BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21687_g1_i1 len=955 path=[1243:0-602 1846:603-604 1848:605-688
1936:689-800 2048:801-878 154:879-954]

Length=955
                                                                      Score     E

ref|XP_003632086.1|  PREDICTED: syntaxin-61                             338   1e-112   
emb|CBI24703.3|  unnamed protein product                                340   1e-112   
ref|XP_007025513.1|  Syntaxin of plants 61                              337   5e-112   
gb|EYU30372.1|  hypothetical protein MIMGU_mgv1a012515mg                336   8e-112   
gb|EYU29617.1|  hypothetical protein MIMGU_mgv1a019006mg                334   7e-111   
ref|XP_009627527.1|  PREDICTED: syntaxin-61                             330   2e-109   
ref|XP_002305773.2|  Syntaxin 61 family protein                         330   2e-109   Populus trichocarpa [western balsam poplar]
emb|CDP08007.1|  unnamed protein product                                330   4e-109   
ref|XP_011027754.1|  PREDICTED: syntaxin-61                             328   1e-108   
ref|XP_009783573.1|  PREDICTED: syntaxin-61                             325   1e-107   
gb|KDP21907.1|  hypothetical protein JCGZ_03045                         324   4e-107   
ref|XP_008460099.1|  PREDICTED: syntaxin-61                             319   5e-105   
ref|XP_009338699.1|  PREDICTED: syntaxin-61-like isoform X1             319   5e-105   
ref|XP_010031666.1|  PREDICTED: syntaxin-61                             318   1e-104   
ref|XP_011001211.1|  PREDICTED: syntaxin-61-like                        317   2e-104   
ref|XP_010538187.1|  PREDICTED: syntaxin-61-like                        317   2e-104   
ref|XP_004145007.1|  PREDICTED: syntaxin-61-like                        317   4e-104   
ref|XP_011097050.1|  PREDICTED: syntaxin-61                             317   4e-104   
ref|XP_009360989.1|  PREDICTED: syntaxin-61-like isoform X1             317   5e-104   
ref|XP_007211922.1|  hypothetical protein PRUPE_ppa010587mg             315   1e-103   
ref|XP_006377433.1|  Syntaxin 61 family protein                         315   1e-103   
gb|AFK40078.1|  unknown                                                 315   2e-103   
ref|XP_010097811.1|  hypothetical protein L484_000959                   315   3e-103   
ref|XP_003617552.1|  Syntaxin-61                                        314   7e-103   
ref|XP_008226891.1|  PREDICTED: syntaxin-61                             313   8e-103   
ref|XP_010269837.1|  PREDICTED: syntaxin-61-like isoform X3             311   1e-101   
ref|XP_010269836.1|  PREDICTED: syntaxin-61-like isoform X2             311   1e-101   
ref|XP_006452410.1|  hypothetical protein CICLE_v10009295mg             310   1e-101   
ref|XP_010549364.1|  PREDICTED: syntaxin-61-like                        310   1e-101   
gb|KHN11919.1|  Syntaxin-61                                             310   2e-101   
ref|XP_003544886.1|  PREDICTED: syntaxin-61-like isoform X1             310   2e-101   
ref|XP_003551880.1|  PREDICTED: syntaxin-61                             309   3e-101   
ref|XP_006475038.1|  PREDICTED: syntaxin-61-like                        308   7e-101   
ref|XP_010269835.1|  PREDICTED: syntaxin-61-like isoform X1             310   7e-101   
ref|XP_006342585.1|  PREDICTED: syntaxin-61-like isoform X1             308   8e-101   
ref|XP_004252790.1|  PREDICTED: syntaxin-61                             308   8e-101   
gb|KHG08114.1|  Syntaxin-61 -like protein                               308   8e-101   
ref|NP_001239921.1|  uncharacterized protein LOC100795447               308   1e-100   
ref|XP_010269839.1|  PREDICTED: syntaxin-61-like isoform X5             307   2e-100   
ref|XP_004491402.1|  PREDICTED: syntaxin-61-like                        307   2e-100   
ref|NP_001241250.1|  uncharacterized protein LOC100787129               307   3e-100   
ref|XP_007142287.1|  hypothetical protein PHAVU_008G267900g             303   6e-99    
ref|XP_010269838.1|  PREDICTED: syntaxin-61-like isoform X4             302   3e-98    
gb|KHG02101.1|  Syntaxin-61 -like protein                               302   3e-98    
ref|XP_004294428.1|  PREDICTED: syntaxin-61-like                        301   4e-98    
ref|XP_010274513.1|  PREDICTED: syntaxin-61-like                        300   1e-97    
ref|XP_010930956.1|  PREDICTED: syntaxin-61-like                        300   2e-97    
gb|EYU20611.1|  hypothetical protein MIMGU_mgv1a011514mg                298   2e-96    
ref|XP_007146484.1|  hypothetical protein PHAVU_006G044400g             295   9e-96    
ref|XP_008781445.1|  PREDICTED: syntaxin-61-like                        295   1e-95    
ref|XP_003600111.1|  Syntaxin-61                                        294   2e-95    
ref|XP_010499379.1|  PREDICTED: syntaxin-61 isoform X1                  293   9e-95    
ref|NP_564310.1|  syntaxin-61                                           291   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478222.1|  PREDICTED: syntaxin-61-like                        291   4e-94    
gb|AAL59937.1|  unknown protein                                         291   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009404897.1|  PREDICTED: syntaxin-61-like isoform X1             291   5e-94    
ref|XP_009404898.1|  PREDICTED: syntaxin-61-like isoform X2             290   9e-94    
ref|XP_006415648.1|  hypothetical protein EUTSA_v10008609mg             289   2e-93    
ref|XP_009102901.1|  PREDICTED: syntaxin-61-like isoform X1             289   4e-93    
ref|XP_006304138.1|  hypothetical protein CARUB_v10010122mg             288   4e-93    
ref|XP_009109711.1|  PREDICTED: syntaxin-61                             287   1e-92    
ref|XP_010693150.1|  PREDICTED: syntaxin-61                             286   4e-92    
emb|CDX94628.1|  BnaC07g10300D                                          286   5e-92    
ref|XP_009113656.1|  PREDICTED: syntaxin-61-like isoform X4             285   6e-92    
ref|XP_009113652.1|  PREDICTED: syntaxin-61-like isoform X1             286   2e-91    
ref|XP_009113653.1|  PREDICTED: syntaxin-61-like isoform X2             285   3e-91    
emb|CDX90156.1|  BnaA08g18280D                                          290   7e-91    
ref|XP_010912452.1|  PREDICTED: syntaxin-61-like isoform X3             282   1e-90    
ref|XP_002459155.1|  hypothetical protein SORBIDRAFT_03g046820          282   1e-90    Sorghum bicolor [broomcorn]
gb|AGT16573.1|  hypothetical protein SHCRBa_250_M20_R_30                281   2e-90    
emb|CDY30816.1|  BnaC05g21920D                                          281   2e-90    
emb|CDM86912.1|  unnamed protein product                                281   4e-90    
ref|XP_003565128.1|  PREDICTED: syntaxin-61                             280   4e-90    
ref|XP_004971361.1|  PREDICTED: syntaxin-61-like                        278   2e-89    
gb|EMS59908.1|  Syntaxin-61                                             278   3e-89    
ref|XP_008805691.1|  PREDICTED: syntaxin-61-like isoform X2             278   8e-89    
ref|NP_001141746.1|  uncharacterized protein LOC100273880               277   1e-88    Zea mays [maize]
ref|XP_008660430.1|  PREDICTED: syntaxin-61-like                        276   1e-88    
dbj|BAJ92922.1|  predicted protein                                      276   1e-88    
ref|XP_008784178.1|  PREDICTED: syntaxin-61-like                        276   3e-88    
ref|XP_006645352.1|  PREDICTED: syntaxin-61-like                        275   4e-88    
ref|NP_001045485.1|  Os01g0963300                                       274   1e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938949.1|  PREDICTED: syntaxin-61-like                        274   3e-87    
ref|XP_008805690.1|  PREDICTED: syntaxin-61-like isoform X1             273   5e-87    
ref|XP_009406119.1|  PREDICTED: syntaxin-61-like                        270   1e-85    
gb|ABA91573.2|  SNELIPTRC, putative, expressed                          266   1e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006662762.1|  PREDICTED: syntaxin-61-like                        266   2e-84    
dbj|BAJ86239.1|  predicted protein                                      261   2e-82    
ref|XP_002449051.1|  hypothetical protein SORBIDRAFT_05g004120          255   4e-80    Sorghum bicolor [broomcorn]
ref|XP_002522503.1|  syntaxin, putative                                 253   5e-80    Ricinus communis
ref|XP_004978775.1|  PREDICTED: syntaxin-61-like                        253   2e-79    
gb|KGN46254.1|  hypothetical protein Csa_6G078000                       251   4e-79    
ref|XP_010912450.1|  PREDICTED: syntaxin-61-like isoform X1             253   6e-79    
emb|CDY35752.1|  BnaC03g58730D                                          258   1e-78    
ref|XP_003577810.2|  PREDICTED: 60S ribosomal protein L3-like           260   3e-77    
gb|EMT10766.1|  60S ribosomal protein L3                                259   3e-77    
gb|AAF16768.1|AC010155_21  F3M18.7                                      247   6e-77    Arabidopsis thaliana [mouse-ear cress]
gb|KHN38273.1|  Syntaxin-61                                             246   7e-77    
ref|XP_009338701.1|  PREDICTED: syntaxin-61-like isoform X2             242   2e-75    
gb|EMS53312.1|  Syntaxin-61                                             243   3e-75    
ref|XP_009360991.1|  PREDICTED: syntaxin-61-like isoform X2             240   1e-74    
gb|EPS61344.1|  hypothetical protein M569_13452                         239   1e-74    
ref|XP_008355340.1|  PREDICTED: syntaxin-61-like                        237   2e-73    
gb|AAA33935.1|  ORF                                                     236   2e-73    Senecio odorus
ref|XP_010912451.1|  PREDICTED: syntaxin-61-like isoform X2             236   1e-72    
gb|AAX92997.1|  hypothetical protein LOC_Os11g06740                     231   4e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006595734.1|  PREDICTED: syntaxin-61-like isoform X2             231   5e-71    
ref|XP_006574424.1|  PREDICTED: uncharacterized protein LOC100795...    229   2e-70    
ref|XP_008349937.1|  PREDICTED: syntaxin-61-like                        221   1e-67    
dbj|BAJ88852.1|  predicted protein                                      219   7e-67    
ref|XP_010499380.1|  PREDICTED: syntaxin-61 isoform X2                  219   2e-66    
ref|NP_001031102.2|  syntaxin-61                                        217   9e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102902.1|  PREDICTED: syntaxin-61-like isoform X2             217   1e-65    
ref|XP_006843554.1|  hypothetical protein AMTR_s00007p00074210          213   4e-64    
gb|KHG24705.1|  Syntaxin-61 -like protein                               215   5e-64    
ref|XP_009113654.1|  PREDICTED: syntaxin-61-like isoform X3             213   4e-63    
ref|XP_002987597.1|  hypothetical protein SELMODRAFT_183263             202   2e-59    
ref|XP_002987656.1|  hypothetical protein SELMODRAFT_126511             201   3e-59    
gb|KHG29550.1|  Syntaxin-61 -like protein                               195   2e-57    
ref|XP_001764511.1|  Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family             189   9e-55    
ref|XP_001762590.1|  Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family             181   2e-51    
ref|XP_002973834.1|  hypothetical protein SELMODRAFT_100026             178   3e-50    
gb|ACU22916.1|  unknown                                                 174   1e-49    Glycine max [soybeans]
ref|XP_008385968.1|  PREDICTED: syntaxin-61                             174   3e-49    
ref|XP_002504052.1|  predicted protein                                  153   1e-40    Micromonas commoda
ref|XP_005646595.1|  hypothetical protein COCSUDRAFT_53946              145   7e-38    
ref|XP_003059590.1|  predicted protein                                  140   1e-35    
ref|NP_001065843.2|  Os11g0168100                                       135   6e-35    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006590063.1|  PREDICTED: syntaxin-61-like                        129   3e-33    
ref|XP_005852077.1|  hypothetical protein CHLNCDRAFT_18657              129   1e-31    
gb|ACG36700.1|  hypothetical protein                                    119   1e-29    Zea mays [maize]
ref|XP_002946496.1|  Qc-SNARE, Tlg1/Syntaxin 6-family                   116   6e-27    
gb|AFW89304.1|  hypothetical protein ZEAMMB73_776234                    110   3e-26    
ref|XP_005705505.1|  syntaxin 6                                         114   7e-26    
ref|XP_001695523.1|  Qc-SNARE protein, Tlg1/Syntaxin 6-family           111   2e-25    Chlamydomonas reinhardtii
gb|KFM24618.1|  Syntaxin-61                                             110   9e-25    
emb|CEF99213.1|  Syntaxin 6, N-terminal                                 104   7e-23    
ref|XP_001419650.1|  predicted protein                                  103   2e-22    Ostreococcus lucimarinus CCE9901
gb|ELT91978.1|  hypothetical protein CAPTEDRAFT_183705                  100   2e-21    
ref|XP_005991139.1|  PREDICTED: syntaxin-6-like isoform X5              100   3e-21    
ref|XP_007510834.1|  predicted protein                                  100   3e-21    
ref|XP_005098867.1|  PREDICTED: syntaxin-6-like                       99.0    1e-20    
ref|XP_003219900.1|  PREDICTED: syntaxin-6                            97.8    3e-20    
ref|XP_003081394.1|  syntaxin 6 (ISS)                                   100   4e-20    
ref|XP_010714078.1|  PREDICTED: syntaxin-6                            96.7    8e-20    
ref|XP_005816492.1|  PREDICTED: syntaxin-6-like                       96.7    8e-20    
gb|AJD09698.1|  SYP61                                                 90.9    1e-19    
ref|NP_001006531.1|  syntaxin-6                                       95.5    2e-19    Gallus gallus [bantam]
gb|EFX69800.1|  hypothetical protein DAPPUDRAFT_113324                95.5    2e-19    
ref|XP_001769807.1|  predicted protein                                90.9    3e-19    
ref|XP_007901143.1|  PREDICTED: syntaxin-6                            94.7    3e-19    
ref|XP_005528748.1|  PREDICTED: syntaxin-6                            93.6    8e-19    
ref|XP_005147190.1|  PREDICTED: syntaxin-6                            93.2    1e-18    
gb|KDD73455.1|  hypothetical protein H632_c2158p0                     92.8    1e-18    
ref|XP_009096675.1|  PREDICTED: syntaxin-6                            93.2    1e-18    
ref|XP_005991138.1|  PREDICTED: syntaxin-6-like isoform X4            93.2    1e-18    
ref|XP_010871020.1|  PREDICTED: syntaxin-10 isoform X1                92.8    2e-18    
ref|XP_008164805.1|  PREDICTED: syntaxin-6                            92.0    3e-18    
gb|AJD09697.1|  SYP61                                                 86.7    4e-18    
ref|XP_010871021.1|  PREDICTED: syntaxin-10 isoform X2                90.5    7e-18    
ref|XP_007579188.1|  PREDICTED: syntaxin-6                            90.9    7e-18    
ref|XP_004084264.1|  PREDICTED: syntaxin-10-like                      90.5    8e-18    
ref|XP_007480968.1|  PREDICTED: syntaxin-6 isoform X1                 90.5    8e-18    
ref|XP_008335593.1|  PREDICTED: syntaxin-6                            90.1    9e-18    
ref|NP_001086134.1|  syntaxin 10                                      90.1    1e-17    Xenopus laevis [clawed frog]
ref|XP_008404754.1|  PREDICTED: syntaxin-6                            90.1    1e-17    
gb|AJD09700.1|  SYP61                                                 84.7    2e-17    
ref|XP_008314456.1|  PREDICTED: syntaxin-10                           89.4    2e-17    
ref|XP_007480969.1|  PREDICTED: syntaxin-6 isoform X2                 89.4    2e-17    
ref|NP_001133615.1|  Syntaxin-10                                      89.0    3e-17    Salmo salar
ref|XP_003389021.1|  PREDICTED: syntaxin-6-like                       88.6    4e-17    
ref|XP_005994381.1|  PREDICTED: syntaxin-10 isoform X1                88.6    4e-17    
ref|XP_005880290.1|  PREDICTED: syntaxin-6                            88.2    5e-17    
ref|XP_009022529.1|  hypothetical protein HELRODRAFT_67123            87.8    5e-17    
ref|XP_008144135.1|  PREDICTED: syntaxin-6 isoform X1                 88.2    5e-17    
ref|XP_010869715.1|  PREDICTED: syntaxin-6                            88.2    6e-17    
ref|XP_002735572.1|  PREDICTED: syntaxin-6-like                       87.8    6e-17    Saccoglossus kowalevskii
ref|XP_006272470.1|  PREDICTED: syntaxin-6                            87.8    7e-17    
ref|XP_006635117.1|  PREDICTED: syntaxin-6-like isoform X1            87.8    8e-17    
ref|XP_006907830.1|  PREDICTED: syntaxin-6 isoform X1                 87.4    9e-17    
gb|AJD09699.1|  SYP61                                                 82.8    1e-16    
gb|AJD09701.1|  SYP61                                                 82.8    1e-16    
ref|XP_002409905.1|  syntaxin, putative                               87.0    1e-16    Ixodes scapularis [blacklegged tick]
ref|XP_005994382.1|  PREDICTED: syntaxin-10 isoform X2                87.0    1e-16    
ref|XP_006635118.1|  PREDICTED: syntaxin-6-like isoform X2            87.0    1e-16    
ref|XP_009166852.1|  hypothetical protein T265_03981                  87.0    1e-16    
ref|XP_006985712.1|  PREDICTED: syntaxin-6                            87.0    1e-16    
ref|XP_004578893.1|  PREDICTED: syntaxin-6                            87.0    1e-16    
ref|NP_001017879.1|  syntaxin-6                                       87.0    2e-16    Danio rerio [leopard danio]
ref|XP_010750970.1|  PREDICTED: syntaxin-6                            86.7    2e-16    
gb|ELK37133.1|  Syntaxin-6                                            86.7    2e-16    
ref|NP_001120630.1|  syntaxin 10                                      86.7    2e-16    Xenopus tropicalis [western clawed frog]
ref|XP_006907831.1|  PREDICTED: syntaxin-6 isoform X2                 86.3    2e-16    
ref|XP_002196537.1|  PREDICTED: syntaxin-6                            86.3    2e-16    Taeniopygia guttata
ref|XP_003259022.1|  PREDICTED: syntaxin-6 isoform 1                  86.3    2e-16    
ref|XP_008293660.1|  PREDICTED: syntaxin-6                            85.9    3e-16    
ref|XP_004688595.1|  PREDICTED: syntaxin-6                            85.9    3e-16    
ref|XP_008579776.1|  PREDICTED: syntaxin-6 isoform X1                 85.9    3e-16    
ref|XP_004425027.1|  PREDICTED: syntaxin-6                            85.9    4e-16    
gb|AAY18872.1|  syntaxin 6                                            85.9    4e-16    
ref|XP_006887839.1|  PREDICTED: syntaxin-6                            85.5    4e-16    
ref|XP_006048665.1|  PREDICTED: syntaxin-6                            85.5    4e-16    
ref|XP_005622446.1|  PREDICTED: syntaxin-6 isoform X1                 85.5    5e-16    
ref|XP_004767955.1|  PREDICTED: syntaxin-6                            85.5    5e-16    
ref|XP_010953234.1|  PREDICTED: syntaxin-6                            85.5    5e-16    
ref|XP_007105189.1|  PREDICTED: syntaxin-6 isoform X2                 85.5    5e-16    
ref|NP_001039240.1|  syntaxin 6                                       85.1    5e-16    Xenopus tropicalis [western clawed frog]
ref|XP_001615864.1|  hypothetical protein                             84.7    5e-16    Plasmodium vivax Sal-1
ref|XP_006142379.1|  PREDICTED: syntaxin-6                            85.1    6e-16    
ref|NP_001085148.1|  syntaxin 6                                       85.1    6e-16    Xenopus laevis [clawed frog]
ref|XP_004013893.1|  PREDICTED: syntaxin-6                            85.1    6e-16    
ref|XP_010628586.1|  PREDICTED: syntaxin-6 isoform X1                 85.1    7e-16    
ref|NP_001088686.1|  uncharacterized protein LOC495950                84.7    7e-16    Xenopus laevis [clawed frog]
ref|XP_004396913.1|  PREDICTED: syntaxin-6                            85.1    7e-16    
ref|XP_008612609.1|  hypothetical protein SDRG_08497                  84.7    7e-16    
ref|XP_001488966.2|  PREDICTED: syntaxin-6                            84.7    7e-16    Equus caballus [domestic horse]
ref|XP_003785700.1|  PREDICTED: syntaxin-6                            84.7    7e-16    
ref|NP_001230649.1|  syntaxin-6                                       84.7    7e-16    
ref|XP_005363947.1|  PREDICTED: syntaxin-6                            84.7    8e-16    
ref|XP_004643487.1|  PREDICTED: syntaxin-6                            84.7    8e-16    
ref|XP_008250553.1|  PREDICTED: syntaxin-6                            84.7    8e-16    
ref|XP_004372939.1|  PREDICTED: syntaxin-6                            84.7    9e-16    
ref|XP_008699353.1|  PREDICTED: syntaxin-6 isoform X1                 84.7    9e-16    
ref|XP_007609029.1|  PREDICTED: syntaxin-6 isoform X2                 84.7    9e-16    
ref|XP_004269872.1|  PREDICTED: syntaxin-6                            84.7    9e-16    
ref|NP_067408.1|  syntaxin-6                                          84.7    9e-16    Mus musculus [mouse]
emb|CCI40246.1|  unnamed protein product                              84.0    9e-16    
emb|CAG46671.1|  STX6                                                 84.7    9e-16    Homo sapiens [man]
ref|XP_007188251.1|  PREDICTED: syntaxin-6 isoform X2                 84.3    1e-15    
ref|XP_005319791.1|  PREDICTED: syntaxin-6                            84.3    1e-15    
gb|AAX37103.1|  syntaxin 6                                            84.3    1e-15    
ref|XP_005375048.1|  PREDICTED: syntaxin-6                            84.3    1e-15    
gb|ESA10383.1|  hypothetical protein GLOINDRAFT_348219                84.3    1e-15    
ref|NP_001248229.1|  syntaxin-6                                       84.3    1e-15    
ref|NP_005810.1|  syntaxin-6 isoform 1                                84.3    1e-15    Homo sapiens [man]
ref|NP_001075900.1|  syntaxin-6                                       84.3    1e-15    Bos taurus [bovine]
ref|XP_006736912.1|  PREDICTED: syntaxin-6                            84.3    1e-15    
ref|NP_113853.1|  syntaxin-6                                          84.3    1e-15    Rattus norvegicus [brown rat]
ref|XP_005049933.1|  PREDICTED: syntaxin-6                            85.1    1e-15    
ref|XP_004998963.1|  hypothetical protein PTSG_00414                  84.0    1e-15    
ref|XP_003451335.1|  PREDICTED: syntaxin-6-like isoform X1            84.3    1e-15    
ref|XP_007105191.1|  PREDICTED: syntaxin-6 isoform X4                 84.0    1e-15    
ref|XP_002760345.1|  PREDICTED: syntaxin-6                            84.3    1e-15    Callithrix jacchus [common marmoset]
ref|XP_003999333.1|  PREDICTED: syntaxin-6 isoform X1                 84.3    1e-15    
gb|AAV38194.1|  syntaxin 6                                            84.3    1e-15    
ref|XP_006876492.1|  PREDICTED: syntaxin-6                            84.0    1e-15    
ref|XP_003893490.1|  PREDICTED: syntaxin-6                            84.0    1e-15    
ref|XP_008827965.1|  PREDICTED: syntaxin-6                            84.0    2e-15    
ref|XP_007105190.1|  PREDICTED: syntaxin-6 isoform X3                 83.6    2e-15    
ref|XP_002920847.1|  PREDICTED: syntaxin-6-like                       84.0    2e-15    
ref|XP_004461910.1|  PREDICTED: syntaxin-6 isoform 1                  83.6    2e-15    
ref|XP_008065520.1|  PREDICTED: syntaxin-6                            83.6    2e-15    
ref|XP_003474978.1|  PREDICTED: syntaxin-6                            83.6    2e-15    
ref|XP_004067601.1|  PREDICTED: syntaxin-6-like                       83.6    2e-15    
emb|CCA16150.1|  syntaxin 6 putative                                  83.6    2e-15    
ref|XP_007188252.1|  PREDICTED: syntaxin-6 isoform X3                 83.2    2e-15    
ref|XP_006529829.1|  PREDICTED: syntaxin-6 isoform X1                 83.2    2e-15    
ref|XP_004658793.1|  PREDICTED: syntaxin-6                            83.2    3e-15    
ref|XP_004706751.1|  PREDICTED: syntaxin-6                            83.2    3e-15    
ref|XP_005991137.1|  PREDICTED: syntaxin-6-like isoform X3            84.3    3e-15    
ref|XP_003972315.1|  PREDICTED: syntaxin-10-like                      82.8    3e-15    
dbj|BAB31104.1|  unnamed protein product                              83.2    3e-15    Mus musculus [mouse]
ref|XP_007421022.1|  PREDICTED: syntaxin-10                           82.8    3e-15    
dbj|BAB26441.1|  unnamed protein product                              82.8    3e-15    Mus musculus [mouse]
dbj|BAE30494.1|  unnamed protein product                              82.8    4e-15    Mus musculus [mouse]
ref|XP_004461911.1|  PREDICTED: syntaxin-6 isoform 2                  82.4    4e-15    
gb|EDM09512.1|  syntaxin 6                                            82.8    4e-15    
ref|XP_780210.2|  PREDICTED: syntaxin-6-like                          83.6    4e-15    Strongylocentrotus purpuratus [purple urchin]
gb|EDL39408.1|  syntaxin 6                                            82.8    4e-15    
ref|XP_004895386.1|  PREDICTED: syntaxin-6                            82.8    4e-15    
gb|ELR52201.1|  Syntaxin-6                                            82.8    4e-15    
gb|EAW91092.1|  syntaxin 6, isoform CRA_b                             82.4    5e-15    
dbj|GAA34101.1|  syntaxin 6                                           82.4    5e-15    
gb|EAW91093.1|  syntaxin 6, isoform CRA_c                             82.4    5e-15    
gb|EHH15752.1|  hypothetical protein EGK_01885                        82.4    5e-15    
ref|XP_004346925.1|  syntaxin-6                                       82.8    6e-15    
gb|KDO21058.1|  hypothetical protein SPRG_13851                       82.0    7e-15    
ref|XP_005800484.1|  PREDICTED: syntaxin-10-like isoform X2           82.0    7e-15    
ref|XP_005800483.1|  PREDICTED: syntaxin-10-like isoform X1           81.6    7e-15    
ref|XP_007240149.1|  PREDICTED: syntaxin-6                            82.0    8e-15    
ref|XP_005496232.1|  PREDICTED: syntaxin-6-like                       81.6    8e-15    
ref|XP_005732444.1|  PREDICTED: syntaxin-6-like                       82.0    8e-15    
ref|XP_009486130.1|  PREDICTED: syntaxin-6                            81.6    1e-14    
emb|CAG02280.1|  unnamed protein product                              81.6    1e-14    
gb|EPQ16417.1|  Syntaxin-6                                            81.6    1e-14    
ref|XP_003411019.1|  PREDICTED: syntaxin-6                            81.3    1e-14    
dbj|GAM26381.1|  hypothetical protein SAMD00019534_095560             80.9    1e-14    
dbj|BAE35046.1|  unnamed protein product                              81.3    1e-14    
gb|KFO61000.1|  Syntaxin-6                                            81.3    1e-14    
gb|EMC77544.1|  Syntaxin-6                                            80.9    1e-14    
ref|XP_006089036.1|  PREDICTED: syntaxin-6 isoform X1                 81.3    1e-14    
ref|XP_010404692.1|  PREDICTED: syntaxin-6                            82.0    1e-14    
ref|XP_008498142.1|  PREDICTED: syntaxin-6                            81.3    1e-14    
ref|XP_009571903.1|  PREDICTED: syntaxin-6                            80.9    1e-14    
ref|XP_010300011.1|  PREDICTED: syntaxin-6                            80.9    2e-14    
ref|XP_009950365.1|  PREDICTED: syntaxin-6                            80.9    2e-14    
ref|XP_009805695.1|  PREDICTED: syntaxin-6                            80.9    2e-14    
ref|XP_009891229.1|  PREDICTED: syntaxin-6                            80.9    2e-14    
ref|XP_009671040.1|  PREDICTED: syntaxin-6                            81.3    2e-14    
ref|XP_007105188.1|  PREDICTED: syntaxin-6 isoform X1                 82.8    2e-14    
ref|XP_007230059.1|  PREDICTED: syntaxin-10                           80.9    2e-14    
ref|XP_004557097.1|  PREDICTED: syntaxin-6-like                       80.9    2e-14    
ref|XP_009937577.1|  PREDICTED: syntaxin-6                            80.9    2e-14    
ref|XP_006790334.1|  PREDICTED: syntaxin-6-like                       80.9    2e-14    
ref|XP_008814099.1|  hypothetical protein C922_00260                  80.1    2e-14    
ref|XP_008287615.1|  PREDICTED: syntaxin-10                           80.5    2e-14    
ref|XP_009988368.1|  PREDICTED: syntaxin-6                            80.5    2e-14    
ref|XP_009911864.1|  PREDICTED: syntaxin-6                            80.5    2e-14    
ref|XP_006809003.1|  PREDICTED: syntaxin-10-like                      80.5    2e-14    
ref|XP_011065488.1|  PREDICTED: syntaxin-6 isoform X2                 80.9    2e-14    
ref|XP_009067556.1|  PREDICTED: syntaxin-6                            80.5    2e-14    
ref|XP_010164951.1|  PREDICTED: syntaxin-6                            80.1    3e-14    
ref|XP_005501227.1|  PREDICTED: syntaxin-6                            80.9    3e-14    
ref|XP_010736194.1|  PREDICTED: syntaxin-10                           80.1    3e-14    
ref|XP_008634358.1|  PREDICTED: syntaxin-6                            81.3    3e-14    
ref|XP_010226931.1|  PREDICTED: syntaxin-6                            80.5    3e-14    
ref|XP_005231696.1|  PREDICTED: syntaxin-6                            80.9    3e-14    
gb|KDR24026.1|  Syntaxin-6                                            80.1    3e-14    
ref|XP_005435956.1|  PREDICTED: syntaxin-6                            80.1    3e-14    
ref|XP_010125742.1|  PREDICTED: syntaxin-6                            80.1    3e-14    
ref|XP_004574491.1|  PREDICTED: syntaxin-10-like                      79.7    4e-14    
ref|XP_010282166.1|  PREDICTED: syntaxin-6                            79.7    4e-14    
ref|XP_010205440.1|  PREDICTED: syntaxin-6                            79.3    4e-14    
ref|XP_007574158.1|  PREDICTED: syntaxin-10                           79.7    4e-14    
ref|XP_009900301.1|  PREDICTED: syntaxin-6                            79.7    4e-14    
gb|KFP05543.1|  Syntaxin-6                                            79.3    5e-14    
ref|XP_002260348.1|  hypothetical protein, conserved in Plasmodiu...  79.0    5e-14    
ref|XP_008868274.1|  hypothetical protein H310_05357                  79.7    5e-14    
ref|XP_009504580.1|  PREDICTED: syntaxin-6                            79.0    5e-14    
ref|XP_002724221.2|  PREDICTED: syntaxin-10                           81.3    6e-14    
gb|KFP33854.1|  Syntaxin-6                                            79.0    6e-14    
ref|XP_010080795.1|  PREDICTED: syntaxin-6                            79.3    6e-14    
gb|KFO10521.1|  Syntaxin-6                                            79.0    6e-14    
ref|XP_009319004.1|  PREDICTED: syntaxin-6                            80.5    6e-14    
ref|XP_003454130.1|  PREDICTED: syntaxin-10-like isoform X1           79.3    6e-14    
gb|KFW01136.1|  Syntaxin-6                                            79.0    6e-14    
ref|XP_009962033.1|  PREDICTED: syntaxin-6                            78.6    7e-14    
ref|XP_008940281.1|  PREDICTED: syntaxin-6                            78.6    8e-14    
gb|KGL74556.1|  Syntaxin-6                                            79.0    8e-14    
gb|KFV20204.1|  Syntaxin-6                                            78.6    9e-14    
gb|KFP99875.1|  Syntaxin-6                                            78.6    1e-13    
ref|XP_010150862.1|  PREDICTED: syntaxin-6                            78.6    1e-13    
gb|KFW76323.1|  Syntaxin-6                                            78.6    1e-13    
ref|XP_004389788.1|  PREDICTED: syntaxin-10 isoform 1                 78.6    1e-13    
ref|XP_005428672.1|  PREDICTED: syntaxin-6                            79.0    1e-13    
gb|KFQ18991.1|  Syntaxin-6                                            78.2    1e-13    
gb|KFM05249.1|  Syntaxin-6                                            78.6    1e-13    
gb|KFP45344.1|  Syntaxin-6                                            78.6    1e-13    
gb|KFW64809.1|  Syntaxin-6                                            78.6    1e-13    
gb|KFQ33748.1|  Syntaxin-6                                            78.2    1e-13    
gb|KFP21316.1|  Syntaxin-6                                            78.2    1e-13    
gb|KHN04741.1|  Syntaxin-61                                           73.6    1e-13    
gb|KFO90685.1|  Syntaxin-6                                            77.8    1e-13    
ref|XP_002430475.1|  syntaxin-6, putative                             78.6    1e-13    
ref|XP_004595630.1|  PREDICTED: syntaxin-10 isoform X1                78.2    1e-13    
gb|KFV68447.1|  Syntaxin-6                                            78.2    1e-13    
gb|KFQ76832.1|  Syntaxin-6                                            77.8    1e-13    
ref|XP_005881640.1|  PREDICTED: syntaxin-10 isoform X1                78.2    2e-13    
ref|XP_010135989.1|  PREDICTED: syntaxin-6-like                       79.0    2e-13    
ref|XP_009062897.1|  hypothetical protein LOTGIDRAFT_129177           78.6    2e-13    
ref|XP_009643636.1|  PREDICTED: syntaxin-6                            79.7    2e-13    
ref|XP_003941761.1|  PREDICTED: syntaxin-10 isoform X2                78.2    2e-13    
gb|KHN72841.1|  Syntaxin-6                                            78.2    2e-13    
gb|KFZ56927.1|  Syntaxin-6                                            77.4    2e-13    
ref|XP_002004195.1|  GI19781                                          78.6    2e-13    
ref|XP_006874335.1|  PREDICTED: syntaxin-10 isoform X1                77.4    3e-13    
gb|KFV14480.1|  Syntaxin-6                                            77.4    3e-13    
emb|CDR15419.1|  SNARE protein, putative                              77.0    3e-13    
ref|XP_010579013.1|  PREDICTED: syntaxin-6                            79.0    3e-13    
emb|CBY17846.1|  unnamed protein product                              77.0    3e-13    
ref|XP_006761458.1|  PREDICTED: syntaxin-10 isoform X1                77.0    4e-13    
gb|KFQ94967.1|  Syntaxin-6                                            77.0    4e-13    
gb|KFQ12289.1|  Syntaxin-6                                            77.0    4e-13    
ref|XP_009557916.1|  PREDICTED: syntaxin-6                            77.0    4e-13    
ref|XP_002767092.1|  Syntaxin-6, putative                             76.6    5e-13    
ref|XP_009274190.1|  PREDICTED: syntaxin-6                            78.2    5e-13    
ref|XP_005026127.1|  PREDICTED: syntaxin-6                            78.2    5e-13    
emb|CDS05041.1|  hypothetical protein LRAMOSA07570                    76.3    6e-13    
ref|XP_003480825.1|  PREDICTED: syntaxin-10 isoform X1                76.6    6e-13    
ref|XP_002059364.1|  GJ17697                                          77.4    6e-13    
ref|XP_003413107.1|  PREDICTED: syntaxin-10                           76.6    6e-13    
ref|XP_004331440.1|  PREDICTED: syntaxin-10 isoform 2                 76.3    6e-13    
emb|CDH51520.1|  syntaxin-6                                           76.3    7e-13    
gb|KFQ72167.1|  Syntaxin-6                                            76.3    8e-13    
ref|XP_008156140.1|  PREDICTED: syntaxin-10 isoform X1                76.3    9e-13    
ref|XP_003915061.1|  PREDICTED: syntaxin-10 isoform X1                76.3    9e-13    
gb|KFV93566.1|  Syntaxin-6                                            75.5    9e-13    
ref|XP_007103686.1|  PREDICTED: syntaxin-10                           75.9    9e-13    
gb|AAW27734.1|  SJCHGC04860 protein                                   76.3    9e-13    
ref|XP_009460815.1|  PREDICTED: syntaxin-6                            78.2    9e-13    
ref|XP_001922254.1|  PREDICTED: syntaxin-10                           75.9    9e-13    
ref|XP_006161064.1|  PREDICTED: syntaxin-10                           75.9    1e-12    
ref|XP_004277489.1|  PREDICTED: syntaxin-10 isoform 1                 75.9    1e-12    
ref|XP_006918810.1|  PREDICTED: syntaxin-10 isoform X2                75.5    1e-12    
ref|XP_006175431.1|  PREDICTED: syntaxin-10 isoform X1                75.5    1e-12    
ref|XP_006126998.1|  PREDICTED: syntaxin-6 isoform X1                 75.9    1e-12    
ref|XP_007098215.1|  PREDICTED: syntaxin-10 isoform X2                75.5    1e-12    
ref|XP_005336287.1|  PREDICTED: syntaxin-10 isoform X1                75.5    1e-12    
ref|XP_533896.2|  PREDICTED: syntaxin-10 isoformX1                    75.5    2e-12    
gb|EZA51078.1|  Syntaxin-6                                            75.9    2e-12    
ref|XP_011065487.1|  PREDICTED: syntaxin-6 isoform X1                 75.9    2e-12    
ref|XP_008115683.1|  PREDICTED: syntaxin-10 isoform X1                75.1    2e-12    
emb|CDS50215.1|  SNARE protein, putative                              74.7    2e-12    
emb|CEG67725.1|  hypothetical protein RMATCC62417_04116               74.7    2e-12    
ref|XP_007667218.1|  PREDICTED: syntaxin-6                            77.0    2e-12    
ref|XP_004331439.1|  PREDICTED: syntaxin-10 isoform 1                 75.1    2e-12    
ref|XP_007061279.1|  PREDICTED: syntaxin-6                            76.3    2e-12    
ref|XP_010359913.1|  PREDICTED: syntaxin-10 isoform X1                75.1    2e-12    
gb|KFQ47379.1|  Syntaxin-6                                            74.7    2e-12    
ref|NP_001248622.1|  syntaxin-10                                      74.7    2e-12    
gb|EOA96667.1|  Syntaxin-6                                            74.3    3e-12    
ref|XP_006126999.1|  PREDICTED: syntaxin-6 isoform X2                 74.7    3e-12    
ref|XP_005991135.1|  PREDICTED: syntaxin-6-like isoform X1            76.3    3e-12    
ref|XP_008577529.1|  PREDICTED: syntaxin-10                           74.7    3e-12    
gb|KFU87363.1|  Syntaxin-6                                            74.7    3e-12    
ref|XP_005991136.1|  PREDICTED: syntaxin-6-like isoform X2            76.3    3e-12    
ref|XP_009032926.1|  hypothetical protein AURANDRAFT_69625            74.7    3e-12    
ref|XP_007098214.1|  PREDICTED: syntaxin-10 isoform X1                75.5    4e-12    
ref|XP_007182140.1|  PREDICTED: syntaxin-10                           74.3    4e-12    
ref|XP_007525905.1|  PREDICTED: syntaxin-6                            74.3    4e-12    
ref|XP_006928537.1|  PREDICTED: syntaxin-10 isoform X3                74.3    4e-12    
emb|CEJ04366.1|  hypothetical protein RMCBS344292_18330               73.6    5e-12    
ref|XP_003981976.1|  PREDICTED: syntaxin-10 isoform X1                73.6    6e-12    
emb|CEJ03972.1|  hypothetical protein RMCBS344292_17943               73.2    8e-12    
dbj|BAC10622.1|  syntaxin-like protein                                73.6    8e-12    
gb|KGL99569.1|  Syntaxin-6                                            73.2    9e-12    
ref|XP_001767575.1|  predicted protein                                70.9    1e-11    
ref|XP_006025459.1|  PREDICTED: syntaxin-6                            73.6    1e-11    
ref|XP_006206285.1|  PREDICTED: syntaxin-10 isoform X2                72.8    1e-11    
ref|XP_008709949.1|  PREDICTED: syntaxin-10 isoform X1                72.4    2e-11    
ref|XP_005588249.1|  PREDICTED: syntaxin-10 isoform X1                73.6    2e-11    
ref|XP_004672523.1|  PREDICTED: syntaxin-10 isoform X1                72.4    2e-11    
emb|CDU19820.1|  SNARE protein, putative                              71.6    2e-11    
ref|XP_002921060.1|  PREDICTED: syntaxin-10-like                      72.4    2e-11    
ref|XP_007952571.1|  PREDICTED: syntaxin-10 isoform X1                72.4    2e-11    
ref|XP_008542088.1|  PREDICTED: syntaxin-10 isoform X2                72.0    2e-11    
ref|NP_001108474.1|  syntaxin 6                                       72.4    2e-11    
gb|ETB56159.1|  hypothetical protein YYC_05637                        71.6    2e-11    
gb|AAY18915.1|  STX10                                                 72.4    2e-11    
ref|XP_006900845.1|  PREDICTED: syntaxin-10 isoform X1                72.0    2e-11    
ref|XP_002807847.1|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-10      71.6    3e-11    
ref|XP_008965942.1|  PREDICTED: syntaxin-10 isoform X2                71.6    3e-11    
gb|EFA81010.1|  putative syntaxin 10                                  73.6    3e-11    
gb|EFB28629.1|  hypothetical protein PANDA_009878                     71.6    3e-11    
gb|EFX62175.1|  hypothetical protein DAPPUDRAFT_68171                 69.7    3e-11    
ref|XP_004060174.1|  PREDICTED: syntaxin-10 isoform 1                 71.6    3e-11    
ref|XP_006463457.1|  hypothetical protein AGABI2DRAFT_225255          71.2    4e-11    
ref|NP_003756.1|  syntaxin-10 isoform 1                               71.6    4e-11    
ref|XP_002828802.1|  PREDICTED: syntaxin-10 isoform X1                71.2    4e-11    
ref|XP_006928536.1|  PREDICTED: syntaxin-10 isoform X2                72.4    4e-11    
ref|NP_001258539.1|  syntaxin-10 isoform 3                            71.2    5e-11    
ref|XP_004715552.1|  PREDICTED: syntaxin-10 isoform X1                71.2    5e-11    
ref|XP_008542087.1|  PREDICTED: syntaxin-10 isoform X1                70.9    6e-11    
ref|XP_006206284.1|  PREDICTED: syntaxin-10 isoform X1                71.6    7e-11    
gb|KFP74808.1|  Syntaxin-6                                            70.5    9e-11    
ref|XP_967493.1|  PREDICTED: syntaxin-6                               70.5    1e-10    
ref|XP_004442615.1|  PREDICTED: syntaxin-10 isoform 1                 70.1    1e-10    
gb|KFZ59688.1|  Syntaxin-6                                            69.7    1e-10    
gb|KFR14435.1|  Syntaxin-6                                            70.1    1e-10    
ref|XP_003767537.1|  PREDICTED: uncharacterized protein LOC100916911  71.6    1e-10    
ref|XP_005691149.1|  PREDICTED: syntaxin-6                            70.5    1e-10    
ref|XP_004329052.1|  PREDICTED: syntaxin-6-like                       70.1    2e-10    
gb|EPQ17252.1|  Syntaxin-10                                           69.3    2e-10    
gb|ETB56161.1|  hypothetical protein, variant 2                       68.2    3e-10    
emb|CDS16212.1|  syntaxin 6                                           69.3    3e-10    
gb|KFQ63723.1|  Syntaxin-6                                            69.3    3e-10    
ref|XP_007332045.1|  hypothetical protein AGABI1DRAFT_77441           68.9    3e-10    
ref|XP_007441589.1|  PREDICTED: syntaxin-6                            69.3    3e-10    
ref|XP_007993669.1|  PREDICTED: syntaxin-10 isoform X1                70.1    3e-10    
gb|EPS60661.1|  hypothetical protein M569_14142                       65.1    4e-10    
ref|XP_003275651.1|  PREDICTED: syntaxin-10 isoform 1                 68.6    4e-10    
ref|XP_001742985.1|  hypothetical protein                             68.9    5e-10    
ref|XP_002592538.1|  hypothetical protein BRAFLDRAFT_113843           67.4    7e-10    
ref|XP_001635440.1|  predicted protein                                67.8    8e-10    
ref|XP_004399015.1|  PREDICTED: syntaxin-10 isoform 1                 67.8    8e-10    
ref|XP_638599.1|  hypothetical protein DDB_G0284385                   67.8    9e-10    
gb|EKC34340.1|  Syntaxin-6                                            68.9    1e-09    
ref|XP_007480970.1|  PREDICTED: syntaxin-6 isoform X3                 67.4    1e-09    
ref|XP_001504925.2|  PREDICTED: LOW QUALITY PROTEIN: syntaxin-10      67.0    1e-09    
ref|XP_007469135.1|  PREDICTED: syntaxin-10 isoform X1                67.0    1e-09    
gb|KDR80137.1|  hypothetical protein GALMADRAFT_242387                67.0    2e-09    
ref|XP_008559607.1|  PREDICTED: syntaxin-6 isoform X2                 67.0    2e-09    
ref|XP_009493143.1|  hypothetical protein H696_00978                  66.6    2e-09    
ref|XP_002109840.1|  expressed hypothetical protein                   66.2    2e-09    
gb|KFV80094.1|  Syntaxin-6                                            66.2    2e-09    
ref|XP_009842820.1|  hypothetical protein H257_16166                  66.6    3e-09    
gb|KFV47147.1|  Syntaxin-6                                            65.9    4e-09    
gb|ELK06734.1|  Syntaxin-10                                           65.9    4e-09    
gb|KFP83395.1|  Syntaxin-6                                            65.9    4e-09    
ref|XP_010327756.1|  PREDICTED: syntaxin-10 isoform X1                65.9    4e-09    
gb|EAW84356.1|  syntaxin 10, isoform CRA_a                            65.5    5e-09    
ref|XP_004224008.1|  hypothetical protein PCYB_126260                 65.1    5e-09    
ref|XP_008559608.1|  PREDICTED: syntaxin-6 isoform X3                 65.5    5e-09    
ref|XP_008579777.1|  PREDICTED: syntaxin-6 isoform X2                 64.7    6e-09    
ref|XP_003746495.1|  PREDICTED: syntaxin-6-like                       65.1    7e-09    
gb|ETE66943.1|  Syntaxin-6                                            65.1    7e-09    
emb|CEG75001.1|  hypothetical protein RMATCC62417_10114               64.3    9e-09    
ref|XP_001736965.1|  syntaxin-61                                      62.8    1e-08    
gb|KFO75200.1|  Syntaxin-6                                            64.7    1e-08    
gb|ELV14322.1|  Syntaxin-10                                           65.1    1e-08    



