEAK  424

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R D K + T++ N ADWE+K+D+ W+ERL+GQDP+ ++ AK+KID AAVE LEPY
Sbjct  425   GSRHVRADNKTSNTTNINAADWEKKVDTFWQERLRGQDPMVILAAKDKIDAAAVEVLEPY  484

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHPELVLELTSKVREDLYFQNYM+
Sbjct  485   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPELVLELTSKVREDLYFQNYMN  544

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P +   R+RP +++RL+ DR NRRE +       R+ R +   S 
Sbjct  545   DPNAPGGTPVMQQSAPDK--SRQRPGMDNRLRYDRANRREYDRAERDGSRYGRGDRSPSL  602

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D           D+QMFD+F G G P A F  ++  PP+LMP+PGAG
Sbjct  603   D---------GADDQMFDAFRGRG-PNAPFVPELPAPPILMPIPGAG  639


 Score =   104 bits (260),  Expect(2) = 2e-157, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRN-----GRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE         G  GP +GG APII +PPS RQDP
Sbjct  640  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGPPHANPGVLGPMMGGPAPIITMPPSFRQDP  699

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  700  RRLRSYNDLDAPDEEVTVLDYRSL  723



>gb|AAK63209.1|AF311224_1 C2H2 zinc-finger protein [Zea mays]
Length=528

 Score =   477 bits (1227),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 339/470 (72%), Gaps = 38/470 (8%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+ P EA+ RY+EYKS YI  QK+AYF  HKDE+WL++KYHPTN
Sbjct  3     REGLMSYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFALHKDEDWLRNKYHPTN  62

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L +VIERRNE AR  A DF L LQSG+LD GPG+T +  + +G +S  N D  A  GD +
Sbjct  63    LENVIERRNELARTTADDFFLQLQSGSLDTGPGLTGSAVSKSGNNSSKNLD--AVEGDGK  120

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +      S D+     APKAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE NILS S++
Sbjct  121   KGKLGKGSDDSYYA--APKAHPVSSEVRRIRIDIEQAQGLICKLDSEKGIENNILSSSNH  178

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++   DKS+ S     +VIV+G ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  179   EKPDMDKSHGSMGP--IVIVQGSSTVKGLEGTELLDTLVTYLWRIHGVDYYGMSETNEPK  236

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SS+  +WE KLDS W++R++GQDPLE++ AKEKID AA E L+PY
Sbjct  237   GLRHVKADARTYNGASSSATEWENKLDSFWQDRIQGQDPLEILKAKEKIDGAATEVLDPY  296

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KH+KLKH +LV++LTSK RED+YF+NYM+
Sbjct  297   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHIKLKHTDLVVDLTSKAREDIYFENYMN  356

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+ K  R+RP +ESRL+D                  +R  + L S
Sbjct  357   DPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRD------------------ERGNHRLDS  397

Query  801   DIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
                  D  G NPD+ ++DSFG    HG    AFP DI  PPVLMPVPGAG
Sbjct  398   -----DGSGENPDDPVYDSFGDPTMHG----AFPPDIPAPPVLMPVPGAG  438


 Score = 92.8 bits (229),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 60/90 (67%), Gaps = 11/90 (12%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGGQAP---------IIALPP  425
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+  +  G              A PP
Sbjct  439  PLGPFIPAPPEVAMHMLRDQGAPPPFEPSGGPHPRKAGRGSGGGGPPMRGPSPVFSAPPP  498

Query  424  SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  499  HHMHDPRRIRSYQDLDAPEDEVTVMDYRSL  528



>ref|XP_003574791.1| PREDICTED: serrate RNA effector molecule-like [Brachypodium distachyon]
Length=636

 Score =   481 bits (1237),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 274/470 (58%), Positives = 346/470 (74%), Gaps = 42/470 (9%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYK F+ ELEDD+ P EA+ RY+EYKS YI  QK+AYFD HK+E+WL++KYHPTN
Sbjct  116   REGLMSYKHFMLELEDDVSPVEAQSRYEEYKSEYITTQKKAYFDLHKNEDWLRNKYHPTN  175

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SV+ERRNE AR  A +F  DLQSG LD GPG++ + +N +G       +++ +A  K+
Sbjct  176   LESVMERRNELARGTANEFFQDLQSGRLDTGPGLS-SAANKSG-------NNDLNANGKK  227

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +H   P     L   APKAHPVSSE RR+ ID++Q+Q L++KLDSEKGIE N+LS +D+
Sbjct  228   GKH---PDD---LYYAAPKAHPVSSEARRVSIDIQQAQALISKLDSEKGIENNVLSGTDD  281

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+ +RD S+ S     +VI+RG ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  282   DKAARDTSHGSMGP--IVIIRGASTVKGLEGVELLDTLVTYLWRIHGVDYYGMSETNEPK  339

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +  +  SSN A+WE  LDS W++R++GQDPLE++ AKEKIDTAA E L+PY
Sbjct  340   GLRHVKSDSRTYDGASSNAAEWEENLDSFWQDRIQGQDPLEILKAKEKIDTAASEVLDPY  399

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA+EFV KHLKLKH E V+ELTSKVR+D+YF+NYM+
Sbjct  400   VRKIRDEKYGWKYGCGAKGCTKLFHASEFVTKHLKLKHTEFVVELTSKVRDDIYFENYMN  459

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+EK  ++RP +ESRL+D+               RFDR     ++
Sbjct  460   DPKAPGGTPIMQQPAPREK-GKQRPPIESRLRDE------------RGRRFDR-----NA  501

Query  801   DIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
             D  S D  G NPD+ M+DS+G    HG    AFP D+  PP+LMPVPGAG
Sbjct  502   DSPSQDGSGENPDDPMYDSYGNPTMHG----AFPPDVPAPPMLMPVPGAG  547


 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/91 (59%), Positives = 62/91 (68%), Gaps = 14/91 (15%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGG----------QAPIIALP  428
            PLGPF+PAPPEVAM+MLREQGGP PFE   G   R+  + GG           AP++  P
Sbjct  548  PLGPFIPAPPEVAMRMLREQGGPTPFEPAAGPRPRKAGKGGGPPMGGPSPMLNAPLMHDP  607

Query  427  PSLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                 DPR+IRSYQDLDAP DEVTV+DYRSL
Sbjct  608  --RMHDPRKIRSYQDLDAPGDEVTVMDYRSL  636



>ref|XP_008663993.1| PREDICTED: serrate RNA effector molecule isoform X1 [Zea mays]
 gb|ACR36031.1| unknown [Zea mays]
 tpg|DAA48117.1| TPA: putative SERRATE-related C2H2 zinc-finger family protein 
[Zea mays]
Length=641

 Score =   480 bits (1236),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 283/467 (61%), Positives = 344/467 (74%), Gaps = 25/467 (5%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+ P EA+ RY+ YKS YI  QK+AYFD HK+E+WL++KYHPTN
Sbjct  112   REGLMSYKQFIQELEDDVSPVEAQSRYEGYKSEYITTQKKAYFDLHKNEDWLRNKYHPTN  171

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L +VIERRNE AR  A DF L LQSG LD+GPG+T +  + +G +S  N D  A  GD +
Sbjct  172   LENVIERRNELARTTANDFFLKLQSGDLDIGPGLTGSAVSKSGNNSSKNLD--AVEGDGK  229

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +      S D+     A KAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE N+LS SD+
Sbjct  230   KGKHGKGSDDSYYA--ASKAHPVSSEVRRIRIDIEQAQVLIRKLDSEKGIENNVLSSSDH  287

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RDKS+ S     +VI++G ++VKGLEGAELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  288   EKSDRDKSHGSVGP--IVIIQGSSTVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPK  345

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SSNGA+WE KLDS W++R++GQDPLE++  KEKID AA E L+PY
Sbjct  346   GLRHVKADARTYNGASSNGAEWENKLDSFWQDRIQGQDPLEMLKGKEKIDGAATEVLDPY  405

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KHLKLKH +LV++LTSKVRED+YF+NYM+
Sbjct  406   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHLKLKHADLVVDLTSKVREDIYFENYMN  465

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+ K  R+RP +ESRL+D+            G  RFDR     + 
Sbjct  466   DPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRDE-----------RGNHRFDR-----NV  508

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D    D  G NPD+ ++DSFG   +   AFP DI  PPVLMPVPGAG
Sbjct  509   DSPKRDGSGENPDDPIYDSFGDPAM-HGAFPPDIPAPPVLMPVPGAG  554


 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQ-----GPQIGGQAPIIALP-PSLR  416
            PLGPF+PAPPEVAM MLR+QG P P E  GG + R+     GP + G +PI   P P   
Sbjct  555  PLGPFIPAPPEVAMHMLRDQGAPPPIEPTGGPHPRKAGTGGGPSMRGPSPIFGAPSPHHM  614

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  615  HDPRRIRSYQDLDAPEDEVTVMDYRSL  641



>ref|XP_006657295.1| PREDICTED: serrate RNA effector molecule-like [Oryza brachyantha]
Length=587

 Score =   477 bits (1228),  Expect(2) = 1e-156, Method: Compositional matrix adjust.
 Identities = 290/467 (62%), Positives = 352/467 (75%), Gaps = 15/467 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+Q LEDDILPAEAERRYQEY++ YI  QKRAYFD HK++E LK+KYHPTN
Sbjct  51    REGLMTYKQFMQVLEDDILPAEAERRYQEYRTEYITTQKRAYFDIHKNDELLKNKYHPTN  110

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SVI+ RN R + +A +F  DLQ+GTLDLGPG+T   ++     S+  + D+    DKR
Sbjct  111   LSSVIDSRNARCKGVASNFFHDLQNGTLDLGPGITAAAASKAASGSD-GNTDDDGDNDKR  169

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H R  SK+   LS AP AHPVSSE RR+ +D+EQ+  LV KLD+EKGI  NILS  D+
Sbjct  170   RKHGRISSKETDPLSGAPVAHPVSSESRRVQVDIEQALALVRKLDTEKGIVGNILSSGDH  229

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+TLLTYLWRIHGVDYYGM E NE K
Sbjct  230   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTLLTYLWRIHGVDYYGMSEANEPK  288

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G+RH+R D K + T++ N ADWE+KLD+ W+ERL GQDP+ ++ AK+KID AAVE LEPY
Sbjct  289   GIRHVRADSKASNTTNINAADWEKKLDTFWQERLIGQDPMVILAAKDKIDAAAVEVLEPY  348

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHPELV+ELTSKVREDLYFQNYM+
Sbjct  349   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPELVIELTSKVREDLYFQNYMN  408

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P +   R+RP +++RL+ DR NRRE +       R+ R       
Sbjct  409   DPNAPGGTPVMQQSAPDK--SRQRPGMDNRLRYDRANRREYDRAERDGGRYSR------G  460

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D   + DG    D+QMFD+F G G P A F  +I  PP+LMPVPGAG
Sbjct  461   DRSPSRDGA---DDQMFDAFRGRG-PNAPFVPEIPAPPILMPVPGAG  503


 Score =   106 bits (264),  Expect(2) = 1e-156, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 65/84 (77%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE      G  G  GP +GG APII +PPS R DP
Sbjct  504  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGPAHGNAGVLGPMMGGPAPIITMPPSFRHDP  563

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  564  RRLRSYNDLDAPDEEVTVLDYRSL  587



>gb|KEH32827.1| serrate RNA effector molecule-like protein [Medicago truncatula]
Length=591

 Score =   477 bits (1228),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 265/374 (71%), Positives = 310/374 (83%), Gaps = 5/374 (1%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRAYF+ HKD EWLKDKYHPTN
Sbjct  176   REGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAYFNTHKDAEWLKDKYHPTN  235

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE AR++AK+FLLDLQSGTLD+ PG+  + S  + Q++EPNS++E DAG KR
Sbjct  236   LLTVIERRNENARRLAKEFLLDLQSGTLDINPGLN-SASTKSEQATEPNSEEETDAGGKR  294

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RG +KD    S APKAHPVSSEPRRI  D+ Q Q +V KLD EKGIE+NIL  +D+
Sbjct  295   RRHGRGSNKDNDF-SAAPKAHPVSSEPRRIQEDIHQVQAVVRKLDKEKGIEDNILCTNDH  353

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              + S    + S     VVI+RGLTS+KGLEG ELL+TL+TYLWRIHGVDYYGM+ET++AK
Sbjct  354   SKNSDKARSGSVGP--VVIIRGLTSIKGLEGVELLDTLITYLWRIHGVDYYGMLETSDAK  411

Query  1338  GLRHMRFDG-KNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R +G ++ ET+ +G++WE+KLDS W+ RL G DPLEV TAKEKID AA + L+PY
Sbjct  412   GFRHVRPEGARHEETAKSGSEWEKKLDSFWQRRLDGLDPLEVRTAKEKIDAAAADMLDPY  471

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAK CTKLFHA EFV+KHLKLKHPELVLELTSK+REDLYFQNYM+
Sbjct  472   VRKIRDEKYGWKYGCGAKSCTKLFHAVEFVYKHLKLKHPELVLELTSKLREDLYFQNYMN  531

Query  981   DESAPGGTPVMLSS  940
             D  APGGTPVM  S
Sbjct  532   DPDAPGGTPVMQQS  545



>ref|XP_008663998.1| PREDICTED: serrate RNA effector molecule isoform X2 [Zea mays]
Length=526

 Score =   474 bits (1220),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 279/462 (60%), Positives = 340/462 (74%), Gaps = 25/462 (5%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             SYKQFIQELEDD+ P EA+ RY+ YKS YI  QK+AYFD HK+E+WL++KYHPTNL +VI
Sbjct  2     SYKQFIQELEDDVSPVEAQSRYEGYKSEYITTQKKAYFDLHKNEDWLRNKYHPTNLENVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRNE AR  A DF L LQSG LD+GPG+T +  + +G +S  N D  A  GD ++    
Sbjct  62    ERRNELARTTANDFFLKLQSGDLDIGPGLTGSAVSKSGNNSSKNLD--AVEGDGKKGKHG  119

Query  1683  GPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsr  1504
               S D+     A KAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE N+LS SD+++  R
Sbjct  120   KGSDDSYYA--ASKAHPVSSEVRRIRIDIEQAQVLIRKLDSEKGIENNVLSSSDHEKSDR  177

Query  1503  dksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHM  1324
             DKS+ S     +VI++G ++VKGLEGAELL+TL+TYLWRIHGVDYYGM ETNE KGLRH+
Sbjct  178   DKSHGSVGP--IVIIQGSSTVKGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHV  235

Query  1323  RFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIR  1147
             + D +     SSNGA+WE KLDS W++R++GQDPLE++  KEKID AA E L+PYVRKIR
Sbjct  236   KADARTYNGASSNGAEWENKLDSFWQDRIQGQDPLEMLKGKEKIDGAATEVLDPYVRKIR  295

Query  1146  DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAP  967
             DEKYGWKYGCGAKGCTKLFHAAEFV KHLKLKH +LV++LTSKVRED+YF+NYM+D  AP
Sbjct  296   DEKYGWKYGCGAKGCTKLFHAAEFVQKHLKLKHADLVVDLTSKVREDIYFENYMNDPKAP  355

Query  966   GGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSN  787
             GGTP+M    P+ K  R+RP +ESRL+D+            G  RFDR     + D    
Sbjct  356   GGTPIMQQPAPRGK-GRQRPPIESRLRDE-----------RGNHRFDR-----NVDSPKR  398

Query  786   DDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D  G NPD+ ++DSFG   +   AFP DI  PPVLMPVPGAG
Sbjct  399   DGSGENPDDPIYDSFGDPAM-HGAFPPDIPAPPVLMPVPGAG  439


 Score = 99.0 bits (245),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQ-----GPQIGGQAPIIALP-PSLR  416
            PLGPF+PAPPEVAM MLR+QG P P E  GG + R+     GP + G +PI   P P   
Sbjct  440  PLGPFIPAPPEVAMHMLRDQGAPPPIEPTGGPHPRKAGTGGGPSMRGPSPIFGAPSPHHM  499

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  500  HDPRRIRSYQDLDAPEDEVTVMDYRSL  526



>ref|XP_008678364.1| PREDICTED: serrate RNA effector molecule isoform X2 [Zea mays]
Length=581

 Score =   476 bits (1225),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 339/470 (72%), Gaps = 38/470 (8%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+ P EA+ RY+EYKS YI  QK+AYF  HKDE+WL++KYHPTN
Sbjct  56    REGLMSYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFALHKDEDWLRNKYHPTN  115

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L +VIERRNE AR  A DF L LQSG+LD GPG+T +  + +G +S  N D  A  GD +
Sbjct  116   LENVIERRNELARTTADDFFLQLQSGSLDTGPGLTGSAVSKSGNNSSKNLD--AVEGDGK  173

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +      S D+     APKAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE NILS S++
Sbjct  174   KGKLGKGSDDSYYA--APKAHPVSSEVRRIRIDIEQAQGLICKLDSEKGIENNILSSSNH  231

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++   DKS+ S     +VIV+G ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  232   EKPDMDKSHGSMGP--IVIVQGSSTVKGLEGTELLDTLVTYLWRIHGVDYYGMSETNEPK  289

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SS+  +WE KLDS W++R++GQDPLE++ AKEKID AA E L+PY
Sbjct  290   GLRHVKADARTYNGASSSATEWENKLDSFWQDRIQGQDPLEILKAKEKIDGAATEVLDPY  349

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KH+KLKH +LV++LTSK RED+YF+NYM+
Sbjct  350   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHIKLKHTDLVVDLTSKAREDIYFENYMN  409

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+ K  R+RP +ESRL+D                  +R  + L S
Sbjct  410   DPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRD------------------ERGNHRLDS  450

Query  801   DIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
                  D  G NPD+ ++DSFG    HG    AFP DI  PPVLMPVPGAG
Sbjct  451   -----DGSGENPDDPVYDSFGDPTMHG----AFPPDIPAPPVLMPVPGAG  491


 Score = 92.8 bits (229),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 60/90 (67%), Gaps = 11/90 (12%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGGQAP---------IIALPP  425
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+  +  G              A PP
Sbjct  492  PLGPFIPAPPEVAMHMLRDQGAPPPFEPSGGPHPRKAGRGSGGGGPPMRGPSPVFSAPPP  551

Query  424  SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  552  HHMHDPRRIRSYQDLDAPEDEVTVMDYRSL  581



>ref|XP_002438945.1| hypothetical protein SORBIDRAFT_10g028740 [Sorghum bicolor]
 gb|EER90312.1| hypothetical protein SORBIDRAFT_10g028740 [Sorghum bicolor]
Length=713

 Score =   480 bits (1236),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 288/453 (64%), Positives = 345/453 (76%), Gaps = 18/453 (4%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+Q LEDDI P+EAERRYQEY++ YI  QKRAYFD HK+E+WLKDKYHPTN
Sbjct  178   REGLMTYKQFMQVLEDDISPSEAERRYQEYRTEYITTQKRAYFDLHKNEDWLKDKYHPTN  237

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNER + +AKDF LDLQ+GTLDLGPG+T   ++  G  S+ NS+D+ D  DKR
Sbjct  238   LLSVIERRNERCKVIAKDFFLDLQNGTLDLGPGITAGAASKPG-GSDGNSEDDMD-NDKR  295

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H +  SK    LS APKAHPVSSE RR+  D+EQ+  LV KLD+EK IE N+LS  D+
Sbjct  296   RKHGKDSSKATDSLSGAPKAHPVSSESRRVQADIEQTLALVRKLDAEKAIEGNVLSSCDH  355

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+T+LTYLWRIHGVDYYG  E++EAK
Sbjct  356   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTILTYLWRIHGVDYYGTSESHEAK  414

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K + TS  + ADWE+KLD+ W+ERL GQDPL ++TAK+KID AA E LEP 
Sbjct  415   GLRHVRVDSKTSSTSDVSAADWEKKLDTFWQERLNGQDPLVILTAKDKIDAAAAEVLEPL  474

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+LVLE TSKVREDLYFQNYM+
Sbjct  475   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLVLESTSKVREDLYFQNYMN  534

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P     RRRPS+++RLK DRG+ RE +       R+ R +   S 
Sbjct  535   DPNAPGGTPVMQQSAPDRG--RRRPSMDNRLKFDRGSNREHDKSERDGGRYGRGDQSPSR  592

Query  801   DIQSNDDGGRNPDEQMFDSFGG---HGIPVAAF  712
             D          PD+QMFD F G   +G  VA F
Sbjct  593   D---------GPDDQMFDGFRGRSSNGPFVAEF  616


 Score =   108 bits (270),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE      G  G  GP +GG APIIA+PP+ R DP
Sbjct  630  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGPPHGNTGMLGPMMGGPAPIIAMPPNFRHDP  689

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  690  RRLRSYNDLDAPDEEVTVLDYRSL  713



>ref|NP_001168339.1| uncharacterized protein LOC100382107 [Zea mays]
 gb|ACN27870.1| unknown [Zea mays]
Length=565

 Score =   474 bits (1220),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 281/437 (64%), Positives = 336/437 (77%), Gaps = 15/437 (3%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             +YKQF+  LEDDI P+EAERRYQEY++ YI  QKRAYFD HK+E+WLKDKYHPTNL+SVI
Sbjct  2     TYKQFMLVLEDDISPSEAERRYQEYRTEYITTQKRAYFDLHKNEDWLKDKYHPTNLLSVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRNER + +AKDF LDLQ+GTLDLGPG+T   ++  G  S+ NSDD+ D  DKRR+H +
Sbjct  62    ERRNERCKVIAKDFFLDLQNGTLDLGPGITGGAASKPG-GSDGNSDDDTD-NDKRRKHGK  119

Query  1683  GPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsr  1504
               SK    +S A KAHPVSSE RR+  D+EQ+  LV KLDSEKGIEEN+LS  D+D+   
Sbjct  120   DSSKGTDSISGALKAHPVSSESRRVQADIEQTLALVRKLDSEKGIEENVLSSGDHDKSDV  179

Query  1503  dksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHM  1324
             DKS+  S GP+++I RGLT+VKGLEG ELL+T+LTYLWRIHGVDYYG  E++EAKGLRH+
Sbjct  180   DKSHIGSMGPIIII-RGLTTVKGLEGVELLDTILTYLWRIHGVDYYGTSESHEAKGLRHV  238

Query  1323  RFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIR  1147
             R D K + TS  + ADWE+KLD+ W+ERL GQDPL ++TAK+KID AA E LEP VRKIR
Sbjct  239   RVDSKTSSTSDVSAADWEKKLDTFWQERLNGQDPLVILTAKDKIDAAAAEVLEPLVRKIR  298

Query  1146  DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAP  967
             DEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+LVLE TSKVREDLYFQNYM D +AP
Sbjct  299   DEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLVLESTSKVREDLYFQNYMKDPNAP  358

Query  966   GGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSN  787
             GGTPVM  S P     RRRPS++SRLK DRG+ +E +       R+ R ++  S D    
Sbjct  359   GGTPVMQLSAPDRG--RRRPSMDSRLKFDRGSNKEHDKAERDGGRYGRDDHSPSRD----  412

Query  786   DDGGRNPDEQMFDSFGG  736
                   PD+QMFD F G
Sbjct  413   -----GPDDQMFDGFRG  424


 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 5/65 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE      G  G  GP +GG APIIA+PP+ R DP
Sbjct  449  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGAPHGSTGMLGPMLGGSAPIIAMPPNFRHDP  508

Query  406  RRIRS  392
            RR+RS
Sbjct  509  RRLRS  513



>ref|XP_008648070.1| PREDICTED: uncharacterized protein LOC100382107 isoform X2 [Zea 
mays]
 gb|AFW75886.1| putative SERRATE-related C2H2 zinc-finger family protein [Zea 
mays]
Length=710

 Score =   479 bits (1233),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 285/442 (64%), Positives = 340/442 (77%), Gaps = 15/442 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+  LEDDI P+EAERRYQEY++ YI  QKRAYFD HK+E+WLKDKYHPTN
Sbjct  175   REGLMTYKQFMLVLEDDISPSEAERRYQEYRTEYITTQKRAYFDLHKNEDWLKDKYHPTN  234

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNER + +AKDF LDLQ+GTLDLGPG+T   ++  G  S+ NSDD+ D  DKR
Sbjct  235   LLSVIERRNERCKVIAKDFFLDLQNGTLDLGPGITGGAASKPG-GSDGNSDDDTD-NDKR  292

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H +  SK    +S A KAHPVSSE RR+  D+EQ+  LV KLDSEKGIEEN+LS  D+
Sbjct  293   RKHGKDSSKGTDSISGALKAHPVSSESRRVQADIEQTLALVRKLDSEKGIEENVLSSGDH  352

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+T+LTYLWRIHGVDYYG  E++EAK
Sbjct  353   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTILTYLWRIHGVDYYGTSESHEAK  411

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K + TS  + ADWE+KLD+ W+ERL GQDPL ++TAK+KID AA E LEP 
Sbjct  412   GLRHVRVDSKTSSTSDVSAADWEKKLDTFWQERLNGQDPLVILTAKDKIDAAAAEVLEPL  471

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+LVLE TSKVREDLYFQNYM 
Sbjct  472   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLVLESTSKVREDLYFQNYMK  531

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P     RRRPS++SRLK DRG+ +E +       R+ R ++  S 
Sbjct  532   DPNAPGGTPVMQLSAPDRG--RRRPSMDSRLKFDRGSNKEHDKAERDGGRYGRDDHSPSR  589

Query  801   DIQSNDDGGRNPDEQMFDSFGG  736
             D          PD+QMFD F G
Sbjct  590   D---------GPDDQMFDGFRG  602


 Score =   117 bits (293),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 5/84 (6%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE      G  G  GP +GG APIIA+PP+ R DP
Sbjct  627  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGAPHGSTGMLGPMLGGSAPIIAMPPNFRHDP  686

Query  406  RRIRSYQDLDAPEDEVTVIDYRSL  335
            RR+RSY DLDAP++EVTV+DYRSL
Sbjct  687  RRLRSYNDLDAPDEEVTVLDYRSL  710



>ref|XP_008648068.1| PREDICTED: uncharacterized protein LOC100382107 isoform X1 [Zea 
mays]
 gb|AFW75885.1| putative SERRATE-related C2H2 zinc-finger family protein [Zea 
mays]
Length=743

 Score =   480 bits (1235),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 285/442 (64%), Positives = 340/442 (77%), Gaps = 15/442 (3%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQF+  LEDDI P+EAERRYQEY++ YI  QKRAYFD HK+E+WLKDKYHPTN
Sbjct  175   REGLMTYKQFMLVLEDDISPSEAERRYQEYRTEYITTQKRAYFDLHKNEDWLKDKYHPTN  234

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNER + +AKDF LDLQ+GTLDLGPG+T   ++  G  S+ NSDD+ D  DKR
Sbjct  235   LLSVIERRNERCKVIAKDFFLDLQNGTLDLGPGITGGAASKPG-GSDGNSDDDTD-NDKR  292

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H +  SK    +S A KAHPVSSE RR+  D+EQ+  LV KLDSEKGIEEN+LS  D+
Sbjct  293   RKHGKDSSKGTDSISGALKAHPVSSESRRVQADIEQTLALVRKLDSEKGIEENVLSSGDH  352

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+T+LTYLWRIHGVDYYG  E++EAK
Sbjct  353   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTILTYLWRIHGVDYYGTSESHEAK  411

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH+R D K + TS  + ADWE+KLD+ W+ERL GQDPL ++TAK+KID AA E LEP 
Sbjct  412   GLRHVRVDSKTSSTSDVSAADWEKKLDTFWQERLNGQDPLVILTAKDKIDAAAAEVLEPL  471

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHP+LVLE TSKVREDLYFQNYM 
Sbjct  472   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPDLVLESTSKVREDLYFQNYMK  531

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P     RRRPS++SRLK DRG+ +E +       R+ R ++  S 
Sbjct  532   DPNAPGGTPVMQLSAPDRG--RRRPSMDSRLKFDRGSNKEHDKAERDGGRYGRDDHSPSR  589

Query  801   DIQSNDDGGRNPDEQMFDSFGG  736
             D          PD+QMFD F G
Sbjct  590   D---------GPDDQMFDGFRG  602


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/65 (66%), Positives = 48/65 (74%), Gaps = 5/65 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----GGRNGRQGPQIGGQAPIIALPPSLRQDP  407
            PLGPFVPAPPE+AM MLREQG P PFE      G  G  GP +GG APIIA+PP+ R DP
Sbjct  627  PLGPFVPAPPEIAMHMLREQGPPPPFEPNGAPHGSTGMLGPMLGGSAPIIAMPPNFRHDP  686

Query  406  RRIRS  392
            RR+RS
Sbjct  687  RRLRS  691



>ref|XP_008678363.1| PREDICTED: serrate RNA effector molecule isoform X1 [Zea mays]
Length=628

 Score =   475 bits (1223),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 279/470 (59%), Positives = 339/470 (72%), Gaps = 38/470 (8%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDD+ P EA+ RY+EYKS YI  QK+AYF  HKDE+WL++KYHPTN
Sbjct  103   REGLMSYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFALHKDEDWLRNKYHPTN  162

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L +VIERRNE AR  A DF L LQSG+LD GPG+T +  + +G +S  N D  A  GD +
Sbjct  163   LENVIERRNELARTTADDFFLQLQSGSLDTGPGLTGSAVSKSGNNSSKNLD--AVEGDGK  220

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +      S D+     APKAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE NILS S++
Sbjct  221   KGKLGKGSDDSYYA--APKAHPVSSEVRRIRIDIEQAQGLICKLDSEKGIENNILSSSNH  278

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++   DKS+ S     +VIV+G ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  279   EKPDMDKSHGSMGP--IVIVQGSSTVKGLEGTELLDTLVTYLWRIHGVDYYGMSETNEPK  336

Query  1338  GLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +     SS+  +WE KLDS W++R++GQDPLE++ AKEKID AA E L+PY
Sbjct  337   GLRHVKADARTYNGASSSATEWENKLDSFWQDRIQGQDPLEILKAKEKIDGAATEVLDPY  396

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KH+KLKH +LV++LTSK RED+YF+NYM+
Sbjct  397   VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHIKLKHTDLVVDLTSKAREDIYFENYMN  456

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M    P+ K  R+RP +ESRL+D                  +R  + L S
Sbjct  457   DPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRD------------------ERGNHRLDS  497

Query  801   DIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
                  D  G NPD+ ++DSFG    HG    AFP DI  PPVLMPVPGAG
Sbjct  498   -----DGSGENPDDPVYDSFGDPTMHG----AFPPDIPAPPVLMPVPGAG  538


 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 60/90 (67%), Gaps = 11/90 (12%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGGQAP---------IIALPP  425
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+  +  G              A PP
Sbjct  539  PLGPFIPAPPEVAMHMLRDQGAPPPFEPSGGPHPRKAGRGSGGGGPPMRGPSPVFSAPPP  598

Query  424  SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  599  HHMHDPRRIRSYQDLDAPEDEVTVMDYRSL  628



>gb|AFW61518.1| putative SERRATE-related C2H2 zinc-finger family protein [Zea 
mays]
Length=522

 Score =   469 bits (1206),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 275/465 (59%), Positives = 335/465 (72%), Gaps = 38/465 (8%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             SYKQFIQELEDD+ P EA+ RY+EYKS YI  QK+AYF  HKDE+WL++KYHPTNL +VI
Sbjct  2     SYKQFIQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFALHKDEDWLRNKYHPTNLENVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRNE AR  A DF L LQSG+LD GPG+T +  + +G +S  N D  A  GD ++    
Sbjct  62    ERRNELARTTADDFFLQLQSGSLDTGPGLTGSAVSKSGNNSSKNLD--AVEGDGKKGKLG  119

Query  1683  GPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsr  1504
               S D+     APKAHPVSSE RRI ID+EQ+Q L+ KLDSEKGIE NILS S++++   
Sbjct  120   KGSDDSYYA--APKAHPVSSEVRRIRIDIEQAQGLICKLDSEKGIENNILSSSNHEKPDM  177

Query  1503  dksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHM  1324
             DKS+ S     +VIV+G ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE KGLRH+
Sbjct  178   DKSHGSMGP--IVIVQGSSTVKGLEGTELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHV  235

Query  1323  RFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIR  1147
             + D +     SS+  +WE KLDS W++R++GQDPLE++ AKEKID AA E L+PYVRKIR
Sbjct  236   KADARTYNGASSSATEWENKLDSFWQDRIQGQDPLEILKAKEKIDGAATEVLDPYVRKIR  295

Query  1146  DEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAP  967
             DEKYGWKYGCGAKGCTKLFHAAEFV KH+KLKH +LV++LTSK RED+YF+NYM+D  AP
Sbjct  296   DEKYGWKYGCGAKGCTKLFHAAEFVQKHIKLKHTDLVVDLTSKAREDIYFENYMNDPKAP  355

Query  966   GGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSN  787
             GGTP+M    P+ K  R+RP +ESRL+D                  +R  + L S     
Sbjct  356   GGTPIMQQPAPRGK-GRQRPPIESRLRD------------------ERGNHRLDS-----  391

Query  786   DDGGRNPDEQMFDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
             D  G NPD+ ++DSFG    HG    AFP DI  PPVLMPVPGAG
Sbjct  392   DGSGENPDDPVYDSFGDPTMHG----AFPPDIPAPPVLMPVPGAG  432


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 60/90 (67%), Gaps = 11/90 (12%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGGQAP---------IIALPP  425
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+  +  G              A PP
Sbjct  433  PLGPFIPAPPEVAMHMLRDQGAPPPFEPSGGPHPRKAGRGSGGGGPPMRGPSPVFSAPPP  492

Query  424  SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  493  HHMHDPRRIRSYQDLDAPEDEVTVMDYRSL  522



>gb|EEE66291.1| hypothetical protein OsJ_22514 [Oryza sativa Japonica Group]
Length=1248

 Score =   487 bits (1253),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 287/472 (61%), Positives = 351/472 (74%), Gaps = 29/472 (6%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL +YKQFIQ LEDDI PAEAE+RYQEY++ YI  QKRAYFD +K+++ LKDKYHPTN
Sbjct  40    REGLMTYKQFIQVLEDDISPAEAEKRYQEYRTEYITTQKRAYFDLNKNDDRLKDKYHPTN  99

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SVI+RRN+  +  AKDF  DLQ+GTLDLGPG+T   ++ +  +S+     +    DKR
Sbjct  100   LSSVIDRRNDSCKATAKDFFHDLQNGTLDLGPGITAAAASGSDGNSD-----DDGDSDKR  154

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H RG SK+   LS AP AHPVSSE RR+ +D+EQ+  LV KLD+EKGI  NILS  D+
Sbjct  155   RKHGRGSSKETDPLSGAPVAHPVSSESRRVQVDIEQALALVRKLDTEKGIVGNILSSGDH  214

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+   DKS+  S GP+++I RGLT+VKGLEG ELL+TLLTYLWRIHGVDYYGM ETNEAK
Sbjct  215   DKSDVDKSHIGSMGPIIII-RGLTTVKGLEGVELLDTLLTYLWRIHGVDYYGMSETNEAK  273

Query  1338  GLRHMRFDGKNTETSS-NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             G RH+R D K + T++ N ADWE+K+D+ W+ERL+GQDP+ ++ AK+KID AAVE LEPY
Sbjct  274   GSRHVRADNKTSNTTNINAADWEKKVDTFWQERLRGQDPMVILAAKDKIDAAAVEVLEPY  333

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA EFVHKHL+LKHPELVLELTSKVREDLYFQNYM+
Sbjct  334   VRKIRDEKYGWKYGCGAKGCTKLFHAPEFVHKHLRLKHPELVLELTSKVREDLYFQNYMN  393

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D +APGGTPVM  S P +   R+RP +++RL+ D                +DR E     
Sbjct  394   DPNAPGGTPVMQQSAPDK--SRQRPGMDNRLRYD----------RANRREYDRAER----  437

Query  801   DIQSNDDGGRNP-----DEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D      G R+P     D+QMFD+F G G P A F  ++  PP+LMP+PGAG
Sbjct  438   DGSRYGRGDRSPSLDGADDQMFDAFRGRG-PNAPFVPELPAPPILMPIPGAG  488