>ref|XP_003632086.1| PREDICTED: syntaxin-61 [Vitis vinifera]
 emb|CAN72346.1| hypothetical protein VITISV_034578 [Vitis vinifera]
Length=247

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 197/230 (86%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWERIP  +GE   L KELLA+CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWERIPVETGEQVHLTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL---SVIEMR  508
            DKTIS+A+KDPAWYGI+EVEL KRRRWTS A TQV NVKK+V+ G+ES+G    +V  MR
Sbjct  61   DKTISVAAKDPAWYGIDEVELDKRRRWTSTAHTQVSNVKKSVVAGKESNGTGTANVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RE+M + +PHQ  D+ N+Y + +NDD++++ESD QLLLI++QD+ELD LSASV RIGGVG
Sbjct  121  REMMRMSNPHQ-ADRSNQYGSQDNDDFISSESDRQLLLIRRQDEELDVLSASVERIGGVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ+KII++LGSEMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  180  LTIHEELLAQEKIIDELGSEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  229



>emb|CBI24703.3| unnamed protein product [Vitis vinifera]
Length=301

 Score =   340 bits (873),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 198/231 (86%), Gaps = 5/231 (2%)
 Frame = -2

Query  858  KMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDE  682
            KMS+AQDPFYIVKEEIQESID+LLSTF QWERIP  +GE   L KELLA+CESI WQVDE
Sbjct  54   KMSSAQDPFYIVKEEIQESIDKLLSTFHQWERIPVETGEQVHLTKELLASCESIEWQVDE  113

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL---SVIEM  511
            LDKTIS+A+KDPAWYGI+EVEL KRRRWTS A TQV NVKK+V+ G+ES+G    +V  M
Sbjct  114  LDKTISVAAKDPAWYGIDEVELDKRRRWTSTAHTQVSNVKKSVVAGKESNGTGTANVNGM  173

Query  510  RRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            RRE+M + +PHQ  D+ N+Y + +NDD++++ESD QLLLI++QD+ELD LSASV RIGGV
Sbjct  174  RREMMRMSNPHQ-ADRSNQYGSQDNDDFISSESDRQLLLIRRQDEELDVLSASVERIGGV  232

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTIH+EL AQ+KII++LGSEMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  233  GLTIHEELLAQEKIIDELGSEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  283



>ref|XP_007025513.1| Syntaxin of plants 61 [Theobroma cacao]
 gb|EOY28135.1| Syntaxin of plants 61 [Theobroma cacao]
Length=243

 Score =   337 bits (864),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 196/227 (86%), Gaps = 3/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS AQDPFYIVKEEIQ+SID+L  +F QWERIP ++GE   L KELLA CESI WQVDEL
Sbjct  1    MSKAQDPFYIVKEEIQDSIDKLQLSFHQWERIPPDTGEQVHLTKELLANCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DKTIS+A++DP+WYGI+EVEL KRRRWTS ARTQVGN+KKAV+ G+E+ G + I MRREL
Sbjct  61   DKTISVAARDPSWYGIDEVELEKRRRWTSTARTQVGNIKKAVVAGKEN-GNTAIAMRREL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LP+ HQ  D+ N+YS  +NDD++A+ESD Q+LLIKQQD+ELDELSASV RIGGVGLTI
Sbjct  120  MRLPNSHQ-PDRSNQYSAEDNDDFIASESDRQMLLIKQQDEELDELSASVERIGGVGLTI  178

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQ+KI+++LG+EMDST+ RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  HEELLAQEKIVDELGTEMDSTTNRLDFVQKKVAMVMKKASAKGQIMM  225



>gb|EYU30372.1| hypothetical protein MIMGU_mgv1a012515mg [Erythranthe guttata]
Length=248

 Score =   336 bits (862),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 196/231 (85%), Gaps = 6/231 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ SID+LLSTF QWER+P  S E  +L KELL+ CE++ WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQGSIDKLLSTFNQWERMPLESVEQLRLTKELLSGCETVEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS---VIEMR  508
            DKTI +A++DPAWYGI++ EL KRRRWTS+ARTQV NVKK  ++G ES+G S   V  MR
Sbjct  61   DKTIDVAARDPAWYGIDQAELDKRRRWTSNARTQVKNVKKTAVIGNESNGTSTSNVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN-NDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            RELM +P+PHQ  DK N+Y+ A  NDDY+++ESD QLLLI+QQD+ELDELSASV RIGGV
Sbjct  121  RELMRVPNPHQ-TDKSNQYAAAQENDDYISSESDRQLLLIRQQDEELDELSASVERIGGV  179

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTIH+ELRAQ+KI++DLG+EMDSTS RLDFVQK+VAMVMKKA  KGQFMM
Sbjct  180  GLTIHEELRAQEKIMDDLGNEMDSTSNRLDFVQKKVAMVMKKAGAKGQFMM  230



>gb|EYU29617.1| hypothetical protein MIMGU_mgv1a019006mg [Erythranthe guttata]
Length=248

 Score =   334 bits (856),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 164/231 (71%), Positives = 195/231 (84%), Gaps = 6/231 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ SID+LLSTF QWER+P  S E  +L KELL+ CE++ WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQGSIDKLLSTFNQWERMPLESVEQLRLTKELLSGCETVEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS---VIEMR  508
            DKTI +A++DPAWYGI++ EL KRRRWTS+AR QV NVKK  ++G ES+G S   V  MR
Sbjct  61   DKTIDVAARDPAWYGIDQAELDKRRRWTSNARNQVKNVKKTAVIGNESNGTSTSNVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN-NDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            RELM +P+PHQ  DK N+Y+ A  NDDY+++ESD QLLLI+QQD+ELDELSASV RIGGV
Sbjct  121  RELMRVPNPHQ-TDKSNQYAAAQENDDYISSESDRQLLLIRQQDEELDELSASVERIGGV  179

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTIH+ELRAQ+KI++DLG+EMDSTS RLDFVQK+VAMVMKKA  KGQFMM
Sbjct  180  GLTIHEELRAQEKIMDDLGNEMDSTSNRLDFVQKKVAMVMKKAGAKGQFMM  230



>ref|XP_009627527.1| PREDICTED: syntaxin-61 [Nicotiana tomentosiformis]
Length=247

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 193/230 (84%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWE+ P NSGE   L KELLAACESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWEQTPANSGEQVHLTKELLAACESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE---MR  508
            DKTI++A+KDP+WYGINE EL +RRRWTS+AR QVG+VKK+++ G+ES G S      MR
Sbjct  61   DKTIAVAAKDPSWYGINESELDRRRRWTSNARAQVGSVKKSIVTGKESYGTSTSNLNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            REL+ LPD  Q  ++ N YS  +NDD++++ESD QLLL++QQD+ELDELSASV RIG VG
Sbjct  121  RELLRLPDSDQ-KERSNAYSARDNDDFISSESDRQLLLMRQQDEELDELSASVVRIGDVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIHDEL  QDKIIN+LG+EM+STS RL+FVQK+VAMVMKKAS KGQ MM
Sbjct  180  LTIHDELLQQDKIINELGTEMESTSNRLEFVQKKVAMVMKKASVKGQMMM  229



>ref|XP_002305773.2| Syntaxin 61 family protein [Populus trichocarpa]
 gb|EEE86284.2| Syntaxin 61 family protein [Populus trichocarpa]
Length=246

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/230 (73%), Positives = 192/230 (83%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L S+F QWERI  +SGE  +L KELLAACESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISSDSGEQVRLTKELLAACESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE---SSGLSVIEMR  508
            DK IS+A++DP+WYGI+E EL KRRRWTS ARTQVGNVKKAV+ G+E   S   SV  MR
Sbjct  61   DKAISVAARDPSWYGIDEAELEKRRRWTSTARTQVGNVKKAVVAGKELNLSGTASVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM +PD  Q  DK N+Y T +NDD++ +ESD Q+LLIKQQDDELDELSASV RIGGVG
Sbjct  121  RELMRMPDAQQ-TDKSNQY-TQDNDDFIQSESDRQMLLIKQQDDELDELSASVERIGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ++II DL +EMD+TS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  LTIHEELLAQERIIGDLDTEMDTTSNRLDFVQKKVAMVMKKASAKGQLMM  228



>emb|CDP08007.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   330 bits (845),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 193/229 (84%), Gaps = 5/229 (2%)
 Frame = -2

Query  852  SAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDELD  676
            S+AQDPFYIVKEEIQ+SID+LLS+F +WER+ P+SGE   L KELLA CESI WQVDELD
Sbjct  3    SSAQDPFYIVKEEIQDSIDKLLSSFHKWERLAPDSGEQLNLTKELLAGCESIQWQVDELD  62

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS---VIEMRR  505
            KTIS+A++DP+WYGINE EL KRRRWT +AR+QVGN+KKA++ G+ES+G+S   V  MRR
Sbjct  63   KTISVAARDPSWYGINEPELEKRRRWTGNARSQVGNMKKAIVAGKESNGISSSNVNGMRR  122

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM +P+  Q  D+ N+Y T  NDD +++ESD QLLLIKQQD+ELDELSASV RIGGVGL
Sbjct  123  ELMRMPNSQQ-TDRSNQYVTQANDDLISSESDRQLLLIKQQDEELDELSASVERIGGVGL  181

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL A +KII+DLG+EM+ TS RLDFVQK+V MVMKKA  KGQFMM
Sbjct  182  TIHEELLAHEKIIDDLGTEMEGTSNRLDFVQKKVGMVMKKAGAKGQFMM  230



>ref|XP_011027754.1| PREDICTED: syntaxin-61 [Populus euphratica]
Length=246

 Score =   328 bits (842),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 193/230 (84%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L S+F QWERI  +SGE  +L KELLAACESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISSDSGELVRLTKELLAACESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE---SSGLSVIEMR  508
            DK IS+A++DP+WYGI+E EL KRRRWTS ARTQVGNVKKAV+ G+E   S   SV  MR
Sbjct  61   DKAISVAARDPSWYGIDEAELEKRRRWTSTARTQVGNVKKAVVAGKELNLSGTASVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM +PD  Q  DK N+Y T +NDD++ +ESD Q+LLIKQQD+ELDELSASV RIGGVG
Sbjct  121  RELMRMPDTQQ-TDKSNQY-TQDNDDFIQSESDRQMLLIKQQDEELDELSASVERIGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ++II+DL +EMD+TS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  LTIHEELLAQERIIDDLDTEMDTTSNRLDFVQKKVAMVMKKASAKGQLMM  228



>ref|XP_009783573.1| PREDICTED: syntaxin-61 [Nicotiana sylvestris]
 ref|XP_009783576.1| PREDICTED: syntaxin-61 [Nicotiana sylvestris]
Length=247

 Score =   325 bits (834),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 191/230 (83%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWE  P N+ E   L KELLAACESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWEETPANNDEQVHLTKELLAACESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE---MR  508
            DKTI++A+KDP+WYGINE EL +RRRWTS+AR QVG+VKK+++ G+ES G S      MR
Sbjct  61   DKTIAVAAKDPSWYGINESELDRRRRWTSNARAQVGSVKKSIVTGKESYGTSTSNLNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            REL+ LPD  Q  ++ N YS  +NDD++++ESD QLLL++QQD+ELDELSASV RIG VG
Sbjct  121  RELLRLPDSDQ-KERSNAYSARDNDDFISSESDRQLLLMRQQDEELDELSASVVRIGDVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIHDEL  QDKIIN+LG+EM+STS RL+FVQK+VAMVMKKAS KGQ MM
Sbjct  180  LTIHDELLQQDKIINELGTEMESTSNRLEFVQKKVAMVMKKASVKGQMMM  229



>gb|KDP21907.1| hypothetical protein JCGZ_03045 [Jatropha curcas]
Length=246

 Score =   324 bits (831),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/230 (72%), Positives = 190/230 (83%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQ-QLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWERI +  E Q  L KELL+ CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWERISSDPEDQMHLSKELLSGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSG---LSVIEMR  508
            DK I +A++DP+WYGI+EVEL KRRRWTS ARTQVGNVKKAV+ G+E +G    SV  MR
Sbjct  61   DKAIGVAARDPSWYGIDEVELEKRRRWTSTARTQVGNVKKAVVAGKEVNGNGRTSVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM L + HQ  DK N Y T +NDD++ +ESD Q+LLIKQQD+ELDELSASV RIGGVG
Sbjct  121  RELMRLQNSHQ-TDKSNPY-TQDNDDFIQSESDRQMLLIKQQDEELDELSASVERIGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ+KII++LG EMDSTS RLDFVQK+VAMVMKKA  KGQ MM
Sbjct  179  LTIHEELLAQEKIIDNLGMEMDSTSNRLDFVQKKVAMVMKKAGAKGQIMM  228



>ref|XP_008460099.1| PREDICTED: syntaxin-61 [Cucumis melo]
Length=246

 Score =   319 bits (818),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 189/229 (83%), Gaps = 4/229 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VK+EIQESID+L S+F QWERI  +SGE  Q  KELLA+CESI WQVDEL
Sbjct  1    MPSAQDPFYVVKDEIQESIDKLQSSFHQWERISSDSGERVQQTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            DK I++A++DP+WYGI++ EL KRRRWTS ARTQVGNVKK V  G+E +G+ S   MRRE
Sbjct  61   DKAIAVAARDPSWYGIDDAELEKRRRWTSTARTQVGNVKKVVGAGKEQTGIASASGMRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTAN-NDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            LM LP+ H+  D+ N Y+    NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGL
Sbjct  121  LMRLPNAHE-TDRSNLYTAHQANDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGL  179