>gb|EMS62084.1| Calcium-transporting ATPase 9, plasma membrane-type [Triticum 
urartu]
Length=1525

 Score =   492 bits (1266),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 272/467 (58%), Positives = 340/467 (73%), Gaps = 33/467 (7%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQF+QELEDD+ P EA+ RY+EYKS YI  QK+AYFD HK+E+WL++KYHPTN
Sbjct  60    REGLMSYKQFMQELEDDVSPVEAQSRYEEYKSEYITTQKKAYFDLHKNEDWLRNKYHPTN  119

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L SV+ERRNE AR  A +F  DLQSG  D GPG+T + +N +G       +++ +   K+
Sbjct  120   LESVMERRNELARATANEFFQDLQSGNFDTGPGLTSSAANKSG-------NNDVNVNGKK  172

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
              +  + P     L   APKAHPVSSEPRRI ID+EQ+Q L+ KLDSEKGIE N+LS SD+
Sbjct  173   GKLGKDPDD---LYYSAPKAHPVSSEPRRISIDIEQAQALICKLDSEKGIENNVLSSSDD  229

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             D+       S      +VI+RG ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE K
Sbjct  230   DKAGSGSHGSMGP---IVIIRGASTVKGLEGVELLDTLVTYLWRIHGVDYYGMSETNEPK  286

Query  1338  GLRHMRFDGKNTET-SSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPY  1162
             GLRH++ D +  +  SSN A+WE KLDS W++R++GQDPLE++ AK+KID AA E L+P+
Sbjct  287   GLRHVKADSRTYDGPSSNTAEWEEKLDSFWQDRIQGQDPLEILKAKDKIDAAASEVLDPH  346

Query  1161  VRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             VRKIRDEKYGWKYGCGAKGCTKLFHA+EFV KHLKLKH + V+ELTSKVRED+YF+NYM+
Sbjct  347   VRKIRDEKYGWKYGCGAKGCTKLFHASEFVTKHLKLKHTDFVVELTSKVREDIYFENYMN  406

Query  981   DESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
             D  APGGTP+M  S P+EK  R+RP +ESRL+D+               RFDR     ++
Sbjct  407   DPKAPGGTPIMQQSAPREK-GRQRPPIESRLRDE------------RGRRFDR-----NA  448

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D  + D    NPD+ M+DS+G   +   AFP DI  PP+LMPVPGAG
Sbjct  449   DSSNPDGSSENPDDPMYDSYGDPSVH-GAFPPDIPAPPMLMPVPGAG  494



>emb|CDX71472.1| BnaC04g17070D [Brassica napus]
Length=703

 Score =   465 bits (1196),  Expect(2) = 1e-151, Method: Compositional matrix adjust.
 Identities = 282/473 (60%), Positives = 350/473 (74%), Gaps = 22/473 (5%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR YF+ HK+EEWLKDKYHPTN
Sbjct  174   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVYFNTHKEEEWLKDKYHPTN  233

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE A+K+AKDF+L LQSG LDLGP  T    N  G++SEPNS+DEA  G KR
Sbjct  234   LLTVIERRNELAQKVAKDFILSLQSGNLDLGPAATAL--NKAGRTSEPNSEDEAVGGGKR  291

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R   R  S    +L+ APKA   +S+P+RI  D+EQ+Q LV KLD+EKGI+EN+LS S+ 
Sbjct  292   RPVKR-ESAGTDVLA-APKAPSFTSDPKRILTDIEQTQALVRKLDAEKGIKENVLSGSET  349

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RD  +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETNEAK
Sbjct  350   EKSGRDNVHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKLETNEAK  408

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G+RH+R +GK ++  + G + E K DS W+ERLKGQDPLE M AKEK++ AA+EAL+P+V
Sbjct  409   GMRHVRAEGKGSD--AKGDESENKFDSHWQERLKGQDPLEGMAAKEKLEAAAIEALDPHV  466

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKH ELV++ T+KVRE+LYFQNYM+D
Sbjct  467   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHAELVVDQTAKVREELYFQNYMND  526

Query  978   ESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
              +APGG P      P+++ + RR+P +E+RL+         +        +    N  S 
Sbjct  527   PNAPGGQPATQQPGPRDRPMMRRKPGMENRLR--------DDRGGRRERAYGNDRNDRSE  578

Query  801   DIQSNDDGG---RNPDEQMFDSFGGHGIP---VAAFPSDITPPPVLMPVPGAG  661
             D +  D  G    NP+E       G G     V ++ +DI  PP+LMPVPGAG
Sbjct  579   DQRRGDGNGPVDPNPEEGGGFDAFGGGQGGFQVPSYSADINAPPMLMPVPGAG  631


 Score =   101 bits (252),  Expect(2) = 1e-151, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEGG  GR GP     AP + L P+ RQDPRR+R
Sbjct  632  PLGPFVPAPPEVAMQMFRDPSGPNPSFEGG--GRGGP-----APFL-LSPAFRQDPRRLR  683

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  684  SYQDLDAPEEEVTVIDYRSL  703



>emb|CDY04478.1| BnaA07g13040D [Brassica napus]
Length=710

 Score =   462 bits (1188),  Expect(2) = 9e-151, Method: Compositional matrix adjust.
 Identities = 286/467 (61%), Positives = 354/467 (76%), Gaps = 11/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR YF+ HK+EEWLKDKYHPTN
Sbjct  182   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVYFNTHKEEEWLKDKYHPTN  241

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIE+RNE A+K+AKDF+L LQSG LDLGP  T    N  G+SSEPNS+DEAD GD +
Sbjct  242   LLTVIEKRNELAQKVAKDFILSLQSGNLDLGPAATAL--NKAGRSSEPNSEDEAD-GDGK  298

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  +  S    +L+ APKA   +S+P+RI  D+EQ+Q LV KLD+EKGI+EN+LS S+ 
Sbjct  299   RRPVKRESAGTDVLA-APKAPSFTSDPKRILTDIEQTQALVRKLDAEKGIKENVLSGSET  357

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RD  +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETNEAK
Sbjct  358   EKSGRDNVHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKLETNEAK  416

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G+RH+R +GK ++  + G + E K DS W+ERLKG DPLEVM AKEK++ AA+EAL+P+V
Sbjct  417   GMRHVRAEGKGSD--AKGDESENKFDSHWQERLKGPDPLEVMAAKEKLEAAAIEALDPHV  474

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKH ELV++ T+KVRE+LYFQNYM+D
Sbjct  475   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHAELVVDQTAKVREELYFQNYMND  534

Query  978   ESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
              +APGG P      P+++ + RR+P +E+RL+DDRG RRER    +     DR E+    
Sbjct  535   PNAPGGQPATQQPGPRDRPMMRRKPGMENRLRDDRGGRRERAYGNDRN---DRSEDQRRG  591

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D     D             G  G  V  + +D+  PP+LMPVPGAG
Sbjct  592   DGNGPVDPNPEEGGGFEAFGGQGGFQVPPYSADMNAPPMLMPVPGAG  638


 Score =   102 bits (253),  Expect(2) = 9e-151, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEGG  GR GP     AP + L P+ RQDPRR+R
Sbjct  639  PLGPFVPAPPEVAMQMFRDPSGPNPSFEGG--GRGGP-----APFL-LSPAFRQDPRRLR  690

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  691  SYQDLDAPEEEVTVIDYRSL  710



>ref|XP_009103578.1| PREDICTED: serrate RNA effector molecule [Brassica rapa]
Length=710

 Score =   458 bits (1179),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 284/467 (61%), Positives = 353/467 (76%), Gaps = 11/467 (2%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKR YF+ HK+EEWLKDKYHPTN
Sbjct  182   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRVYFNTHKEEEWLKDKYHPTN  241

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIE+RNE A+K+AKDF+L LQSG LDLGP  T    N  G++SEPNS+DEA AGD +
Sbjct  242   LLTVIEKRNELAQKVAKDFILSLQSGNLDLGPAATAL--NKAGRTSEPNSEDEA-AGDGK  298

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RR  +  S    +L+ APKA   +S+P+RI  D+EQ+  LV KLD+EKGI+EN+LS S+ 
Sbjct  299   RRPVKRESAGTDVLA-APKAPSFTSDPKRILTDIEQTPALVRKLDAEKGIKENVLSGSET  357

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
             ++  RD  +S S+GPV++I RGLTSVKGLEG ELL+TL+TYLWR+HGVDYYG +ETNEAK
Sbjct  358   EKSGRDNVHSGSTGPVIII-RGLTSVKGLEGVELLDTLVTYLWRVHGVDYYGKLETNEAK  416

Query  1338  GLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             G+RH+R + K ++  + G + E K DS W+ERLKGQDPLEVM AKEK++ AA+EAL+P+V
Sbjct  417   GMRHVRAEAKGSD--AKGDESENKFDSHWQERLKGQDPLEVMAAKEKLEAAAIEALDPHV  474

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKH ELV++ T+KVRE+LYFQNYM+D
Sbjct  475   RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHAELVVDQTAKVREELYFQNYMND  534

Query  978   ESAPGGTPVMLSSLPKEK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSS  802
              +APGG P      P+++ + RR+P +E+RL+DDRG RRER    +     DR E+    
Sbjct  535   PNAPGGQPATQQPGPRDRPMMRRKPGMENRLRDDRGGRRERAYGNDRN---DRSEDQRRG  591

Query  801   DIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             D     D             G  G  V  + +D+  PP+LMPVPGAG
Sbjct  592   DGNGPVDPNPEEGGGFEAFGGQGGFQVPPYSADMNAPPMLMPVPGAG  638


 Score =   101 bits (252),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEGG  GR GP     AP + L P+ RQDPRR+R
Sbjct  639  PLGPFVPAPPEVAMQMFRDPSGPNPSFEGG--GRGGP-----APFL-LSPAFRQDPRRLR  690

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  691  SYQDLDAPEEEVTVIDYRSL  710



>gb|AAK63208.1|AF311223_1 C2H2 zinc-finger protein [Zea mays]
Length=504

 Score =   441 bits (1133),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 263/441 (60%), Positives = 322/441 (73%), Gaps = 25/441 (6%)
 Frame = -1

Query  1980  YQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSG  1801
             Y+ YKS YI  QK+AYFD HK+E+WL++KYHPTNL +VIERRNE AR  A DF L LQSG
Sbjct  1     YEGYKSEYITTQKKAYFDLHKNEDWLRNKYHPTNLENVIERRNELARTTANDFFLKLQSG  60

Query  1800  TLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSE  1621
              LD+GPG+T +  + +G +S  N D  A  GD ++      S D+     A KAHPVSSE
Sbjct  61    DLDIGPGLTGSAVSKSGNNSSKNLD--AVEGDGKKGKHGKGSDDSYYA--ASKAHPVSSE  116

Query  1620  PRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVVIVRGLTSV  1441
              RRI ID+EQ+Q L+ KLDSEKGIE N+LS SD+++  RDKS+ S     +VI++G ++V
Sbjct  117   VRRIRIDIEQAQVLIRKLDSEKGIENNVLSSSDHEKSDRDKSHGSVGP--IVIIQGSSTV  174

Query  1440  KglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTE-TSSNGADWERKL  1264
             KGLEGAELL+TL+TYLWRIHGVDYYGM ETNE KGLRH++ D +     SSNGA+WE KL
Sbjct  175   KGLEGAELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHVKADARTYNGASSNGAEWENKL  234

Query  1263  DSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHA  1084
             DS W++R++GQDPLE++  KEKID AA E L+PYVRKIRDEKYGWKYGCGAKGCTKLFHA
Sbjct  235   DSFWQDRIQGQDPLEMLKGKEKIDGAATEVLDPYVRKIRDEKYGWKYGCGAKGCTKLFHA  294

Query  1083  AEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPS  904
             AEFV KHLKLKH +LV++LTSKVRED+YF+NYM+D  APGGTP+M    P+ K  R+RP 
Sbjct  295   AEFVQKHLKLKHADLVVDLTSKVREDIYFENYMNDPKAPGGTPIMQQPAPRGK-GRQRPP  353

Query  903   LESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSNDDGGRNPDEQMFDSFGGHGIP  724
             +ESRL+D+            G  RFDR     + D    D  G NPD+ ++DSFG   + 
Sbjct  354   IESRLRDE-----------RGNHRFDR-----NVDSPKRDGSGENPDDPIYDSFGDPAM-  396

Query  723   VAAFPSDITPPPVLMPVPGAG  661
               AFP DI  PPVLMPVPGAG
Sbjct  397   HGAFPPDIPAPPVLMPVPGAG  417


 Score = 99.4 bits (246),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQ-----GPQIGGQAPIIALP-PSLR  416
            PLGPF+PAPPEVAM MLR+QG P P E  GG + R+     GP + G +PI   P P   
Sbjct  418  PLGPFIPAPPEVAMHMLRDQGAPPPIEPTGGPHPRKAGTGGGPSMRGPSPIFGAPSPHHM  477

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  478  HDPRRIRSYQDLDAPEDEVTVMDYRSL  504



>ref|XP_008349839.1| PREDICTED: LOW QUALITY PROTEIN: serrate RNA effector molecule-like 
[Malus domestica]
Length=373

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 266/324 (82%), Gaps = 2/324 (1%)
 Frame = -1

Query  1908  WLKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNS  1729
             ++  K + T LV+ + RRNE ARK+AKDFLLDLQSGTLDLGPGV    SN  G +SEPNS
Sbjct  14    FIYHKIYXTILVAFLSRRNELARKVAKDFLLDLQSGTLDLGPGVNSAASNKPGHNSEPNS  73

Query  1728  DDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGI  1549
             +DE D G KRRR  R P+K+  LLS APKAHPVSSEPRRI +D+EQ+Q LV KLDSEKGI
Sbjct  74    EDETDVGGKRRRPGREPNKENVLLSAAPKAHPVSSEPRRIQVDIEQAQALVXKLDSEKGI  133

Query  1548  EENILsrsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDY  1369
              ENIL   DND+        S+    V+I+RGLTSVKGLEG ELL+TL+TYLWRIHG+DY
Sbjct  134   VENILYGPDNDKNREKLHGGSTGP--VIIIRGLTSVKGLEGIELLDTLITYLWRIHGLDY  191

Query  1368  YGMIETNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDT  1189
             YGM E+NEAKGLRH+R +GK++  +SNG +WE KLD RW+ERL+ QDPLE+MTAKEKIDT
Sbjct  192   YGMSESNEAKGLRHVRAEGKSSNLTSNGNEWEEKLDLRWQERLQSQDPLEIMTAKEKIDT  251

Query  1188  AAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVRE  1009
              A E+L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELV+E+TSK+RE
Sbjct  252   TASESLDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVMEVTSKLRE  311

Query  1008  DLYFQNYMSDESAPGGTPVMLSSL  937
             +LYFQNYM+D  APGGTP+M  S+
Sbjct  312   ELYFQNYMNDVDAPGGTPIMQQSV  335



>ref|XP_006648306.1| PREDICTED: serrate RNA effector molecule-like [Oryza brachyantha]
Length=598

 Score =   426 bits (1095),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 254/468 (54%), Positives = 317/468 (68%), Gaps = 54/468 (12%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL +YKQF QELEDD+ P EAE RYQEYK+ YI  QK  YFD HK+E+WLKD YHPTN
Sbjct  114   RKGLMTYKQFTQELEDDVSPGEAENRYQEYKASYISTQKEVYFDQHKNEDWLKDMYHPTN  173

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVI+RRNE  R  AK  +LDL+SGTLDLGPG+T   ++ +G  S+  S D+ D  D +
Sbjct  174   LLSVIKRRNELCRTAAKKLILDLRSGTLDLGPGMTAGAASKSGNESDGISADDEDY-DNK  232

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R H R   K+   LSDAPKAHPVSS  RRI  D+EQ+  LV KLD EKGI  NILS  D+
Sbjct  233   RSHHRVLIKETEPLSDAPKAHPVSSHYRRIQTDIEQTLALVQKLDEEKGIVGNILSTGDH  292

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
                  DKS++ S+GP +VIVRGLT+VKGLEG ELL+TLLTYLWR+HGVDYYGM E+  AK
Sbjct  293   GNSDGDKSHAGSTGP-IVIVRGLTTVKGLEGLELLDTLLTYLWRVHGVDYYGMSESKNAK  351

Query  1338  GLRHMRFDGKNTETS-SNGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALEP  1165
             GLRH+R D K+T TS S+ ADWE+KLDS W+ERL  G+DPL  +TAK+KID +A + LE 
Sbjct  352   GLRHVRADKKSTNTSRSSSADWEKKLDSFWQERLTTGKDPLVALTAKDKIDASADKNLES  411

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YV K++D+KYGWKYGCGAKGC K+FHA EFV KHL LKH +LV +LT KV++D+YFQNYM
Sbjct  412   YVTKVKDDKYGWKYGCGAKGCIKIFHAPEFVLKHLNLKHLDLVSKLTLKVQDDIYFQNYM  471

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D SAPGG PV         +Q+  P  + R++                      + P S
Sbjct  472   NDPSAPGGIPV---------IQQHAPEKQDRIQ----------------------QRPTS  500

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             +++  +  G +N                  F  +I  PP+L+PVPGAG
Sbjct  501   TELGVS--GEQN-----------------CFAVEIPTPPILIPVPGAG  529


 Score = 54.7 bits (130),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 10/79 (13%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPA PEV MQM+R QG        ++G     +G   P+    P   +    +RS
Sbjct  530  PLGPFVPASPEVVMQMMRGQGS-------QHGMNSAMLGPMMPMYPPRPPNPR---PLRS  579

Query  391  YQDLDAPEDEVTVIDYRSL  335
            Y+DLD P +EVT +DYRSL
Sbjct  580  YKDLDDPGEEVTAVDYRSL  598



>gb|EEE56303.1| hypothetical protein OsJ_05384 [Oryza sativa Japonica Group]
Length=631

 Score =   423 bits (1088),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 245/468 (52%), Positives = 313/468 (67%), Gaps = 57/468 (12%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL +YKQF Q+LEDD+ P EAE RYQEYK+ YI +QK+ YFD HK+E+ LKD YHPTN
Sbjct  164   RKGLMTYKQFTQKLEDDVSPGEAESRYQEYKTSYITSQKQDYFDHHKNEDRLKDMYHPTN  223

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE  +  AK+ +LDL+SGTLDLGPG+T   ++ +G  S+    D+ D  +KR
Sbjct  224   LLSVIERRNELCKAAAKNLILDLRSGTLDLGPGMTAGTASKSGNDSDGIPADDEDYHNKR  283

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP ++  L+S APKAHPVSS  RRI  D+ Q+  LV KLD EKGI  NIL+  D+
Sbjct  284   RRHHRGPLEETELVSVAPKAHPVSSHYRRIQTDIHQTLALVKKLDEEKGIVGNILTTGDH  343

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              + + DKS + S+GP +VIVRGL++VKGL+G ELL+TLLTYLW +HG+DYYGM E+  AK
Sbjct  344   TKSNGDKSYAGSTGP-LVIVRGLSTVKGLDGFELLDTLLTYLWHVHGIDYYGMSESTNAK  402

Query  1338  GLRHMRFDGKNTET-SSNGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALEP  1165
             GLRH+R D KN     S+ ADWE+KLD  W+ERL  G+DPL  +TAK+KID +A + LE 
Sbjct  403   GLRHVRADTKNANMDKSSAADWEKKLDYFWQERLTNGKDPLVALTAKDKIDASADKVLES  462

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YV K++D+ YGW YGCGAKGC K+FHA +FV KHL LKHP+LV +LTS+V+ED+YFQNYM
Sbjct  463   YVTKVKDDNYGWTYGCGAKGCIKVFHAPDFVLKHLNLKHPDLVSKLTSRVQEDIYFQNYM  522

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D +APGGTPVM    P+++                                        
Sbjct  523   NDPNAPGGTPVMQQQSPEQQ----------------------------------------  542

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                      G  P E    +FGG G  V     ++  PPVL+PVPGAG
Sbjct  543   ---------GPTPSELTPGAFGGQGSFV-----EMPTPPVLIPVPGAG  576


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 24/79 (30%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEV MQM+R                          + + P    +PRR+RS
Sbjct  577  PLGPFVPAPPEVVMQMMRPV------------------------MPMYPPRPPNPRRLRS  612

Query  391  YQDLDAPEDEVTVIDYRSL  335
            Y+DLDAP+DEVT++DYRSL
Sbjct  613  YKDLDAPDDEVTLVDYRSL  631



>ref|NP_001045896.1| Os02g0149600 [Oryza sativa Japonica Group]
 dbj|BAD13072.1| putative C2H2 zinc-finger protein SERRATE [Oryza sativa Japonica 
Group]
 dbj|BAF07810.1| Os02g0149600 [Oryza sativa Japonica Group]
 gb|EEC72490.1| hypothetical protein OsI_05859 [Oryza sativa Indica Group]
Length=666

 Score =   422 bits (1086),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 245/468 (52%), Positives = 313/468 (67%), Gaps = 57/468 (12%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL +YKQF Q+LEDD+ P EAE RYQEYK+ YI +QK+ YFD HK+E+ LKD YHPTN
Sbjct  199   RKGLMTYKQFTQKLEDDVSPGEAESRYQEYKTSYITSQKQDYFDHHKNEDRLKDMYHPTN  258

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE  +  AK+ +LDL+SGTLDLGPG+T   ++ +G  S+    D+ D  +KR
Sbjct  259   LLSVIERRNELCKAAAKNLILDLRSGTLDLGPGMTAGTASKSGNDSDGIPADDEDYHNKR  318

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             RRH RGP ++  L+S APKAHPVSS  RRI  D+ Q+  LV KLD EKGI  NIL+  D+
Sbjct  319   RRHHRGPLEETELVSVAPKAHPVSSHYRRIQTDIHQTLALVKKLDEEKGIVGNILTTGDH  378

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              + + DKS + S+GP +VIVRGL++VKGL+G ELL+TLLTYLW +HG+DYYGM E+  AK
Sbjct  379   TKSNGDKSYAGSTGP-LVIVRGLSTVKGLDGFELLDTLLTYLWHVHGIDYYGMSESTNAK  437

Query  1338  GLRHMRFDGKNTET-SSNGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALEP  1165
             GLRH+R D KN     S+ ADWE+KLD  W+ERL  G+DPL  +TAK+KID +A + LE 
Sbjct  438   GLRHVRADTKNANMDKSSAADWEKKLDYFWQERLTNGKDPLVALTAKDKIDASADKVLES  497

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YV K++D+ YGW YGCGAKGC K+FHA +FV KHL LKHP+LV +LTS+V+ED+YFQNYM
Sbjct  498   YVTKVKDDNYGWTYGCGAKGCIKVFHAPDFVLKHLNLKHPDLVSKLTSRVQEDIYFQNYM  557

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D +APGGTPVM    P+++                                        
Sbjct  558   NDPNAPGGTPVMQQQSPEQQ----------------------------------------  577

Query  804   SDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                      G  P E    +FGG G  V     ++  PPVL+PVPGAG
Sbjct  578   ---------GPTPSELTPGAFGGQGSFV-----EMPTPPVLIPVPGAG  611


 Score = 53.5 bits (127),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 46/79 (58%), Gaps = 24/79 (30%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            PLGPFVPAPPEV MQM+R                          + + P    +PRR+RS
Sbjct  612  PLGPFVPAPPEVVMQMMRPV------------------------MPMYPPRPPNPRRLRS  647

Query  391  YQDLDAPEDEVTVIDYRSL  335
            Y+DLDAP+DEVT++DYRSL
Sbjct  648  YKDLDAPDDEVTLVDYRSL  666



>gb|EPS63495.1| hypothetical protein M569_11289, partial [Genlisea aurea]
Length=374

 Score =   408 bits (1049),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 253/391 (65%), Positives = 300/391 (77%), Gaps = 20/391 (5%)
 Frame = -1

Query  1824  FLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAP  1645
             F +DLQ+GTLD+GPG TP  S+ T Q +E NSDDEAD   KRRR  RG +K++  LS AP
Sbjct  1     FQVDLQNGTLDVGPGYTP--SSKTEQMTENNSDDEADVAGKRRRSGRGSAKESDHLS-AP  57

Query  1644  KAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVV  1465
             K H V SEPRRI ID+ Q  +LV KLDSEKGIEENIL R +NDR SRDK++ +SSGPVV+
Sbjct  58    KGHLVFSEPRRIQIDIHQVLSLVRKLDSEKGIEENILVRDNNDRLSRDKAHGNSSGPVVI  117

Query  1464  IVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRF-DGKNTETSS-  1291
             I RG  ++KGLEG ELL+T LTYLWRIHG+DYYG+ E+++AKGLRH+R  DG  ++ S+ 
Sbjct  118   I-RGSNAIKGLEGVELLDTGLTYLWRIHGLDYYGLTESSDAKGLRHVRTSDGNLSDMSAV  176

Query  1290  NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGA  1111
             +G + E+KLD+ W+ RL G DPLEVMTAK+KI  A     EP+VRKIRDEKYGWKYGCGA
Sbjct  177   DGDEAEKKLDAFWQNRLNGSDPLEVMTAKDKIKEATTREFEPFVRKIRDEKYGWKYGCGA  236

Query  1110  KGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPK  931
             KGCTKLFHAAE+VHKHLKLKHPELV+EL SKV E+LY+QNYM+DE+APGG PVM  S  K
Sbjct  237   KGCTKLFHAAEYVHKHLKLKHPELVMELLSKVYEELYYQNYMNDENAPGGKPVMQQSFSK  296

Query  930   EK-LQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSNDDGGRNPDEQM  754
             ++ LQR RPSLESRLKDD      R+ R NG ++FD         +QS D    NPDE +
Sbjct  297   DRLLQRGRPSLESRLKDD--RGSRRDHRSNGNDKFD--------GLQSRD--ANNPDEAL  344

Query  753   FDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             FDSFGG GIPVAAFP DI  PPVLMPVPGAG
Sbjct  345   FDSFGGSGIPVAAFPLDIA-PPVLMPVPGAG  374



>ref|XP_004954714.1| PREDICTED: serrate RNA effector molecule-like [Setaria italica]
Length=577

 Score =   416 bits (1068),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 248/467 (53%), Positives = 303/467 (65%), Gaps = 58/467 (12%)
 Frame = -1

Query  2043  SYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVI  1864
             +YKQF Q LEDD+ P++A  RYQEY++ YI  QKRAYFD +K+E+WLKD YHPT L+SVI
Sbjct  2     TYKQFTQVLEDDVSPSQAGGRYQEYRTEYITTQKRAYFDLNKNEDWLKDMYHPTKLLSVI  61

Query  1863  ERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDR  1684
             ERRN+  +  AK+ + DLQ+GTLDLGPG+T      +G     +S+D+ D G+K+ +H R
Sbjct  62    ERRNDFCKTAAKNLIHDLQNGTLDLGPGLTADAVIKSGDGDGGSSEDDTDYGEKKIKHGR  121

Query  1683  GPSKDARLLS--DAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrg  1510
             GP K+   LS   APKAHPVSS+ RRI  D++++  LV KLDSEK I  NIL   D+D  
Sbjct  122   GPQKEIEPLSVSAAPKAHPVSSQYRRIHTDIDRTLALVKKLDSEKDILGNILLTGDHDNS  181

Query  1509  srdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLR  1330
             + DKS+  S GPVV IVRGL +VKGLEG ELL+TLLTYLWR+HGVDYYGM E   AKG R
Sbjct  182   NVDKSHIRSMGPVV-IVRGLNTVKGLEGVELLDTLLTYLWRVHGVDYYGMSEMKYAKGFR  240

Query  1329  HMRFDGKNTETS--SNGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALEPYV  1159
             H+R + K+   +  +N ADWE+KLDS WE+RL  G+DPL V+TAK+KID A VE LEPYV
Sbjct  241   HVRAENKSGSMAENNNAADWEKKLDSFWEQRLVNGEDPLVVLTAKDKIDAAIVEVLEPYV  300

Query  1158  RKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSD  979
             RK+RDEKY WKYGCGAKGC KLFHA E+VHKHL+LKHP LV  L+S++  D+YFQNYM+D
Sbjct  301   RKMRDEKYVWKYGCGAKGCEKLFHAPEYVHKHLRLKHPLLVSILSSRIENDIYFQNYMND  360

Query  978   ESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSD  799
               APGG PVM                                                  
Sbjct  361   PDAPGGKPVM--------------------------------------------------  370

Query  798   IQSNDDGGRNPDEQMFDSFGGHGIPVAAFPS-DITPPPVLMPVPGAG  661
              Q  D   R PDEQMF + GG G      P       PVL+PVPGAG
Sbjct  371   -QQTDRTRRRPDEQMFGASGGRGSDAPLLPDPKCALSPVLIPVPGAG  416



>gb|EMT24215.1| Serrate RNA effector molecule [Aegilops tauschii]
Length=607

 Score =   412 bits (1060),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 248/473 (52%), Positives = 300/473 (63%), Gaps = 64/473 (14%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL +YKQFI  LEDD+ PAEAE RY EYK+ YI  QK AYFD HK +  LK+KYHPT+
Sbjct  101   RKGLMTYKQFILALEDDVSPAEAESRYHEYKTAYITTQKHAYFDLHKGDTRLKEKYHPTS  160

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVIERRNE  +  AK  +LDL+SGTLDLGPG+T   S+ +G  +  +S +  D G+KR
Sbjct  161   LLSVIERRNEFCKAAAKSLILDLRSGTLDLGPGMTADGSSKSGNVNYGSSGNGEDYGNKR  220

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R++ RGP K+   LS APKAHPVSS+ RR+  D++Q+  LV KLD+EKGI  NILS   +
Sbjct  221   RKNGRGPPKEPGPLSTAPKAHPVSSKYRRVQADIDQTLALVRKLDTEKGIVGNILSIGGD  280

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
                  D  +   S   +VI+RGLT+VKGLEG ELL+TLLTYLWR+HGVDYYGM E   A 
Sbjct  281   HGKPDDDRSHVGSAGPLVIIRGLTTVKGLEGVELLDTLLTYLWRVHGVDYYGMSERRNAN  340

Query  1338  GLRHMRFDGKNTET-SSNGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALEP  1165
             G RH+R D K  +  + + ADWE+KLDS W ERL  G DPL V+TAK+KID A VEAL P
Sbjct  341   GFRHVRADNKIADGFNISAADWEKKLDSFWHERLVNGDDPLVVLTAKDKIDAATVEALAP  400

Query  1164  YVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYM  985
             YV+KI DE YG+KYGCGA GC K+FHA EFVHKHLKLKHP+LV  LT  V++D+YFQNYM
Sbjct  401   YVKKIMDENYGYKYGCGAMGCAKVFHAPEFVHKHLKLKHPDLVSVLTLNVQDDIYFQNYM  460

Query  984   SDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLS  805
             +D +APGG PVM                                                
Sbjct  461   NDPNAPGGKPVMQ-----------------------------------------------  473

Query  804   SDIQSNDDGGRN---PDEQMFDSFGGHG--IPVAAFPSDITPPPVLMPVPGAG  661
                QS  D GR    PDE  FD  G     IP A       PP VL+P+PGAG
Sbjct  474   ---QSEQDSGRMRRIPDEGAFDKQGSDAPLIPDA-------PPTVLVPLPGAG  516


 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = -3

Query  580  LYSPLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRR  401
             +SPLGPFVP  P++A+QM+REQ  P P    R  +              P     DPR 
Sbjct  530  CFSPLGPFVPITPDMAVQMMREQRPPRPNGAQRKKKPLMPEPMMPMYPHFP----LDPRP  585

Query  400  IRSYQDLDAPEDEVTVIDYRSL  335
            +R Y DLDAPE+EVT IDYRS+
Sbjct  586  LRRYNDLDAPEEEVTAIDYRSV  607



>ref|XP_002451545.1| hypothetical protein SORBIDRAFT_04g003540 [Sorghum bicolor]
 gb|EES04521.1| hypothetical protein SORBIDRAFT_04g003540 [Sorghum bicolor]
Length=796

 Score =   406 bits (1043),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 300/469 (64%), Gaps = 56/469 (12%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R GL +YKQFIQ LEDD+ PA+A  RYQEY++ YI  QKRAYFD +K+E+WLKD YHPT 
Sbjct  308   RLGLMTYKQFIQVLEDDVSPAQAGCRYQEYRTEYISTQKRAYFDLNKNEDWLKDMYHPTK  367

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L+SVI RRN+  + +A++ +LDL++GTLDLGPGVT   +  +G+ ++  S D AD G+K+
Sbjct  368   LLSVIRRRNDFCKTVARNLILDLRNGTLDLGPGVTAHAAIKSGKGNDGRSQDNADYGEKK  427

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+H RGP K+   LS APKAHP+SS+ RRI  D+ ++  LV KLDSEKGI ENIL   D+
Sbjct  428   RKHGRGPQKEIEPLSAAPKAHPISSQHRRIHTDIHRTLALVKKLDSEKGIMENILLTGDH  487

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAK  1339
              + + DKS   S  P V I+RG  +VKGLEG ELL+TLLTYLWR+HGVDYYGM E   AK
Sbjct  488   GKSNVDKSCGRSKTP-VAIIRGFNTVKGLEGVELLDTLLTYLWRVHGVDYYGMSEMKHAK  546

Query  1338  GLRHMRFDGKNTETSS--NGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALE  1168
             G RH+R + K+   +   + ADWE+KLDS WEERL  G+DPL V+TA +KI+ A VE LE
Sbjct  547   GFRHVRAENKSDSMAEYISAADWEKKLDSFWEERLMNGEDPLVVLTAMDKIEAALVEVLE  606

Query  1167  PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNY  988
              YVRK+RDE   WKY CGAKGC KLFHA E+VHKHL LKHP+LV  L S+V  D+YFQNY
Sbjct  607   RYVRKMRDENCIWKYFCGAKGCEKLFHAPEYVHKHLNLKHPDLVSTLASRVENDIYFQNY  666

Query  987   MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
             M+D  APGG P M      ++  R R  L                               
Sbjct  667   MNDPDAPGGKPFM------QQTDRMRQRL-------------------------------  689

Query  807   SSDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
                           DEQMFD+ G  G      P       VL+PVPGAG
Sbjct  690   --------------DEQMFDASGVWGSHAPLLPM-CAHSLVLIPVPGAG  723


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 6/79 (8%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIRS  392
            P GPFVPAPPE+AMQM+  Q G A  +  +N  + P + G  P++ + PS        RS
Sbjct  724  PYGPFVPAPPEIAMQMI--QKGLAGPDSAQN--RKPSVLG--PMLPMYPSFPLGSGIYRS  777

Query  391  YQDLDAPEDEVTVIDYRSL  335
            Y+DLDAP +EV+ +D+RSL
Sbjct  778  YEDLDAPMEEVSPLDFRSL  796



>ref|XP_001768827.1| predicted protein [Physcomitrella patens]
 gb|EDQ66380.1| predicted protein [Physcomitrella patens]
Length=539

 Score =   371 bits (952),  Expect(2) = 7e-118, Method: Compositional matrix adjust.
 Identities = 236/478 (49%), Positives = 300/478 (63%), Gaps = 49/478 (10%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFI ELEDDILP EAERRY+EYKS +I  QKRA+F+ HKD++WL++KY P  
Sbjct  1     RDGLMSYKQFIVELEDDILPGEAERRYEEYKSEFITTQKRAFFEQHKDDDWLREKYDPAR  60

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L  V+ RRNE A+ ++K+ L +LQ+G+LDLGP V  +  +++G  ++ N        +KR
Sbjct  61    LEIVLVRRNENAKILSKELLAELQAGSLDLGPSVRSSSKDDSGDDADGN--------NKR  112

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             R+  +   K    +  AP AHP  S+P+R+  D+E  ++L+ KLD+EKGIE N+LS   N
Sbjct  113   RKSSQEHVKAQETIV-APTAHPGCSDPQRVLKDIELGRSLIKKLDAEKGIEGNLLSVDQN  171

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEA-  1342
                 R     S     +VIVR    VKGLEG ELL+ +LTYLWR+H VDYYGMIE  E  
Sbjct  172   TENERTVGGGSVGP--IVIVRSGNHVKGLEGTELLDVVLTYLWRVHSVDYYGMIEYKEQP  229