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL AQDKII+DLG EMDSTS RLDFVQK+VA+VMKKAS KGQ MM
Sbjct  180  TIHEELLAQDKIIDDLGMEMDSTSNRLDFVQKKVAVVMKKASAKGQIMM  228



>ref|XP_009338699.1| PREDICTED: syntaxin-61-like isoform X1 [Pyrus x bretschneideri]
Length=244

 Score =   319 bits (817),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 187/227 (82%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VKEEIQESID+L S+F QWERI  ++GE   L KELLA+C SI WQVDEL
Sbjct  1    MPSAQDPFYVVKEEIQESIDKLQSSFHQWERISSDNGEQAHLTKELLASCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A++DP WYGI+EVEL KRRRWTS AR QVG+VKKAV  G+ESSG S+  MRREL
Sbjct  61   NKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGSVKKAVEAGRESSGTSLNGMRREL  120

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M + +  +  D+  +Y+  +NDD++ +ESD QLLLIKQQDDELDELSASV RIGGVGLTI
Sbjct  121  MRMTNSQE-TDRSKQYAAQHNDDFITSESDRQLLLIKQQDDELDELSASVERIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQ+KII++LG+EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  180  HEELLAQEKIIDELGTEMDSTSNRLDFVQKKVATVMKKAGVKGQLMM  226



>ref|XP_010031666.1| PREDICTED: syntaxin-61 [Eucalyptus grandis]
 gb|KCW51026.1| hypothetical protein EUGRSUZ_J00643 [Eucalyptus grandis]
Length=244

 Score =   318 bits (815),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 190/224 (85%), Gaps = 2/224 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEE+QESID+L STF  WER+P ++GE   L KELLA CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEVQESIDKLQSTFHHWERVPLDNGERAHLTKELLANCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DKT+++A+KDPA YGINEVEL KRRRWTS AR QVG VKKAVIVG+++S  +   MRREL
Sbjct  61   DKTVAVAAKDPALYGINEVELDKRRRWTSTARAQVGAVKKAVIVGKDNSLSTANGMRREL  120

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            + LPD + + ++ ++Y + +NDD++A+ESD Q+LLIK+QD+ELDELSASV RIGG+GLTI
Sbjct  121  LRLPDSN-LPNRSDQYVSRDNDDFIASESDRQMLLIKRQDEELDELSASVERIGGIGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
            HDEL AQD+II+DLG+EM+ TS RLDFVQK+VAMVMKKA  KGQ
Sbjct  180  HDELLAQDRIIDDLGTEMEGTSNRLDFVQKKVAMVMKKAGAKGQ  223



>ref|XP_011001211.1| PREDICTED: syntaxin-61-like [Populus euphratica]
 ref|XP_011001213.1| PREDICTED: syntaxin-61-like [Populus euphratica]
Length=246

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 186/230 (81%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L S+F QWERI  + G+   L KEL AACESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISCDMGDQVHLTKELFAACESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE---SSGLSVIEMR  508
            DK IS+A +DP+WYGI+E EL KRRRWTS AR QVGNVKKAV+ G+E   S   SV  MR
Sbjct  61   DKAISVAGRDPSWYGIDEAELEKRRRWTSTARNQVGNVKKAVVAGREVNISGAASVSGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM +P+  Q  DK N+Y T +NDD++ +ESD Q+LLIKQQD+ELDELS ++ R GGVG
Sbjct  121  RELMRMPNSQQ-ADKSNQY-TQDNDDFIQSESDRQVLLIKQQDEELDELSITIGRFGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ+KII+DLG EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  LTIHEELLAQEKIIDDLGMEMDSTSNRLDFVQKKVAMVMKKASAKGQLMM  228



>ref|XP_010538187.1| PREDICTED: syntaxin-61-like [Tarenaya hassleriana]
Length=245

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 189/228 (83%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L S F +WERIP ++GE   L KELLA CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSNFHKWERIPPDTGEQVHLTKELLAGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            DK I++A++DPAWYGINE EL KRRRWTS+ARTQVGNVKK+V+ G+  SG +   E+RRE
Sbjct  61   DKAITVAARDPAWYGINETELEKRRRWTSNARTQVGNVKKSVLAGKSISGAAGASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  D+ ++Y + N++D+  +ESD QLLLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNSTE-TDRYDQYGSQNDNDFAQSESDRQLLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQIMM  227



>ref|XP_004145007.1| PREDICTED: syntaxin-61-like [Cucumis sativus]
 ref|XP_004154296.1| PREDICTED: syntaxin-61-like [Cucumis sativus]
 ref|XP_004160675.1| PREDICTED: syntaxin-61-like [Cucumis sativus]
Length=246

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 186/229 (81%), Gaps = 4/229 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VK+EIQESID+L S+F QWERI  +SGE  Q  KELLA+CESI WQVDEL
Sbjct  1    MPSAQDPFYVVKDEIQESIDKLQSSFHQWERISSDSGERVQQTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            DK I++A++DP+WYGI+  EL KRRRWTS ARTQVGNVKK V  G+E  G  S   MRRE
Sbjct  61   DKAIAVAARDPSWYGIDNAELEKRRRWTSTARTQVGNVKKVVGAGKEQIGTASASGMRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTAN-NDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            LM LP+ H+  D+ N YS    NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGL
Sbjct  121  LMRLPNAHE-TDRSNLYSAHQANDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGL  179

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL AQDKII+DLG EMDSTS RLDFVQK+VA+VMKKAS KGQ MM
Sbjct  180  TIHEELLAQDKIIDDLGMEMDSTSNRLDFVQKKVAVVMKKASAKGQIMM  228



>ref|XP_011097050.1| PREDICTED: syntaxin-61 [Sesamum indicum]
Length=247

 Score =   317 bits (811),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 191/230 (83%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+LLSTF QWER P +SGE  +L  ELLA CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLLSTFHQWERTPSDSGEQLRLTNELLAGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM---R  508
            DKTI++A+KDP+WYGI+EVEL KRRRWTS+AR QV NVKK+++   ES+  S   +   R
Sbjct  61   DKTIAVAAKDPSWYGIDEVELDKRRRWTSNARIQVRNVKKSLVTQNESNRTSTSNINGVR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM + + HQ  +KPN+Y   +NDD++++ESD QLLLI+QQD+ELDELSASV+RIG VG
Sbjct  121  RELMRIQNSHQ-AEKPNQYIAQDNDDFISSESDRQLLLIRQQDEELDELSASVQRIGDVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ+KII++LG+EM+ TS RLDFVQK+VAMVMKKA  KGQ MM
Sbjct  180  LTIHEELLAQEKIIDELGTEMEGTSNRLDFVQKKVAMVMKKAGAKGQLMM  229



>ref|XP_009360989.1| PREDICTED: syntaxin-61-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009360990.1| PREDICTED: syntaxin-61-like isoform X1 [Pyrus x bretschneideri]
Length=244

 Score =   317 bits (811),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 156/227 (69%), Positives = 186/227 (82%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VKEEIQESID+L S+F QWERI  ++GE  +L KELLA+C SI WQVDEL
Sbjct  1    MPSAQDPFYVVKEEIQESIDKLQSSFHQWERISSDNGEQVRLTKELLASCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK IS+A++DP WYGI+EVEL KRRRWTS AR QVG++KKAV  G+ESSG SV  MRREL
Sbjct  61   DKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGSLKKAVEAGKESSGTSVNGMRREL  120

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M + +  +  ++ N Y   +NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGLTI
Sbjct  121  MRVANSQE-TERSNPYGAHHNDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQ+KII +LG+EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  180  HEELLAQEKIIEELGTEMDSTSNRLDFVQKKVAAVMKKAGVKGQLMM  226



>ref|XP_007211922.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica]
 ref|XP_007211923.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica]
 gb|EMJ13121.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica]
 gb|EMJ13122.1| hypothetical protein PRUPE_ppa010587mg [Prunus persica]
Length=244

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/227 (68%), Positives = 185/227 (81%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VKEEIQESID+L S+F QWERI  ++GE   L KEL+A C SI WQVDEL
Sbjct  1    MPSAQDPFYVVKEEIQESIDKLQSSFHQWERISSDTGEQLHLTKELIATCGSIDWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK IS+A++DP WYGI+EVEL KRRRWTS AR QVG VKKAV  G++S+G SV  MRREL
Sbjct  61   DKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGAVKKAVEAGKDSTGTSVNGMRREL  120

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M L +  +  D+ N+Y+  +NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGLTI
Sbjct  121  MRLANSQE-TDRSNQYAAQHNDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQ+KI+++LG EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  180  HEELLAQEKIVDELGMEMDSTSNRLDFVQKKVATVMKKAGVKGQCMM  226



>ref|XP_006377433.1| Syntaxin 61 family protein [Populus trichocarpa]
 gb|ERP55230.1| Syntaxin 61 family protein [Populus trichocarpa]
Length=246

 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 187/230 (81%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L S+F QWERI  + G+   L K+LLAACESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSSFHQWERISCDMGDQVHLTKDLLAACESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE---SSGLSVIEMR  508
            DK IS+A +DP+WYGI+E EL KRRRWTS AR QVGNVKKAV+ G+E   S   SV  MR
Sbjct  61   DKAISVAGRDPSWYGIDEAELEKRRRWTSTARNQVGNVKKAVVAGREVNISGTASVSGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM +P+  Q  DK N+Y T +NDD++ +ESD QLLLIKQQD+ELDELS ++ R+GGVG
Sbjct  121  RELMRMPNSQQ-ADKSNQY-TQDNDDFIQSESDRQLLLIKQQDEELDELSITIGRLGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ+KII+DLG EMDSTS RLDFVQK+VA VMKKAS KGQ MM
Sbjct  179  LTIHEELLAQEKIIDDLGMEMDSTSNRLDFVQKKVATVMKKASAKGQLMM  228



>gb|AFK40078.1| unknown [Medicago truncatula]
Length=247

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 185/229 (81%), Gaps = 3/229 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VKE+IQ+SIDRL S F QWE   ++GEH  L KE+LAAC SI WQVDELD
Sbjct  1    MPSAQDPFYVVKEDIQDSIDRLQSNFHQWENTSDTGEHLNLSKEVLAACGSIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQES---SGLSVIEMRR  505
            K IS+AS+DP+WYGI+EVE+  RRRWTS+ARTQV  +K+ V  G+ S   +  S+  M R
Sbjct  61   KAISVASRDPSWYGIDEVEIENRRRWTSNARTQVRTIKRTVEAGKGSNPTTHASISGMHR  120

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LPD HQ   K N+Y++ +NDD++ +ESD Q+LLIKQQD+ELDELS SV+RIGGVGL
Sbjct  121  ELMRLPDSHQSTSKSNQYASGDNDDFIESESDRQMLLIKQQDEELDELSLSVQRIGGVGL  180

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q+KI+++LG+EMDSTS RLDFVQKRVAMVMKKAS KGQ MM
Sbjct  181  TIHEELLGQEKILDELGNEMDSTSNRLDFVQKRVAMVMKKASAKGQMMM  229



>ref|XP_010097811.1| hypothetical protein L484_000959 [Morus notabilis]
 gb|EXB72069.1| hypothetical protein L484_000959 [Morus notabilis]
Length=247

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 189/230 (82%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VKEEIQESI++L S+F QWERI  N+GE   L KELLA+CESI WQVDEL
Sbjct  1    MPSAQDPFYVVKEEIQESIEKLQSSFHQWERIHANTGEQIHLAKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL---SVIEMR  508
            DKTI++A+KDPA YGI+ +EL KRRRWTS+ARTQV  VKKAV  G+E++G    S   M 
Sbjct  61   DKTIAVAAKDPALYGIDGIELEKRRRWTSNARTQVSTVKKAVKRGKEANGTGTTSANAMH  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            RELM LP+ H+  D+ N YS  +NDD++A+ESD QLLLIKQQD+ELDELSASV+RIGGVG
Sbjct  121  RELMRLPNLHE-TDRSNPYSAHDNDDFIASESDRQLLLIKQQDEELDELSASVQRIGGVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIH+EL AQ+KII++L  EMDSTS RLDFVQK+V+MVMKKA  KGQ MM
Sbjct  180  LTIHEELLAQEKIIDELDMEMDSTSNRLDFVQKKVSMVMKKAGAKGQIMM  229



>ref|XP_003617552.1| Syntaxin-61 [Medicago truncatula]
 gb|AET00511.1| syntaxin protein [Medicago truncatula]
Length=258

 Score =   314 bits (804),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 185/229 (81%), Gaps = 3/229 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VKE+IQ+SIDRL S F QWE   ++GEH  L KE+LAAC SI WQVDELD
Sbjct  1    MPSAQDPFYVVKEDIQDSIDRLQSNFHQWENTSDTGEHLNLSKEVLAACGSIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQES---SGLSVIEMRR  505
            K IS+AS+DP+WYGI+EVE+  RRRWTS+ARTQV  +K+ V  G+ S   +  S+  M R
Sbjct  61   KAISVASRDPSWYGIDEVEIENRRRWTSNARTQVRTIKRTVEAGKGSNPTTHASISGMHR  120

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LPD HQ   K N+Y++ +NDD++ +ESD Q+LLIKQQD+ELDELS SV+RIGGVGL
Sbjct  121  ELMRLPDSHQSTSKSNQYASGDNDDFIESESDRQMLLIKQQDEELDELSLSVQRIGGVGL  180

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q+KI+++LG+EMDSTS RLDFVQKRVAMVMKKAS KGQ MM
Sbjct  181  TIHEELLGQEKILDELGNEMDSTSNRLDFVQKRVAMVMKKASAKGQMMM  229



>ref|XP_008226891.1| PREDICTED: syntaxin-61 [Prunus mume]
 ref|XP_008226892.1| PREDICTED: syntaxin-61 [Prunus mume]
Length=244

 Score =   313 bits (802),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 184/227 (81%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VKEEIQESID+L S+F QWERI  ++GE   L KEL+A C SI WQVDEL
Sbjct  1    MPSAQDPFYVVKEEIQESIDKLQSSFHQWERISSDTGEQLHLTKELIATCGSIDWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK IS+A++DP WYGI+EVEL KRRRWTS AR QVG VK AV  G++S+G SV  MRREL
Sbjct  61   DKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGAVKNAVEAGKDSTGTSVNGMRREL  120

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M L +  +  D+ N+Y+  +NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGLTI
Sbjct  121  MRLANSQE-TDRSNQYAAQHNDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQ+KI+++LG EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  180  HEELLAQEKIVDELGMEMDSTSNRLDFVQKKVATVMKKAGVKGQCMM  226



>ref|XP_010269837.1| PREDICTED: syntaxin-61-like isoform X3 [Nelumbo nucifera]
Length=261

 Score =   311 bits (797),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 185/235 (79%), Gaps = 9/235 (4%)
 Frame = -2

Query  864  GHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQV  688
             H MS+AQDPFYIVKEEIQESID+L STF  WE IP N+GE   L K+LLA CESI WQV
Sbjct  12   AHNMSSAQDPFYIVKEEIQESIDKLQSTFHHWENIPPNTGERVHLTKDLLAGCESIEWQV  71

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLS  523
            DEL+K I++A++DP WYGI+EVEL KR+RWTS AR QV  ++K V VG++     +SGL+
Sbjct  72   DELEKAIAVAARDPTWYGIDEVELDKRKRWTSTARAQVATIRKTVEVGKDQNTTVTSGLN  131

Query  522  VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRR  343
               MR+ELM LPD HQ   + N+Y + +NDD++ +ESD QLLLIKQQD+ELDELS+SV R
Sbjct  132  --GMRQELMRLPDQHQAA-RSNQYMSEDNDDFITSESDRQLLLIKQQDEELDELSSSVER  188

Query  342  IGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IG VGLTIH+EL  Q+KII DL  EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  189  IGNVGLTIHEELLGQEKIIQDLSLEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  243



>ref|XP_010269836.1| PREDICTED: syntaxin-61-like isoform X2 [Nelumbo nucifera]
Length=274

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 185/235 (79%), Gaps = 9/235 (4%)
 Frame = -2

Query  864  GHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQV  688
             H MS+AQDPFYIVKEEIQESID+L STF  WE IP N+GE   L K+LLA CESI WQV
Sbjct  25   AHNMSSAQDPFYIVKEEIQESIDKLQSTFHHWENIPPNTGERVHLTKDLLAGCESIEWQV  84

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLS  523
            DEL+K I++A++DP WYGI+EVEL KR+RWTS AR QV  ++K V VG++     +SGL+
Sbjct  85   DELEKAIAVAARDPTWYGIDEVELDKRKRWTSTARAQVATIRKTVEVGKDQNTTVTSGLN  144

Query  522  VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRR  343
               MR+ELM LPD HQ   + N+Y + +NDD++ +ESD QLLLIKQQD+ELDELS+SV R
Sbjct  145  --GMRQELMRLPDQHQAA-RSNQYMSEDNDDFITSESDRQLLLIKQQDEELDELSSSVER  201

Query  342  IGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IG VGLTIH+EL  Q+KII DL  EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  202  IGNVGLTIHEELLGQEKIIQDLSLEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  256



>ref|XP_006452410.1| hypothetical protein CICLE_v10009295mg [Citrus clementina]
 gb|ESR65650.1| hypothetical protein CICLE_v10009295mg [Citrus clementina]
Length=246

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 188/230 (82%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWER-IPNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SI++L STF QWE    + GE   L KELLA CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSINKLQSTFHQWENSASDPGEQVHLKKELLAGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESS--GLSVIEMRR  505
            DK I +AS+DP+WYGI+++EL KRRRWTS ARTQV ++KKAV+ G  +    +S   MRR
Sbjct  61   DKAIGVASRDPSWYGIDDIELEKRRRWTSTARTQVSSMKKAVLSGGANGVGTMSASGMRR  120

Query  504  ELMNLPDPHQIVDKPNKYSTA-NNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            ELM LP+ HQ   K N+Y+ A +NDD++ +ESD QLLL+KQQD+ELDELSASV+RIGGVG
Sbjct  121  ELMRLPNSHQA--KSNQYAAAQDNDDFIQSESDRQLLLVKQQDEELDELSASVQRIGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIHDEL AQ+KII++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  LTIHDELVAQEKIIDELGTEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  228



>ref|XP_010549364.1| PREDICTED: syntaxin-61-like [Tarenaya hassleriana]
 ref|XP_010549365.1| PREDICTED: syntaxin-61-like [Tarenaya hassleriana]
 ref|XP_010549366.1| PREDICTED: syntaxin-61-like [Tarenaya hassleriana]
Length=245

 Score =   310 bits (795),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 190/228 (83%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L S F +WERIP ++GE   L KELLAACESI WQ+DEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSNFHKWERIPPDTGEQVHLTKELLAACESIEWQLDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            +K I++A++DPAWYGINE EL KRR WTS+ARTQVG+ KK V+ G+ S+G++   EMRRE
Sbjct  61   NKAITVAARDPAWYGINEAELEKRRTWTSNARTQVGSAKKTVLAGKGSNGVAGAKEMRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  ++ ++++  N+DD+V ++SD QLLLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNSSE-TERYDQFAARNDDDFVQSQSDRQLLLIKQQDEELDELSISVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL +Q++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVSQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQIMM  227



>gb|KHN11919.1| Syntaxin-61 [Glycine soja]
Length=242

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 183/226 (81%), Gaps = 2/226 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK+EIQESID+L STF QWE+  ++GE   L KE+L +CESI WQVDELD
Sbjct  1    MPSAQDPFYVVKQEIQESIDKLQSTFHQWEKTADAGERSNLSKEVLGSCESIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
            K IS+AS+DP+WYGI+EVE+  RR+WTSDARTQV   KKAV  G+  +  S+  M +ELM
Sbjct  61   KAISVASRDPSWYGIDEVEVENRRKWTSDARTQVSTAKKAVQAGKGLNNASLNGMHKELM  120

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
             LP  HQ     N+Y+  +NDD++ +ESD Q+LLIK+QD+ELDELS SV+RIGGVGLTIH
Sbjct  121  RLPSSHQTT--SNQYAAQDNDDFIESESDRQMLLIKRQDEELDELSLSVQRIGGVGLTIH  178

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            +EL AQ+KII++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  EELLAQEKIIDELGNEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  224



>ref|XP_003544886.1| PREDICTED: syntaxin-61-like isoform X1 [Glycine max]
Length=242

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 183/226 (81%), Gaps = 2/226 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK+EIQESID+L STF QWE+  ++GE   L KE+L +CESI WQVDELD
Sbjct  1    MPSAQDPFYVVKQEIQESIDKLQSTFHQWEKTADAGERSNLSKEVLGSCESIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
            K IS+AS+DP+WYGI+EVE+  RR+WTSDARTQV   KKAV  G+  +  S+  M +ELM
Sbjct  61   KAISVASRDPSWYGIDEVEVENRRKWTSDARTQVSTAKKAVQAGKGLNNASLNGMHKELM  120

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
             LP  HQ     N+Y+  +NDD++ +ESD Q+LLIK+QD+ELDELS SV+RIGGVGLTIH
Sbjct  121  RLPSSHQTT--SNQYAAQDNDDFIESESDRQMLLIKRQDEELDELSLSVQRIGGVGLTIH  178

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            +EL AQ+KII++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  EELLAQEKIIDELGNEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  224



>ref|XP_003551880.1| PREDICTED: syntaxin-61 [Glycine max]
 gb|KHN02841.1| Syntaxin-61 [Glycine soja]
Length=246

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 182/229 (79%), Gaps = 4/229 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK EIQ+SID+L STF QWE    + E   L KE+LA CESI WQVDELD
Sbjct  1    MPSAQDPFYVVKAEIQDSIDKLQSTFHQWESKSGAAEQGHLTKEVLAGCESIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL---SVIEMRR  505
            K I+IAS+DP+WYGI+E E+  RRRWTS+ R+QVG +KKAV  G+ SS     SV  MRR
Sbjct  61   KAIAIASRDPSWYGIDEAEVESRRRWTSNTRSQVGTMKKAVESGKGSSTTSHASVNGMRR  120

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LP+ HQ  D  N+Y+  +NDD++ +ESD Q LLIK+QD+ELDELS SVRRIGGVGL
Sbjct  121  ELMRLPNSHQ-TDSSNQYAARDNDDFILSESDRQTLLIKRQDEELDELSESVRRIGGVGL  179

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIHDEL AQ+KI+++LGSEMDST+ RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  180  TIHDELTAQEKILDELGSEMDSTTNRLDFVQKKVAMVMKKASAKGQIMM  228



>ref|XP_006475038.1| PREDICTED: syntaxin-61-like [Citrus sinensis]
 gb|KDO62064.1| hypothetical protein CISIN_1g047293mg [Citrus sinensis]
Length=246

 Score =   308 bits (790),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 187/230 (81%), Gaps = 6/230 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWER-IPNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SI++L STF QWE    + GE   L KELLA CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSINKLQSTFHQWENSASDPGEQVHLKKELLAGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESS--GLSVIEMRR  505
            DK I +AS+DP+WYGI+++EL KRRRWTS ARTQV ++KKAV+ G  +    +S   MRR
Sbjct  61   DKAIGVASRDPSWYGIDDIELEKRRRWTSTARTQVSSMKKAVLSGGANGVGTMSASGMRR  120

Query  504  ELMNLPDPHQIVDKPNKYSTA-NNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            ELM LP+ HQ   K N+Y+ A +NDD++ +ESD QLLL+KQQD+ELDELSASV+RIGGVG
Sbjct  121  ELMRLPNSHQA--KSNQYAAAQDNDDFIQSESDRQLLLVKQQDEELDELSASVQRIGGVG  178

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIHDEL AQ+ II++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  LTIHDELVAQENIIDELGTEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  228



>ref|XP_010269835.1| PREDICTED: syntaxin-61-like isoform X1 [Nelumbo nucifera]
Length=298

 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 155/235 (66%), Positives = 185/235 (79%), Gaps = 9/235 (4%)
 Frame = -2

Query  864  GHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQV  688
             H MS+AQDPFYIVKEEIQESID+L STF  WE IP N+GE   L K+LLA CESI WQV
Sbjct  49   AHNMSSAQDPFYIVKEEIQESIDKLQSTFHHWENIPPNTGERVHLTKDLLAGCESIEWQV  108

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLS  523
            DEL+K I++A++DP WYGI+EVEL KR+RWTS AR QV  ++K V VG++     +SGL+
Sbjct  109  DELEKAIAVAARDPTWYGIDEVELDKRKRWTSTARAQVATIRKTVEVGKDQNTTVTSGLN  168

Query  522  VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRR  343
               MR+ELM LPD HQ   + N+Y + +NDD++ +ESD QLLLIKQQD+ELDELS+SV R
Sbjct  169  --GMRQELMRLPDQHQAA-RSNQYMSEDNDDFITSESDRQLLLIKQQDEELDELSSSVER  225

Query  342  IGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IG VGLTIH+EL  Q+KII DL  EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  226  IGNVGLTIHEELLGQEKIIQDLSLEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  280



>ref|XP_006342585.1| PREDICTED: syntaxin-61-like isoform X1 [Solanum tuberosum]
 ref|XP_006342586.1| PREDICTED: syntaxin-61-like isoform X2 [Solanum tuberosum]
Length=247

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 188/230 (82%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWE+    S E   L KELLA+ ESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWEQTSAGSSEQVHLTKELLASSESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE---MR  508
            DKTI +A++DP+WYGIN++EL KRRRWTS+AR QVG++KKAV+ G++S+G S      MR
Sbjct  61   DKTIDVAARDPSWYGINDIELDKRRRWTSNARAQVGSMKKAVVAGKQSNGTSTSNLSGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            REL+ LPD  Q  ++ N Y+  +NDD++++ESD QLLL++QQD+ELDELSASV RIG VG
Sbjct  121  RELLRLPDSDQ-KERSNAYNARDNDDFISSESDRQLLLMRQQDEELDELSASVVRIGDVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIHDEL A +KI+++L +EMDSTS RLDFVQK++ MVMKKAS KGQ MM
Sbjct  180  LTIHDELLAHEKILSELDTEMDSTSNRLDFVQKKIGMVMKKASVKGQMMM  229



>ref|XP_004252790.1| PREDICTED: syntaxin-61 [Solanum lycopersicum]
Length=247

 Score =   308 bits (790),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 188/230 (82%), Gaps = 5/230 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWE+    S E   L KELLA+ ESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWEQTSAGSSEQVHLTKELLASSESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE---MR  508
            DKTI +A++DP+WYGIN++EL KRRRWTS+AR QVG++KKAV+ G++S+G S      MR
Sbjct  61   DKTIDVAARDPSWYGINDIELDKRRRWTSNARAQVGSMKKAVVAGKQSNGTSTSNLSGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            REL+ LPD  Q  ++ N Y+  +NDD++++ESD QLLL++QQD+ELDELSASV RIG VG
Sbjct  121  RELLRLPDSEQ-KERSNAYNARDNDDFISSESDRQLLLMRQQDEELDELSASVVRIGDVG  179

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTIHDEL A +KI+++L +EMDSTS RLDF+QK++ MVMKKAS KGQ MM
Sbjct  180  LTIHDELLAHEKILSELDTEMDSTSNRLDFIQKKIGMVMKKASVKGQMMM  229



>gb|KHG08114.1| Syntaxin-61 -like protein [Gossypium arboreum]
Length=238

 Score =   308 bits (789),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 184/227 (81%), Gaps = 8/227 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS AQDPFYIVKEEIQESID+L S+F +WERI P + +  +L KEL   CESI WQVDEL
Sbjct  1    MSKAQDPFYIVKEEIQESIDKLQSSFHRWERIRPENEQRVRLTKELFTNCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK IS+A++DP+ YGI+EVEL  RRRWTS ARTQVGNVKKAV+ G+E+ G S   M REL
Sbjct  61   DKAISVAARDPSLYGIDEVELENRRRWTSSARTQVGNVKKAVVAGKEN-GNSASAMHREL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LPD      + N Y+  +NDD++++ESD Q+LLI+QQD+ELDELSASV RIGGVGLTI
Sbjct  120  MRLPD------RSNMYTVEDNDDFISSESDRQMLLIRQQDEELDELSASVERIGGVGLTI  173

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQ+KII+DLG+EMDST+ RLDFVQK+VAMVMKKAS  GQ MM
Sbjct  174  HEELLAQEKIIDDLGNEMDSTTNRLDFVQKKVAMVMKKASATGQCMM  220



>ref|NP_001239921.1| uncharacterized protein LOC100795447 [Glycine max]
 gb|ACU24473.1| unknown [Glycine max]
Length=242

 Score =   308 bits (788),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 182/226 (81%), Gaps = 2/226 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK+EIQESID+L STF QWE   + GE   L KE+LA+CESI+WQVDELD
Sbjct  1    MPSAQDPFYVVKQEIQESIDKLKSTFHQWENTADVGERSSLSKEVLASCESIAWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
            K IS+A++DP+WYGI+EVE+  RR+WTSDARTQV   K+ V  G+ S+  S+  M RELM
Sbjct  61   KAISVAARDPSWYGIDEVEVENRRKWTSDARTQVNKAKRTVEAGKGSNNASLSGMHRELM  120

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
             LP  HQ     N+Y+  +NDD++ +ESD Q+LLIK+QD+ELDELS SV+RIGGVGLTIH
Sbjct  121  RLPSSHQTT--SNQYAAQDNDDFIESESDRQMLLIKRQDEELDELSLSVQRIGGVGLTIH  178

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            +EL AQ+KII++LG+EMD TS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  EELLAQEKIIDELGNEMDGTSNRLDFVQKKVAMVMKKASAKGQIMM  224



>ref|XP_010269839.1| PREDICTED: syntaxin-61-like isoform X5 [Nelumbo nucifera]
 ref|XP_010269840.1| PREDICTED: syntaxin-61-like isoform X5 [Nelumbo nucifera]
 ref|XP_010269841.1| PREDICTED: syntaxin-61-like isoform X5 [Nelumbo nucifera]
 ref|XP_010269842.1| PREDICTED: syntaxin-61-like isoform X5 [Nelumbo nucifera]
Length=247

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/232 (66%), Positives = 184/232 (79%), Gaps = 9/232 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L STF  WE IP N+GE   L K+LLA CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSTFHHWENIPPNTGERVHLTKDLLAGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLSVIE  514
            +K I++A++DP WYGI+EVEL KR+RWTS AR QV  ++K V VG++     +SGL+   
Sbjct  61   EKAIAVAARDPTWYGIDEVELDKRKRWTSTARAQVATIRKTVEVGKDQNTTVTSGLN--G  118

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            MR+ELM LPD HQ   + N+Y + +NDD++ +ESD QLLLIKQQD+ELDELS+SV RIG 
Sbjct  119  MRQELMRLPDQHQAA-RSNQYMSEDNDDFITSESDRQLLLIKQQDEELDELSSSVERIGN  177

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL  Q+KII DL  EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  178  VGLTIHEELLGQEKIIQDLSLEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  229



>ref|XP_004491402.1| PREDICTED: syntaxin-61-like [Cicer arietinum]
Length=245

 Score =   307 bits (786),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/229 (66%), Positives = 183/229 (80%), Gaps = 5/229 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VKEEIQ+SIDRL S F QWE   ++GEH  L KE++AAC SI WQVDELD
Sbjct  1    MPSAQDPFYVVKEEIQDSIDRLQSNFHQWENTSDTGEHLHLSKEVIAACGSIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQES---SGLSVIEMRR  505
            K IS+AS+DP+WYGI++VE+  RRRWTS+ARTQV  VKK V  G+ S   S  S+  M +
Sbjct  61   KAISVASRDPSWYGIDDVEIENRRRWTSNARTQVRTVKKTVESGKGSNTTSHASINGMHK  120

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LPD HQ     NKY+  +NDD++ +ESD Q+LLIK+QD+ELDELS SV+RIGGVGL
Sbjct  121  ELMRLPDSHQ--STSNKYTAGDNDDFIESESDRQMLLIKRQDEELDELSLSVQRIGGVGL  178

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q+KI+++LG+EMDSTS RLDFVQKRVAMVMKKAS KGQ MM
Sbjct  179  TIHEELLGQEKILDELGNEMDSTSNRLDFVQKRVAMVMKKASVKGQIMM  227



>ref|NP_001241250.1| uncharacterized protein LOC100787129 [Glycine max]
 gb|ACU23236.1| unknown [Glycine max]
 gb|KHM99559.1| Syntaxin-61 [Glycine soja]
Length=246

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 150/229 (66%), Positives = 181/229 (79%), Gaps = 4/229 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK EIQ+SID+L STF QWE    + E   L KE+LA CESI WQVDELD
Sbjct  1    MPSAQDPFYVVKAEIQDSIDKLQSTFHQWESKSGAAEQGHLTKEVLAGCESIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS---VIEMRR  505
            K I++AS+DP+WYGI+E E+  RRRW S AR+QVG +KKA+  G+ SS  S   V  MRR
Sbjct  61   KAIAVASRDPSWYGIDEAEVESRRRWASSARSQVGTMKKAMESGKGSSTTSHASVNGMRR  120

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LP+ HQ  D  N+Y+  +NDD++ +ESD Q LLIK+QD+ELDELS SVRRIGGVGL
Sbjct  121  ELMRLPNSHQ-TDSSNQYAARDNDDFIQSESDRQTLLIKRQDEELDELSESVRRIGGVGL  179

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIHDEL AQ+KI+++LGSEMDST+ RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  180  TIHDELTAQEKILDELGSEMDSTTNRLDFVQKKVAMVMKKASAKGQIMM  228



>ref|XP_007142287.1| hypothetical protein PHAVU_008G267900g [Phaseolus vulgaris]
 gb|AGV54519.1| syntaxin-61 [Phaseolus vulgaris]
 gb|ESW14281.1| hypothetical protein PHAVU_008G267900g [Phaseolus vulgaris]
Length=245

 Score =   303 bits (777),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 184/229 (80%), Gaps = 5/229 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VKEEIQESID+L STFRQWE+  ++GE   L KE+L +CESI WQVDELD
Sbjct  1    MPSAQDPFYVVKEEIQESIDKLQSTFRQWEKAADAGERSNLSKEVLTSCESIDWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQES---SGLSVIEMRR  505
            K IS+AS+DP+ YGI+EVEL  RRRWTS+AR+QV   KKAV  G+ S   +  S+  M R
Sbjct  61   KAISVASRDPSLYGIDEVELENRRRWTSEARSQVSTAKKAVEAGKRSNITNNASLNGMHR  120

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LP+ HQ      +Y T +NDD++ +ESD Q+LLIK+QD+ELDEL+ S++RIGGVGL
Sbjct  121  ELMRLPNSHQTA--SGQYPTQDNDDFMESESDRQMLLIKRQDEELDELTVSIQRIGGVGL  178

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL AQ+KI+++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  179  TIHEELLAQEKIVDELGNEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  227



>ref|XP_010269838.1| PREDICTED: syntaxin-61-like isoform X4 [Nelumbo nucifera]
Length=253

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 181/232 (78%), Gaps = 9/232 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
             S  QDPFYIVKEEIQESID+L STF  WE IP N+GE   L K+LLA CESI WQVDEL
Sbjct  7    FSFPQDPFYIVKEEIQESIDKLQSTFHHWENIPPNTGERVHLTKDLLAGCESIEWQVDEL  66

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLSVIE  514
            +K I++A++DP WYGI+EVEL KR+RWTS AR QV  ++K V VG++     +SGL+   
Sbjct  67   EKAIAVAARDPTWYGIDEVELDKRKRWTSTARAQVATIRKTVEVGKDQNTTVTSGLN--G  124

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            MR+ELM LPD HQ   + N+Y + +NDD++ +ESD QLLLIKQQD+ELDELS+SV RIG 
Sbjct  125  MRQELMRLPDQHQAA-RSNQYMSEDNDDFITSESDRQLLLIKQQDEELDELSSSVERIGN  183

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL  Q+KII DL  EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  184  VGLTIHEELLGQEKIIQDLSLEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  235



>gb|KHG02101.1| Syntaxin-61 -like protein [Gossypium arboreum]
Length=261

 Score =   302 bits (773),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/229 (65%), Positives = 185/229 (81%), Gaps = 3/229 (1%)
 Frame = -2

Query  861  HKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPN-SGEHQQLVKELLAACESISWQVD  685
            +KMS AQDPFYIVKEEIQ+SID+L S+F QWER+P  +GE   L KELLA CESI+WQVD
Sbjct  17   YKMSKAQDPFYIVKEEIQDSIDKLQSSFHQWERVPGGTGEQVHLTKELLANCESIAWQVD  76

Query  684  ELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRR  505
            EL K IS+A++DP+WYGINEVEL  RRRWTS+AR QV +VK+ +  G+E+   + + +R 
Sbjct  77   ELAKAISVAARDPSWYGINEVELENRRRWTSNARLQVADVKRTIGAGKENDNSASV-IRL  135

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            ELM LP+  Q  D  + YS  NNDD+VA+ESD Q+LL+KQQD+ELDELS SV+RIGGVGL
Sbjct  136  ELMRLPNSQQ-PDISDHYSAKNNDDFVASESDRQMLLLKQQDEELDELSTSVKRIGGVGL  194

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL AQ+KI+++LG+EMDST  RLDFVQK++ MVMKKA  KGQ M+
Sbjct  195  TIHEELLAQEKILDELGTEMDSTKNRLDFVQKKMGMVMKKAGAKGQIMI  243



>ref|XP_004294428.1| PREDICTED: syntaxin-61-like [Fragaria vesca subsp. vesca]
Length=245

 Score =   301 bits (772),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 148/227 (65%), Positives = 180/227 (79%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +A+DPFY+VKEEIQESID+L S+F QWERI  N G+  QL+KELLA CE I W+VDEL
Sbjct  2    MPSARDPFYVVKEEIQESIDKLQSSFHQWERISSNGGQQVQLMKELLATCERIEWEVDEL  61

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
             K +S+A+ +P  YGI+EVEL KR+RWTS A  QVG VK+AV  G+ES+G S   MRREL
Sbjct  62   GKAVSVAATNPNKYGIDEVELEKRKRWTSTAHAQVGAVKRAVEAGKESTGTSAAGMRREL  121

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M L +  +  D+ ++Y+  +NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGLTI
Sbjct  122  MRLANSQE-TDRSHQYAAHHNDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGLTI  180

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL AQDKI+ +LG EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  181  HEELLAQDKIVEELGMEMDSTSNRLDFVQKKVATVMKKAGVKGQIMM  227



>ref|XP_010274513.1| PREDICTED: syntaxin-61-like [Nelumbo nucifera]
Length=246

 Score =   300 bits (768),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/232 (66%), Positives = 184/232 (79%), Gaps = 10/232 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+L STF QWER P N+GE   L KELLA+CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLQSTFHQWERAPSNTGEQVHLTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLSVIE  514
            DK I++A++DPAWYGI+E+EL KRRRWTS ARTQV  V+KAV   +E     +SGL+   
Sbjct  61   DKAIAVAARDPAWYGIDEIELDKRRRWTSMARTQVATVRKAVEAQKEQNSTVTSGLN--G  118

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
             R+ELM LP         ++Y + ++DD++ +ESD Q+LLIKQQD+ELDELSASV+RIGG
Sbjct  119  TRQELMRLPGDRYTA--KSQYMSQDDDDFITSESDRQMLLIKQQDEELDELSASVQRIGG  176

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL  Q+KI+ DL  EMDSTS RLDFVQK+VA+VMKKAS KGQ MM
Sbjct  177  VGLTIHEELLGQEKILEDLSLEMDSTSNRLDFVQKKVAIVMKKASAKGQIMM  228



>ref|XP_010930956.1| PREDICTED: syntaxin-61-like [Elaeis guineensis]
Length=244

 Score =   300 bits (767),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 185/227 (81%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+  QDPFYIVKEEIQ+SID+L +TFRQWE+ P ++GEH  L KELLA+CES+ WQV+EL
Sbjct  1    MTPPQDPFYIVKEEIQDSIDKLQATFRQWEQTPSDTGEHVHLSKELLASCESLEWQVEEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK I++A++DPAWYG++EVEL KRR+WTS A  QVG V++AV  G+E S  S+  MR+EL
Sbjct  61   DKAIAVAARDPAWYGLDEVELEKRRKWTSTAHNQVGIVRRAVEAGKEKSS-SINGMRQEL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LP+ H      + +  A+NDD++++ESD QLLLIKQQD+ELDELSASV+R+GGVGLTI
Sbjct  120  MRLPNDHASQAGRSNHFIADNDDFISSESDRQLLLIKQQDEELDELSASVQRLGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL  Q++I++DL  EM++TS RLDFVQK+VAMVMKKA  KGQ MM
Sbjct  180  HDELVGQERILDDLSMEMETTSNRLDFVQKKVAMVMKKAGAKGQLMM  226



>gb|EYU20611.1| hypothetical protein MIMGU_mgv1a011514mg [Erythranthe guttata]
Length=279

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 184/228 (81%), Gaps = 5/228 (2%)
 Frame = -2

Query  858  KMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDE  682
            +MS+AQDPFYIVKEEIQ+SID+LLSTF +WER+P +SGE  +L KEL   C+SI WQVDE
Sbjct  32   QMSSAQDPFYIVKEEIQDSIDKLLSTFHKWERMPSDSGEQLRLTKELHVGCDSIQWQVDE  91

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVI---EM  511
            LDK I++ASKDPA YGINEVEL KRRRWTS+AR QV NVKK V+ G+E +G S     E 
Sbjct  92   LDKAIAVASKDPALYGINEVELDKRRRWTSNAREQVKNVKKLVVNGKELNGTSTSNFNEK  151

Query  510  RRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
             REL  LP+ HQ  DK N Y   +NDD+V++ESD Q+LL++QQD+ELDEL+ASV+ IGGV
Sbjct  152  NRELSRLPNSHQ-PDKSNYYGGRDNDDFVSSESDRQMLLMRQQDEELDELTASVQVIGGV  210

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
            G TIH+EL AQ+KI+++LG EMDSTS RLDFVQK+V M+MKKA  KGQ
Sbjct  211  GRTIHEELLAQEKIMDELGMEMDSTSNRLDFVQKKVGMIMKKAGAKGQ  258



>ref|XP_007146484.1| hypothetical protein PHAVU_006G044400g [Phaseolus vulgaris]
 gb|ESW18478.1| hypothetical protein PHAVU_006G044400g [Phaseolus vulgaris]
Length=243

 Score =   295 bits (756),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 144/226 (64%), Positives = 177/226 (78%), Gaps = 1/226 (0%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK EIQ+SID+L STF QW+   N+ E  +L KE+ A CESI WQVDELD
Sbjct  1    MPSAQDPFYVVKYEIQDSIDKLQSTFHQWQNTSNAAEQGRLTKEVRAGCESIEWQVDELD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
            K I++AS+DP+WYGI+EVEL  R  WTS +R+QV  +KKA+  G+ SS  S   MR+ELM
Sbjct  61   KAIAVASRDPSWYGIDEVELESRMTWTSSSRSQVVTMKKALEAGKGSSTTSHSSMRQELM  120

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
             LP   Q  D  N+Y+  +NDD++ +ESD Q+LLIK+QD+ELD+LS SVRRIGGVGLTIH
Sbjct  121  RLPSSRQ-NDTYNQYAARDNDDFIQSESDRQMLLIKKQDEELDDLSESVRRIGGVGLTIH  179

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            DEL AQDKI+ +LGSEMDST+ RLDFVQK+V MVMKKAS KGQ MM
Sbjct  180  DELTAQDKILEELGSEMDSTTNRLDFVQKKVGMVMKKASAKGQIMM  225



>ref|XP_008781445.1| PREDICTED: syntaxin-61-like [Phoenix dactylifera]
 ref|XP_008781446.1| PREDICTED: syntaxin-61-like [Phoenix dactylifera]
Length=244

 Score =   295 bits (755),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 143/227 (63%), Positives = 182/227 (80%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+  QDPFYIVKEEIQ+SID+L +TF  WE+ P ++GE   L KELLA+CESI WQVDEL
Sbjct  1    MTPPQDPFYIVKEEIQDSIDKLQATFHHWEQTPSDTGERVHLSKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK I++A++DPAWYG++EVEL +RR+WT  A  QVG V++AV  G+E S  S+  MR+EL
Sbjct  61   DKAIAVAARDPAWYGLDEVELERRRKWTGTAHNQVGVVRRAVEAGKEKSS-SINGMRKEL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LP+ H      + +  A+NDD++++ESD QLLLIKQQD+ELDELSASV+R+GGVGLTI
Sbjct  120  MRLPNDHASQTGRSNHFIADNDDFISSESDRQLLLIKQQDEELDELSASVQRLGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL  Q++I++DLG EM++TS RLDFVQK+VAMVMKKA  KGQ MM
Sbjct  180  HDELVGQERILDDLGMEMETTSNRLDFVQKKVAMVMKKAGAKGQLMM  226



>ref|XP_003600111.1| Syntaxin-61 [Medicago truncatula]
 gb|AES70362.1| syntaxin protein [Medicago truncatula]
Length=243

 Score =   294 bits (753),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/226 (63%), Positives = 179/226 (79%), Gaps = 1/226 (0%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFY+VK EIQESID L STF QW+   +S E  ++ KE+L+ CESI WQVDEL+
Sbjct  1    MPSAQDPFYVVKSEIQESIDNLHSTFEQWKHTSDSAEKVRVTKEVLSGCESIEWQVDELE  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
            K I++A+++P+WYGI++ E+  RRRWTS ARTQVG +KK V  G+ SS  S+  M RELM
Sbjct  61   KAIAVAAREPSWYGIDDAEIENRRRWTSSARTQVGTMKKTVDAGKSSSTTSINGMHRELM  120

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
             LPD +Q     N+ +  +NDD++ +ESD Q LLIKQQD+ELDELS SV+RIGGVGLTIH
Sbjct  121  RLPDSYQPY-ASNQNAANDNDDFIQSESDRQTLLIKQQDEELDELSLSVQRIGGVGLTIH  179

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            +EL +Q+KII++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  180  EELLSQEKIIDELGNEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  225



>ref|XP_010499379.1| PREDICTED: syntaxin-61 isoform X1 [Camelina sativa]
 ref|XP_010460647.1| PREDICTED: syntaxin-61 [Camelina sativa]
Length=245

 Score =   293 bits (749),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 184/228 (81%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WERI P+ G+   + KEL+A C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAHVAKELVATCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            +K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V+ G+ SSG     E+RRE
Sbjct  61   EKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+ ++  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNANE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>ref|NP_564310.1| syntaxin-61 [Arabidopsis thaliana]
 ref|XP_002890778.1| hypothetical protein ARALYDRAFT_473066 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q946Y7.1|SYP61_ARATH RecName: Full=Syntaxin-61; Short=AtSYP61; AltName: Full=Osmotic 
stress-sensitive mutant 1 [Arabidopsis thaliana]
 gb|AAK40222.2|AF355754_1 syntaxin of plants 61 [Arabidopsis thaliana]
 gb|AAN12965.1| unknown protein [Arabidopsis thaliana]
 gb|EFH67037.1| hypothetical protein ARALYDRAFT_473066 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE30982.1| syntaxin-61 [Arabidopsis thaliana]
Length=245

 Score =   291 bits (746),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WERI P+ G+   + KEL+A C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAHVAKELVATCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            +K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V+ G+ SSG     E+RRE
Sbjct  61   EKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +   + ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNSGE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_010478222.1| PREDICTED: syntaxin-61-like [Camelina sativa]
 ref|XP_010478223.1| PREDICTED: syntaxin-61-like [Camelina sativa]
 ref|XP_010478224.1| PREDICTED: syntaxin-61-like [Camelina sativa]
Length=245

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WERI P+ G+   + KEL+A C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAHVAKELVATCVSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            +K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V  G+ SSG     E+RRE
Sbjct  61   EKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVSAGKVSSGAGHASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM LP+ ++  ++ + Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRLPNANE-ANRYDHYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>gb|AAL59937.1| unknown protein [Arabidopsis thaliana]
Length=245

 Score =   291 bits (745),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WERI P+ G+   + KEL+A C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPDMGDQAHVAKELVATCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            +K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V+ G+ SSG     E+RRE
Sbjct  61   EKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +   + ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNSGE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_009404897.1| PREDICTED: syntaxin-61-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=249

 Score =   291 bits (745),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 180/233 (77%), Gaps = 9/233 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+AAQDPFYIVK EIQESID+L  TF QWE+ P N+GE   L KELL +CESI WQVDEL
Sbjct  1    MAAAQDPFYIVKGEIQESIDKLQVTFHQWEQTPSNTGERVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLSVIE  514
            DK I++A++DPAWYG++EVEL KRRRWTS A  QVG  ++ V  G+      SSG + + 
Sbjct  61   DKAIAVAARDPAWYGLDEVELEKRRRWTSTAHNQVGRTRRTVETGKVKQNLFSSGANGV-  119

Query  513  MRRELMNLPDPHQI-VDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
             R+ELM LP+ H     + N Y   +NDD++++ESD QLLL+K+QD+ELDELSASVRRIG
Sbjct  120  -RKELMKLPNDHASQAGRSNHYVNQHNDDFISSESDQQLLLVKKQDEELDELSASVRRIG  178

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
             VGLTIHDEL  Q+KI+++LG EM++TS RLDFVQK+VA+VMKKA  KGQ MM
Sbjct  179  HVGLTIHDELIGQEKILDELGMEMETTSNRLDFVQKKVALVMKKAGAKGQIMM  231



>ref|XP_009404898.1| PREDICTED: syntaxin-61-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   290 bits (742),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 180/233 (77%), Gaps = 9/233 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+AAQDPFYIVK EIQESID+L  TF QWE+ P N+GE   L KELL +CESI WQVDEL
Sbjct  1    MAAAQDPFYIVKGEIQESIDKLQVTFHQWEQTPSNTGERVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQE-----SSGLSVIE  514
            DK I++A++DPAWYG++EVEL KRRRWTS A  QVG  ++ V  G+      SSG + + 
Sbjct  61   DKAIAVAARDPAWYGLDEVELEKRRRWTSTAHNQVGRTRRTVETGKVKQNLFSSGANGV-  119

Query  513  MRRELMNLPDPHQI-VDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
             R+ELM LP+ H     + N Y   +NDD++++ESD QLLL+K+QD+ELDELSASVRRIG
Sbjct  120  -RKELMKLPNDHASQAGRSNHYVNQHNDDFISSESDQQLLLVKKQDEELDELSASVRRIG  178

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
             VGLTIHDEL  Q+KI+++LG EM++TS RLDFVQK+VA+VMKKA  KGQ MM
Sbjct  179  HVGLTIHDELIGQEKILDELGMEMETTSNRLDFVQKKVALVMKKAGAKGQIMM  231



>ref|XP_006415648.1| hypothetical protein EUTSA_v10008609mg [Eutrema salsugineum]
 gb|ESQ34001.1| hypothetical protein EUTSA_v10008609mg [Eutrema salsugineum]
Length=245

 Score =   289 bits (740),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 183/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WERI P  G+   + KE+LA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERISPGMGDQVHVTKEILANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K +++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ ++G  +  E+RRE
Sbjct  61   EKAVTVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGNAGAGNASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNSTE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_009102901.1| PREDICTED: syntaxin-61-like isoform X1 [Brassica rapa]
 emb|CDY15661.1| BnaA07g08320D [Brassica napus]
Length=245

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S+F +WERI P  G+   + KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSSFHKWERISPGMGDQVHVTKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K +++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ S+G  +  E+RRE
Sbjct  61   EKAVNVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGSAGGGNASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  121  LMRMPNSSE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_006304138.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 ref|XP_006304139.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 gb|EOA37036.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
 gb|EOA37037.1| hypothetical protein CARUB_v10010122mg [Capsella rubella]
Length=245

 Score =   288 bits (738),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/228 (63%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S F +WERI P+ G+   + KEL+  C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSAFHKWERISPDMGDQAHVAKELVDTCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS-VIEMRRE  502
            +K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V+ G+ SSG     E+RRE
Sbjct  61   EKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGVLAGKVSSGAGHANEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+ ++  +K ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV+RIGGVGLT
Sbjct  121  LMRMPNSNE-ANKYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVQRIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELIAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_009109711.1| PREDICTED: syntaxin-61 [Brassica rapa]
 ref|XP_009109713.1| PREDICTED: syntaxin-61 [Brassica rapa]
 ref|XP_009109714.1| PREDICTED: syntaxin-61 [Brassica rapa]
 ref|XP_009109715.1| PREDICTED: syntaxin-61 [Brassica rapa]
Length=245

 Score =   287 bits (735),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WER+ P  G+   + KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERVSPGMGDQVHVTKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K +++A+KDPA YGI++ EL +RRRWTS+ARTQV NVK  V+ G+ S+G  +  E+RRE
Sbjct  61   EKAVAVAAKDPALYGIDDAELERRRRWTSNARTQVRNVKTGVLAGKGSAGAGNASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+ ++   + ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  121  LMRMPNSNE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_010693150.1| PREDICTED: syntaxin-61 [Beta vulgaris subsp. vulgaris]
Length=242

 Score =   286 bits (731),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 146/229 (64%), Positives = 180/229 (79%), Gaps = 8/229 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWER-IPNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLS+FRQWE  +  + E  +L +EL   C SI WQV+EL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSSFRQWEHAVYGTAEQARLTEELRTGCGSIEWQVEEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK +S+A+KDPA+YGI+EVEL KRRRWT  AR QVG +KK V  G+E   LS  +   EL
Sbjct  61   DKAVSVAAKDPAYYGIDEVELEKRRRWTRTARDQVGTMKKKVSAGKE---LSYHDSHLEL  117

Query  498  MNLP--DPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            M LP   PHQ  ++ N+Y   +NDD++++ESD QLLLIKQQD+ELDELSASV+RIG VGL
Sbjct  118  MRLPMEHPHQ-TERSNQYG-HHNDDFISSESDRQLLLIKQQDEELDELSASVQRIGNVGL  175

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIHDEL A +KII++LG EMD+TS RLDF+QK+V++VMKKA  KGQ MM
Sbjct  176  TIHDELLAHEKIIDELGVEMDTTSNRLDFLQKKVSIVMKKAGAKGQIMM  224



>emb|CDX94628.1| BnaC07g10300D [Brassica napus]
Length=245

 Score =   286 bits (731),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 179/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S F +WERI P  G+   + KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSAFHKWERISPGMGDQVHVTKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K +++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ S+G  +  E+RRE
Sbjct  61   EKAVNVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGSAGAGNASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +   + ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  121  LMRMPNSSE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RL FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLHFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_009113656.1| PREDICTED: syntaxin-61-like isoform X4 [Brassica rapa]
 ref|XP_009113657.1| PREDICTED: syntaxin-61-like isoform X4 [Brassica rapa]
 emb|CDY34096.1| BnaA09g27220D [Brassica napus]
Length=245

 Score =   285 bits (730),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 180/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S F +WERI P  G+     KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSAFHKWERISPGMGDQVHATKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K I++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ ++G+ +  E+R E
Sbjct  61   EKAITVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGNAGVGNASEVRLE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  121  LMRMPNSSE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_009113652.1| PREDICTED: syntaxin-61-like isoform X1 [Brassica rapa]
Length=282

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 180/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S F +WERI P  G+     KELLA C SI WQVDEL
Sbjct  38   MSSAQDPFYIVKEEIQDSIDKLQSAFHKWERISPGMGDQVHATKELLANCGSIEWQVDEL  97

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K I++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ ++G+ +  E+R E
Sbjct  98   EKAITVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGNAGVGNASEVRLE  157

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  158  LMRMPNSSE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  216

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  217  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  264



>ref|XP_009113653.1| PREDICTED: syntaxin-61-like isoform X2 [Brassica rapa]
Length=281

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/228 (62%), Positives = 180/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S F +WERI P  G+     KELLA C SI WQVDEL
Sbjct  37   MSSAQDPFYIVKEEIQDSIDKLQSAFHKWERISPGMGDQVHATKELLANCGSIEWQVDEL  96

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K I++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ ++G+ +  E+R E
Sbjct  97   EKAITVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGNAGVGNASEVRLE  156

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  157  LMRMPNSSE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  215

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  216  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  263



>emb|CDX90156.1| BnaA08g18280D [Brassica napus]
Length=441

 Score =   290 bits (741),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/228 (62%), Positives = 182/228 (80%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L STF +WER+ P  G+   + KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSTFHKWERVSPGMGDQVHVTKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K +++A+KDPA YGI++ EL +RRRWTS+ARTQV NVK  V+ G+ S+G  +  E+RRE
Sbjct  61   EKAVAVAAKDPALYGIDDAELERRRRWTSNARTQVRNVKTGVLAGKGSAGAGNASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+ ++   + ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  121  LMRMPNSNE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RL+FVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLEFVQKKVGMVMKKAGAKGQMMM  227



>ref|XP_010912452.1| PREDICTED: syntaxin-61-like isoform X3 [Elaeis guineensis]
Length=244

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 179/227 (79%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+  QDPFYIVKEEIQ+SID+L +TF QWE+ P ++GEH  L K++LA+CESI WQVDE+
Sbjct  1    MTPPQDPFYIVKEEIQDSIDKLRATFHQWEQTPLDTGEHVHLTKDVLASCESIEWQVDEM  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK I++A++DPAWYG++E+EL +RR+WTS A  QV  V++AV  G+  S  S+  M +EL
Sbjct  61   DKAIAVAARDPAWYGLDELELERRRKWTSTAHNQVATVRRAVEAGKGKSS-SINGMHQEL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LP  H      + +  A+NDD++++ESD QLLLIKQQD+ELDELS S++RIGGVGLTI
Sbjct  120  MRLPSDHASQAGRSNHFIADNDDFISSESDRQLLLIKQQDEELDELSDSIQRIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+++L  EM++TS RLDFVQK+VAMVMKKA  KGQ MM
Sbjct  180  HEELVGQERILDELSMEMETTSNRLDFVQKKVAMVMKKAGAKGQLMM  226



>ref|XP_002459155.1| hypothetical protein SORBIDRAFT_03g046820 [Sorghum bicolor]
 gb|EES04275.1| hypothetical protein SORBIDRAFT_03g046820 [Sorghum bicolor]
Length=232

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 175/227 (77%), Gaps = 14/227 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ+SID+L STF +WE+   N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQDSIDKLQSTFHRWEQTASNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR QVG VK+A+  G+ ++  S        
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARKQVGTVKRAIEKGKSNAATS--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                  +Q   + N YS  +NDD++++ESD QLLL++QQD+ELDELS SV+RIGGVGLTI
Sbjct  113  -----KYQDTSRTNHYSAQDNDDFISSESDRQLLLMRQQDEELDELSESVQRIGGVGLTI  167

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+NDL  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  HEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  214



>gb|AGT16573.1| hypothetical protein SHCRBa_250_M20_R_30 [Saccharum hybrid cultivar 
R570]
Length=231

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 175/227 (77%), Gaps = 14/227 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ+SID+L STF +WE+   N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQDSIDKLQSTFHRWEQTASNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR QVG VK+A+  G+ ++  S        
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARKQVGTVKRAIEKGKSNAATS--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                  +Q   + N YS  +NDD++++ESD QLLL++QQD+ELDELS SV+RIGGVGLTI
Sbjct  113  -----KYQDTSRTNHYSAQDNDDFISSESDRQLLLMRQQDEELDELSESVQRIGGVGLTI  167

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+NDL  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  HEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  214



>emb|CDY30816.1| BnaC05g21920D [Brassica napus]
Length=245

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/228 (61%), Positives = 180/228 (79%), Gaps = 3/228 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+SID+L S F +WE I P  G+     KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSIDKLQSAFHKWECISPGMGDQVHATKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            +K I++A+KDPA YGI++ EL +RRRWTS+ARTQV NVK  V+ G+ ++G+ +  E+R E
Sbjct  61   EKAITVAAKDPALYGIDQAELERRRRWTSNARTQVRNVKTGVLAGKGNAGVGNASEVRLE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+ ++  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS SV RIGGVGLT
Sbjct  121  LMRMPNSNE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKSVERIGGVGLT  179

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  180  IHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  227



>emb|CDM86912.1| unnamed protein product [Triticum aestivum]
Length=234

 Score =   281 bits (718),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 177/229 (77%), Gaps = 16/229 (7%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ SI +L +TF +WE++  N+GE+  L KELLA+CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQGSIGKLQTTFHRWEQVSSNTGEYIHLTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR Q+G VK+AV  G+ +  ++        
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARNQIGTVKRAVEKGKSNPAMA--------  112