Query  1341  KGLRHMRF-DGKNTETSSNG------ADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAA  1183
             K LRH+R  +GK+   + NG      ADWE+KLD+ W+ RL+G D +  M  +EK+DT A
Sbjct  230   KRLRHIRAPEGKSGGDTKNGTEGAGFADWEKKLDTTWQTRLQGGDIIVSMLGREKLDTTA  289

Query  1182  VEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDL  1003
              EAL+P+VRKIRDEKYGWKYGCGAKGCTKLFH  EFVHKHLKLKH +LV ++ +K RE+L
Sbjct  290   NEALDPFVRKIRDEKYGWKYGCGAKGCTKLFHGPEFVHKHLKLKHSDLVADVVAKAREEL  349

Query  1002  YFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDR  823
             YFQNYMSD  APG   V  SS P +   R     E   +D+               RFDR
Sbjct  350   YFQNYMSDPDAPGANQVT-SSQPGQVCAREEQRFERGTRDE-------------KGRFDR  395

Query  822   PENPLSSDIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDI-TPPPVLMPVPGAG  661
             P              G   +  MFD F G    G+P   F  D+  PP VLMPVPGAG
Sbjct  396   PFE------------GGPMEPPMFDHFNGPPVRGLPGGLFVPDMPGPPQVLMPVPGAG  441


 Score = 83.2 bits (204),  Expect(2) = 7e-118, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 27/102 (26%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-----------------GGRNGRQGPQIGGQAP  443
            PLGPFVPAPPE+AM+ LRE  GP PF                  GG+ G  GP + G   
Sbjct  442  PLGPFVPAPPEIAMRFLRE--GPGPFRMGGFDAGYQEEGNGGPRGGKRGAPGPMMEGG--  497

Query  442  IIALPPSL------RQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
            ++ +PP++      R+DPR +RSY DLDAPEDEV+VIDYRSL
Sbjct  498  LLDIPPNMMPPHGMRRDPRGVRSYHDLDAPEDEVSVIDYRSL  539



>ref|XP_001761709.1| predicted protein [Physcomitrella patens]
 gb|EDQ73465.1| predicted protein [Physcomitrella patens]
Length=541

 Score =   347 bits (890),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 231/486 (48%), Positives = 291/486 (60%), Gaps = 61/486 (13%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFI ELEDDILP EAERRY+EYKS +I   KRA+F+ HKD+EWL++KY P  
Sbjct  2     RDGLMSYKQFIVELEDDILPGEAERRYEEYKSEFITTHKRAFFEQHKDDEWLREKYDPAR  61

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L  V+ RRNE A+ ++K+ L +LQ+G+LDLGP V          S++ +S D+AD   KR
Sbjct  62    LEIVLVRRNENAKILSKELLAELQTGSLDLGPSVR--------SSAKDDSGDDADGSSKR  113

Query  1698  RRHDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdn  1519
             +R  +   K A+ ++ APKAHP SS+P+R+  D+   + LV KLD+EKGIE N+L+   +
Sbjct  114   KRPPQEHVK-AQEINAAPKAHPGSSDPKRVLKDIGIGRALVKKLDAEKGIEGNLLTVDQS  172

Query  1518  drgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNE-A  1342
                 R     S     +VIVR    VKGLEG ELLE +LTYLWR+H VDYYGM E  E  
Sbjct  173   AGSERTMGGGSVGP--IVIVRSGNQVKGLEGTELLEVVLTYLWRVHAVDYYGMTEYKEQP  230

Query  1341  KGLRHMR-------FDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAA  1183
             K LRH+R        D KN    +  ADWE+KLD+ W+ RL+  D +  M  +EK+DT A
Sbjct  231   KRLRHIRPPEAKNSGDPKNNAEEAGFADWEKKLDTTWQTRLESGDIIVSMLGREKLDTTA  290

Query  1182  VEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDL  1003
              EAL+P+VRKIRDEKYGWKYGCGAKGCTKLFH  EFVHKHLKLKH +LV ++ +K RE+L
Sbjct  291   NEALDPFVRKIRDEKYGWKYGCGAKGCTKLFHGPEFVHKHLKLKHSDLVADVVAKAREEL  350

Query  1002  YFQNYMSDE--------SAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrv  847
             YFQNYM           S P G P   +    + L    PS ++R               
Sbjct  351   YFQNYMGGRRGSQRPGFSGPVGGPGNRAG--ADWLPSDHPSRDNRFG-------------  395

Query  846   ngveRFDRPENPLSSDIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDIT-PPPVLM  679
                    R   P           G   +  MFD F G    G+P   F  D+  PP VLM
Sbjct  396   ------PRTGGPFE---------GGPMEPPMFDHFNGPPLRGLPGGLFVPDMPGPPQVLM  440

Query  678   PVPGAG  661
             PVPGAG
Sbjct  441   PVPGAG  446


 Score = 81.3 bits (199),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 63/97 (65%), Gaps = 20/97 (21%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNG---RQGPQIGGQAP--------IIALP  428
            PLGPFVPAPPEVAM+ LRE  GP PF  GG +     +GP+ G +          I+ +P
Sbjct  447  PLGPFVPAPPEVAMRFLRE--GPGPFRPGGFDSGYQEEGPRGGKRGAPGPMMGGGILDIP  504

Query  427  P------SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
            P       +R+DPR +RSY DLDAPEDEV+VIDYRSL
Sbjct  505  PMMMPSHGMRRDPRGVRSYHDLDAPEDEVSVIDYRSL  541



>ref|XP_002989962.1| hypothetical protein SELMODRAFT_130620, partial [Selaginella 
moellendorffii]
 gb|EFJ08975.1| hypothetical protein SELMODRAFT_130620, partial [Selaginella 
moellendorffii]
Length=490

 Score =   341 bits (875),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 212/446 (48%), Positives = 279/446 (63%), Gaps = 48/446 (11%)
 Frame = -1

Query  1980  YQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSG  1801
             Y+EYK+ Y+  QKRAYF+ HK+E+WL++KY P+ L S++ RR E A+  A+DF+L+LQ+G
Sbjct  1     YEEYKAEYVSTQKRAYFEQHKEEDWLREKYDPSRLDSLMARRIETAKSSARDFILELQAG  60

Query  1800  TLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSE  1621
             +LD+      T +      S   +D E D  DKR           R     P+A   SS+
Sbjct  61    SLDM------TAAAAAAAGSRSTADVETD-DDKR--------MGGRQADTIPRAQHASSD  105

Query  1620  PRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVVIVRGLTSV  1441
              +R+ ID+EQ+Q LV KLD+EKG+E NIL  S+    S +          +VIVRG   V
Sbjct  106   LKRVAIDIEQAQALVKKLDTEKGVEGNILFSSEQQNLSSETGGP------IVIVRGANQV  159

Query  1440  KglegaelletlltyLWRIHGVDYYGMIETNEA-KGLRHMRFDGKNTETSSNGADWERKL  1264
             KGLEG ELL+ +LTYLWR+HG+DYYGM+E  E  KG RH+R + K  + ++  A+WE+KL
Sbjct  160   KGLEGIELLDVMLTYLWRVHGLDYYGMMELRELPKGFRHLRGEEKAGDDNAR-AEWEKKL  218

Query  1263  DSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHA  1084
             DS W+ RL+GQDP+E M  K+K + +  EALEPYVRKIRDEKYGWKYGC A GC+KLFH 
Sbjct  219   DSTWQARLQGQDPVEAMLGKDKSEASMSEALEPYVRKIRDEKYGWKYGCLATGCSKLFHG  278

Query  1083  AEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPS  904
              EFVHKHLKLKHPE+V E  +K+R +LY+QNYMSD +APG   V  +     +L RRRP 
Sbjct  279   PEFVHKHLKLKHPEIVNESMAKLRRELYYQNYMSDPNAPGVASVQANQR-DSRLHRRRPG  337

Query  903   L-----ESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSNDDGGRNPDEQMFDSFG  739
             L      SR + +                 D  ++P + D      G  + ++ MFD FG
Sbjct  338   LLGNSDRSRGRGE-----------------DVDKSP-AGDYPYEGAGPASSEQPMFDPFG  379

Query  738   GHGIPVAAFPSDITPPPVLMPVPGAG  661
             G  I   AF S+I PPPVLMPVPGAG
Sbjct  380   GTNIHGGAFGSEI-PPPVLMPVPGAG  404


 Score = 79.0 bits (193),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGG------PAPFEGGRNGRQGPQIGGQAPIIALP---PSL  419
            PLGPFVPAPP+V M+M RE GG      PAPF+   +   G +      ++  P   P +
Sbjct  405  PLGPFVPAPPDVTMRMWREHGGGPQPFHPAPFDP--SFDGGDRGRKGRGVLETPQMVPPV  462

Query  418  RQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
            R DPR +RSY DLDAPED+VTVIDYRS+
Sbjct  463  RHDPRHMRSYHDLDAPEDDVTVIDYRSI  490



>ref|XP_002968914.1| hypothetical protein SELMODRAFT_90313, partial [Selaginella moellendorffii]
 gb|EFJ30030.1| hypothetical protein SELMODRAFT_90313, partial [Selaginella moellendorffii]
Length=489

 Score =   340 bits (872),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 209/446 (47%), Positives = 279/446 (63%), Gaps = 49/446 (11%)
 Frame = -1

Query  1980  YQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVIERRNERARKMAKDFLLDLQSG  1801
             Y+EYK+ Y+  QKRAYF+ HK+E+WL++KY P+ L S++ RR E A+  A+DF+L+LQ+G
Sbjct  1     YEEYKAEYVSTQKRAYFEQHKEEDWLREKYDPSRLDSLMARRIETAKSSARDFILELQAG  60

Query  1800  TLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSE  1621
             +LD+        S +T   ++  +DD+   G              R     P+A   SS+
Sbjct  61    SLDMTAAAAAAGSRST---ADVETDDDKRMG-------------GRQADTIPRAQHASSD  104

Query  1620  PRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVVIVRGLTSV  1441
              +R+ ID+EQ+Q LV KLD+EKG+E NIL  S+    S +          +VIVRG   V
Sbjct  105   LKRVAIDIEQAQALVKKLDTEKGVEGNILFSSEQQNLSSETGGP------IVIVRGANQV  158

Query  1440  KglegaelletlltyLWRIHGVDYYGMIETNEA-KGLRHMRFDGKNTETSSNGADWERKL  1264
             KGLEG ELL+ +LTYLWR+HG+DYYGM+E  E  KG RH+R + K  + ++  A+WE+KL
Sbjct  159   KGLEGIELLDVMLTYLWRVHGLDYYGMMELRELPKGFRHLRGEEKAGDDNAR-AEWEKKL  217

Query  1263  DSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHA  1084
             DS W+ RL+GQDP+E M  K+K + +  EALEPYVRKIRDEKYGWKYGC A GC+KLFH 
Sbjct  218   DSTWQARLQGQDPVEAMLGKDKSEASMSEALEPYVRKIRDEKYGWKYGCLATGCSKLFHG  277

Query  1083  AEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPS  904
              EFVHKHLKLKHPE+V E  +K+R +LY+QNYMSD +APG   V  +     +L RRRP 
Sbjct  278   PEFVHKHLKLKHPEIVNESMAKLRRELYYQNYMSDPNAPGVASVQANQR-DSRLHRRRPG  336

Query  903   L-----ESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSNDDGGRNPDEQMFDSFG  739
             L      SR + +                 D  ++P + D      G  + ++ MFD FG
Sbjct  337   LLGNSDRSRGRGE-----------------DVDKSP-AGDYPYEGAGPASSEQPMFDPFG  378

Query  738   GHGIPVAAFPSDITPPPVLMPVPGAG  661
             G  I   AF S+I PPPVLMPVPGAG
Sbjct  379   GTNIHGGAFGSEI-PPPVLMPVPGAG  403


 Score = 79.0 bits (193),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 57/88 (65%), Gaps = 11/88 (13%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGG------PAPFEGGRNGRQGPQIGGQAPIIALP---PSL  419
            PLGPFVPAPP+V M+M RE GG      PAPF+   +   G +      ++  P   P +
Sbjct  404  PLGPFVPAPPDVTMRMWREHGGGPQPFHPAPFDP--SFDGGDRGRKGRGVLETPQMVPPV  461

Query  418  RQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
            R DPR +RSY DLDAPED+VTVIDYRS+
Sbjct  462  RHDPRHMRSYHDLDAPEDDVTVIDYRSI  489



>gb|AAK63207.1|AF311222_1 C2H2 zinc-finger protein SERRATE [Saccharum hybrid cultivar NCo 
376]
Length=345

 Score =   302 bits (774),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/274 (62%), Positives = 207/274 (76%), Gaps = 25/274 (9%)
 Frame = -1

Query  1470  VVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTE-TS  1294
             +VI+RG ++VKGLEG ELL+TL+TYLWRIHGVDYYGM ETNE KGLRH++ D +     S
Sbjct  6     IVIIRGSSTVKGLEGPELLDTLVTYLWRIHGVDYYGMSETNEPKGLRHVKADARTYNGAS  65

Query  1293  SNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCG  1114
             SNGA+WE KLDS W++R++GQDPLE++ AKEKID AA E L+PYVRKIRDEKYGWKYGCG
Sbjct  66    SNGAEWENKLDSFWQDRIQGQDPLEMLKAKEKIDGAATEVLDPYVRKIRDEKYGWKYGCG  125

Query  1113  AKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLP  934
             AKGCTKLFHAAEFV KHLKLKH +LV++LTSK RED+YF+NYM+D  APGGTP+M    P
Sbjct  126   AKGCTKLFHAAEFVQKHLKLKHADLVVDLTSKAREDIYFENYMNDPKAPGGTPIMQQPAP  185

Query  933   KEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPLSSDIQSNDDGGRNPDEQM  754
             + K  R+RP +ESRL+D+            G  RF+R     + D  ++D  G NPD+ +
Sbjct  186   RGK-GRQRPPIESRLRDE-----------RGNHRFER-----NVDSPTHDGSGENPDDPI  228

Query  753   FDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
             +DSFG    HG    AFP +I  PPVLMPVPGAG
Sbjct  229   YDSFGDPIMHG----AFPPNIPAPPVLMPVPGAG  258


 Score =   100 bits (248),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 65/87 (75%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQ-----GPQIGGQAPII-ALPPSLR  416
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+     GP + G +PI  A PP   
Sbjct  259  PLGPFIPAPPEVAMHMLRDQGAPPPFEPTGGPHPRKAGRGAGPPMRGPSPIFTAPPPHQM  318

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  319  HDPRRIRSYQDLDAPEDEVTVMDYRSL  345



>gb|ACN33226.1| unknown [Zea mays]
 tpg|DAA48120.1| TPA: putative SERRATE-related C2H2 zinc-finger family protein 
[Zea mays]
Length=304

 Score =   272 bits (695),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 142/235 (60%), Positives = 170/235 (72%), Gaps = 19/235 (8%)
 Frame = -1

Query  1362  MIETNEAKGLRHMRFDGKNTE-TSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTA  1186
             M ETNE KGLRH++ D +     SSNGA+WE KLDS W++R++GQDPLE++  KEKID A
Sbjct  1     MSETNEPKGLRHVKADARTYNGASSNGAEWENKLDSFWQDRIQGQDPLEMLKGKEKIDGA  60

Query  1185  AVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVRED  1006
             A E L+PYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFV KHLKLKH +LV++LTSKVRED
Sbjct  61    ATEVLDPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVQKHLKLKHADLVVDLTSKVRED  120

Query  1005  LYFQNYMSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFD  826
             +YF+NYM+D  APGGTP+M    P+ K  R+RP +ESRL+D+            G  RFD
Sbjct  121   IYFENYMNDPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRDE-----------RGNHRFD  168

Query  825   RPENPLSSDIQSNDDGGRNPDEQMFDSFGGHGIPVAAFPSDITPPPVLMPVPGAG  661
             R     + D    D  G NPD+ ++DSFG   +   AFP DI  PPVLMPVPGAG
Sbjct  169   R-----NVDSPKRDGSGENPDDPIYDSFGDPAM-HGAFPPDIPAPPVLMPVPGAG  217


 Score = 98.6 bits (244),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 63/87 (72%), Gaps = 8/87 (9%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQ-----GPQIGGQAPIIALP-PSLR  416
            PLGPF+PAPPEVAM MLR+QG P P E  GG + R+     GP + G +PI   P P   
Sbjct  218  PLGPFIPAPPEVAMHMLRDQGAPPPIEPTGGPHPRKAGTGGGPSMRGPSPIFGAPSPHHM  277

Query  415  QDPRRIRSYQDLDAPEDEVTVIDYRSL  335
             DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  278  HDPRRIRSYQDLDAPEDEVTVMDYRSL  304



>tpg|DAA38646.1| TPA: putative SERRATE-related C2H2 zinc-finger family protein 
[Zea mays]
Length=641

 Score =   250 bits (639),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 182/222 (82%), Gaps = 2/222 (1%)
 Frame = -1

Query  1644  KAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVV  1465
             KA PVSSE RR+ ID+EQ+  LV KLDSEKGIE+N+LS  D+D+   DKS+  S GP+++
Sbjct  50    KAQPVSSESRRVKIDIEQTLALVRKLDSEKGIEDNVLSSGDHDKSDVDKSHIGSMGPIII  109

Query  1464  IVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTETSS-N  1288
             I RGLT+VKGLEG ELL+T+LTYLWRIHGVD YG  E++EAKGLRH+R D K + TS  +
Sbjct  110   I-RGLTTVKGLEGVELLDTILTYLWRIHGVDCYGTSESHEAKGLRHVRVDSKTSSTSDVS  168

Query  1287  GADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAK  1108
              ADWE+KLD+ W+ERL GQDPL ++TAK+K+D AA E LEP VRKIRDEKYGWKYGCG+K
Sbjct  169   AADWEKKLDTTWQERLNGQDPLVILTAKDKMDAAAAEVLEPLVRKIRDEKYGWKYGCGSK  228

Query  1107  GCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             GC K FH  EFVHKHL+LKHP+L LE TSKVREDLY QNYM+
Sbjct  229   GCKKPFHVPEFVHKHLRLKHPDLALESTSKVREDLYNQNYMN  270