Query  498  MNLPDPHQ--IVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  HQ     + N YS+ +NDDY+A+ESD QLLL++QQDDELDELSASV+RIGGVGL
Sbjct  113  -----RHQDNGTSRTNYYSSQDNDDYIASESDRQLLLMRQQDDELDELSASVQRIGGVGL  167

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q++I+N+L  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  TIHEELSGQERILNNLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  216



>ref|XP_003565128.1| PREDICTED: syntaxin-61 [Brachypodium distachyon]
Length=234

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 179/226 (79%), Gaps = 12/226 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ SI +L +TF++WE+I  N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQGSIGKLQTTFQRWEQIASNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR+QVG V++AV  G+ +S ++     ++L
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARSQVGAVRRAVEKGKNNSAMA---RHQDL  117

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M     H        YS+ +NDDY+A+ESD QLLL++QQDDELDELSASV+RIGGVGLTI
Sbjct  118  MGTSRNH--------YSSQDNDDYIASESDRQLLLMRQQDDELDELSASVQRIGGVGLTI  169

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFM  181
            H+EL  Q++I+NDL  EM++TS RLDFVQK+VA+VMKKA  KGQ M
Sbjct  170  HEELSGQERILNDLSLEMETTSNRLDFVQKKVAVVMKKAGIKGQIM  215



>ref|XP_004971361.1| PREDICTED: syntaxin-61-like [Setaria italica]
Length=232

 Score =   278 bits (712),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 175/227 (77%), Gaps = 14/227 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ+SID+L STF +WE+   N+GE+  L K+LL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQDSIDKLQSTFHRWEQTASNTGEYVHLTKDLLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR QVG V++A+  G+ +S  S        
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARNQVGTVRRAIEKGKSNSATS--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                  +Q   + N YS  +NDD++++ESD Q LL++QQD+ELDELSASV+RIGGVGLTI
Sbjct  113  -----RYQDTSRTNLYSAQDNDDFISSESDRQQLLMRQQDEELDELSASVQRIGGVGLTI  167

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+NDL  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  HEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  214



>gb|EMS59908.1| Syntaxin-61 [Triticum urartu]
Length=234

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 176/229 (77%), Gaps = 16/229 (7%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ SI +L +TF +WE++  N+GE+  + KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQGSIGKLQTTFHRWEQVSSNTGEYVHITKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR Q+G VK+AV  G+ +  ++        
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARNQIGTVKRAVEKGKSNPAMA--------  112

Query  498  MNLPDPHQ--IVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  HQ     + N YS+ +NDDY+A+ESD QLLL++QQDDELDELSASV+RIGGVGL
Sbjct  113  -----RHQDNGTSRTNYYSSQDNDDYIASESDRQLLLMRQQDDELDELSASVQRIGGVGL  167

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q++I+N+L  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  TIHEELSGQERILNNLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  216



>ref|XP_008805691.1| PREDICTED: syntaxin-61-like isoform X2 [Phoenix dactylifera]
Length=249

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 178/231 (77%), Gaps = 5/231 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M++AQDPFYIVK+EIQESID+L  +FRQWE  P NSGEH  L K+LLA CESI WQVDEL
Sbjct  1    MTSAQDPFYIVKDEIQESIDKLHDSFRQWEETPYNSGEHLHLTKQLLANCESIKWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSG---LSVIEMR  508
            DK I++A+ DPAWYG++EVEL KRRRWT+ A  QVG V+KA+  G++ S    L    M 
Sbjct  61   DKAIAVAASDPAWYGLDEVELEKRRRWTNIAHIQVGTVRKALEDGRKKSNSINLGPGGMH  120

Query  507  RELMNLPD-PHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            REL+ LP+       + N Y+  +NDD+++AESD Q+LLIKQQD+ELD+LS SV+RIG V
Sbjct  121  RELLRLPNVGFSQAGRSNNYAAEDNDDFISAESDRQMLLIKQQDEELDDLSVSVQRIGDV  180

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTI++EL  Q++I++D+  +M++TS RL FVQK+VAMVMKKA  KGQ MM
Sbjct  181  GLTINEELIGQERILDDMSVDMETTSNRLGFVQKKVAMVMKKAGAKGQIMM  231



>ref|NP_001141746.1| uncharacterized protein LOC100273880 [Zea mays]
 gb|ACF86976.1| unknown [Zea mays]
 tpg|DAA55729.1| TPA: hypothetical protein ZEAMMB73_314997 [Zea mays]
Length=232

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 172/227 (76%), Gaps = 14/227 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQESID+L S F +WE+   N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQESIDKLQSNFHRWEQTASNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DP++YG++EVEL +RR WT  A  QVG VK+A+  G+ +   S        
Sbjct  61   EKTISVASRDPSYYGLDEVELSRRRNWTGSAHKQVGTVKRAIEKGKSNVATS--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                  +Q   + N YS  +NDD++++ESD QLLL++QQD+ELDELS SV+RIGGVGLTI
Sbjct  113  -----KYQDTSRTNHYSAQDNDDFISSESDRQLLLMRQQDEELDELSESVQRIGGVGLTI  167

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+NDL  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  HEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  214



>ref|XP_008660430.1| PREDICTED: syntaxin-61-like [Zea mays]
 ref|XP_008660431.1| PREDICTED: syntaxin-61-like [Zea mays]
 gb|AFW89302.1| hypothetical protein ZEAMMB73_776234 [Zea mays]
Length=232

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/227 (59%), Positives = 174/227 (77%), Gaps = 14/227 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQESID+L STF +WE+   N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQESIDKLQSTFHRWEQTASNTGEYVHLTKELLISCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  +  QVG VK+A+  G+ ++  S        
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSSHKQVGTVKRAIEKGKSNAATS--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                  +Q   + N YS  +NDD++++ESD QLLL++QQD+ELDELS SV+RIGGVGLTI
Sbjct  113  -----KYQDTSRTNHYSAQDNDDFLSSESDRQLLLMRQQDEELDELSESVQRIGGVGLTI  167

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+NDL  EM++TS RLDFVQKRVAMV+KKA  KGQ M+
Sbjct  168  HEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVIKKAGIKGQIML  214



>dbj|BAJ92922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/227 (60%), Positives = 177/227 (78%), Gaps = 11/227 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+ QDPFYIV+EEIQ SI +L +TF +WE++  N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSPQDPFYIVREEIQGSIGKLQATFHRWEQVSSNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR Q+G V++AV  G+ +  ++    R + 
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARNQIGTVRRAVEKGKSNPAMA----RHQ-  115

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                DP     + N YS+ +NDDY+A+ESD QLLL++QQDDELDELSASV+RIGGVGLTI
Sbjct  116  ----DPMG-TSRTNHYSSQDNDDYIASESDRQLLLMRQQDDELDELSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+N+L  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  171  HEELSGQERILNNLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  217



>ref|XP_008784178.1| PREDICTED: syntaxin-61-like [Phoenix dactylifera]
Length=244

 Score =   276 bits (706),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 176/227 (78%), Gaps = 2/227 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M   QDPFYIVKEEIQ+SID+L +TF QW++ P ++GEH  L KE LA+CESI WQVDE+
Sbjct  1    MMPPQDPFYIVKEEIQDSIDKLQATFHQWKQTPSDTGEHVHLTKEFLASCESIEWQVDEM  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
             K I++A++DPAWYG+ +VEL +RR+WTS A  QVG V++AV  G+  S  S+  M++EL
Sbjct  61   KKAIAVAARDPAWYGLEDVELERRRKWTSTAHNQVGTVRRAVEAGKGKSS-SINGMQQEL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            + LP  H      + +  ANNDD++++ESD QLLLIK+QD+ELDELS S++RIGGVGLTI
Sbjct  120  IRLPSGHASQAGRSNHFIANNDDFISSESDRQLLLIKRQDEELDELSDSIQRIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q++I+++L  EM++TS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  180  HEELVGQERILDELSMEMETTSNRLDFVQKKVARVMKKAGAKGQLMM  226



>ref|XP_006645352.1| PREDICTED: syntaxin-61-like [Oryza brachyantha]
Length=234

 Score =   275 bits (704),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 172/229 (75%), Gaps = 16/229 (7%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ+SID+L +TF QWE+IP N+GEH  L KEL  +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQDSIDKLQTTFHQWEKIPSNTGEHVHLTKELHTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTI +AS+DPA+YG++EVEL +RR W   AR QV  V++ V  G+ +S  S        
Sbjct  61   EKTILVASRDPAYYGLDEVELSRRRNWIGSARNQVAAVRRGVEKGKSNSAFS--------  112

Query  498  MNLPDPHQIV--DKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  HQ +   + N Y+T +NDD++ +ESD Q LL++QQD+ELDELS SV+RIGGVGL
Sbjct  113  -----AHQDMGTSRSNHYTTQDNDDFITSESDRQQLLMRQQDEELDELSESVQRIGGVGL  167

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q++I+NDL  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  TIHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  216



>ref|NP_001045485.1| Os01g0963300 [Oryza sativa Japonica Group]
 dbj|BAD87234.1| putative syntaxin 6 [Oryza sativa Japonica Group]
 dbj|BAF07399.1| Os01g0963300 [Oryza sativa Japonica Group]
 dbj|BAG90468.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC72217.1| hypothetical protein OsI_05319 [Oryza sativa Indica Group]
 gb|EEE56055.1| hypothetical protein OsJ_04863 [Oryza sativa Japonica Group]
Length=234

 Score =   274 bits (701),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 173/229 (76%), Gaps = 16/229 (7%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQ+SID+L +TF +WE+ P N+GEH  L KEL  +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQDSIDKLQTTFHRWEKTPSNTGEHVHLTKELHTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTI +AS+DPA+YG++EVEL +RR W   AR QV  V+++V  G+ +S  S        
Sbjct  61   EKTILVASRDPAYYGLDEVELSRRRNWIGSARNQVAAVRRSVEKGKSNSTFS--------  112

Query  498  MNLPDPHQIV--DKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  HQ +   + N Y+  +NDD++A+ESD QLLL++QQD+ELDELS SV+RIGGVGL
Sbjct  113  -----AHQDMGTSRSNHYTAQDNDDFIASESDRQLLLMRQQDEELDELSESVQRIGGVGL  167

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q++I+NDL  EM++TS RLDFVQKRVAMVMKKA  KGQ M+
Sbjct  168  TIHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMVMKKAGIKGQIML  216



>ref|XP_010938949.1| PREDICTED: syntaxin-61-like [Elaeis guineensis]
Length=249

 Score =   274 bits (700),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 177/231 (77%), Gaps = 5/231 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M++AQDPFYIVK+EIQESID+L  +F +WE  P NSG+H  L K+LLA CESI WQVDEL
Sbjct  1    MTSAQDPFYIVKDEIQESIDKLHDSFHRWEETPANSGDHLLLTKQLLANCESIKWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSG---LSVIEMR  508
            DK I++A++DPAWYG+NEVEL KRRRWT+ A  QV +V+KAV  G++ S    L    M 
Sbjct  61   DKAIAVAARDPAWYGLNEVELEKRRRWTNIAHKQVDSVRKAVEDGRKKSNSVNLGPSGMH  120

Query  507  RELMNLPDPHQI-VDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            RELM LP  H     + N Y+  +NDD+++AESD Q+LLIKQQD ELD+LS SV+RIG V
Sbjct  121  RELMRLPIDHASQAGRSNNYAAEDNDDFISAESDRQMLLIKQQDQELDDLSISVQRIGDV  180

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTI++EL  Q++I++D+  E+++TS RL FVQK+VAMVMKKA  KGQ MM
Sbjct  181  GLTINEELIGQERILDDVSMEVETTSNRLGFVQKKVAMVMKKAGAKGQIMM  231



>ref|XP_008805690.1| PREDICTED: syntaxin-61-like isoform X1 [Phoenix dactylifera]
Length=250

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/232 (60%), Positives = 178/232 (77%), Gaps = 6/232 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQES-IDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDE  682
            M++AQDPFYIVK+EIQES ID+L  +FRQWE  P NSGEH  L K+LLA CESI WQVDE
Sbjct  1    MTSAQDPFYIVKDEIQESQIDKLHDSFRQWEETPYNSGEHLHLTKQLLANCESIKWQVDE  60

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSG---LSVIEM  511
            LDK I++A+ DPAWYG++EVEL KRRRWT+ A  QVG V+KA+  G++ S    L    M
Sbjct  61   LDKAIAVAASDPAWYGLDEVELEKRRRWTNIAHIQVGTVRKALEDGRKKSNSINLGPGGM  120

Query  510  RRELMNLPD-PHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
             REL+ LP+       + N Y+  +NDD+++AESD Q+LLIKQQD+ELD+LS SV+RIG 
Sbjct  121  HRELLRLPNVGFSQAGRSNNYAAEDNDDFISAESDRQMLLIKQQDEELDDLSVSVQRIGD  180

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTI++EL  Q++I++D+  +M++TS RL FVQK+VAMVMKKA  KGQ MM
Sbjct  181  VGLTINEELIGQERILDDMSVDMETTSNRLGFVQKKVAMVMKKAGAKGQIMM  232



>ref|XP_009406119.1| PREDICTED: syntaxin-61-like [Musa acuminata subsp. malaccensis]
Length=249

 Score =   270 bits (690),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/235 (59%), Positives = 181/235 (77%), Gaps = 13/235 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ A+DPFYIVKEEIQ SID+L ++FRQWE+   + GE  +L KELLA+CES+ WQVDEL
Sbjct  1    MTPARDPFYIVKEEIQGSIDKLQASFRQWEQTSLDIGERVRLTKELLASCESLDWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-------SV  520
            DK I++A+KDPA Y ++E ELGKRR+WTS AR QVG +++ +    E SG+       S+
Sbjct  61   DKAIAVAAKDPARYSLDETELGKRRKWTSIARKQVGTIRRTL----EESGVKGSSVTPSL  116

Query  519  IEMRRELMNLPDPHQIVDKPNKYSTA-NNDDYVAAESDTQLLLIKQQDDELDELSASVRR  343
              +R+ELM LP+ +      + Y+T+ ++DD++++ESD QLLLIKQQD+ELDELSASV R
Sbjct  117  NGVRQELMRLPNDYASKTGRSGYNTSQDDDDFISSESDRQLLLIKQQDEELDELSASVER  176

Query  342  IGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            IGG+GLTIHDEL  Q++I+ DL  EMD+TS RLDFVQK+VA+VMKKA  KGQ MM
Sbjct  177  IGGIGLTIHDELVGQERILGDLSLEMDTTSNRLDFVQKKVAVVMKKAGAKGQIMM  231



>gb|ABA91573.2| SNELIPTRC, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAH01230.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67745.1| hypothetical protein OsI_35257 [Oryza sativa Indica Group]
 gb|EEE51716.1| hypothetical protein OsJ_33101 [Oryza sativa Japonica Group]
Length=235

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 176/227 (78%), Gaps = 11/227 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M++AQDPFYIVK+EIQESI+++  T  QW++ P N+GEH  L KE++A+CESI WQV EL
Sbjct  1    MASAQDPFYIVKDEIQESIEKIQDTLHQWKQTPENTGEHVHLTKEIIASCESIQWQVVEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A +DPA+YG+NEVE+GKRR WTS AR QV ++++ V  G++ S           
Sbjct  61   EKAISVAERDPAYYGLNEVEIGKRRNWTSTARNQVVSIRRCVEAGKQKSAFG--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
             +  +P ++V +  ++   +NDD++A+ESD Q+LLIK+QD+ELDELSASV+RIGGVGLTI
Sbjct  113  -HSVNPSELV-RSKQHIAQDNDDFIASESDQQMLLIKRQDEELDELSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL  Q++++ +L  +M++T+ RLDFVQKRVAMV+KKAS KGQ MM
Sbjct  171  HDELVGQERLLGELSLDMETTTNRLDFVQKRVAMVLKKASLKGQIMM  217



>ref|XP_006662762.1| PREDICTED: syntaxin-61-like [Oryza brachyantha]
Length=235

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 177/227 (78%), Gaps = 11/227 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ AQDPFYIVK+EIQ+SIDR+  TF QW++ P N+GE+  L KEL+A+CESI WQV EL
Sbjct  1    MTPAQDPFYIVKDEIQDSIDRVQDTFHQWKQTPENTGEYVHLTKELIASCESIQWQVVEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A +DPA+YG+N+VE+GKRR WTS AR QV ++++ +  G++ +  S        
Sbjct  61   EKAISVAERDPAYYGLNDVEIGKRRNWTSTARNQVVSIRRYIETGKQKNAYS--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                +P ++V +  ++   +NDD++A+ESD Q+LLIK+QD+ELDELSASV+RIGGVGLTI
Sbjct  113  -RSANPSELV-RSKQHIAQDNDDFIASESDQQMLLIKRQDEELDELSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL  Q+K++++L  +M++TS RLDFVQKRVAMV+KKAS KGQ MM
Sbjct  171  HDELIGQEKLLDELSLDMETTSNRLDFVQKRVAMVLKKASLKGQIMM  217



>dbj|BAJ86239.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99537.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=235

 Score =   261 bits (666),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/227 (56%), Positives = 171/227 (75%), Gaps = 11/227 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ AQDPFYIVK+EIQ+SID++  TF QW++ P N+GE+  L +ELL  CES+ WQVDEL
Sbjct  1    MTPAQDPFYIVKDEIQDSIDKVQDTFNQWKQTPENTGEYVHLTRELLTTCESVQWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A +DPA+YG+NEVE+GKRR WTS AR+QV +V++ V  G+              
Sbjct  61   EKAISVAERDPAYYGLNEVEIGKRRNWTSTARSQVVSVRRNVEAGKHKGAFG------RS  114

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
             N P+    + +  ++   +NDD++A+ESD Q+LL+K+QDDELD LSASV+RIGGVGLTI
Sbjct  115  ANPPE----LGRSKQHIAQDNDDFIASESDQQMLLMKRQDDELDALSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q+K++ +L  +M++TS RLDFVQKRVAMV+KKAS KGQ MM
Sbjct  171  HEELVGQEKLLGELSLDMETTSNRLDFVQKRVAMVLKKASLKGQIMM  217



>ref|XP_002449051.1| hypothetical protein SORBIDRAFT_05g004120 [Sorghum bicolor]
 gb|EES08039.1| hypothetical protein SORBIDRAFT_05g004120 [Sorghum bicolor]
Length=235

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/227 (56%), Positives = 170/227 (75%), Gaps = 11/227 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ AQDPFYIVK+EIQ+SID++  TF QW++ P N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MTPAQDPFYIVKDEIQDSIDKVQDTFLQWKQTPENTGEYVHLTKELLTSCESIQWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A +DPA+YG+NE E+G+RR WTS AR QV  +K+ V  G++ S           
Sbjct  61   EKAISVAQRDPAYYGLNEAEIGRRRSWTSTARNQVLALKRNVEGGRQKSVFG--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                +P + + +  K    +ND+++A+ESD Q+LLIK+QD+ELD LSASV+RIGGVGLTI
Sbjct  113  -RSTNPSESI-RSKKNIVQDNDEFIASESDQQILLIKRQDEELDALSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL  Q+K++ +L  +M++T+ RLDFVQKRVAMVMKKAS KGQ MM
Sbjct  171  HDELVGQEKLLGELSLDMETTTNRLDFVQKRVAMVMKKASWKGQIMM  217



>ref|XP_002522503.1| syntaxin, putative [Ricinus communis]
 gb|EEF39803.1| syntaxin, putative [Ricinus communis]
Length=189

 Score =   253 bits (646),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 153/190 (81%), Gaps = 6/190 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQ-QLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQESID+LLSTF QWERI +  E Q  L KELLA+CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQESIDKLLSTFHQWERIFSDPEEQMHLTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSG---LSVIEMR  508
            DK I +A++DP+WYGI+E EL KRRRWT+ AR QVGNVKKA+  G+E++     SV  MR
Sbjct  61   DKAIGVAARDPSWYGIDEGELEKRRRWTNTARVQVGNVKKAIKTGKEANSNGTTSVNGMR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            REL+ L + HQ  DK N Y T +NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVG
Sbjct  121  RELLRLQNTHQ-TDKSNPY-TQDNDDFIQSESDRQLLLIKQQDEELDELSASVERIGGVG  178

Query  327  LTIHDELRAQ  298
            LTIH+EL AQ
Sbjct  179  LTIHEELLAQ  188



>ref|XP_004978775.1| PREDICTED: syntaxin-61-like [Setaria italica]
Length=235

 Score =   253 bits (647),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/227 (55%), Positives = 170/227 (75%), Gaps = 11/227 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ AQDPFYIVK+EIQ+SID++  TF QW++ P N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MTPAQDPFYIVKDEIQDSIDKVQDTFNQWKQTPENTGEYVHLTKELLTSCESIQWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A +DPA+YG+N+ E+ +RR WTS AR QV ++++ V  G++ +         E 
Sbjct  61   EKAISVAERDPAYYGLNDAEIRRRRSWTSTARNQVLSLRRNVEAGRQKTLFGHSTNASES  120

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            +          +  K+ + +ND+++A+ESD Q+LLIK+QD+ELD LSASV+RIGGVGLTI
Sbjct  121  I----------RSKKHISQDNDEFIASESDQQMLLIKRQDEELDALSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL  Q+K++ +L  +M++TS RLDFVQKRVAMVMKKAS KGQ MM
Sbjct  171  HDELVGQEKLLGELSLDMETTSNRLDFVQKRVAMVMKKASLKGQIMM  217



>gb|KGN46254.1| hypothetical protein Csa_6G078000 [Cucumis sativus]
Length=192

 Score =   251 bits (641),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 150/189 (79%), Gaps = 4/189 (2%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M +AQDPFY+VK+EIQESID+L S+F QWERI  +SGE  Q  KELLA+CESI WQVDEL
Sbjct  1    MPSAQDPFYVVKDEIQESIDKLQSSFHQWERISSDSGERVQQTKELLASCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
            DK I++A++DP+WYGI+  EL KRRRWTS ARTQVGNVKK V  G+E  G  S   MRRE
Sbjct  61   DKAIAVAARDPSWYGIDNAELEKRRRWTSTARTQVGNVKKVVGAGKEQIGTASASGMRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTAN-NDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
            LM LP+ H+  D+ N YS    NDD++ +ESD QLLLIKQQD+ELDELSASV RIGGVGL
Sbjct  121  LMRLPNAHE-TDRSNLYSAHQANDDFITSESDRQLLLIKQQDEELDELSASVERIGGVGL  179

Query  324  TIHDELRAQ  298
            TIH+EL AQ
Sbjct  180  TIHEELLAQ  188



>ref|XP_010912450.1| PREDICTED: syntaxin-61-like isoform X1 [Elaeis guineensis]
Length=254

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 164/209 (78%), Gaps = 2/209 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+  QDPFYIVKEEIQ+SID+L +TF QWE+ P ++GEH  L K++LA+CESI WQVDE+
Sbjct  1    MTPPQDPFYIVKEEIQDSIDKLRATFHQWEQTPLDTGEHVHLTKDVLASCESIEWQVDEM  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK I++A++DPAWYG++E+EL +RR+WTS A  QV  V++AV  G+  S  S+  M +EL
Sbjct  61   DKAIAVAARDPAWYGLDELELERRRKWTSTAHNQVATVRRAVEAGKGKSS-SINGMHQEL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LP  H      + +  A+NDD++++ESD QLLLIKQQD+ELDELS S++RIGGVGLTI
Sbjct  120  MRLPSDHASQAGRSNHFIADNDDFISSESDRQLLLIKQQDEELDELSDSIQRIGGVGLTI  179

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQ  232
            H+EL  Q++I+++L  EM++TS RLDFVQ
Sbjct  180  HEELVGQERILDELSMEMETTSNRLDFVQ  208



>emb|CDY35752.1| BnaC03g58730D [Brassica napus]
Length=427

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 172/228 (75%), Gaps = 10/228 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYI+KEEIQ+SID+L STF +WER+ P  G+   + KELLA C SI WQVDEL
Sbjct  1    MSSAQDPFYIIKEEIQDSIDKLQSTFHKWERVSPGMGDQVHVTKELLANCGSIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL-SVIEMRRE  502
             K +++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G+ S+G  +  E+RRE
Sbjct  61   GKAVAVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAGKGSAGAGNASEVRRE  120

Query  501  LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            LM +P+  +   + ++Y   ++D +V +ESD Q+LLIKQQD+ELDELS S       GL 
Sbjct  121  LMRMPNSSE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELDELSKS------WGL-  172

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            + DEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ MM
Sbjct  173  LPDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQMMM  220



>ref|XP_003577810.2| PREDICTED: 60S ribosomal protein L3-like [Brachypodium distachyon]
Length=651

 Score =   260 bits (664),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/229 (56%), Positives = 175/229 (76%), Gaps = 15/229 (7%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ AQDPFYIVK+EIQ+SID++  TF QW++ P N+GE+  L KEL+ +CES+ WQVDEL
Sbjct  1    MTPAQDPFYIVKDEIQDSIDKVQDTFHQWKQTPENTGEYVHLTKELVTSCESVQWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESS--GLSVIEMRR  505
            +K IS+A +DPA+YG+NEVE+GKRR WTS AR QV ++++ V  G+  +  G SV     
Sbjct  61   EKAISVAERDPAYYGLNEVEIGKRRNWTSSARNQVVSIRRNVEAGKHKTAFGRSV-----  115

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  +P +   +  ++ T +NDD++A+ESD Q+LL+K+QDDELD LSASV+RIGGVGL
Sbjct  116  ------NPSE-QSRSKQHITQDNDDFIASESDQQMLLMKRQDDELDALSASVQRIGGVGL  168

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q+K++ +L  +M++TS RLDFVQKRVAMV+KKAS KGQ MM
Sbjct  169  TIHEELIGQEKLLGELSLDMETTSNRLDFVQKRVAMVLKKASLKGQIMM  217



>gb|EMT10766.1| 60S ribosomal protein L3 [Aegilops tauschii]
Length=625

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/229 (56%), Positives = 174/229 (76%), Gaps = 15/229 (7%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+ AQDPFYIVK+EIQ+SID++  TF QW++ P N+GE+  L +ELL  CES+ WQVDEL
Sbjct  1    MTPAQDPFYIVKDEIQDSIDKVQDTFNQWKQAPENTGEYVHLTRELLTTCESVQWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESS--GLSVIEMRR  505
            +K IS+A +DPA+YG+NEVE+GKRR WTS AR QV ++++ V  G+  +  G SV     
Sbjct  61   EKAISVAERDPAYYGLNEVEIGKRRNWTSTARNQVVSIRRNVEAGKHKTAFGRSV-----  115

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  +P ++  +  ++   +NDD++A+ESD Q+LL+K+QDDELD LSASV+RIGGVGL
Sbjct  116  ------NPSEL-GRSKQHIAQDNDDFIASESDQQMLLMKRQDDELDALSASVQRIGGVGL  168

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TIH+EL  Q+K++ +L  +M++TS RLDFVQKRVAMV+KKAS KGQ MM
Sbjct  169  TIHEELVGQEKLLGELSLDMETTSNRLDFVQKRVAMVLKKASLKGQIMM  217



>gb|AAF16768.1|AC010155_21 F3M18.7 [Arabidopsis thaliana]
Length=241

 Score =   247 bits (631),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/232 (56%), Positives = 168/232 (72%), Gaps = 25/232 (11%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQES---------IDRLLSTFRQWERI-PNSGEHQQLVKELLAACE  706
            MS+AQDPFYIVKEEIQ+S         ID+L STF +WERI P+ G+   + KEL+A C 
Sbjct  1    MSSAQDPFYIVKEEIQDSVSCSEIARDIDKLQSTFHKWERISPDMGDQAHVAKELVATCG  60

Query  705  SISWQV-------------DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNV  565
            SI WQV             DEL+K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NV
Sbjct  61   SIEWQVLVFSHAVFTDRKVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNV  120

Query  564  KKAVIVGQESSGLS-VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIK  388
            K  V+ G+ SSG     E+RRELM +P+  +   + ++Y   ++D +V +ESD Q+LLIK
Sbjct  121  KSGVLAGKVSSGAGHASEVRRELMRMPNSGE-ASRYDQYGGRDDDGFVQSESDRQMLLIK  179

Query  387  QQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQ  232
            QQD+ELDELS SV+RIGGVGLTIHDEL AQ++II++L +EMDST  RL+FVQ
Sbjct  180  QQDEELDELSKSVQRIGGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQ  231



>gb|KHN38273.1| Syntaxin-61 [Glycine soja]
Length=218

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 159/245 (65%), Gaps = 64/245 (26%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQ-----  691
            M +AQDPFY+VK+EIQESID+L STF QWE   + GE   L KE+LA+CESI+WQ     
Sbjct  1    MPSAQDPFYVVKQEIQESIDKLKSTFHQWENTADVGERSSLSKEVLASCESIAWQSESGK  60

Query  690  --------------VDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV  553
                          VDELDK IS+A++DP+WYGI+EVE+  RR+WTSDARTQ        
Sbjct  61   QKPSYFQLHKHTLSVDELDKAISVAARDPSWYGIDEVEVENRRKWTSDARTQ--------  112

Query  552  IVGQESSGLSVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDE  373
                                                 +NDD++ +ESD Q+LLIK+QD+E
Sbjct  113  -------------------------------------DNDDFIESESDRQMLLIKRQDEE  135

Query  372  LDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPK  193
            LDELS SV+RIGGVGLTIH+EL AQ+KII++LG+EMD TS RLDFVQK+VAMVMKKAS K
Sbjct  136  LDELSLSVQRIGGVGLTIHEELLAQEKIIDELGNEMDGTSNRLDFVQKKVAMVMKKASAK  195

Query  192  GQFMM  178
            GQ MM
Sbjct  196  GQIMM  200



>ref|XP_009338701.1| PREDICTED: syntaxin-61-like isoform X2 [Pyrus x bretschneideri]
Length=210

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 143/172 (83%), Gaps = 1/172 (1%)
 Frame = -2

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
            +VDEL+K IS+A++DP WYGI+EVEL KRRRWTS AR QVG+VKKAV  G+ESSG S+  
Sbjct  22   KVDELNKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGSVKKAVEAGRESSGTSLNG  81