>tpg|DAA38645.1| TPA: putative SERRATE-related C2H2 zinc-finger family protein 
[Zea mays]
Length=538

 Score =   209 bits (531),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = -1

Query  1470  VVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTETSS  1291
             ++I+RGLT+VKGLEG ELL+T+LTYLWRIHGVD YG  E++EAKGLRH+R D K + TS 
Sbjct  4     IIIIRGLTTVKGLEGVELLDTILTYLWRIHGVDCYGTSESHEAKGLRHVRVDSKTSSTSD  63

Query  1290  -NGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCG  1114
              + ADWE+KLD+ W+ERL GQDPL ++TAK+K+D AA E LEP VRKIRDEKYGWKYGCG
Sbjct  64    VSAADWEKKLDTTWQERLNGQDPLVILTAKDKMDAAAAEVLEPLVRKIRDEKYGWKYGCG  123

Query  1113  AKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMS  982
             +KGC K FH  EFVHKHL+LKHP+L LE TSKVREDLY QNYM+
Sbjct  124   SKGCKKPFHVPEFVHKHLRLKHPDLALESTSKVREDLYNQNYMN  167



>gb|KEH38883.1| serrate RNA effector molecule-like protein, putative [Medicago 
truncatula]
Length=248

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 112/173 (65%), Positives = 124/173 (72%), Gaps = 25/173 (14%)
 Frame = -1

Query  1467  VIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTETSSN  1288
             VI+RGLT  KGLEG ELL+TL+TYLWRIHGVDYYGMIETNEAKG RH+R +    E +  
Sbjct  26    VIIRGLTYFKGLEGVELLDTLITYLWRIHGVDYYGMIETNEAKGFRHVRPERTGHEET--  83

Query  1287  GADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAK  1108
                                    VM AKE ID AA+E L+P VRKIRDEKYGWKY CGAK
Sbjct  84    -----------------------VMAAKENIDAAAIEVLDPSVRKIRDEKYGWKYVCGAK  120

Query  1107  GCTKLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVM  949
             GCTKLFHAAE V+KHLKLKH EL LE TSK+REDLY QNY++D  APGG PVM
Sbjct  121   GCTKLFHAAEVVYKHLKLKHLELALEQTSKLREDLYTQNYINDPDAPGGKPVM  173



>ref|XP_010093793.1| Receptor-like protein kinase HERK 1 [Morus notabilis]
 gb|EXB54644.1| Receptor-like protein kinase HERK 1 [Morus notabilis]
Length=890

 Score =   202 bits (514),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 108/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELED ILPAEA+RRYQEYKS YI  QKRAYF+AHK+EEWLKDKYHPTN
Sbjct  704   REGLMSYKQFIQELEDVILPAEAQRRYQEYKSEYITTQKRAYFNAHKEEEWLKDKYHPTN  763

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKR  1699
             L++VIERRNE ARK+AKDFLLDLQSGTLDLG G+    SN   Q S+PNS+DE D G K+
Sbjct  764   LLAVIERRNELARKVAKDFLLDLQSGTLDLGQGLNALSSNKKEQPSDPNSEDEVDVGGKK  823

Query  1698  RRHDRGPSK  1672
             RR  R P+K
Sbjct  824   RRRCRTPTK  832



>ref|XP_001784098.1| predicted protein [Physcomitrella patens]
 gb|EDQ51112.1| predicted protein [Physcomitrella patens]
Length=789

 Score =   188 bits (478),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 181/336 (54%), Gaps = 36/336 (11%)
 Frame = -1

Query  2052  GLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLV  1873
             GL +YKQ I ELEDDILP +A+R            + +           L++KY P  L 
Sbjct  210   GLLTYKQLILELEDDILPGDAQR-------SCFACRLKGRMSR------LREKYDPARLE  256

Query  1872  SVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRR  1693
             +V+ RRNERA+ +AK+ L +LQ+G L+ GP +  TP+N   +S   +S  E       R 
Sbjct  257   AVLARRNERAKILAKELLSELQAGFLESGPSME-TPTNKVPES---DSGYEVKKRKSLRL  312

Query  1692  HDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndr  1513
             H R    +      AP   P  SEPRR+ ID+E +++L+ KLD+EKGI +NIL   +N  
Sbjct  313   HSRAQKNNV-----APTECPGCSEPRRVIIDIELARSLIKKLDAEKGIGDNILLADENSE  367

Query  1512  gsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNE-AKG  1336
             G   +  S          R    VK LE  EL E + TYLWR+H +DYYGMIE  E  K 
Sbjct  368   GDVTEVGS------TATTRSFKQVKDLEDVELSEVMRTYLWRVHFLDYYGMIEYKEQPKK  421

Query  1335  LRHMRFDGKNTETSSNG-------ADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVE  1177
              R +      ++  SN        A+W++KL++ W+ RL+  D +E M  KE + +   +
Sbjct  422   FRIITSTESKSKGGSNSNIEESMFAEWDKKLETTWQARLQSGDLIEFMLGKESLQSTGSD  481

Query  1176  ALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVH  1069
             AL+ +VRKIRDEKYGWKYGCGAKG         F H
Sbjct  482   ALDTFVRKIRDEKYGWKYGCGAKGYAVGSDQTTFTH  517


 Score = 57.0 bits (136),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 55/116 (47%), Gaps = 37/116 (32%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFEGGR-----NGRQ---------GPQIGG---QAP  443
            PLGPFVPAPP + M+ L E  GP+  +  R     N R          GP++GG     P
Sbjct  674  PLGPFVPAPPGITMRFLIEGPGPSHCDFERSFVDDNNRWPRDRNRPTPGPRLGGGLSDFP  733

Query  442  IIALPPS-LRQDPRRIR-------------------SYQDLDAPEDEVTVIDYRSL  335
             + +PP     DPR I+                   SY DLD P DEVTVIDYR+L
Sbjct  734  SMMIPPHGSHYDPRGIQRCTPKVSTLHISTRGYSMGSYHDLDTPRDEVTVIDYRTL  789


 Score = 36.2 bits (82),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 21/36 (58%), Gaps = 4/36 (11%)
 Frame = -1

Query  756  MFDSFGG---HGIPVAAFPSDI-TPPPVLMPVPGAG  661
            MFD F     HG+P      DI  PP VLMPVPGAG
Sbjct  638  MFDHFSDSPFHGLPGDLIVPDIPCPPQVLMPVPGAG  673



>ref|XP_010474531.1| PREDICTED: serrate RNA effector molecule-like [Camelina sativa]
Length=281

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             R+GL SYKQFIQELEDDILP+EAERRYQEYKS YI  QKRAYF+ HK+EEWLK+KYHPTN
Sbjct  192   RDGLMSYKQFIQELEDDILPSEAERRYQEYKSEYITTQKRAYFNTHKEEEWLKNKYHPTN  251

Query  1878  LVSVIERRNERARKMAKDFLLDLQSGTLDL  1789
             L+SVIERRN+ ARK+AKDFLLDLQSG LDL
Sbjct  252   LLSVIERRNDLARKVAKDFLLDLQSGALDL  281



>ref|XP_008661048.1| PREDICTED: serrate RNA effector molecule-like [Zea mays]
Length=210

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 142/202 (70%), Gaps = 7/202 (3%)
 Frame = -1

Query  1788  GPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHDRGPSKDARLLSDAPKAHPVSSEPRRI  1609
             GPG+T +  + +G +S  N D  A  GD ++      S D+     A KAHPVSSE RRI
Sbjct  4     GPGLTSSAVSKSGNNSSKNLD--AVEGDGKKGKHGKGSDDSYYA--ASKAHPVSSEVRRI  59

Query  1608  CIDVEQSQTLVAKLDSEKGIEENILsrsdndrgsrdksnssssGPVVVIVRGLTSVKgle  1429
              ID+EQ+Q L+ KLDS+KGIE N+LS SD+++  R+K + S     +VIV+G ++VKGLE
Sbjct  60    QIDIEQAQALIRKLDSKKGIENNVLSSSDHEKSDRNKLHGSVGP--IVIVQGSSTVKGLE  117

Query  1428  gaelletlltyLWRIHGVDYYGMIETNEAKGLRHMRFDGKNTE-TSSNGADWERKLDSRW  1252
             G ELL+TL+TYLWRIHGVDYYGM E NE KGLRH++ D +     SSNGA WE KLDS W
Sbjct  118   GTELLDTLVTYLWRIHGVDYYGMSEANEPKGLRHVKADARTYNGASSNGAKWENKLDSFW  177

Query  1251  EERLKGQDPLEVMTAKEKIDTA  1186
             ++R++ QDPLE++  KEKID A
Sbjct  178   QDRIQDQDPLEMLKGKEKIDGA  199



>ref|XP_008349834.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica]
 ref|XP_008349835.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica]
 ref|XP_008366392.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica]
 ref|XP_008366393.1| PREDICTED: serrate RNA effector molecule-like [Malus domestica]
Length=134

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 70/80 (88%), Gaps = 1/80 (1%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE-GGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQMLR+QGGP PFE  GRN   GPQ+ G +PI+AL P+ RQDPRR+R
Sbjct  55   PLGPFVPAPPEVAMQMLRDQGGPPPFEXSGRNVWSGPQMSGPSPILALSPAFRQDPRRLR  114

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPEDEVTVIDYRSL
Sbjct  115  SYQDLDAPEDEVTVIDYRSL  134



>gb|ACF81502.1| unknown [Zea mays]
Length=174

 Score = 91.3 bits (225),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 60/90 (67%), Gaps = 11/90 (12%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAPFE--GGRNGRQGPQIGGQAP---------IIALPP  425
            PLGPF+PAPPEVAM MLR+QG P PFE  GG + R+  +  G              A PP
Sbjct  85   PLGPFIPAPPEVAMHMLRDQGAPPPFEPSGGPHPRKAGRGSGGGGPPMRGPSPVFSAPPP  144

Query  424  SLRQDPRRIRSYQDLDAPEDEVTVIDYRSL  335
                DPRRIRSYQDLDAPEDEVTV+DYRSL
Sbjct  145  HHMHDPRRIRSYQDLDAPEDEVTVMDYRSL  174


 Score = 67.0 bits (162),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 59/112 (53%), Gaps = 31/112 (28%)
 Frame = -1

Query  987  MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
            M+D  APGGTP+M    P+ K  R+RP +ESRL+D+R                       
Sbjct  1    MNDPKAPGGTPIMQQPAPRGK-GRQRPPIESRLRDER-----------------------  36

Query  807  SSDIQSNDDGGRNPDEQMFDSFGG---HGIPVAAFPSDITPPPVLMPVPGAG  661
             +    +D  G NPD+ ++DSFG    HG    AFP DI  PPVLMPVPGAG
Sbjct  37   GNHRLDSDGSGENPDDPVYDSFGDPTMHG----AFPPDIPAPPVLMPVPGAG  84



>ref|XP_008385647.1| PREDICTED: serrate RNA effector molecule [Malus domestica]
Length=279

 Score =   124 bits (311),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 56/67 (84%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REGL SYKQFIQELEDDILP+EAERRYQEYK+ Y+  QKRAYF+AHKDE+WLKDKYHPTN
Sbjct  205   REGLMSYKQFIQELEDDILPSEAERRYQEYKTEYVSTQKRAYFNAHKDEDWLKDKYHPTN  264

Query  1878  LVSVIER  1858
             L++VIER
Sbjct  265   LLTVIER  271



>ref|XP_005643110.1| hypothetical protein COCSUDRAFT_68267 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18566.1| hypothetical protein COCSUDRAFT_68267 [Coccomyxa subellipsoidea 
C-169]
Length=659

 Score =   127 bits (320),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 107/377 (28%), Positives = 179/377 (47%), Gaps = 34/377 (9%)
 Frame = -1

Query  2061  CREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
              + G  SYK+F+  L DD+ P +A+  YQ+Y + Y  ++ RA F   ++ +W++ KY P 
Sbjct  110   AKTGPMSYKEFMMRLSDDVTPEDAQVEYQKYLAQYWGSETRAEFQQKQNLDWMRKKYDPR  169

Query  1881  NLVSVIERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPN-SDDEAD-AG  1708
              L+  +E+RN  A+  A+ F   L  G LD     +P+    TG+ +  +  +  AD + 
Sbjct  170   QLMVALEQRNTDAQAAAEAFGEALAEGKLDP---ASPSFHQGTGEGAAADVQNGHADGSA  226

Query  1707  DKRRRHDRGPSKDARLLSDAPKAHPVSS---EPRRICIDVEQSQTLVAKLDSEKGIEENI  1537
             +K    D     D + L     +  V     +  R+  D+  S+ L+ KLD+EKGIE N 
Sbjct  227   EKESAADGAKEGDDKELDAETSSSAVPGAGWKAARVEADLALSKELMLKLDAEKGIESNP  286

Query  1536  LsrsdndrgsrdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMI  1357
             L           +           +     +    E    L+  LTYLWR+H +DYYG  
Sbjct  287   LEAQATAAEPAKEGE---------VGEEAATKGYEEQVGQLDLQLTYLWRVHSLDYYGGA  337

Query  1356  ETNEA-------KGLRHMRF-DGKNTETSSNGAD---WERKLDSRWEERLKGQDPLEVMT  1210
             E  +        + LR  R  +G+  + +  G +    E ++D+ W++RL   DP+E   
Sbjct  338   ELQDPADVSAAKRTLRGPRPEEGEQPDEAEEGKELKALEEQVDAVWKKRLTAGDPVEAYL  397

Query  1209  AKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLE  1030
              ++K+     E +E  V +I + KYG K         KLF   E+V KH++LKH  ++  
Sbjct  398   QRDKVQKLVEEWVEDQVLQIEENKYGCKL------SQKLFVGKEYVLKHIRLKHTAVLEA  451

Query  1029  LTSKVREDLYFQNYMSD  979
                K+ + +Y++N+ SD
Sbjct  452   HREKIYDQIYYENFESD  468



>gb|EPS59535.1| hypothetical protein M569_15270, partial [Genlisea aurea]
Length=277

 Score =   122 bits (306),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTN  1879
             REG+ SYKQFIQELEDDILPAEAE+RYQEY+S YI  QKR YF+AHKDEEWLKDKYHPTN
Sbjct  211   REGMMSYKQFIQELEDDILPAEAEKRYQEYRSEYISTQKRNYFNAHKDEEWLKDKYHPTN  270

Query  1878  LVSVIER  1858
             L++V+ER
Sbjct  271   LLAVVER  277



>ref|XP_010473101.1| PREDICTED: serrate RNA effector molecule-like [Camelina sativa]
Length=180

 Score = 96.3 bits (238),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 9/80 (11%)
 Frame = -3

Query  571  PLGPFVPAPPEVAMQMLREQGGPAP-FEGGRNGRQGPQIGGQAPIIALPPSLRQDPRRIR  395
            PLGPFVPAPPEVAMQM R+  GP P FEG  +GR GP     AP + L P+ RQDPRR+R
Sbjct  109  PLGPFVPAPPEVAMQMFRDPSGPNPSFEG--SGRGGP-----APFL-LSPAFRQDPRRLR  160

Query  394  SYQDLDAPEDEVTVIDYRSL  335
            SYQDLDAPE+EVTVIDYRSL
Sbjct  161  SYQDLDAPEEEVTVIDYRSL  180


 Score = 51.2 bits (121),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 3/110 (3%)
 Frame = -1

Query  987  MSDESAPGGTPVMLSSLPKEKLQRRRPSLESRLKDDrgnrrerngrvngveRFDRPENPL  808
            M+D +APGG P    S P+++  +R+P +E+RL+DDRG RRER+GR NG +R DR E+  
Sbjct  1    MNDPNAPGGQPATQQSGPRDRPMKRKPGMENRLRDDRGGRRERDGRANGNDRNDRSED--  58

Query  807  SSDIQSNDDGGRNPDEQMFDSFGGH-GIPVAAFPSDITPPPVLMPVPGAG  661
                  +   G NP E  +D+FGG  G+ V  F SDI PPP+LMPVPGAG
Sbjct  59   QQRGDGDGPDGGNPGEGGYDAFGGQAGVHVPPFLSDINPPPMLMPVPGAG  108



>ref|XP_003083474.1| putative C2H2 zinc-finger protein (ISS) [Ostreococcus tauri]
 emb|CAL58023.1| Zinc finger, C2H2 [Ostreococcus tauri]
Length=481

 Score = 98.2 bits (243),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 105/373 (28%), Positives = 171/373 (46%), Gaps = 47/373 (13%)
 Frame = -1

Query  2043  SYKQFIQE-LEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSV  1867
             S++ F  + L DD  PAEAERRY+EY+    EA    Y+  H+ +E  + +  P  LV  
Sbjct  63    SFRDFCYKYLRDDTTPAEAERRYEEYQKENQEAFYERYWRDHRHDEHERARNDPRRLVET  122

Query  1866  IERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHD  1687
             + RR++ +R  A++F    +SG+LD+         ++ G  ++ N ++  D  +   +H 
Sbjct  123   LARRDDVSRAHAQEFFTARESGSLDVYG--AEEGGHDEGDDADVNMNEGGDNAEGGEQHH  180

Query  1686  RGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrgs  1507
             +      R ++     HPV     R+  D +Q+  L+A LD+EKGIE N L  +D   G 
Sbjct  181   K-----KRSVAPIEAWHPV-----RLGFDFKQAGKLIAALDAEKGIEGNPLLNADEGVGM  230

Query  1506  rdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMIETNEAKGLRH  1327
               ++++      +      T       AE L+  L YL R+HG+DYY  +       +  
Sbjct  231   DTEASAEEDAATLE-----TLGNEEGTAEKLDERLCYLIRVHGIDYYKRVSE-----MHP  280

Query  1326  MRFDGKNTETSS-------------------NGADWERKLDSRWEERLKGQDPLEVMTAK  1204
             + F  K T T++                    G  W   LD   + R+   DP       
Sbjct  281   VTFLEKVTMTTTFSKRDPKPAEPVRPVAENPYGVRWSAALDGNVKRRITEGDPQVKKLGT  340