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            MRRELM + +  +  D+  +Y+  +NDD++ +ESD QLLLIKQQDDELDELSASV RIGG
Sbjct  82   MRRELMRMTNSQE-TDRSKQYAAQHNDDFITSESDRQLLLIKQQDDELDELSASVERIGG  140

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL AQ+KII++LG+EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  141  VGLTIHEELLAQEKIIDELGTEMDSTSNRLDFVQKKVATVMKKAGVKGQLMM  192



>gb|EMS53312.1| Syntaxin-61 [Triticum urartu]
Length=262

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 173/256 (68%), Gaps = 42/256 (16%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQES---------------------------IDRLLSTFRQWERIP  757
            M+ AQDPFYIVK+EIQ+S                           ID++  TF QW++ P
Sbjct  1    MTPAQDPFYIVKDEIQDSFLHFAIHESEMLRSSHDLRFFWLLRGPIDKVQDTFNQWKQAP  60

Query  756  -NSGEHQQLVKELLAACESISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDART  580
             N+GE+  L +ELL  CES+ WQVDEL+K IS+A +DPA+YG+NEVE+GKRR WTS AR 
Sbjct  61   ENTGEYVHLTRELLTTCESVQWQVDELEKAISVAERDPAYYGLNEVEIGKRRNWTSTARN  120

Query  579  QVGNVKKAVIVGQESS--GLSVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDT  406
            QV  +++ V  G+  +  G SV           +P ++  +  ++   +NDD++A+ESD 
Sbjct  121  QVVAIRRNVEAGKHKTAFGRSV-----------NPSEL-GRSKQHIAQDNDDFIASESDQ  168

Query  405  QLLLIKQQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKR  226
            Q+LL+K+QDDELD LSASV+RIGGVGLTIH+EL  Q+K++ +L  +M++TS RLDFVQKR
Sbjct  169  QMLLMKRQDDELDALSASVQRIGGVGLTIHEELVGQEKLLGELSLDMETTSNRLDFVQKR  228

Query  225  VAMVMKKASPKGQFMM  178
            VAMV+KKAS KGQ MM
Sbjct  229  VAMVLKKASLKGQIMM  244



>ref|XP_009360991.1| PREDICTED: syntaxin-61-like isoform X2 [Pyrus x bretschneideri]
Length=210

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 141/172 (82%), Gaps = 1/172 (1%)
 Frame = -2

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
            +VDELDK IS+A++DP WYGI+EVEL KRRRWTS AR QVG++KKAV  G+ESSG SV  
Sbjct  22   KVDELDKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGSLKKAVEAGKESSGTSVNG  81

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            MRRELM + +  +  ++ N Y   +NDD++ +ESD QLLLIKQQD+ELDELSASV RIGG
Sbjct  82   MRRELMRVANSQE-TERSNPYGAHHNDDFITSESDRQLLLIKQQDEELDELSASVERIGG  140

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL AQ+KII +LG+EMDSTS RLDFVQK+VA VMKKA  KGQ MM
Sbjct  141  VGLTIHEELLAQEKIIEELGTEMDSTSNRLDFVQKKVAAVMKKAGVKGQLMM  192



>gb|EPS61344.1| hypothetical protein M569_13452 [Genlisea aurea]
Length=189

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 153/190 (81%), Gaps = 6/190 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPN-SGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVKEEIQ+S+D+LLS+F QWER P  +GE  +L K++L+ CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKEEIQDSVDKLLSSFHQWERTPKEAGEQWRLSKDILSGCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS---VIEMR  508
            DKTI++A+K PA YGI+E EL +RRRWTS+ RTQ+ NVKK+V VG ES+G S   V  MR
Sbjct  61   DKTIAVAAKQPALYGIDEAELDRRRRWTSNTRTQIRNVKKSV-VGNESNGTSTSNVNGMR  119

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
            REL+ LP+  Q  DK N+Y   +NDD++++ESD QLLLI++QD+ELDELSASV RIG VG
Sbjct  120  RELLRLPNA-QSNDKSNQYLAQDNDDFISSESDRQLLLIRRQDEELDELSASVERIGDVG  178

Query  327  LTIHDELRAQ  298
            LTIH+EL A 
Sbjct  179  LTIHEELLAH  188



>ref|XP_008355340.1| PREDICTED: syntaxin-61-like, partial [Malus domestica]
Length=211

 Score =   237 bits (605),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 145/183 (79%), Gaps = 2/183 (1%)
 Frame = -2

Query  726  ELLAACESISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIV  547
            +LL  C  +  +VDELDK IS+A++DP WYGI+EVEL KRRRWTS AR QVG++KKAV  
Sbjct  13   QLLKGC-FLDRKVDELDKAISVAARDPTWYGIDEVELEKRRRWTSTARAQVGSLKKAVEA  71

Query  546  GQESSGLSVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            G++SSG SV  MRRELM + +  +  ++ N Y   +NDD++ +ESD QLLLIKQQD+ELD
Sbjct  72   GKDSSGTSVNGMRRELMRVANSQE-TERSNPYGAHHNDDFITSESDRQLLLIKQQDEELD  130

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
            ELSASV RIGGVGLTIH+EL AQ+KII +LG+EMD TS RLDFVQK+VA VMKKA  KGQ
Sbjct  131  ELSASVERIGGVGLTIHEELLAQEKIIEELGTEMDGTSNRLDFVQKKVAAVMKKAGVKGQ  190

Query  186  FMM  178
             MM
Sbjct  191  XMM  193



>gb|AAA33935.1| ORF [Senecio odorus]
Length=183

 Score =   236 bits (602),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 144/190 (76%), Gaps = 8/190 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIVK+EIQ+SID+L +TF QWE IP  SGE  +L KELL+ CESI WQVDEL
Sbjct  1    MSSAQDPFYIVKDEIQDSIDKLQATFHQWEHIPVASGEQSRLTKELLSNCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A++DP+ YGIN+    KRR+WTS AR QVGN+KKAV             MR+EL
Sbjct  61   EKAISVAARDPSLYGINQAACDKRRKWTSTARIQVGNIKKAVTASNFGG------MRQEL  114

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M +P  HQ      KY   +NDD++++ESDTQ+LLI+QQD+ELDEL+ASV RIG VGLTI
Sbjct  115  MRMPKSHQQTTN-GKYVAKDNDDFISSESDTQMLLIRQQDEELDELNASVERIGSVGLTI  173

Query  318  HDELRAQDKI  289
            HDEL AQD+I
Sbjct  174  HDELLAQDRI  183



>ref|XP_010912451.1| PREDICTED: syntaxin-61-like isoform X2 [Elaeis guineensis]
Length=248

 Score =   236 bits (602),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/209 (56%), Positives = 158/209 (76%), Gaps = 8/209 (4%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+  QDPFYIVKEEIQ+SID+L +TF QWE+ P ++GEH  L K++LA+CESI WQ    
Sbjct  1    MTPPQDPFYIVKEEIQDSIDKLRATFHQWEQTPLDTGEHVHLTKDVLASCESIEWQA---  57

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
               I++A++DPAWYG++E+EL +RR+WTS A  QV  V++AV  G+  S  S+  M +EL
Sbjct  58   ---IAVAARDPAWYGLDELELERRRKWTSTAHNQVATVRRAVEAGKGKSS-SINGMHQEL  113

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M LP  H      + +  A+NDD++++ESD QLLLIKQQD+ELDELS S++RIGGVGLTI
Sbjct  114  MRLPSDHASQAGRSNHFIADNDDFISSESDRQLLLIKQQDEELDELSDSIQRIGGVGLTI  173

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQ  232
            H+EL  Q++I+++L  EM++TS RLDFVQ
Sbjct  174  HEELVGQERILDELSMEMETTSNRLDFVQ  202



>gb|AAX92997.1| hypothetical protein LOC_Os11g06740 [Oryza sativa Japonica Group]
 gb|AAX96478.1| hypothetical protein [Oryza sativa Japonica Group]
Length=213

 Score =   231 bits (589),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 158/227 (70%), Gaps = 33/227 (15%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M++AQDPFYIVK+EIQESI+++  T  QW++ P N+GEH  L KE++A+CESI WQV EL
Sbjct  1    MASAQDPFYIVKDEIQESIEKIQDTLHQWKQTPENTGEHVHLTKEIIASCESIQWQVVEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +K IS+A +DPA+YG+NEVE+GKRR WTS AR QV ++++ V  G++ S           
Sbjct  61   EKAISVAERDPAYYGLNEVEIGKRRNWTSTARNQVVSIRRCVEAGKQKSAFG--------  112

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
             +  +P ++V +  ++   +NDD++A+ESD Q+LLIK+QD+ELDELSASV+RIGGVGLTI
Sbjct  113  -HSVNPSELV-RSKQHIAQDNDDFIASESDQQMLLIKRQDEELDELSASVQRIGGVGLTI  170

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            HDEL                        QKRVAMV+KKAS KGQ MM
Sbjct  171  HDELVG----------------------QKRVAMVLKKASLKGQIMM  195



>ref|XP_006595734.1| PREDICTED: syntaxin-61-like isoform X2 [Glycine max]
Length=210

 Score =   231 bits (588),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 2/172 (1%)
 Frame = -2

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
            +VDELDK IS+AS+DP+WYGI+EVE+  RR+WTSDARTQV   KKAV  G+  +  S+  
Sbjct  23   KVDELDKAISVASRDPSWYGIDEVEVENRRKWTSDARTQVSTAKKAVQAGKGLNNASLNG  82

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            M +ELM LP  HQ     N+Y+  +NDD++ +ESD Q+LLIK+QD+ELDELS SV+RIGG
Sbjct  83   MHKELMRLPSSHQTT--SNQYAAQDNDDFIESESDRQMLLIKRQDEELDELSLSVQRIGG  140

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL AQ+KII++LG+EMDSTS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  141  VGLTIHEELLAQEKIIDELGNEMDSTSNRLDFVQKKVAMVMKKASAKGQIMM  192



>ref|XP_006574424.1| PREDICTED: uncharacterized protein LOC100795447 isoform X1 [Glycine 
max]
Length=210

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 139/172 (81%), Gaps = 2/172 (1%)
 Frame = -2

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
            +VDELDK IS+A++DP+WYGI+EVE+  RR+WTSDARTQV   K+ V  G+ S+  S+  
Sbjct  23   KVDELDKAISVAARDPSWYGIDEVEVENRRKWTSDARTQVNKAKRTVEAGKGSNNASLSG  82

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            M RELM LP  HQ     N+Y+  +NDD++ +ESD Q+LLIK+QD+ELDELS SV+RIGG
Sbjct  83   MHRELMRLPSSHQTT--SNQYAAQDNDDFIESESDRQMLLIKRQDEELDELSLSVQRIGG  140

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            VGLTIH+EL AQ+KII++LG+EMD TS RLDFVQK+VAMVMKKAS KGQ MM
Sbjct  141  VGLTIHEELLAQEKIIDELGNEMDGTSNRLDFVQKKVAMVMKKASAKGQIMM  192



>ref|XP_008349937.1| PREDICTED: syntaxin-61-like, partial [Malus domestica]
Length=198

 Score =   221 bits (564),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 139/182 (76%), Gaps = 2/182 (1%)
 Frame = -2

Query  723  LLAACESISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVG  544
            LL AC  +  +VDEL+K IS+A++DP WYGI+EVEL KRRRWTS A  QVG+VKKAV  G
Sbjct  1    LLKAC-FLDRKVDELNKAISVAARDPTWYGIDEVELEKRRRWTSTAXAQVGSVKKAVEAG  59

Query  543  QESSGLSVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDE  364
            +ESSG SV  MRRELM L +  +  ++ N+Y+  +NDD++       +   +QQD+ELD+
Sbjct  60   KESSGTSVNGMRRELMRLTNSQE-TNRSNQYAAQHNDDFITXXXXXSIDACRQQDEELDQ  118

Query  363  LSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            LSASV RIGGVGLTIH+EL AQ+KII++LG+EMD TS RLDFVQK+VA VMKKA  KGQ 
Sbjct  119  LSASVERIGGVGLTIHEELLAQEKIIDELGTEMDGTSNRLDFVQKKVATVMKKAGVKGQL  178

Query  183  MM  178
            MM
Sbjct  179  MM  180



>dbj|BAJ88852.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=187

 Score =   219 bits (558),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 142/187 (76%), Gaps = 11/187 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+ QDPFYIV+EEIQ SI +L +TF +WE++  N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSPQDPFYIVREEIQGSIGKLQATFHRWEQVSSNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTIS+AS+DPA+YG++EVEL +RR WT  AR Q+G V++AV  G+ +  ++  +     
Sbjct  61   EKTISVASRDPAYYGLDEVELSRRRNWTGSARNQIGTVRRAVEKGKSNPAMARHQ-----  115

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                DP     + N YS+ +NDDY+A+ESD QLLL++QQDDELDELSASV+RIGGVGLTI
Sbjct  116  ----DP-MGTSRTNHYSSQDNDDYIASESDRQLLLMRQQDDELDELSASVQRIGGVGLTI  170

Query  318  HDELRAQ  298
            H+EL  Q
Sbjct  171  HEELSGQ  177



>ref|XP_010499380.1| PREDICTED: syntaxin-61 isoform X2 [Camelina sativa]
Length=206

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 147/186 (79%), Gaps = 3/186 (2%)
 Frame = -2

Query  729  KELLAACESISW-QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV  553
            + LL   E++S  +VDEL+K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V
Sbjct  4    RSLLLLVEALSGRKVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGV  63

Query  552  IVGQESSGLS-VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDD  376
            + G+ SSG     E+RRELM +P+ ++  ++ ++Y   ++D +V +ESD Q+LLIKQQD+
Sbjct  64   LAGKVSSGAGHASEVRRELMRMPNANE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDE  122

Query  375  ELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASP  196
            ELDELS SV+RIGGVGLTIHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  
Sbjct  123  ELDELSKSVQRIGGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGA  182

Query  195  KGQFMM  178
            KGQ MM
Sbjct  183  KGQMMM  188



>ref|NP_001031102.2| syntaxin-61 [Arabidopsis thaliana]
 gb|AEE30983.1| syntaxin-61 [Arabidopsis thaliana]
Length=206

 Score =   217 bits (553),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 145/186 (78%), Gaps = 3/186 (2%)
 Frame = -2

Query  729  KELLAACESISW-QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV  553
            + LL   E++S  +VDEL+K I++A+KDP+WYGI+E EL KRRRWTS+ARTQV NVK  V
Sbjct  4    RSLLLLVEALSGRKVDELEKAITVAAKDPSWYGIDEAELEKRRRWTSNARTQVRNVKSGV  63

Query  552  IVGQESSGLS-VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDD  376
            + G+ SSG     E+RRELM +P+  +   + ++Y   ++D +V +ESD Q+LLIKQQD+
Sbjct  64   LAGKVSSGAGHASEVRRELMRMPNSGE-ASRYDQYGGRDDDGFVQSESDRQMLLIKQQDE  122

Query  375  ELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASP  196
            ELDELS SV+RIGGVGLTIHDEL AQ++II++L +EMDST  RL+FVQK+V MVMKKA  
Sbjct  123  ELDELSKSVQRIGGVGLTIHDELVAQERIIDELDTEMDSTKNRLEFVQKKVGMVMKKAGA  182

Query  195  KGQFMM  178
            KGQ MM
Sbjct  183  KGQMMM  188



>ref|XP_009102902.1| PREDICTED: syntaxin-61-like isoform X2 [Brassica rapa]
Length=206

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 145/186 (78%), Gaps = 3/186 (2%)
 Frame = -2

Query  729  KELLAACESISW-QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV  553
            +  L   E++S  +VDEL+K +++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V
Sbjct  4    RSFLLTVEALSGRKVDELEKAVNVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGV  63

Query  552  IVGQESSGL-SVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDD  376
            + G+ S+G  +  E+RRELM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+
Sbjct  64   LAGKGSAGGGNASEVRRELMRMPNSSE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDE  122

Query  375  ELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASP  196
            ELDELS SV RIGGVGLTIHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  
Sbjct  123  ELDELSKSVERIGGVGLTIHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGA  182

Query  195  KGQFMM  178
            KGQ MM
Sbjct  183  KGQMMM  188



>ref|XP_006843554.1| hypothetical protein AMTR_s00007p00074210 [Amborella trichopoda]
 gb|ERN05229.1| hypothetical protein AMTR_s00007p00074210 [Amborella trichopoda]
Length=191

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/171 (60%), Positives = 131/171 (77%), Gaps = 0/171 (0%)
 Frame = -2

Query  690  VDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM  511
            VDELDK I++A++DP+WYGI+E EL KRRRWTS AR QV  V+KA+   +E + L    M
Sbjct  3    VDELDKAIAVAARDPSWYGIDEFELEKRRRWTSGARNQVATVRKALEAAKEKNSLGQNGM  62

Query  510  RRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            RRELM LP+ H             NDD++++ESD Q+LLIKQQD+ELDELSASV++IGG+
Sbjct  63   RRELMKLPNDHGAGRSSQYPDPQGNDDFISSESDRQVLLIKQQDEELDELSASVQKIGGI  122

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTIH+EL  Q+K+++DL SEMD T+ +LDFVQK+VAMVMKKA  KGQ MM
Sbjct  123  GLTIHEELMGQEKLLDDLNSEMDRTANKLDFVQKKVAMVMKKAGLKGQIMM  173



>gb|KHG24705.1| Syntaxin-61 -like protein [Gossypium arboreum]
Length=276

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 8/187 (4%)
 Frame = -2

Query  858  KMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDEL  679
            KMS A+DPFYIVKEEIQES   +         +P++GE   L KELLA CE I WQVDEL
Sbjct  95   KMSKARDPFYIVKEEIQESFSSMGKI------LPDTGEQVHLTKELLANCEIIEWQVDEL  148

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTI +A+ DP+WYGI+  EL  RRRWT  ARTQVG++KK+V+  +E +G S   MRREL
Sbjct  149  NKTIDVATIDPSWYGIDNRELESRRRWTITARTQVGDMKKSVVARKE-NGNSASAMRREL  207

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            M L   HQ  D+  +YS  +NDD++A++SD Q+LLIKQQD+ELDELSASV RIGGVGLTI
Sbjct  208  MKLLISHQ-SDRSYQYSAEDNDDFIASKSDRQMLLIKQQDEELDELSASVERIGGVGLTI  266

Query  318  HDELRAQ  298
            H+EL AQ
Sbjct  267  HEELLAQ  273



>ref|XP_009113654.1| PREDICTED: syntaxin-61-like isoform X3 [Brassica rapa]
Length=279

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 142/183 (78%), Gaps = 2/183 (1%)
 Frame = -2

Query  723  LLAACESISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVG  544
            LL    S   +VDEL+K I++A+KDPA YGI+E EL +RRRWTS+ARTQV NVK  V+ G
Sbjct  80   LLTVEASSGRKVDELEKAITVAAKDPALYGIDEAELERRRRWTSNARTQVRNVKTGVLAG  139

Query  543  QESSGL-SVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            + ++G+ +  E+R ELM +P+  +  ++ ++Y   ++D +V +ESD Q+LLIKQQD+ELD
Sbjct  140  KGNAGVGNASEVRLELMRMPNSSE-ANRYDQYGGRDDDGFVQSESDRQMLLIKQQDEELD  198

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
            ELS SV RIGGVGLTIHDEL AQ++II++LG+EMDST  RLDFVQK+V MVMKKA  KGQ
Sbjct  199  ELSKSVERIGGVGLTIHDELVAQERIIDELGTEMDSTKNRLDFVQKKVGMVMKKAGAKGQ  258

Query  186  FMM  178
             MM
Sbjct  259  MMM  261



>ref|XP_002987597.1| hypothetical protein SELMODRAFT_183263 [Selaginella moellendorffii]
 gb|EFJ11433.1| hypothetical protein SELMODRAFT_183263 [Selaginella moellendorffii]
Length=240

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 156/231 (68%), Gaps = 14/231 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWER-IPNSGEHQQLVKELLAACESISWQVDEL  679
            MSAA DPFY+VKEEI ES+ ++   F  WE+    + E   L ++LLA  ES+ WQV+EL
Sbjct  1    MSAA-DPFYLVKEEIDESVKKVEGNFETWEKQSTGASERASLKRDLLAGIESVEWQVNEL  59

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK I++A +DP+ +GI+  E+G+RR+W++     +  ++KA+  G+ S+  S    RREL
Sbjct  60   DKAIAVAERDPSRFGIDAAEIGRRRKWSTATHDTIDTIRKALHDGRTSNASST---RREL  116

Query  498  MNLPDPHQIVDKP----NKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            M + D     D+P    N+     NDD+++ ES+ Q L++K QD++LDE+SASV RIG V
Sbjct  117  MRMED-----DRPGPKANRSLMEGNDDFLSLESERQALILKDQDEDLDEISASVVRIGDV  171

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTIH+EL +Q+KI++DL  +MD T+ R++  QKR+A V+KKA  KGQ  +
Sbjct  172  GLTIHEELSSQEKIVSDLDKDMDGTANRMELAQKRLAHVLKKAGLKGQLCL  222



>ref|XP_002987656.1| hypothetical protein SELMODRAFT_126511 [Selaginella moellendorffii]
 gb|EFJ11231.1| hypothetical protein SELMODRAFT_126511 [Selaginella moellendorffii]
Length=240

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/231 (45%), Positives = 155/231 (67%), Gaps = 14/231 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWER-IPNSGEHQQLVKELLAACESISWQVDEL  679
            MSAA DPFY+VKEEI ES+ ++   F  WE+    + E   L ++LLA  ES+ WQV+EL
Sbjct  1    MSAA-DPFYLVKEEIDESVKKVEGNFETWEKQGTGASERASLKRDLLAGIESVEWQVNEL  59

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            DK I++A +DP+ +GI+  E+G+RR+W++     +  ++KA+  G+ S+  S    RREL
Sbjct  60   DKAIAVAERDPSRFGIDAAEIGRRRKWSTATHDTIDTIRKALHDGRTSNASST---RREL  116

Query  498  MNLPDPHQIVDKP----NKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            M + D     D+P    N+     NDD+++ ES+ Q L++K QD++LDE+SASV RIG V
Sbjct  117  MRMED-----DRPGPKANRSLMEGNDDFLSLESERQALILKDQDEDLDEISASVVRIGDV  171

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            GLTIH+EL  Q+KI++DL  +MD T+ R++  QKR+A V+KKA  KGQ  +
Sbjct  172  GLTIHEELSGQEKIVSDLDKDMDGTANRMELAQKRLAHVLKKAGLKGQLCL  222



>gb|KHG29550.1| Syntaxin-61 -like protein [Gossypium arboreum]
Length=193

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 143/193 (74%), Gaps = 6/193 (3%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDEL  679
            MS AQDPFYIVKEEIQESID+L S+F Q ERI P++ E   L KELLA CESI WQV EL
Sbjct  1    MSKAQDPFYIVKEEIQESIDKLQSSFHQLERILPDTREQVHLTKELLANCESIEWQVVEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            +KTI +A++DP+WYGI+  EL  RRRWT   RTQVG+VKK+V+  +E +G S   M REL
Sbjct  61   NKTIDVAARDPSWYGIDNRELESRRRWTITTRTQVGDVKKSVVARKE-NGNSESAMCREL  119

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLI---KQQDDELDELSASVRRIGGVG  328
            M LP  H+  D+  + S  +NDD++ +ESD Q+LLI   +QQD+ELDELSASV  I GVG
Sbjct  120  MKLPISHK-SDRSYQDSAEDNDDFIVSESDRQMLLINGSRQQDEELDELSASVEIIRGVG  178

Query  327  LTIHDELRAQDKI  289
            LTIH EL AQ +I
Sbjct  179  LTIHKELLAQCRI  191



>ref|XP_001764511.1| Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family [Physcomitrella patens]
 gb|EDQ70778.1| Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family [Physcomitrella patens]
Length=236

 Score =   189 bits (481),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 102/225 (45%), Positives = 152/225 (68%), Gaps = 11/225 (5%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG-EHQQLVKELLAACESISWQV-DELD  676
            +A DPFY+V+EE+Q+S+ +L  T  +WE++P+S  E   L KELL+ CESI WQV +ELD
Sbjct  2    SALDPFYLVREEVQDSVVKLQVTLGRWEQLPSSAAERIVLHKELLSGCESIEWQVVNELD  61

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
            + I +A +DPA + ++  E+ +R++WT+  R+QV  V   V+     +    I  RRELM
Sbjct  62   RAIGVAERDPARFSVDSAEIERRKKWTASTRSQVTTVLSVVVEKNTEASNGQIS-RRELM  120

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
             L + +Q         T+N+      ESD Q L++K+QD++LD+LSA+V R+G VGL+IH
Sbjct  121  RLENQYQ--------PTSNHGVDDVYESDRQALILKEQDEDLDDLSATVERLGDVGLSIH  172

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFM  181
            +EL  Q  ++++L ++MDST+ RLDFVQKR+A V+KKA  KGQ M
Sbjct  173  EELSVQGHLMDELTNDMDSTANRLDFVQKRIAGVLKKAGWKGQVM  217



>ref|XP_001762590.1| Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family [Physcomitrella patens]
 gb|EDQ72713.1| Qc-SNARE, SYP6/Tlg1p/Syntaxin 6 family [Physcomitrella patens]
Length=241

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/227 (41%), Positives = 146/227 (64%), Gaps = 8/227 (4%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVK-ELLAACESISWQVDELDK  673
            +A DPFY+VK+EIQ+++ +LLST  +WE++P S   + ++  E+L++CES+ WQVDELDK
Sbjct  2    SASDPFYLVKDEIQDTVTKLLSTLVRWEKLPTSSTERSVIGGEMLSSCESLEWQVDELDK  61

Query  672  TISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQ--ESSGLSVIEMRREL  499
              S+A KDPA + ++ VE+ +R+ WTS  R QV ++ + +       + G      R   
Sbjct  62   ATSVAEKDPARFKLDAVEIKRRKSWTSSTRNQVHSITEKLQSKSLTNAGGADAPTSRPGF  121

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
            + + D  Q    P +   +N D ++A ESD Q LL+++QD+ LD+LSAS+  +G VG++I
Sbjct  122  LRIDD--QFQQAPTR---SNYDSHIANESDRQELLLREQDEGLDDLSASLTHVGHVGVSI  176

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            H+EL  Q +++     + D T++RLD VQK++A VMK A  KGQ  M
Sbjct  177  HEELSLQGQLMEKFSEDTDGTASRLDVVQKKLATVMKMAGWKGQVFM  223



>ref|XP_002973834.1| hypothetical protein SELMODRAFT_100026 [Selaginella moellendorffii]
 gb|EFJ24789.1| hypothetical protein SELMODRAFT_100026 [Selaginella moellendorffii]
Length=241

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 146/224 (65%), Gaps = 4/224 (2%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELDKT  670
            +AQDPFY +K+++ E +  L S++ +W+ +P S E   + K+L+  C SI  QVDELD+ 
Sbjct  4    SAQDPFYYIKDQLDELVGGLNSSYLRWQGLPASLERDGIAKQLVEKCGSIERQVDELDRA  63

Query  669  ISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNL  490
            I++A ++PA + +   E+ +RRRWT+  R+++G +K A     + +  +   M       
Sbjct  64   ITVAERNPAKFRVGPAEIEQRRRWTTQTRSKIGGIKAAAQDAVQKA-QAAAPMGGARFGA  122

Query  489  PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDE  310
            P P Q   K     + +NDDY+A+ESD Q LL+++QD +LD++S S+ +IGGVG TIH+E
Sbjct  123  PPPTQ---KQGPDYSQHNDDYIASESDRQSLLMREQDQDLDDISTSLEKIGGVGATIHEE  179

Query  309  LRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            L  Q+ +I++L  ++DSTS++L +VQK++  V++KA  KGQ  M
Sbjct  180  LSQQEGMIDELQHDVDSTSSKLAYVQKKLEHVIRKAGSKGQLAM  223



>gb|ACU22916.1| unknown [Glycine max]
Length=150

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 107/133 (80%), Gaps = 4/133 (3%)
 Frame = -2

Query  567  VKKAVIVGQESSGLS---VIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLL  397
            +KKAV  G+ SS  S   V  MRRELM LP+ HQ  D  N+Y+  +NDD++ +ESD Q L
Sbjct  1    MKKAVESGKGSSTTSHASVNGMRRELMRLPNSHQ-TDSSNQYAARDNDDFILSESDRQTL  59

Query  396  LIKQQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAM  217
            LIK+QD+ELDELS SVRRIGGVGLTIHDEL AQ+KI+++LGSEMDST+ RLDFVQK+VAM
Sbjct  60   LIKRQDEELDELSESVRRIGGVGLTIHDELTAQEKILDELGSEMDSTTNRLDFVQKKVAM  119

Query  216  VMKKASPKGQFMM  178
            VMKKAS KGQ MM
Sbjct  120  VMKKASAKGQIMM  132



>ref|XP_008385968.1| PREDICTED: syntaxin-61 [Malus domestica]
Length=182

 Score =   174 bits (440),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 107/132 (81%), Gaps = 1/132 (1%)
 Frame = -2

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
            +VDEL+K IS+A++DP WYGI+EVEL KRRRWTS A  QVG+VKK V  G+ESSG SV  
Sbjct  22   KVDELNKAISVAARDPTWYGIDEVELEKRRRWTSTAXAQVGSVKKXVEAGKESSGTSVNG  81

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
            MRRELM L +  Q  ++ N+Y+  +NDD++ +ESD QLLLIKQQD+ELD+LSASV RIGG
Sbjct  82   MRRELMRLTN-SQETNRSNQYAAQHNDDFITSESDRQLLLIKQQDEELDQLSASVERIGG  140

Query  333  VGLTIHDELRAQ  298
            VGLTIH+EL AQ
Sbjct  141  VGLTIHEELLAQ  152



>ref|XP_002504052.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO65310.1| predicted protein [Micromonas sp. RCC299]
Length=236

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/229 (36%), Positives = 139/229 (61%), Gaps = 13/229 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M    DPFY+VK+EIQ ++D++     + ER+P  + E Q+   ++ + CES+ WQ++EL
Sbjct  1    MGDVNDPFYLVKDEIQATVDKVRGVLERMERLPEGNSERQRYASQITSECESVQWQLEEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM--RR  505
            D+  ++A +D   + ++  EL  R+RWT+  ++ V N ++A          SV++   RR
Sbjct  61   DRATAMAEQDFMRFKVDANELASRKRWTAATKSTVANAERA--------ARSVLDAAKRR  112

Query  504  ELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGL  325
                  DP          + AN DDY+  E+D Q LL+++QD +LD++SAS++R+G VGL
Sbjct  113  GPAGF-DPSNASGYDQGIAAAN-DDYLNREADNQQLLMRKQDADLDDISASIQRLGQVGL  170

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            TI +EL  Q K+I++L  ++D T++RL   Q+++  V+KKA  KGQ  +
Sbjct  171  TIGEELETQGKMIDELEQDVDGTNSRLAAAQRKMNQVLKKAGVKGQMCI  219



>ref|XP_005646595.1| hypothetical protein COCSUDRAFT_53946 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22051.1| hypothetical protein COCSUDRAFT_53946 [Coccomyxa subellipsoidea 
C-169]
Length=237

 Score =   145 bits (367),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 78/222 (35%), Positives = 130/222 (59%), Gaps = 12/222 (5%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERIPNSG-EHQQLVKELLAACESISWQVDELDKTIS  664
            DPFY+VK++IQ S+++  S   +W+ +  +  + ++L  E+   C+SI+WQVDE++K + 
Sbjct  10   DPFYLVKDDIQASLEKAKSQHARWQSLGKTNPDKKRLESEIEDECKSIAWQVDEMEKAVD  69

Query  663  IASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNLPD  484
            +A K+ A +G+++ E+  RR+W    R Q   V ++ +  Q S  LSV           D
Sbjct  70   VAEKNMARFGLSQAEISGRRKWVLQTRRQCEGVMRS-LEAQHSVSLSV----------GD  118

Query  483  PHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDELR  304
            P     K        ND Y+ +E D Q LL++QQDDELD+L   V ++GG+G  IH EL 
Sbjct  119  PGTPTGKLGSAIGLENDRYINSEGDRQQLLLRQQDDELDQLGQHVEKLGGLGREIHGELE  178

Query  303  AQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            +Q +++++L  E+++T  RL   QK++  V+KK   +GQ  +
Sbjct  179  SQSRMLDELDEEVETTHHRLAAAQKKMNNVLKKMGMRGQLCL  220



>ref|XP_003059590.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56722.1| predicted protein [Micromonas pusilla CCMP1545]
Length=239

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/230 (36%), Positives = 139/230 (60%), Gaps = 12/230 (5%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+A DPFY+VKEEIQES++++ +   + +R+P  +GE  +      + CES+ WQ+DEL
Sbjct  1    MSSANDPFYLVKEEIQESVNKVKALCDRVDRLPEGNGERVRYATSAKSECESVFWQLDEL  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE-  502
            D+  ++A +D A + ++  EL  R+RWT+           A  +  +++G  VIE R+  
Sbjct  61   DRATAMAERDFARFKVDASELTSRKRWTAAT------KATASALCDKANG--VIEARKRR  112

Query  501  --LMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVG  328
                +            +   A ND Y+ A+SD Q  L+++QD +LD++SAS+ RIG VG
Sbjct  113  GAGYHGGGGGDDDAASRQQQRAANDGYLEAQSDQQQTLLRRQDVDLDDISASISRIGQVG  172

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            LTI +EL  Q ++++DL ++++ T++RL   Q+++  V+KKA  +GQ  +
Sbjct  173  LTIGEELDTQGRMLDDLETDVEGTNSRLRAAQRKMNQVLKKAGVRGQMCI  222



>ref|NP_001065843.2| Os11g0168100 [Oryza sativa Japonica Group]
 dbj|BAF27688.2| Os11g0168100, partial [Oryza sativa Japonica Group]
Length=141

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 87/103 (84%), Gaps = 1/103 (1%)
 Frame = -2

Query  486  DPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDEL  307
            +P ++V +  ++   +NDD++A+ESD Q+LLIK+QD+ELDELSASV+RIGGVGLTIHDEL
Sbjct  22   NPSELV-RSKQHIAQDNDDFIASESDQQMLLIKRQDEELDELSASVQRIGGVGLTIHDEL  80

Query  306  RAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
              Q++++ +L  +M++T+ RLDFVQKRVAMV+KKAS KGQ MM
Sbjct  81   VGQERLLGELSLDMETTTNRLDFVQKRVAMVLKKASLKGQIMM  123



>ref|XP_006590063.1| PREDICTED: syntaxin-61-like [Glycine max]
Length=93

 Score =   129 bits (323),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 75/93 (81%), Gaps = 0/93 (0%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELD  676
            M +AQDPFYIVK+EIQESID+L STF QWE+  N+GE   L K++L +CE+I WQV+ LD
Sbjct  1    MPSAQDPFYIVKQEIQESIDKLQSTFPQWEKTANAGEQSNLSKKVLDSCENIEWQVNGLD  60

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQ  577
            K I +AS+DP+WYGI+ VE+  RR+WTSDA T+
Sbjct  61   KAIFVASRDPSWYGIDGVEVENRRKWTSDAGTR  93



>ref|XP_005852077.1| hypothetical protein CHLNCDRAFT_18657 [Chlorella variabilis]
 gb|EFN59975.1| hypothetical protein CHLNCDRAFT_18657 [Chlorella variabilis]
Length=232

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/226 (33%), Positives = 127/226 (56%), Gaps = 18/226 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPN-SGEHQQLVKELLAACESISWQVDELDK  673
             ++DP+YIVK+E+ E++  + + F +W+ +P  S E + L +EL   C+S+ + V E+DK
Sbjct  2    GSRDPYYIVKDEVGETLRGVQAKFGKWQNMPRMSAEKKALQQELEEDCQSLEYMVAEIDK  61

Query  672  TISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMN  493
            +I  A ++P  + +++ EL  RR+W    R Q+ ++         SSGLS          
Sbjct  62   SIDAAERNPQRFNLSQAELSDRRKWVMSTRRQMSSM---------SSGLSAPASGGGGQA  112

Query  492  LPDPHQIVDKPNKYSTA---NNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
             P          + + A    ND ++ +E D Q L++++QD++LD LS  V RIG +G  
Sbjct  113  TP-----TTASGRLAAAVQEENDRFIHSEGDRQQLMMQRQDEDLDHLSHHVLRIGELGKE  167

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  EL  Q +++++L  E++ TSTR+   QK+V  V++KA  KGQ 
Sbjct  168  MGQELHVQGQLLDELDQEVEGTSTRIAAAQKKVEYVLQKAGSKGQL  213



>gb|ACG36700.1| hypothetical protein [Zea mays]
Length=92

 Score =   119 bits (298),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            MS+AQDPFYIV+EEIQESID+L S F +WE+   N+GE+  L KELL +CESI WQVDEL
Sbjct  1    MSSAQDPFYIVREEIQESIDKLQSNFHRWEQTASNTGEYVHLTKELLTSCESIEWQVDEL  60

Query  678  DKTISIASKDPAWYGINEVEL  616
            +KTIS+AS+DP++YG++EVE+
Sbjct  61   EKTISVASRDPSYYGLDEVEI  81



>ref|XP_002946496.1| Qc-SNARE, Tlg1/Syntaxin 6-family [Volvox carteri f. nagariensis]
 gb|EFJ52423.1| Qc-SNARE, Tlg1/Syntaxin 6-family [Volvox carteri f. nagariensis]
Length=225

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 122/221 (55%), Gaps = 19/221 (9%)
 Frame = -2

Query  846  AQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSGEHQQLVKELLAACESISWQVDELDKT  670
            +QDPFY++++EIQ++++ L     ++  +   + E +++ + +   C S++WQ++ELD  
Sbjct  3    SQDPFYLIRQEIQDTVNELQQRMSRFHGLQATNPERKKIAQSVEEGCNSLAWQLNELDTA  62

Query  669  ISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNL  490
            +  AS++P  + +   EL  RRRW S+ R QV  +K  +               R     
Sbjct  63   VDRASENPQRFNLTPEELSSRRRWISNTRRQVEGMKDTL---------------RTATAP  107

Query  489  PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDE  310
            P P   V      + A ND +++ + + Q L++K+QD +L+++  +V RIG  G  I +E
Sbjct  108  PPP---VSAAETKAVAANDKFLSGQYENQQLMLKRQDQDLEDIEQAVIRIGRQGREIGNE  164

Query  309  LRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
            L AQD ++N+L  ++D+T + L   QK++  +++K+    Q
Sbjct  165  LAAQDILLNELEQDVDTTHSTLKAAQKKMQELIRKSGSNTQ  205



>gb|AFW89304.1| hypothetical protein ZEAMMB73_776234 [Zea mays]
Length=90

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/72 (71%), Positives = 63/72 (88%), Gaps = 0/72 (0%)
 Frame = -2

Query  393  IKQQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMV  214
            ++QQD+ELDELS SV+RIGGVGLTIH+EL  Q++I+NDL  EM++TS RLDFVQKRVAMV
Sbjct  1    MRQQDEELDELSESVQRIGGVGLTIHEELSGQERILNDLSLEMETTSNRLDFVQKRVAMV  60

Query  213  MKKASPKGQFMM  178
            +KKA  KGQ M+
Sbjct  61   IKKAGIKGQIML  72



>ref|XP_005705505.1| syntaxin 6 [Galdieria sulphuraria]
 gb|EME28985.1| syntaxin 6 [Galdieria sulphuraria]
Length=260

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 134/242 (55%), Gaps = 20/242 (8%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQ---LVKELLAACESISW  694
            + + QDPFY+V+++++ES+  +   F+QW+R+    N+  +++   L  +L  +  S+  
Sbjct  5    LPSKQDPFYVVRDQVKESLVSIREIFQQWKRLIFTTNTATNEEFDLLHNQLQNSLRSVYL  64

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
             + EL KT+ +  ++P  + ++E+E+  R+R+ SD   ++  +K  +   Q    L  +E
Sbjct  65   DLQELQKTVHVVERNPVKFHLSELEIDSRKRFVSDTMKELETIKSTL---QSPRTLQKLE  121

Query  513  MRRELMN-----LPDPHQIVDKPNKYSTANN-----DDYVAAESDTQLLLIKQQDDELDE  364
              R+  +     L   + + +   K   A N     D Y+  E+  Q  LI+QQD  LDE
Sbjct  122  EDRKKSSSGGSLLVKKNLVYEDERKSRAARNMERLNDQYIQDEALRQENLIEQQDSSLDE  181

Query  363  LSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            L+++V RIG +G  IH+EL   ++++ ++G   DST  RL  +Q R++ ++++   +GQF
Sbjct  182  LASAVIRIGNMGKEIHEELNEHNRMLEEVGGRFDSTQGRLQLLQGRISRLVRETG-RGQF  240

Query  183  MM  178
             +
Sbjct  241  CL  242



>ref|XP_001695523.1| Qc-SNARE protein, Tlg1/Syntaxin 6-family [Chlamydomonas reinhardtii]
 gb|AAM12662.1|AF404746_1 syntaxin 6 [Chlamydomonas reinhardtii]
 gb|EDP01781.1| Qc-SNARE protein, Tlg1/Syntaxin 6-family [Chlamydomonas reinhardtii]
Length=225

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 120/221 (54%), Gaps = 19/221 (9%)
 Frame = -2

Query  846  AQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG-EHQQLVKELLAACESISWQVDELDKT  670
            + DPFY++++EIQ+S++ L     ++  +  +  E +++ + +   C S+SWQ++ELD  
Sbjct  3    SNDPFYLIRQEIQDSVNELQQRMSRFHGLTATNPERKKIAQTVEEGCGSLSWQLNELDTA  62

Query  669  ISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNL  490
            +  AS++P  + +   EL  RRRW ++ R Q+  +K                    L   
Sbjct  63   VDRASENPQRFNLTPEELSSRRRWITNTRRQLDGMKDT------------------LRTA  104

Query  489  PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDE  310
              P   V      + A ND ++  + ++Q L++K+QD +L+++  +V RIG  G  I +E
Sbjct  105  TAPAPAVSAAESKAIAQNDKFLTGQYESQQLVMKRQDQDLEDIEQAVIRIGRQGREIGNE  164

Query  309  LRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
            L  Q++++++L  ++D+T +RL   QK++  +++K+    Q
Sbjct  165  LAEQERMLDELDQDVDTTHSRLKAAQKKMQELIRKSGSNTQ  205



>gb|KFM24618.1| Syntaxin-61 [Auxenochlorella protothecoides]
Length=232

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/227 (28%), Positives = 120/227 (53%), Gaps = 13/227 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQ-LVKELLAACESISWQVDEL  679
            M+  QDP++IV+ ++ +++  + + + Q   +P +  +++ L++EL   C S+ + V E+
Sbjct  1    MAGQQDPYFIVQRDVNDTLSSVQTRYTQLRSLPAAHSNRKPLLEELQEDCSSLEYMVSEI  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            ++++  A  +PA + +++ EL  RRRW   AR Q   + +         GL+      + 
Sbjct  61   ERSLDAAEANPARFRLSQAELSDRRRWAISARRQTSVLNE---------GLAAARTAADA  111

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                 P     K        ND ++A+E+D Q  L+ +QD++LD L   V RIG +G  +
Sbjct  112  APRLTP---ASKLAAAVHEENDRFIASEADRQQALMSRQDEDLDVLGGHVVRIGELGREM  168

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
              EL  Q +++++   E++ TSTRL   QK++  V+ +   KGQ  +
Sbjct  169  GQELHMQGQLLDEFDEELEGTSTRLAAAQKKIQAVLDRTGSKGQLAI  215



>emb|CEF99213.1| Syntaxin 6, N-terminal [Ostreococcus tauri]
Length=230

 Score =   104 bits (260),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 73/224 (33%), Positives = 120/224 (54%), Gaps = 18/224 (8%)
 Frame = -2

Query  846  AQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAA-CESISWQVDELDKT  670
            A DP+Y+V++E+    DR +   RQ     + G +   + EL+    E   W++DELD+ 
Sbjct  5    AADPYYVVRDEL----DRRVDALRQRCAETSGGGNASALTELMRQDAEGALWELDELDRA  60

Query  669  ISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNL  490
             + ASKD A YG+   EL +R RW++  R +V  V    I  + + G       R   + 
Sbjct  61   TTTASKDLARYGLTREELEERWRWSARERERVREVMS--IAARRAGGTGGT---RTADDA  115

Query  489  PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDE  310
             D  +  D  +  +    DD+       Q LL+++QD++LD++SAS+ RIG VGLTI +E
Sbjct  116  GDATR-RDVESGRTERGFDDH-------QQLLVRRQDEDLDDISASISRIGQVGLTIGEE  167

Query  309  LRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            L +Q K++ +L  ++D    RL   + ++  V+KKA  +GQ  +
Sbjct  168  LASQSKMLEELDEDVDGVQARLKAAELKMRDVLKKAGLRGQLCV  211



>ref|XP_001419650.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97943.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=232

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 117/227 (52%), Gaps = 25/227 (11%)
 Frame = -2

Query  846  AQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAA-CESISWQVDELDKT  670
            A DP+Y+V++EI   +D L        R   SG     V   L    ES  W++DELD+ 
Sbjct  10   ANDPYYVVRDEIARHVDDLA-------RRARSGAASATVSAALERDIESARWELDELDRA  62

Query  669  ISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNL  490
            I++A ++ A Y ++  E+ +R+RW++ AR  V           E+   +    R    N 
Sbjct  63   IAVAERESARYKLDAREIDERKRWSARAREAV----------DEAMATTRARARAGRANG  112

Query  489  PDPHQIVDKPNKYSTANNDDYVAAES---DTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
                      N  +T    D    E+   D Q LL+++QD++LD++SAS+ RIG VGLTI
Sbjct  113  DGDGD----ANGTTTRTAGDAGVGEAGFDDHQQLLVRRQDEDLDDISASITRIGQVGLTI  168

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
             +EL +Q K++ DL  ++D  + RL   ++++  V+KK   +GQ  +
Sbjct  169  GEELASQSKMLEDLDEDVDGVNARLAAAERKMRDVLKKVGLRGQLCV  215



>gb|ELT91978.1| hypothetical protein CAPTEDRAFT_183705 [Capitella teleta]
Length=260

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/241 (28%), Positives = 130/241 (54%), Gaps = 19/241 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPN---SGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK+E+Q+++      +++W  + +   S   ++L     EL  +  SI W V
Sbjct  2    SLEDPFFVVKDEVQKAVQTARGLYQRWCELIDESVSCSREELDWTTNELRNSIRSIEWDV  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++L++TISI  K+P  + I++ EL  RR +    +  V  +K+ +   Q     + + + 
Sbjct  62   EDLEETISIVEKNPRKFKIDDGELSDRRAFIDRTKMTVKEMKEHLANPQAHCSRNSM-VH  120

Query  507  RELMNLPDPHQIV-----DKP-NKYS------TANNDDYVAAESDTQLLLIKQQDDELDE  364
             E    P PHQ +      KP NKY+       A+N+ ++      Q L+I+ QD++L+ 
Sbjct  121  SESDERPSPHQALLNNGPSKPQNKYTRLENEIEASNEHFIQDTHGQQQLMIRAQDEQLEN  180

Query  363  LSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            + ASV  +  +   + +EL  Q  +++D   EMD+T T++D V K++A V+  ++ + Q+
Sbjct  181  VGASVGVLKNISQQVGNELDEQAVMLDDFAHEMDNTETKMDNVMKKIAKVLHMSNDRRQW  240

Query  183  M  181
            +
Sbjct  241  I  241



>ref|XP_005991139.1| PREDICTED: syntaxin-6-like isoform X5 [Latimeria chalumnae]
Length=255

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 125/236 (53%), Gaps = 13/236 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISW  694
            MS+ +DPF++VK E+Q++++     F++W  +   PN+   +++     EL  +  SI W
Sbjct  1    MSSMEDPFFVVKGEVQKAVNTAQGLFQRWMELLQDPNAATKEEIDWTTNELRNSLRSIEW  60

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE  514
             +++LD+TISI   +P  + ++ +EL KR+ + +  R  V  +K   +    +  L+  +
Sbjct  61   DLEDLDETISIVEANPRKFNLDPIELSKRKAFITGTRQTVKEMKDQ-MSSPSAQALAERK  119

Query  513  MRRELMNLPDPHQIVDKPNKYS------TANNDDYVAAESDTQLLLIKQQDDELDELSAS  352
             R+ L+            NKYS       + N  ++  +   Q L+ +QQD++L+ +S S
Sbjct  120  SRQVLLGDSGSQGWGPSTNKYSRLDRELQSANSHFIEDQQTQQQLIAEQQDEQLELVSGS  179

Query  351  VRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +  +   I +EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  180  IGVLKNMSQRIGNELDEQAVMLDDFSQELDSTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_007510834.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18367.1| predicted protein [Bathycoccus prasinos]
Length=251

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 114/226 (50%), Gaps = 23/226 (10%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELDKTISI  661
            DPFY+V+EEI +S+    S+F +   +    + ++    + +  +S+ WQ++ELD+    
Sbjct  21   DPFYLVREEISDSVSTCESSFSRIHNLQTLTQKKETCINISSEIDSLLWQLNELDRATEA  80

Query  660  ASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNLPDP  481
            A +DP  + ++  EL +R+ WTS  R +                L+V++ R E M +   
Sbjct  81   AERDPNRFRVSREELERRKAWTSQTRER----------------LNVLKGRVENMMMNSS  124

Query  480  HQIVDKPNKYSTANN------DDYVAA-ESDTQLLLIKQQDDELDELSASVRRIGGVGLT  322
            + +  + N+  +  +      DDY+ + E  TQ  L   QD++L++LS  +R IG VG T
Sbjct  125  NSLNSEQNRVKSVLDQNRNTIDDYMLSDERATQDQLFANQDEQLEDLSHHIRTIGNVGKT  184

Query  321  IHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            I +EL  Q +++ DL  E +    R+    + +  V KKA  + Q 
Sbjct  185  IGEELEQQGRMLEDLEEETEGVRARMQAANQMMIHVFKKAGVRAQL  230



>ref|XP_005098867.1| PREDICTED: syntaxin-6-like [Aplysia californica]
Length=251

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 124/231 (54%), Gaps = 10/231 (4%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI-PNSG-----EHQQLVKELLAACESISWQV  688
            + +DPF++VKEE+Q+++  + + F +W  +  N+G     E +    EL  +  SI W +
Sbjct  2    SVEDPFFVVKEEVQKALGVVRNLFTRWRDLQENAGATSKEELEYTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++L++T+ I  K+P  + I+E EL +RR +    +T V ++K + I    +        R
Sbjct  62   EDLEETVGIVEKNPRKFKISEYELQERRNFVEKTKTTVRDMK-SQISSPGNRQRDDASFR  120

Query  507  RELMNLPDPHQIVDKPNKYST---ANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
            + LM    P    DK  +      + N  +++     Q +LI+ QDD+LD + +SV  + 
Sbjct  121  QSLMAANGPKTPQDKYKRLDEEMESANQRFISDSQQQQQMLIRNQDDQLDMIGSSVGVLK  180

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +   I +EL  Q+ ++++   EMD+T T++D   K++A V+  ++ + Q+
Sbjct  181  NMSQQIGNELEDQNLMLDEFHHEMDNTETKMDQTMKKMAKVLHMSNDRRQW  231



>ref|XP_003219900.1| PREDICTED: syntaxin-6 [Anolis carolinensis]
Length=254

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 123/234 (53%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGVRKAFITSTRQVVRDMKDQ-MSNTSVQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+     H      +KYS  +      N +++  +   Q L+I+QQD++L+ +S S+ 
Sbjct  121  QVLLGESGTHGWSSGADKYSRLDREMQSVNSNFIEDQQVQQQLIIEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   EMDST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELDEQAVMLDDFAHEMDSTQSRLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_003081394.1| syntaxin 6 (ISS) [Ostreococcus tauri]
Length=522

 Score =   100 bits (249),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 71/227 (31%), Positives = 115/227 (51%), Gaps = 28/227 (12%)
 Frame = -2

Query  846  AQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAA-CESISWQVDELDKT  670
            A DP+Y+V++E+    DR +   RQ     + G +   + EL+    E   W++DELD+ 
Sbjct  84   AADPYYVVRDEL----DRRVDALRQRCAETSGGGNASALTELMRQDAEGALWELDELDRA  139

Query  669  ISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELMNL  490
             + ASKD A YG+   EL +R RW++  R +V  V    I  + + G             
Sbjct  140  TTTASKDLARYGLTREELEERWRWSARERERVREVMS--IAARRAGGTGGTRT-------  190

Query  489  PDPHQIVDKPNKYSTANNDDYVAAES-----DTQLLLIKQQDDELDELSASVRRIGGVGL  325
                      +    A   D  +  +     D Q LL+++QD++LD++SAS+ RIG VGL
Sbjct  191  ---------ADDAGDATRRDVESGRTERGFDDHQQLLVRRQDEDLDDISASISRIGQVGL  241

Query  324  TIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            TI +EL +Q K++ +L  ++D    RL   + ++  V+KKA  +GQ 
Sbjct  242  TIGEELASQSKMLEELDEDVDGVQARLKAAELKMRDVLKKAGLRGQL  288



>ref|XP_010714078.1| PREDICTED: syntaxin-6 [Meleagris gallopavo]
Length=254

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 120/234 (51%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGIRKSFITSTR-QVVREMKDQMSNSSMQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+           P+KYS  +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGESSSQNWSSGPDKYSRLDRDLQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRISGELEEQAVMLDDFSHELDSTHSRLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_005816492.1| PREDICTED: syntaxin-6-like [Xiphophorus maculatus]
Length=255

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 66/232 (28%), Positives = 120/232 (52%), Gaps = 12/232 (5%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQW-ERIPNSG-----EHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+++++    S  R+W E  P  G     E      EL     SI W +++
Sbjct  4    EDPFFVVKGEVEKAVQAAQSLHRRWVELQPEVGGASREEADWTTNELRNGLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL KR+ + +  R  V ++K+ ++     SG +    ++ 
Sbjct  64   LDETISIVESNPRKFHLDAAELTKRKAFITGTRRTVQDMKEQMLGPAAGSGSADRHGKQV  123

Query  501  LMN-LPDP-----HQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRI  340
            L+    DP           P++   + N +++  +   Q L+ +QQD++L+ +S ++  +
Sbjct  124  LLGGARDPIWQPGSDRFGPPDRRPQSANSEFIGEQQTQQQLIAEQQDEQLERVSGTIGVL  183

Query  339  GGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              +   I  EL  Q  +++D G EMDST +RLD V K++A V    S + Q+
Sbjct  184  KNMSERIGLELDEQAGMLDDFGHEMDSTQSRLDNVMKKLAKVSHMNSDRRQW  235



>gb|AJD09698.1| SYP61, partial [Arabis caerulea]
Length=56

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = -2

Query  387  QQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVA  220
            QQD+ELDELS SV+RIGGVGLTIHDEL AQD+I+++LG+EMDST  RLDFVQK+V 
Sbjct  1    QQDEELDELSKSVQRIGGVGLTIHDELVAQDRIMDELGTEMDSTKNRLDFVQKKVG  56



>ref|NP_001006531.1| syntaxin-6 [Gallus gallus]
 sp|Q5ZL19.1|STX6_CHICK RecName: Full=Syntaxin-6 [Gallus gallus]
 emb|CAG31574.1| hypothetical protein RCJMB04_8d16 [Gallus gallus]
Length=254

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 120/234 (51%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGIRKSFITSTR-QVVREMKDQMSNSSMQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+           P+KYS  +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGESSSQSWSSGPDKYSRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFSHELDSTHSRLDNVMKKLAKVSHMTSDRRQW  234



>gb|EFX69800.1| hypothetical protein DAPPUDRAFT_113324 [Daphnia pulex]
Length=258

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/238 (28%), Positives = 131/238 (55%), Gaps = 15/238 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQV  688
            + +DPF++VK+E+ ++++R    ++ W+ +   G      E Q+   EL  +  SI W +
Sbjct  2    SLEDPFFVVKDEVTKALNRTRGLYQHWQHLRKEGIVFSKDEVQKTTAELRNSIRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKA--VIVGQ---ESSGLS  523
            ++L+ TI+I  K+P+ + +N  E+ +RR +    R ++GN+K+   ++ GQ   +S+   
Sbjct  62   EDLEDTIAIVEKNPSRFRLNSAEVVQRRFFVQQTRDEIGNIKEKLQIMRGQDFDQSAKKP  121

Query  522  VIEMRRELMNLPDPHQ--IVDKPNKYSTANNDDYVAAES--DTQLLLIKQQDDELDELSA  355
            ++E    + + P       V  P +    + DD    +S    Q  L+KQQD++L  +S 
Sbjct  122  LLENSSPIRHAPKNSSAGYVRIPIQGDQEDGDDDRKMKSVLQQQASLVKQQDEQLVLISG  181

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFM  181
            SV  +  +   I  EL  Q  I++D+G EM++T T++D   K++A V++ ++ + Q++
Sbjct  182  SVGTLKSMSRRIGSELDEQALILDDMGHEMENTETKMDSTLKKMAKVLRMSNDRRQWI  239



>ref|XP_001769807.1| predicted protein [Physcomitrella patens]
 gb|EDQ65369.1| predicted protein [Physcomitrella patens]
Length=88

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 61/84 (73%), Gaps = 1/84 (1%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDELDKTIS  664
            DPFY+VK EIQ+++ +L STF +WE++P +S E   L KELL++CE+I WQVDELDK   
Sbjct  5    DPFYLVKLEIQDTVTKLQSTFARWEQLPFSSTERSVLSKELLSSCENIEWQVDELDKVTG  64

Query  663  IASKDPAWYGINEVELGKRRRWTS  592
            +   DPA + ++  E+ + R+W+S
Sbjct  65   VVENDPARFSVDAAEIERWRKWSS  88



>ref|XP_007901143.1| PREDICTED: syntaxin-6 [Callorhinchus milii]
Length=255

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/237 (28%), Positives = 124/237 (52%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     +++W  +   P+S   ++      EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNNAQGLYQRWTELLEDPSSASKEECDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM-  511
            ++LD+TISI   +P  + ++  EL KR+ + +  +  V ++K  +     SS  +++E  
Sbjct  62   EDLDETISIVETNPRKFNLDPAELSKRKAFITSTKQIVKDMKDHM---SSSSVQALVEQK  118

Query  510  -RRELMNLPDPHQIVDKP-NKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
             R+ L+           P NKYS  +      N  Y+  +   Q L+++QQDD+L  +S 
Sbjct  119  NRQALLGNGGSQGWSSTPENKYSRLDRELHTVNSQYIDEQQAQQQLIVEQQDDQLQLVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I +EL  Q  ++++   E+DST  RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQKIGNELEEQAVMLDEFSYELDSTQNRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_005528748.1| PREDICTED: syntaxin-6 [Pseudopodoces humilis]
Length=254

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 121/234 (52%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TI+I   +P  + ++  ELG R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETINILFANPRKFNLDATELGIRKAFITSTRQVVRDMKDQ-MSNSSMQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+           P+KYS  +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGESGSQSWSSGPDKYSRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_005147190.1| PREDICTED: syntaxin-6 [Melopsittacus undulatus]
Length=256

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 120/236 (51%), Gaps = 15/236 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGIRKAFITSTR-QVVREMKDQMSNSSMQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTANND-----DYVAAESDTQ---LLLIKQQDDELDELSAS  352
            + L+           P+KYS  + D      +   E   Q   LL+++QQD++L+ +S S
Sbjct  121  QALLGESGSQSWSTGPDKYSRLDRDLQLANSHFIEEQQAQQQHLLIVEQQDEQLELVSGS  180

Query  351  VRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +  +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  181  IGVLKNMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKVSHMTSDRRQW  236



>gb|KDD73455.1| hypothetical protein H632_c2158p0 [Helicosporidium sp. ATCC 50920]
Length=231

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 64/225 (28%), Positives = 113/225 (50%), Gaps = 14/225 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIP-NSGEHQQLVKELLAACESISWQVDEL  679
            M+A+ DP+YIV+EE   ++  +   F +W+ +P  S E + L+ E      S+ + + E+
Sbjct  1    MAASGDPYYIVQEETNGTMQEVQEKFARWKVLPPGSAERKALLVEQEEELHSLEYILQEI  60