Query  1203  EKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELT  1024
             E+I+    E ++  V K  DE+   +YGC A  CTKLF A EF+ KH+K KH     +  
Sbjct  341   EEIERKLEEWVQSCVVK-HDEQ---RYGC-ALNCTKLFVAPEFLVKHVKTKHASAYEQQR  395

Query  1023  SKVREDLYFQNYM  985
               + ++ + +N +
Sbjct  396   ESLIDEQFHRNVL  408



>ref|XP_004165090.1| PREDICTED: serrate RNA effector molecule-like, partial [Cucumis 
sativus]
Length=255

 Score = 87.8 bits (216),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = -1

Query  2058  REGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEE  1909
             REGL +YKQF+QELEDDILPAEAERRYQEYKS YI  QK+A+FD+HKDEE
Sbjct  206   REGLMTYKQFMQELEDDILPAEAERRYQEYKSEYITTQKQAFFDSHKDEE  255



>ref|XP_004336218.1| hypothetical protein ACA1_138820 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14205.1| hypothetical protein ACA1_138820 [Acanthamoeba castellanii str. 
Neff]
Length=747

 Score = 86.7 bits (213),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/122 (44%), Positives = 68/122 (56%), Gaps = 11/122 (9%)
 Frame = -1

Query  1278  WERKLDSRWEERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCT  1099
             W   LD+R E+RL    P E+ TAK  ++      LE +V++  DEK   KY C    CT
Sbjct  494   WLAYLDARLEQRLSAPAP-ELCTAKLAVEQEVDAFLEAHVKR-EDEK---KYRCAVPKCT  548

Query  1098  KLFHAAEFVHKHLKLKHPELVLELTSKVREDLYFQNYMSDESAPGGTPVMLSSLPKEKLQ  919
             KLF A +FV KHLKLKHP LV E T K  E+ YFQNY+ D         +L S+P+  L 
Sbjct  549   KLFMAPDFVRKHLKLKHPHLVEEATRKAVEEQYFQNYVRDPR------RILPSMPEATLS  602

Query  918   RR  913
              R
Sbjct  603   AR  604



>ref|XP_001421677.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99970.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=473

 Score = 73.6 bits (179),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 100/366 (27%), Positives = 156/366 (43%), Gaps = 47/366 (13%)
 Frame = -1

Query  2043  SYKQFIQE-LEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSV  1867
             S++ F  + L DD  PAEAERRY+EYK    EA    YF  H+ +E  + +  P  LV  
Sbjct  63    SFRDFCYKYLRDDTTPAEAERRYEEYKKENQEAFYERYFRDHRHDEGERARNDPRVLVET  122

Query  1866  IERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHD  1687
             ++RR+E A   A +F      G+L +                     DE DA  K     
Sbjct  123   LKRRDELACARAHEFFASKADGSLRIY--------------------DEGDAEGKDADMG  162

Query  1686  RGPSKDARLLSDAPKAHPVSS-EPRRICIDVEQSQTLVAKLDSEKGIEENILsrsdndrg  1510
              G  +            P+ +  P R+  D +Q+  L+A LD+EKGI+ N L   D D G
Sbjct  163   EGEHQGEHQQEKRRSMVPIEAWHPTRLGTDYKQTGRLIAALDAEKGIDNNPLLDGDEDSG  222

Query  1509  srdksnssssGPVVVIVRGLTSVKglegaelletlltyLWRIHGVDYYGMI-ETNEAKGL  1333
                ++       +  +    ++ + L+             R+HGVDYY  I E      L
Sbjct  223   MDAEAAEDDVAALEALGNEASTPEKLDERLCYLV------RVHGVDYYRRISEMQPVTFL  276

Query  1332  RHM-----RFDGK--NTETSSNGAD-----WERKLDSRWEERLKGQDPLEVMTAKEKIDT  1189
               +     + D K  +T  SS   +         +D+  + R+   DP        +I++
Sbjct  277   EKLPSAFAKRDPKPEDTPVSSIAQNPYAVRLFATVDANVKRRIAEGDPQVKKLGTSEIES  336

Query  1188  AAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLELTSKVRE  1009
                E ++  V K  DE+   ++GC     TKLF A EFV KH+K K    V ++  ++ +
Sbjct  337   KLDEWIQSCVVK-HDEQ---RFGCTL--STKLFVAEEFVIKHIKTKQAHHVEDMRERLFD  390

Query  1008  DLYFQN  991
             + Y +N
Sbjct  391   EQYRKN  396



>gb|AFW66323.1| hypothetical protein ZEAMMB73_651615 [Zea mays]
Length=380

 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 46/68 (68%), Gaps = 4/68 (6%)
 Frame = -1

Query  1980  YQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSVIERRNERA----RKMAKDFLLD  1813
             Y+EYKS YI  QK+AYFD HKDE+WL++KYHPTNL +VIER           + K F L 
Sbjct  26    YEEYKSEYITTQKKAYFDLHKDEDWLRNKYHPTNLGNVIERWPMLFLFDENLLRKVFELY  85

Query  1812  LQSGTLDL  1789
              ++G LDL
Sbjct  86    YENGLLDL  93



>ref|XP_642791.1| C2H2-type zinc finger-containing protein [Dictyostelium discoideum 
AX4]
 gb|EAL68874.1| C2H2-type zinc finger-containing protein [Dictyostelium discoideum 
AX4]
Length=1068

 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
              +SYKQF+   +D I P EA+++Y+EYK  Y + Q R +F  H+ EEW K+KY P  L  
Sbjct  204   FRSYKQFLDYQDDSITPIEADKKYEEYKIEYSKRQSRVFFKEHQQEEWFKEKYDPFFLAK  263

Query  1869  VIERRNERARKMAKDFLLDL  1810
               + + E+++   + F L+L
Sbjct  264   KRKEKVEKSKSFIQTFALNL  283


 Score = 59.7 bits (143),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 61/119 (51%), Gaps = 9/119 (8%)
 Frame = -1

Query  1326  MRFDGKNTE-TSSNGADWERKLDSRWEERL-KGQDPLEVMTAKEKIDTAAVEALEPYVRK  1153
             M  D K  + T+ +   W   LD+  + ++ K     E  T KE I+ AA E +     K
Sbjct  735   MEIDNKQPKLTTESEMLWVTSLDNNTKNKINKIPTSEEQYTCKESIEKAAEEYIATNTIK  794

Query  1152  IRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHPE-LVLELTSKVREDLYFQNYMSD  979
             I +EK+     C    C+KLF  AEFV KH+ LKHPE L  E  +K  E+ +F NY SD
Sbjct  795   IEEEKFK----CSL--CSKLFRGAEFVKKHINLKHPEDLQKESEAKGTEEQFFLNYFSD  847



>ref|XP_003293253.1| hypothetical protein DICPUDRAFT_58394 [Dictyostelium purpureum]
 gb|EGC30217.1| hypothetical protein DICPUDRAFT_58394 [Dictyostelium purpureum]
Length=924

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
              +SYKQF+   +D I  A+A+++Y+EYK  Y + Q R +F  H++EEW K+KY P  L  
Sbjct  162   FRSYKQFLDYQDDQITAADADKKYEEYKVEYSKRQSRVFFKEHQNEEWFKEKYDPVFLAK  221

Query  1869  VIERRNERARKMAKDFLLDLQ  1807
               + + E+++ +   F L+L 
Sbjct  222   KRKEKVEKSKSLVSTFSLNLN  242


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 45/82 (55%), Gaps = 7/82 (9%)
 Frame = -1

Query  1221  EVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVHKHLKLKHP-  1045
             E    KE I+ AA + +     KI +EKY     C    C+KLF  AE+V KH+ LKHP 
Sbjct  664   EQYLCKEAIEKAAEDYINNNTIKIEEEKYK----CNL--CSKLFKGAEYVKKHINLKHPE  717

Query  1044  ELVLELTSKVREDLYFQNYMSD  979
             EL  E  +K  E+ +F NY SD
Sbjct  718   ELKNESETKGTEEQFFLNYFSD  739



>ref|XP_001693770.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09024.1| predicted protein [Chlamydomonas reinhardtii]
Length=428

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 73/148 (49%), Gaps = 19/148 (13%)
 Frame = -1

Query  1392  WRIHGVDYYGMIETNEA------KGLRHMRF----DGKNTETSSNGADWE---RKLDSRW  1252
             W++HGVDYY  IE NE          R +R     +G+  + ++  AD E   R++D  W
Sbjct  231   WKVHGVDYYAGIELNEQDWPYRLNCCRLIRGPKPEEGEGEDEATAKADREKLGRQVDETW  290

Query  1251  EERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFV  1072
               R+   DP+E    K +I+    + +E  V  + D K+G      +K   KLF   ++V
Sbjct  291   NRRISLGDPIEAKCMKARIEDELDKWIESQVTMVADNKWG------SKLSNKLFVGKKYV  344

Query  1071  HKHLKLKHPELVLELTSKVREDLYFQNY  988
              KH+K KH + +     ++ + LYF N+
Sbjct  345   IKHIKTKHQDKLAVERERILDQLYFDNF  372


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 47/85 (55%), Gaps = 1/85 (1%)
 Frame = -1

Query  2043  SYKQF-IQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSV  1867
             ++K+F + ++ DD  P  A R +QEY   Y  +  +A F+ +KD +  K ++ P N   V
Sbjct  77    TFKEFMLHKVPDDAAPDVAHRMFQEYLVEYYGSAIKAEFEQNKDSDMFKYQFDPRNFAKV  136

Query  1866  IERRNERARKMAKDFLLDLQSGTLD  1792
             +  R E A+  AK    DL SGTLD
Sbjct  137   VASRAEEAQDSAKHVAADLASGTLD  161



>ref|XP_004359066.1| C2H2-type zinc finger-containing protein [Dictyostelium fasciculatum]
 gb|EGG21216.1| C2H2-type zinc finger-containing protein [Dictyostelium fasciculatum]
Length=888

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -1

Query  2052  GLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLV  1873
               K+YKQF+   +D I P +AE+RY EY++ +++ Q R +F  H+ EEW ++KY P+ L+
Sbjct  204   ACKTYKQFLDYQDDSITPTDAEKRYDEYRTEFLKKQSRVFFKDHQTEEWFREKYDPSFLI  263

Query  1872  SVIERRNERARKMAKDFL  1819
                + + E A+   + F+
Sbjct  264   KKHKEKIEFAKNRVQPFI  281



>emb|CDS27738.1| serrate RNA effector molecule [Hymenolepis microstoma]
Length=857

 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 53/95 (56%), Gaps = 0/95 (0%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  R  LK +K+F++ L+D I   EA  +Y EYK  + +     +F+AHKDEEWL++KYH
Sbjct  96    SIYRPPLKPFKRFLEPLDDFITDVEAVAKYNEYKKNFNKQYIEKFFEAHKDEEWLREKYH  155

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTLDLGP  1783
             P  +   +E+ ++  R     FL     G +D  P
Sbjct  156   PDFVDETLEQISKTIRHRLDIFLDLFDKGMIDNQP  190



>gb|AAM11365.1| LD27090p [Drosophila melanogaster]
Length=259

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             +  +  + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYH
Sbjct  58    TLTQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYH  117

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTL  1795
             P + V   E +    ++    F+  L++GT+
Sbjct  118   PEDSVKRSEEQRGFLQRRTDVFMELLENGTI  148



>ref|XP_002949189.1| zinc finger related protein [Volvox carteri f. nagariensis]
 gb|EFJ49682.1| zinc finger related protein [Volvox carteri f. nagariensis]
Length=667

 Score = 63.9 bits (154),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 69/149 (46%), Gaps = 18/149 (12%)
 Frame = -1

Query  1392  WRIHGVDYYGMIETNE------------AKGLRHMRFDGKNTETSSNGADWERKLDSRWE  1249
             W++HGVDYY  IE NE             +G +    + +     +      R +D  W+
Sbjct  369   WKVHGVDYYAGIELNEQDWPYRLNCCRLIRGPKPEEGESEEGAEKAEKEKLTRTVDETWK  428

Query  1248  ERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVH  1069
              R+   DP+E    K +I+    + +E  V  + D K+G      +K   KLF   ++V 
Sbjct  429   ARIAHGDPIEAKCLKARIEEELDKWIESQVTMVADNKWG------SKLSNKLFVGKKYVI  482

Query  1068  KHLKLKHPELVLELTSKVREDLYFQNYMS  982
             KH+K KH + +     ++ + LYF+N+ +
Sbjct  483   KHIKTKHQDKLAAERERILDMLYFENFRT  511


 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 81/173 (47%), Gaps = 23/173 (13%)
 Frame = -1

Query  2043  SYKQF-IQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSV  1867
             ++K+F ++++ DD  P  A R +QEY   Y  +  +A F+ +KD +  K ++ P     V
Sbjct  126   TFKEFTLRKVPDDAAPDVAHRMFQEYLVEYYGSAIKAEFEQNKDSDVFKYQFDPRYFAKV  185

Query  1866  IERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSE--PNSDDEADAGDKRRR  1693
             +  R E A+  AK    D+ SG LD      P+  N      +  P  + +   G+    
Sbjct  186   VASRAEEAQDSAKHIAADVASGALD------PSHENFCQGMYDLAPKVEKDKQPGNA---  236

Query  1692  HDRGPSKDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIEENIL  1534
              + GP     L    P          R+  D++ S+ L+ KLD+EKGIEEN L
Sbjct  237   -EEGPKFAPNLCWRMP----------RVAHDLDLSRKLIRKLDAEKGIEENPL  278



>ref|XP_008495048.1| PREDICTED: uncharacterized protein LOC103531196 [Calypte anna]
Length=297

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  161   MKSFKEFLLSLDDAVDETEAVKRYNDYKLEFRRQQMQDFFLAHKDEEWFRSKYHPDE---  217

Query  1869  VIERRNERARKMAKDFL  1819
              + RR E AR   ++ L
Sbjct  218   -VGRRREEARAALRNRL  233



>gb|AAW31949.1| arsenite-resistance protein [Volvox carteri f. nagariensis]
Length=669

 Score = 63.5 bits (153),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/149 (27%), Positives = 68/149 (46%), Gaps = 18/149 (12%)
 Frame = -1

Query  1392  WRIHGVDYYGMIETNE------------AKGLRHMRFDGKNTETSSNGADWERKLDSRWE  1249
             W++HGVDYY  IE NE             +G +    + +     +      R +D  W+
Sbjct  370   WKVHGVDYYAGIELNEQDWPYRLNCCRLIRGPKPEEGESEEGAEKAEKEKLTRTVDETWK  429

Query  1248  ERLKGQDPLEVMTAKEKIDTAAVEALEPYVRKIRDEKYGWKYGCGAKGCTKLFHAAEFVH  1069
              R+   DP+E    K +I+    + +E  V  + D K+G K         KLF   ++V 
Sbjct  430   ARIAHGDPIEAKCLKARIEEELDKWIESQVTMVADNKWGTKL------SNKLFVGKKYVI  483

Query  1068  KHLKLKHPELVLELTSKVREDLYFQNYMS  982
             KH+K KH + +     ++ + LYF+N+ +
Sbjct  484   KHIKTKHQDKLAAERERILDMLYFENFRT  512



>gb|EGI59578.1| Serrate RNA effector molecule-like protein [Acromyrmex echinatior]
Length=764

 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  14    MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  73

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  74    RKEEQVSALKKRVEIFLEMLKSGDIE  99



>ref|XP_002026596.1| GL11804 [Drosophila persimilis]
 sp|B4H732.1|SRRT_DROPE RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 homolog [Drosophila persimilis]
 gb|EDW33565.1| GL11804 [Drosophila persimilis]
Length=951

 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             +  +  + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYH
Sbjct  148   TLTQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYH  207

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTL  1795
             P + V+  E +    R+    F+  L++GT+
Sbjct  208   PEDSVNRSEEQRGFLRRRTDVFVELLENGTI  238



>ref|XP_001362029.2| GA20626, isoform A [Drosophila pseudoobscura pseudoobscura]
 sp|Q28WQ8.2|SRRT_DROPS RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 homolog [Drosophila pseudoobscura 
pseudoobscura]
 gb|EAL26609.2| GA20626, isoform A [Drosophila pseudoobscura pseudoobscura]
Length=951

 Score = 63.2 bits (152),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             +  +  + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYH
Sbjct  148   TLTQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYH  207

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTL  1795
             P + V+  E +    R+    F+  L++GT+
Sbjct  208   PEDSVNRSEEQRGFLRRRTDVFVELLENGTI  238



>ref|XP_008830547.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Nannospalax 
galili]
Length=873

 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLDL  1789
              + +R + AR   ++    FL  ++SG  D+
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFDI  235



>ref|XP_008830546.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Nannospalax 
galili]
Length=874

 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLDL  1789
              + +R + AR   ++    FL  ++SG  D+
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFDI  235



>gb|EFN83063.1| Arsenite-resistance protein 2-like protein [Harpegnathos saltator]
Length=384

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYKS +   Q   +F AHKDEEW K KYHP   V 
Sbjct  171   MMSFKAFLGTQEDTITDEEAIKRYNEYKSEFRRQQMNEFFVAHKDEEWFKIKYHPEESVK  230

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               + +    +K  + FL  L+ G +D
Sbjct  231   RKDEQVSALKKRVEVFLEMLKLGEID  256



>ref|XP_008830550.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Nannospalax 
galili]
Length=869

 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLDL  1789
              + +R + AR   ++    FL  ++SG  D+
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFDI  235



>ref|XP_008830549.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Nannospalax 
galili]
Length=870

 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLDL  1789
              + +R + AR   ++    FL  ++SG  D+
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFDI  235



>ref|XP_008830551.1| PREDICTED: serrate RNA effector molecule homolog isoform X5 [Nannospalax 
galili]
Length=867

 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLDL  1789
              + +R + AR   ++    FL  ++SG  D+
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFDI  235



>ref|XP_008830552.1| PREDICTED: serrate RNA effector molecule homolog isoform X6 [Nannospalax 
galili]
 ref|XP_008830553.1| PREDICTED: serrate RNA effector molecule homolog isoform X6 [Nannospalax 
galili]
Length=863

 Score = 62.8 bits (151),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLDL  1789
              + +R + AR   ++    FL  ++SG  D+
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFDI  235



>ref|XP_002006841.1| GI21286 [Drosophila mojavensis]
 sp|B4KLY7.1|SRRT_DROMO RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 homolog [Drosophila mojavensis]
 gb|EDW10776.1| GI21286 [Drosophila mojavensis]
Length=980

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = -1

Query  2052  GLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLV  1873
              + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYHP + V
Sbjct  161   AMLTLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSV  220

Query  1872  SVIERRNERARKMAKDFLLDLQSGTL  1795
                E +    ++  + FL  L++GT+
Sbjct  221   RRSEEQRGFLKRRTEVFLELLENGTI  246



>ref|XP_001961341.1| GF13819 [Drosophila ananassae]
 sp|B3MJ69.1|SRRT_DROAN RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 homolog [Drosophila ananassae]
 gb|EDV38163.1| GF13819 [Drosophila ananassae]
Length=948

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             S  +  + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYH
Sbjct  151   SLTQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYH  210

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTL  1795
             P + V   E +    ++    F+  L++GT+
Sbjct  211   PEDSVRRAEEQRGFLKRRTDVFVELLENGTI  241



>gb|EFZ12062.1| hypothetical protein SINV_04615 [Solenopsis invicta]
Length=953

 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  181   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  240

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K    FL  LQ G +D
Sbjct  241   RKEEQVSALKKRVDIFLELLQLGDID  266



>ref|XP_006764766.1| PREDICTED: serrate RNA effector molecule homolog isoform X7 [Myotis 
davidii]
Length=803

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_011063860.1| PREDICTED: serrate RNA effector molecule homolog isoform X6 [Acromyrmex 
echinatior]
Length=925

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  153   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  212

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  213   RKEEQVSALKKRVEIFLEMLKSGDIE  238



>ref|XP_002049185.1| GJ20888 [Drosophila virilis]
 sp|B4LIK8.1|SRRT_DROVI RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 homolog [Drosophila virilis]
 gb|EDW60378.1| GJ20888 [Drosophila virilis]
Length=963

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2052  GLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLV  1873
              + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYHP + V
Sbjct  157   AMLTLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYHPEDSV  216

Query  1872  SVIERRNERARKMAKD----FLLDLQSGTL  1795
                 RR+E  R   K     FL  L++GT+
Sbjct  217   ----RRSEEQRGFLKRRTDVFLELLENGTI  242



>ref|XP_006504693.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Mus 
musculus]
Length=778

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  52    MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  108

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  109   -VGKRRQEARGALQNRLKVFLSLMESGWFD  137



>ref|XP_011063856.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Acromyrmex 
echinatior]
Length=927

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  153   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  212

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  213   RKEEQVSALKKRVEIFLEMLKSGDIE  238



>ref|XP_011063859.1| PREDICTED: serrate RNA effector molecule homolog isoform X5 [Acromyrmex 
echinatior]
Length=918

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  157   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  216

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  217   RKEEQVSALKKRVEIFLEMLKSGDIE  242



>ref|XP_002502723.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63981.1| predicted protein [Micromonas sp. RCC299]
Length=673

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/172 (32%), Positives = 79/172 (46%), Gaps = 9/172 (5%)
 Frame = -1

Query  2043  SYKQF-IQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVSV  1867
             S+++F IQ L D I PAEAER YQ Y+  + E  +   F   K++  L++ + P  L   
Sbjct  86    SFREFTIQHLPDHIAPAEAERAYQRYQETHAEKFRERNFHDVKNDPKLRELHDPRKLDGP  145

Query  1866  IERRNERARKMAKDFLLDLQSGTLDLGPGVTPTPSNNTGQSSEPNSDDEADAGDKRRRHD  1687
                R E A   AK+F   L +GTL++       P+       + + D      D+RR H 
Sbjct  146   FRTRAELAADAAKEFHERLAAGTLEMPKPAEAPPTAPDPPKDDKDDDAGDAPADERRHHR  205

Query  1686  RGPS-----KDARLLSDAPKAHPVSSEPRRICIDVEQSQTLVAKLDSEKGIE  1546
               P      +DAR     P   P +  P R+  D+     LV  LD EKG+E
Sbjct  206   PFPQRPFERRDARGRFPVP---PQAWNPTRLAHDLRNLVRLVKSLDEEKGVE  254



>ref|XP_011063858.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Acromyrmex 
echinatior]
Length=920

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  157   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  216

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  217   RKEEQVSALKKRVEIFLEMLKSGDIE  242



>ref|XP_005080466.1| PREDICTED: serrate RNA effector molecule homolog isoform X5 [Mesocricetus 
auratus]
Length=882

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005080462.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Mesocricetus 
auratus]
Length=883

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_011063855.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Acromyrmex 
echinatior]
Length=929

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  157   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  216

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  217   RKEEQVSALKKRVEIFLEMLKSGDIE  242



>ref|XP_011063853.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Acromyrmex 
echinatior]
 ref|XP_011063854.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Acromyrmex 
echinatior]
Length=931

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + S+K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   V 
Sbjct  157   MMSFKAFLGTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESVK  216

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L+SG ++
Sbjct  217   RKEEQVSALKKRVEIFLEMLKSGDIE  242



>ref|XP_005080465.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Mesocricetus 
auratus]
Length=876

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_008139649.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Eptesicus 
fuscus]
Length=883

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_008139648.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Eptesicus 
fuscus]
Length=884

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_008544778.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Microplitis 
demolitor]
Length=1149

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + ++K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   + 
Sbjct  180   MMTFKAFLVTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESIK  239

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L SG +D
Sbjct  240   RKEEQISALKKRVEVFLELLNSGEID  265



>ref|XP_005879176.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Myotis 
brandtii]
Length=883

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005879175.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Myotis 
brandtii]
Length=884

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006081065.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Myotis 
lucifugus]
 ref|XP_006081066.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Myotis 
lucifugus]
Length=884

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005080468.1| PREDICTED: serrate RNA effector molecule homolog isoform X7 [Mesocricetus 
auratus]
Length=870

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005080463.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Mesocricetus 
auratus]
Length=871

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005080464.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Mesocricetus 
auratus]
Length=870

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005371483.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Microtus 
ochrogaster]
Length=882

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_008544777.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Microplitis 
demolitor]
Length=1150

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + ++K F+   ED I   EA +RY EYK  +   Q   +F AHKDEEW K KYHP   + 
Sbjct  180   MMTFKAFLVTQEDTITDEEAIKRYNEYKLEFRRQQLNEFFVAHKDEEWFKIKYHPEESIK  239

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
               E +    +K  + FL  L SG +D
Sbjct  240   RKEEQISALKKRVEVFLELLNSGEID  265



>ref|XP_005879177.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Myotis 
brandtii]
Length=876

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>gb|KDO29351.1| hypothetical protein SPRG_05887 [Saprolegnia parasitica CBS 223.65]
Length=679

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  2055  EGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
             E L SYK F+ +  D+  P   ++RY+EYK  YI+   R +FDAHK EEWL+++Y P 
Sbjct  90    EPLMSYKAFMMQQNDESSPEVYQQRYEEYKKKYIQGLMRVFFDAHKSEEWLQERYSPA  147


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 67/141 (48%), Gaps = 16/141 (11%)
 Frame = -1

Query  1359  IETNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAV  1180
             +E N A  + H  F  +  +  +    W   LD R E  +   +  E +++++  + A V
Sbjct  413   VEDNNA--VEHKTFATRENKELAGWGGWSAALDERIEAAIAA-NASEKLSSQKAAEAALV  469

Query  1179  E--------ALEPYVRKIRDEKYG--WKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLE  1030
             E        +LEP V     EK G   K+ C    CTKLF   +FV KH++ KHPELV++
Sbjct  470   EDIEAREEASLEP-VYASYAEKAGDDGKHRCLL--CTKLFKTVDFVKKHIRNKHPELVVD  526

Query  1029  LTSKVREDLYFQNYMSDESAP  967
               +KV E   ++ Y  D   P
Sbjct  527   KIAKVGESYMWEQYREDPDRP  547



>ref|XP_006971305.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Peromyscus 
maniculatus bairdii]
Length=881

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_005371484.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Microtus 
ochrogaster]
Length=883

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_008139651.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Eptesicus 
fuscus]
Length=871

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005879180.1| PREDICTED: serrate RNA effector molecule homolog isoform X6 [Myotis 
brandtii]
Length=871

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_008139650.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Eptesicus 
fuscus]
Length=872

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005879178.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Myotis 
brandtii]
 ref|XP_005879179.1| PREDICTED: serrate RNA effector molecule homolog isoform X5 [Myotis 
brandtii]
 gb|EPQ15707.1| Serrate RNA effector molecule like protein [Myotis brandtii]
Length=872

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006971307.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Peromyscus 
maniculatus bairdii]
Length=874

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>dbj|GAM17977.1| hypothetical protein SAMD00019534_011520 [Acytostelium subglobosum 
LB1]
Length=875

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLV  1873
              K+YKQF+   +D I+P +A+++Y+EYK  + + Q R +F  H+ EEW ++KY P  LV
Sbjct  225   FKTYKQFLDYQDDSIVPTDADKKYEEYKVEFAKRQARLFFKDHQTEEWFREKYDPVYLV  283



>ref|XP_006971306.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Peromyscus 
maniculatus bairdii]
Length=877

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_005080467.1| PREDICTED: serrate RNA effector molecule homolog isoform X6 [Mesocricetus 
auratus]
Length=864

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005371485.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Microtus 
ochrogaster]
Length=875

 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_006971308.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Peromyscus 
maniculatus bairdii]
Length=870

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_006764765.1| PREDICTED: serrate RNA effector molecule homolog isoform X6 [Myotis 
davidii]
Length=871

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006081068.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Myotis 
lucifugus]
Length=871

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006081067.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Myotis 
lucifugus]
Length=872

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006764764.1| PREDICTED: serrate RNA effector molecule homolog isoform X5 [Myotis 
davidii]
 gb|ELK29550.1| Serrate RNA effector molecule like protein [Myotis davidii]
Length=872

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006764763.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Myotis 
davidii]
Length=875

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006764760.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Myotis 
davidii]
 ref|XP_006764761.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Myotis 
davidii]
 ref|XP_006764762.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Myotis 
davidii]
Length=876

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_005371487.1| PREDICTED: serrate RNA effector molecule homolog isoform X5 [Microtus 
ochrogaster]
Length=863

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_006504692.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Mus 
musculus]
 gb|AAK28818.1|AF312033_3 ASR2B [Mus musculus]
Length=871

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_005371486.1| PREDICTED: serrate RNA effector molecule homolog isoform X4 [Microtus 
ochrogaster]
Length=871

 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|NP_113582.1| serrate RNA effector molecule homolog isoform 1 [Mus musculus]
 sp|Q99MR6.1|SRRT_MOUSE RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 [Mus musculus]
 gb|AAK28817.1|AF312033_2 ASR2A [Mus musculus]
 gb|EDL19279.1| arsenate resistance protein 2 [Mus musculus]
Length=875

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|XP_008609376.1| hypothetical protein SDRG_05440 [Saprolegnia diclina VS20]
 gb|EQC37214.1| hypothetical protein SDRG_05440 [Saprolegnia diclina VS20]
Length=658

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  2055  EGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPT  1882
             E L SYK F+ +  D+  P   ++RY+EYK  YI+   R +FDAHK EEWL+++Y P 
Sbjct  90    EPLMSYKAFMMQQNDESSPEVYQQRYEEYKKKYIQGLMRVFFDAHKSEEWLQERYSPA  147


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 68/141 (48%), Gaps = 16/141 (11%)
 Frame = -1

Query  1359  IETNEAKGLRHMRFDGKNTETSSNGADWERKLDSRWEERLKGQDPLEVMTAKEKIDTAAV  1180
             +E N A  + H  F  ++ +  +    W   LD R E  +   +  E + +++  + A V
Sbjct  393   VEDNHA--VEHKTFATRDNKVLAGWGGWSAALDERIEAAIAA-NATEKLASQKAAEAALV  449

Query  1179  E--------ALEPYVRKIRDEKYG--WKYGCGAKGCTKLFHAAEFVHKHLKLKHPELVLE  1030
             +        ALEP V     EK G   K+ C    CTKLF   +FV KH++ KHPELV++
Sbjct  450   DDIEAREEAALEP-VYTSYAEKAGDDGKHRCLL--CTKLFKTVDFVKKHIRNKHPELVVD  506

Query  1029  LTSKVREDLYFQNYMSDESAP  967
               +KV E   +++Y  D   P
Sbjct  507   KIAKVGESYMWESYREDPDRP  527



>ref|NP_001103379.1| serrate RNA effector molecule homolog isoform 2 [Mus musculus]
 gb|AAK28819.1|AF312033_4 ASR2D [Mus musculus]
 gb|AAH66831.1| Ars2 protein [Mus musculus]
Length=868

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>ref|NP_001103380.1| serrate RNA effector molecule homolog isoform 3 [Mus musculus]
 gb|AAK28820.1|AF312033_5 ASR2C [Mus musculus]
Length=864

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMESGWFD  234



>gb|KHJ41686.1| Arsenite-resistance protein 2 [Trichuris suis]
Length=850

 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 51/82 (62%), Gaps = 5/82 (6%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             + ++KQF+   +D I   EA ++YQEYK  Y + Q  A+F AHKD+EW + KYHP +   
Sbjct  130   MMTFKQFLSSQDDYITDEEAMKKYQEYKLDYRKQQLHAFFLAHKDQEWFRMKYHPED---  186

Query  1869  VIERRNER--ARKMAKDFLLDL  1810
              +++RNE+  A K   D  ++L
Sbjct  187   SLKKRNEQKAATKRRLDVFMEL  208



>ref|XP_004705662.1| PREDICTED: serrate RNA effector molecule homolog isoform X1 [Echinops 
telfairi]
Length=883

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGGLQNRLRVFLSLMESGWFD  234



>gb|EDM13276.1| rCG21727 [Rattus norvegicus]
Length=352

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  +++G  D
Sbjct  206   -VGKRRQEARGALQNRLKVFLSLMETGWFD  234



>ref|NP_610203.2| Ars2, isoform A [Drosophila melanogaster]
 ref|NP_724453.1| Ars2, isoform C [Drosophila melanogaster]
 ref|NP_724454.1| Ars2, isoform D [Drosophila melanogaster]
 sp|Q9V9K7.2|SRRT_DROME RecName: Full=Serrate RNA effector molecule homolog; AltName: 
Full=Arsenite-resistance protein 2 homolog [Drosophila melanogaster]
 gb|AAF57281.2| Ars2, isoform A [Drosophila melanogaster]
 gb|AAM68343.1| Ars2, isoform C [Drosophila melanogaster]
 gb|AAM68344.1| Ars2, isoform D [Drosophila melanogaster]
 gb|AAR96160.1| RE64037p [Drosophila melanogaster]
Length=943

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 52/91 (57%), Gaps = 0/91 (0%)
 Frame = -1

Query  2067  SFCREGLKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYH  1888
             +  +  + + KQF+   +++I  +E  R+Y EYK+ +   Q   +F AHKDEEW K+KYH
Sbjct  149   TLTQPAMLNLKQFLDTQDENISDSEVMRKYTEYKTDFKRQQLNEFFVAHKDEEWFKNKYH  208

Query  1887  PTNLVSVIERRNERARKMAKDFLLDLQSGTL  1795
             P + V   E +    ++    F+  L++GT+
Sbjct  209   PEDSVKRSEEQRGFLQRRTDVFMELLENGTI  239



>gb|KGB37733.1| Serrate RNA effector molecule-like protein [Schistosoma haematobium]
Length=991

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = -1

Query  2040  YKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHP  1885
             +K+F+  L+D I   EA  +Y+EYK GY++     +FDAHK+EEWL+ +YHP
Sbjct  112   FKRFLDPLDDLITEEEACSKYKEYKEGYMKRHTEEFFDAHKNEEWLRLRYHP  163



>ref|XP_010397867.1| PREDICTED: serrate RNA effector molecule homolog, partial [Corvus 
cornix cornix]
Length=136

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHP  1885
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP
Sbjct  16    MKSFKEFLLSLDDAVDETEAVKRYNDYKLDFRRQQLQEFFLAHKDEEWFRSKYHP  70



>ref|XP_008297233.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Stegastes 
partitus]
Length=859

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY EYK  +   Q + +F AHKDEEW + KYHP     
Sbjct  148   MKSFKEFLLSLDDSVDETEAVKRYNEYKIDFRRQQMQDFFLAHKDEEWFRSKYHPDEASR  207

Query  1869  VIERRNERARKMAKDFLLDLQSGTLD  1792
             +              F+  L++G  D
Sbjct  208   LKAEAQSALNNRLNVFVFLLENGWFD  233



>ref|XP_008696663.1| PREDICTED: serrate RNA effector molecule homolog isoform X3 [Ursus 
maritimus]
Length=710

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +K++K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_006942067.1| PREDICTED: LOW QUALITY PROTEIN: serrate RNA effector molecule 
homolog [Felis catus]
Length=851

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +K++K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKTFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGALQNRLRVFLSLMESGWFD  234



>ref|XP_004705663.1| PREDICTED: serrate RNA effector molecule homolog isoform X2 [Echinops 
telfairi]
Length=871

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  149   MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  205

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  ++SG  D
Sbjct  206   -VGKRRQEARGGLQNRLRVFLSLMESGWFD  234



>ref|XP_004617359.1| PREDICTED: serrate RNA effector molecule homolog [Sorex araneus]
Length=804

 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 52/90 (58%), Gaps = 8/90 (9%)
 Frame = -1

Query  2049  LKSYKQFIQELEDDILPAEAERRYQEYKSGYIEAQKRAYFDAHKDEEWLKDKYHPTNLVS  1870
             +KS+K+F+  L+D +   EA +RY +YK  +   Q + +F AHKDEEW + KYHP     
Sbjct  70    MKSFKEFLLSLDDSVDETEAVKRYNDYKLDFRRQQMQDFFLAHKDEEWFRSKYHPDE---  126

Query  1869  VIERRNERARKMAKD----FLLDLQSGTLD  1792
              + +R + AR   ++    FL  +++G  D
Sbjct  127   -VGKRRQEARGALQNRLRVFLSLMETGWFD  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6326231589360