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            D++   A   P  + + + E+ +RR W    R QV  ++ A+   ++  G          
Sbjct  61   DRSTDAAETQPDRFRLTQAEISQRRSWAESKRRQVRQIRDAL---RDPGG----------  107

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTI  319
             N         K    + + N+ ++ +E   Q   + QQD++LD L   V RIG +G  +
Sbjct  108  ANAGTGGSPAAKLAAAARSENEYFLQSEGQRQQAALLQQDNDLDALGDHVIRIGELGRVM  167

Query  318  HDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              EL+A   ++++L  EMD T TRL   Q+++  V+ KA  KGQ+
Sbjct  168  GTELQAHGVLLDELDEEMDGTQTRLAVAQRKIQHVLDKAGGKGQW  212



>ref|XP_009096675.1| PREDICTED: syntaxin-6 [Serinus canaria]
Length=254

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 121/234 (52%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TI+I   +P  + ++  ELG R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETINILFANPRKFNLDATELGIRKAFITSTRQVVRDMKDQ-MSNSSMQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+           P+KYS  +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGDSGSQSWSSGPDKYSRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_005991138.1| PREDICTED: syntaxin-6-like isoform X4 [Latimeria chalumnae]
Length=278

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/258 (25%), Positives = 126/258 (49%), Gaps = 34/258 (13%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISW  694
            MS+ +DPF++VK E+Q++++     F++W  +   PN+   +++     EL  +  SI W
Sbjct  1    MSSMEDPFFVVKGEVQKAVNTAQGLFQRWMELLQDPNAATKEEIDWTTNELRNSLRSIEW  60

Query  693  QVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQV--GNVKKAVIVGQESSG--L  526
             +++LD+TISI   +P  + ++ +EL KR+ + +  R  V      +    G+  +    
Sbjct  61   DLEDLDETISIVEANPRKFNLDPIELSKRKAFITGTRQTVKFSAFLRGGTFGRTKTKDET  120

Query  525  SVIEMRRELMNLPDPHQIVDK------------------PNKYS------TANNDDYVAA  418
                  ++ M+ P    + ++                   NKYS       + N  ++  
Sbjct  121  CCFHEMKDQMSSPSAQALAERKSRQVLLGDSGSQGWGPSTNKYSRLDRELQSANSHFIED  180

Query  417  ESDTQLLLIKQQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDF  238
            +   Q L+ +QQD++L+ +S S+  +  +   I +EL  Q  +++D   E+DST +RLD 
Sbjct  181  QQTQQQLIAEQQDEQLELVSGSIGVLKNMSQRIGNELDEQAVMLDDFSQELDSTQSRLDN  240

Query  237  VQKRVAMVMKKASPKGQF  184
            V K++A V    S + Q+
Sbjct  241  VMKKLAKVSHMTSDRRQW  258



>ref|XP_010871020.1| PREDICTED: syntaxin-10 isoform X1 [Esox lucius]
Length=257

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 69/238 (29%), Positives = 120/238 (50%), Gaps = 19/238 (8%)
 Frame = -2

Query  864  GHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACES  703
            G  MS  +DPF++VK E+Q+++ R  S + +WE +   G      E      EL     +
Sbjct  8    GANMSL-EDPFFVVKGEVQKALSRARSLYERWEELLQEGSQVSKDELDWSTNELRNCLRA  66

Query  702  ISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS  523
            I W +++L +TISI   +P  + + E EL +RR +    R  V  +K+ +      S  S
Sbjct  67   IDWDLEDLSETISIVESNPGKFRLGENELQERRDFVERTRQSVQEMKEQL------SSPS  120

Query  522  VIEM-----RRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            V+ +     R+ LM +    +  D    +  + N  Y+  + + Q L+++ QDD L+ ++
Sbjct  121  VVALSEKRNRQALMGVTVQDK-SDGLEPHLVSANSRYIQEQQEQQQLIMQDQDDHLELVT  179

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+R +  +   I DEL  Q  ++ + G EMD TS+R+D V K++  V    S + Q+
Sbjct  180  GSIRVLKDMSGRIGDELDDQAVMLGEFGEEMDQTSSRMDSVLKKMEKVSHMTSSRRQW  237



>ref|XP_008164805.1| PREDICTED: syntaxin-6 [Chrysemys picta bellii]
Length=254

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 119/234 (51%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEVDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       LS  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGVRKAFITSTR-QVVREMKDQMSNSSVQALSERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+            +KY   +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  KALLGESGGQSWSSGSDKYGGLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E+D+T +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFSHELDNTQSRLDNVMKKLAKVSHMTSDRRQW  234



>gb|AJD09697.1| SYP61, partial [Arabis alpina]
Length=54

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = -2

Query  387  QQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKR  226
            QQD+ELDELS SV RIGGVGLTIH+EL AQD+I+++L SEMDST  RLDFVQK+
Sbjct  1    QQDEELDELSKSVERIGGVGLTIHEELSAQDRIMDELASEMDSTKNRLDFVQKK  54



>ref|XP_010871021.1| PREDICTED: syntaxin-10 isoform X2 [Esox lucius]
Length=235

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 115/226 (51%), Gaps = 15/226 (7%)
 Frame = -2

Query  864  GHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACES  703
            G  MS  +DPF++VK E+Q+++ R  S + +WE +   G      E      EL     +
Sbjct  8    GANMSL-EDPFFVVKGEVQKALSRARSLYERWEELLQEGSQVSKDELDWSTNELRNCLRA  66

Query  702  ISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLS  523
            I W +++L +TISI   +P  + + E EL +RR +    R  V  +K+  +       LS
Sbjct  67   IDWDLEDLSETISIVESNPGKFRLGENELQERRDFVERTRQSVQEMKEQ-LSSPSVVALS  125

Query  522  VIEMRRELMNLPDPHQIVDKPNK---YSTANNDDYVAAESDTQLLLIKQQDDELDELSAS  352
                R+ LM +     + DK +    +  + N  Y+  + + Q L+++ QDD L+ ++ S
Sbjct  126  EKRNRQALMGVT----VQDKSDGLEPHLVSANSRYIQEQQEQQQLIMQDQDDHLELVTGS  181

Query  351  VRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMV  214
            +R +  +   I DEL  Q  ++ + G EMD TS+R+D V K++  V
Sbjct  182  IRVLKDMSGRIGDELDDQAVMLGEFGEEMDQTSSRMDSVLKKMEKV  227



>ref|XP_007579188.1| PREDICTED: syntaxin-6 [Poecilia formosa]
Length=255

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 118/232 (51%), Gaps = 12/232 (5%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI------PNSGEHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+++++    S  R+W  +       +  E      EL     SI W +++
Sbjct  4    EDPFFVVKGEVEKAVHAAQSLHRRWVELQQEVGGASREEADWTTNELRNGLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL KR+ + +  R  V ++K+ +      SG +    ++ 
Sbjct  64   LDETISIVESNPRKFHLDAAELTKRKAFITSTRLTVQDMKEQMSGPAAGSGTADRYGKQV  123

Query  501  LM-NLPDP-----HQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRI  340
            L+ +  DP           P++   + N  ++  +   Q L+ +QQD++L+ +S ++  +
Sbjct  124  LLGDARDPIWQPGSDRFGPPDRRPQSANAQFIGDQQTQQQLIAEQQDEQLERVSGTIGVL  183

Query  339  GGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              +   I  EL  Q  +++D G EMDST +RLD V K++A V    S + Q+
Sbjct  184  KNMSERIGLELDEQAGMLDDFGHEMDSTQSRLDNVMKKLAKVSHMNSDRRQW  235



>ref|XP_004084264.1| PREDICTED: syntaxin-10-like [Oryzias latipes]
Length=247

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/230 (31%), Positives = 119/230 (52%), Gaps = 16/230 (7%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+Q+++ R  S   +WE +   G      E      EL     +I W +++
Sbjct  4    EDPFFVVKGEVQKALSRARSLSDRWEELLQDGTQVSRDELDWSANELRNCLRAIDWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM---  511
            L +TISI   +P  + + E EL +RR +    RT V  +K      Q SS  +V +    
Sbjct  64   LSETISIVESNPGKFRLGEYELQERRDFVERTRTSVQEMKD-----QLSSPSAVAQAEKK  118

Query  510  -RRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
             R+ L+    P +         +AN+  Y+  + + Q L++++QD++LD +S S+R +  
Sbjct  119  NRQALLTSTGPDRSTGLEAHLVSANSR-YIQEQQEQQQLIMQEQDEQLDLVSGSIRVLKD  177

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +   I DEL  Q  ++ND G EMD TS+R+D V K++  V    S + Q+
Sbjct  178  MSGRIGDELDEQAVMLNDFGDEMDQTSSRMDSVLKKLEKVSHMTSSRRQW  227



>ref|XP_007480968.1| PREDICTED: syntaxin-6 isoform X1 [Monodelphis domestica]
Length=254

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 62/232 (27%), Positives = 118/232 (51%), Gaps = 13/232 (6%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDE  682
            +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNTAQGLFQRWSELLQDPSAATREEVDWTTNELRNNLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       L+  + R+ 
Sbjct  64   LDETISIVEANPRKFNLDATELGVRKAFITSTR-QVVREMKDQMSSSSVQALAERKNRQA  122

Query  501  LMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVRRI  340
            L+            +KY   +      N  ++  +   Q L+++QQD++L+ +S S+  +
Sbjct  123  LLGESGGQSWSAGTDKYGRLDRELQRANAHFIEEQQAQQQLIVEQQDEQLELVSGSIGVL  182

Query  339  GGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  183  KNMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_008335593.1| PREDICTED: syntaxin-6 [Cynoglossus semilaevis]
Length=246

 Score = 90.1 bits (222),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 119/234 (51%), Gaps = 21/234 (9%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQV  688
            + +DPF++VK E++++++   S   +W  +   G      E      EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVEKAVNAAQSLHHRWTELVQEGGGASKEEMDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKK------AVIVGQESSGL  526
            ++LD+T+SI   +P  + ++  EL KR+ + S  R  +  +K+      A +V +++  +
Sbjct  62   EDLDETVSIVESNPRKFNLDAPELSKRKAFISKTRETLKLMKEQMSSPAAALVDKKNKQV  121

Query  525  SVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVR  346
              +         P P + V    +   AN+  ++  +   Q L+ +QQD++L+ +S ++ 
Sbjct  122  PTLR--------PGPDKFVRLDQQLQNANSQ-FIEEQQSQQQLIAEQQDEQLELVSGTIG  172

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D G EMD+T +RLD V K++A V    S + Q+
Sbjct  173  VLKNMSERIGMELDEQAVMLDDFGHEMDNTQSRLDNVMKKLAKVSHMTSDRRQW  226



>ref|NP_001086134.1| syntaxin 10 [Xenopus laevis]
 gb|AAH74240.1| MGC83976 protein [Xenopus laevis]
Length=250

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 117/233 (50%), Gaps = 17/233 (7%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQW------ERIPNSGEHQQLVKELLAACESISWQVDEL  679
            DPF +V+ E+Q++++     +++W        + ++ E      EL  +  SI W +++L
Sbjct  5    DPFSVVRGEVQKALNTSRGLYQRWCELLQESHVASAEEFDWTTNELRNSLRSIEWDLEDL  64

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            ++TISI   +P  + I   EL +RR +  + R  V  ++  +     SS +SV    R+ 
Sbjct  65   EETISIVESNPRKFKITGAELSERRGFVEETRNSVKEMRDHI-----SSPISVAFTERKN  119

Query  498  MNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
              +        + +++S  +      N  Y+  +   Q L+I  QD ELD +S S+R + 
Sbjct  120  REVLLSGAQQPRTDRFSRLDEEIIPGNSHYMEEQQAAQQLIIDGQDAELDMVSGSIRVLK  179

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
             +   I DEL  Q  +++D   EMD+T TR+D V KR+A V   +S + Q+ +
Sbjct  180  DMSSRIGDELDEQTVMLDDFTHEMDNTRTRVDSVFKRMAKVSHISSDRRQWCV  232



>ref|XP_008404754.1| PREDICTED: syntaxin-6 [Poecilia reticulata]
Length=255

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 115/233 (49%), Gaps = 14/233 (6%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI------PNSGEHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+++++    S  R+W  +       +  E      EL     SI W +++
Sbjct  4    EDPFFVVKGEVEKAVHAAQSLHRRWVELQQEVGGASREEADWTTNELRNGLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL KR+ + +  R  V ++K+ +      SG +    ++ 
Sbjct  64   LDETISIVESNPRKFHLDAAELTKRKAFITSTRLTVQDMKEQMSGPAAGSGTADRYGKQV  123

Query  501  LMN-------LPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRR  343
            L+         P   Q    P+      N  ++  +   Q L+ +QQD++L+ +S ++  
Sbjct  124  LLGDSQDPIWQPGSDQF-GPPDHRPQNANTQFIGEQQTQQQLIAEQQDEQLERVSGTIGV  182

Query  342  IGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +   I  EL  Q  +++D G EMDST +RLD V K++A V    S + Q+
Sbjct  183  LKNMSERIGLELDEQAGMLDDFGHEMDSTQSRLDTVMKKLAKVSHMNSDRRQW  235



>gb|AJD09700.1| SYP61, partial [Arabis soyeri subsp. subcoriacea]
Length=53

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  387  QQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQK  229
            QQD+ELDELS SV RIGGVGLTIH+EL AQ++I+++L SEMDST  RLDFVQK
Sbjct  1    QQDEELDELSKSVERIGGVGLTIHEELNAQERIMDELASEMDSTKNRLDFVQK  53



>ref|XP_008314456.1| PREDICTED: syntaxin-10 [Cynoglossus semilaevis]
Length=247

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/232 (27%), Positives = 114/232 (49%), Gaps = 16/232 (7%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQV  688
            + +DPF++VK E+Q+++ R    + +WE +   G      E      EL     +I W +
Sbjct  2    SVEDPFFVVKGEVQKALSRAHGLYTRWEELLQDGTQVSRDELDWSANELRNCLRAIDWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVI---  517
            ++L +TISI   +P  + + + EL +RR +    R  V  +K  +      S  SV+   
Sbjct  62   EDLSETISIVESNPGKFRLGDNELQERRDFVDRTRKAVQEMKDQL------SSPSVVAQA  115

Query  516  -EMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRI  340
             +  R+ +  P           +  + N  Y+  + + Q L+++ QD++L+ +S S+R +
Sbjct  116  EKKNRQALLPPSAQDRSTGLEAHLVSANSRYIQEQQEQQQLIMQDQDEQLELVSGSIRVL  175

Query  339  GGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              +   I DEL  Q  ++ D G EMD TS+R+D V K++  V    S + Q+
Sbjct  176  KDMSGRIGDELDEQSIMLGDFGDEMDQTSSRMDSVLKKLEKVSHMTSSRRQW  227



>ref|XP_007480969.1| PREDICTED: syntaxin-6 isoform X2 [Monodelphis domestica]
Length=252

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/224 (27%), Positives = 115/224 (51%), Gaps = 13/224 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWSELLQDPSAATREEVDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGVRKAFITSTR-QVVREMKDQMSSSSVQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+            +KY   +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGESGGQSWSAGTDKYGRLDRELQRANAHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMV  214
             +  +   I  EL  Q  +++D   E+DST +RLD V K++A V
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKV  224



>ref|NP_001133615.1| Syntaxin-10 [Salmo salar]
 gb|ACI33575.1| Syntaxin-10 [Salmo salar]
Length=247

 Score = 89.0 bits (219),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 63/230 (27%), Positives = 115/230 (50%), Gaps = 16/230 (7%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+Q+++ R  S + +WE +   G      E      EL     +I W +++
Sbjct  4    EDPFFVVKGEVQKALSRARSLYERWEELLEEGTQVSKDELDWSTNELRNCLRAIDWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV----IVGQESSGLSVIE  514
            L +TISI   +P  + + E EL +RR +    R  V  +K+ +    +V Q        +
Sbjct  64   LSETISIVESNPGKFRLGENELQERRDFVERTRQAVQEMKEQLSSPSVVAQAEK-----K  118

Query  513  MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGG  334
             R+ LM      +  D    +  + N  Y+  + + Q L+++ QD++L+ ++ S+R +  
Sbjct  119  NRQALMGTSGQDR-SDGLESHLVSANSRYIQDQQEQQQLIMQDQDEQLELVTGSIRVLKD  177

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +   I DEL  Q  ++ + G EMD T +R+D V K++  V    S + Q+
Sbjct  178  MSGRIGDELDQQAVMLGEFGEEMDQTGSRMDSVLKKMEKVSHMTSSRRQW  227



>ref|XP_003389021.1| PREDICTED: syntaxin-6-like [Amphimedon queenslandica]
Length=251

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 122/231 (53%), Gaps = 13/231 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQLVKELLAAC-ESISWQVDE  682
            + +DPFY V+++++ES++     + +W  +    +  E  Q V   L +C +SI W + +
Sbjct  2    SLEDPFYTVRDDVRESLNNAQDLYSRWCMLLEDQSDLEKTQGVSTDLRSCIKSIEWDLQD  61

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TIS+   +P  + ++  E+  R+++  D R  +  +K  +   Q  + L    M+R+
Sbjct  62   LDETISVVEANPQKFRVSTGEIETRKQFIRDTRQVINKMKSHMSSDQAQNMLE--NMKRQ  119

Query  501  LMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVRRI  340
             + L   H    K  +Y   +      N D++  +   Q +L+ +QD ++D++S ++  +
Sbjct  120  QL-LSSSHAQKKKHGRYQRLDDELERSNQDFIDQQRHQQQMLMVEQDKQVDKVSNTIVVL  178

Query  339  GGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
              +G  I  EL  Q+K+I+++  +M  T TRL  + KRV   ++K+S + Q
Sbjct  179  HQMGEDIGIELDEQNKMIDEIDEDMQRTETRLTSLTKRVNTAIRKSSDRCQ  229



>ref|XP_005994381.1| PREDICTED: syntaxin-10 isoform X1 [Latimeria chalumnae]
Length=252

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 119/234 (51%), Gaps = 15/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQW------ERIPNSGEHQQLVKELLAACESISWQV  688
            + +DPF++VK E+Q++++     +++W        I +  E      EL  +  SI W +
Sbjct  2    SLEDPFFVVKGEVQKTVNTSRGLYQRWCELLQETNIVSKEEFDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM-  511
            ++L++TISI   +P  + I   EL +RR +    R  V  +K  +      S L++ E  
Sbjct  62   EDLEETISIVESNPKKFKIEASELNERRAFVERTRETVKEMKDHI---SSPSALAMAERK  118

Query  510  -RRELMNLPDPHQI-VDKPNKYS---TANNDDYVAAESDTQLLLIKQQDDELDELSASVR  346
             R+ LM      ++  D+ N       A N  Y+  +   Q L++ QQD++L+ +S S+ 
Sbjct  119  NRQSLMAGDLKSRLYTDQYNHLDEDLLATNSRYIEDQQAQQQLIMDQQDEQLELVSGSIG  178

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I +EL  Q  +++D G EMD+T +R+D + K++A V    S + Q+
Sbjct  179  VLKNISGRIGEELDEQAIMLDDFGHEMDNTQSRMDGILKKMAKVSHMTSDRRQW  232



>ref|XP_005880290.1| PREDICTED: syntaxin-6 [Myotis brandtii]
 ref|XP_006089037.1| PREDICTED: syntaxin-6 isoform X2 [Myotis lucifugus]
 ref|XP_006754550.1| PREDICTED: syntaxin-6 [Myotis davidii]
Length=255

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 121/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKSFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D          P+KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQKWSTGTPDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTHSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_009022529.1| hypothetical protein HELRODRAFT_67123 [Helobdella robusta]
 gb|ESN98805.1| hypothetical protein HELRODRAFT_67123 [Helobdella robusta]
Length=232

 Score = 87.8 bits (216),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 62/232 (27%), Positives = 127/232 (55%), Gaps = 29/232 (13%)
 Frame = -2

Query  846  AQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG----EHQQLVKELLAACESISWQVDEL  679
            A+DPF+ VKEE++++++ + S +  W+++ N+     E  ++  EL    +S+ W +D+L
Sbjct  3    ARDPFFCVKEEVEKTLNSVNSLYSLWKKLRNTDGSGDELHRISDELRNNLKSVEWDLDDL  62

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            + TI IA K+   + ++ +EL  RR++ +          KA++       +S+  +  + 
Sbjct  63   EDTIKIAEKNQKKFNLDPLELDSRRQFITST--------KAIV------EVSIYRLSNK-  107

Query  498  MNLPDPHQIVDKPNKYSTANNDDYVAAES--DT---QLLLIKQQDDELDELSASVRRIGG  334
             NLP   Q  +    Y+  N DD  +  +  DT   Q +++K+QD +L  +  SV  +  
Sbjct  108  -NLPGFGQRFN----YTKLNMDDLESERTIDDTIQRQQMIMKEQDSQLHNIGNSVNSLKM  162

Query  333  VGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
            +   I +EL  Q  +++D   +MDST+++LD V K+++ V+  ++ + Q+++
Sbjct  163  MSSQIGNELDEQAVMLDDFADKMDSTNSKLDNVMKKMSKVLHMSNDRRQWIV  214



>ref|XP_008144135.1| PREDICTED: syntaxin-6 isoform X1 [Eptesicus fuscus]
Length=255

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 60/241 (25%), Positives = 123/241 (51%), Gaps = 26/241 (11%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     +S +  +  R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKSFITSTRQVVRDMKDQM----STSSVQALAER  117

Query  507  RELMNL-------------PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            +    L             PD ++ +D   + +   N  ++  +   Q L+++QQD++L+
Sbjct  118  KNRQALLGDSGGQKWSTGAPDKYRRLDHELQLA---NSHFIEEQQAQQQLIVEQQDEQLE  174

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
             +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q
Sbjct  175  LVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTHSRLDNVMKKLAKVSHMTSDRRQ  234

Query  186  F  184
            +
Sbjct  235  W  235



>ref|XP_010869715.1| PREDICTED: syntaxin-6 [Esox lucius]
Length=256

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/236 (26%), Positives = 121/236 (51%), Gaps = 15/236 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     +++W  +   P+    +++     EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLYQRWTELLQDPSGASKEEVDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++ +EL KR+ + +  R  V  +K   +       LS  + R
Sbjct  62   EDLDETISIVESNPKKFNLDALELTKRKGFITSTRHTVKEMKDH-MSSPSVLALSDKKNR  120

Query  507  RELMNLPDPHQIV--DKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSAS  352
            + L+        +    P+KY+  +      N  ++  +   Q L+ +QQDD+L+ +S +
Sbjct  121  QALLGDTGSQGPIWQPGPDKYTRLDQELRSANSQFIEEQQTQQQLMAEQQDDQLELVSGT  180

Query  351  VRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +  +   I  EL  Q  +++D   EMD T +RLD V K++A V    + + Q+
Sbjct  181  IGVLKNMSERIGMELDEQAVMLDDFSHEMDGTHSRLDNVMKKLAQVSNMTTDRRQW  236



>ref|XP_002735572.1| PREDICTED: syntaxin-6-like [Saccoglossus kowalevskii]
Length=250

 Score = 87.8 bits (216),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 61/233 (26%), Positives = 125/233 (54%), Gaps = 15/233 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNS---GEHQQLVKELLAACESISWQV  688
            + +DPF++VK+E+Q+++    S +++W  +   PN+    E+     EL  +  SI W +
Sbjct  2    SLEDPFFVVKDEVQKAVSNAKSLYQRWCELLEDPNAVSKEEYDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++L++TI I   +P  + I+  E+ +R+++    +  V ++K+ +     S      E R
Sbjct  62   EDLEETIGIVETNPRKFKIDSSEIHERKQFVVHTKDMVKDMKEHMA----SPSTKTREDR  117

Query  507  RELMNL-PD-PHQIVDKPNKYSTA---NNDDYVAAESDTQLLLIKQQDDELDELSASVRR  343
            +    L P+ P +  DK  +       +N  ++      Q L+++ QDD+L+ +  SV  
Sbjct  118  KTRTTLLPNGPKKGQDKYTRLDNEMDRSNQRFIDDTRQQQQLVMEHQDDQLERVGDSVTV  177

Query  342  IGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +G TI +EL  Q  +++D  +EM+ T ++LD V K++A V + ++ + Q+
Sbjct  178  LKSMGQTIGNELDEQAVMLDDFATEMERTDSKLDGVMKKMAKVTRMSNDRRQW  230



>ref|XP_006272470.1| PREDICTED: syntaxin-6 [Alligator mississippiensis]
Length=254

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 118/234 (50%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  ELG R+ + +  R QV    K  +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELGIRKAFITSTR-QVVREMKDQMSNSSVQALAERKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+            +KY   +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGESTSQSWSSGSDKYGRLDREQQLVNSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFTHELESTHSRLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_006635117.1| PREDICTED: syntaxin-6-like isoform X1 [Lepisosteus oculatus]
Length=262

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 124/242 (51%), Gaps = 21/242 (9%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     +++W  +   P S   +++     EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLYQRWTELLQEPGSATKEEVDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIAS------KDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL  526
            ++LD+TI+I S       +P  + ++ +EL KR+ + +  R  V  +K   +    +  +
Sbjct  62   EDLDETINILSPSHIVESNPRKFNLDTMELTKRKAFITGTRQTVKEMKDH-MSSPMAQAM  120

Query  525  SVIEMRRELMNL-----PDPHQIVDKPNKYS---TANNDDYVAAESDTQLLLIKQQDDEL  370
            S  + R+ L+       P  H   DK  +      + N  ++  +   Q L+++QQDD+L
Sbjct  121  SDRKNRQALLGESVSQGPGWHSGTDKYTRLDRELQSANSQFIEDQQAQQQLIVEQQDDQL  180

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S SV  +  +   I  EL  Q  +++D   EMD+T +RLD V K++A V    S + 
Sbjct  181  ELVSGSVGVLKNMSQRIGQELDEQAVMLDDFSHEMDNTQSRLDNVMKKLAKVSHMTSDRR  240

Query  189  QF  184
            Q+
Sbjct  241  QW  242



>ref|XP_006907830.1| PREDICTED: syntaxin-6 isoform X1 [Pteropus alecto]
Length=255

 Score = 87.4 bits (215),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+S   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSSATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  +  E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQAFAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +     P+KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSTGTPDKYGRFDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ T +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKSMSQRIGGELEEQAVMLDDFSHELEGTQSRLDNVMKKLAKVSHMTSDRRQW  235



>gb|AJD09699.1| SYP61, partial [Arabis ciliata]
Length=52

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  387  QQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQ  232
            QQD+ELDELS SV RIGGVGLTIH+EL AQ++I+++L SEMDST  RLDFVQ
Sbjct  1    QQDEELDELSKSVERIGGVGLTIHEELNAQERIMDELASEMDSTKNRLDFVQ  52



>gb|AJD09701.1| SYP61, partial [Draba aizoides]
Length=52

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/52 (75%), Positives = 46/52 (88%), Gaps = 0/52 (0%)
 Frame = -2

Query  387  QQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQ  232
            QQD+ELDELS SV RIGGVGLTIH+EL AQ++I+++LG EMDST  RLDFVQ
Sbjct  1    QQDEELDELSKSVERIGGVGLTIHEELNAQERIMDELGMEMDSTKNRLDFVQ  52



>ref|XP_002409905.1| syntaxin, putative [Ixodes scapularis]
 gb|EEC02474.1| syntaxin, putative [Ixodes scapularis]
Length=247

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 122/235 (52%), Gaps = 20/235 (9%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWER------IPNSGEHQQLVKELLAACESISWQV  688
            + +DPF+ VK+EI ++I +  S F +W +      +P   E      EL     SI W +
Sbjct  2    SLEDPFFAVKDEIVKAIAKNKSLFERWNQYQDPSSLPCKEELDWTTNELRNGLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++L++TI+I  K+P  + I++ E+  R+ +   ++ +V  +K+ V+  +  +     +MR
Sbjct  62   EDLEETIAIVEKNPKKFKIDDKEIRNRKSFIEQSKNEVKCMKEKVLESKSKNK----KMR  117

Query  507  RELMNLPDPHQIVDKPNKYSTANND------DYVAAESDTQLLLIKQQDDELDELSASVR  346
               M L +P +      KY++  N+        +      Q  L+  QD+EL+ +  SV 
Sbjct  118  PSSMELFNPSRTA----KYTSLRNEVESPIRRLLDTTQRQQQELMVSQDEELEGIQKSVG  173

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFM  181
             +  +   I +EL  Q  +++DLG +MD+T +++D   K++A V+  ++ + Q+M
Sbjct  174  SLKVMSKQIGNELDEQSVMLDDLGHDMDNTESKMDGALKKMAKVLHMSNDRRQWM  228



>ref|XP_005994382.1| PREDICTED: syntaxin-10 isoform X2 [Latimeria chalumnae]
Length=229

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 115/224 (51%), Gaps = 15/224 (7%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQW------ERIPNSGEHQQLVKELLAACESISWQV  688
            + +DPF++VK E+Q++++     +++W        I +  E      EL  +  SI W +
Sbjct  2    SLEDPFFVVKGEVQKTVNTSRGLYQRWCELLQETNIVSKEEFDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM-  511
            ++L++TISI   +P  + I   EL +RR +    R  V  +K  +      S L++ E  
Sbjct  62   EDLEETISIVESNPKKFKIEASELNERRAFVERTRETVKEMKDHI---SSPSALAMAERK  118

Query  510  -RRELMNLPDPHQI-VDKPNKYS---TANNDDYVAAESDTQLLLIKQQDDELDELSASVR  346
             R+ LM      ++  D+ N       A N  Y+  +   Q L++ QQD++L+ +S S+ 
Sbjct  119  NRQSLMAGDLKSRLYTDQYNHLDEDLLATNSRYIEDQQAQQQLIMDQQDEQLELVSGSIG  178

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMV  214
             +  +   I +EL  Q  +++D G EMD+T +R+D + K++A V
Sbjct  179  VLKNISGRIGEELDEQAIMLDDFGHEMDNTQSRMDGILKKMAKV  222



>ref|XP_006635118.1| PREDICTED: syntaxin-6-like isoform X2 [Lepisosteus oculatus]
Length=246

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 123/244 (50%), Gaps = 41/244 (17%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     +++W  +   P S   +++     EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLYQRWTELLQEPGSATKEEVDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIAS------KDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL  526
            ++LD+TI+I S       +P  + ++ +EL KR               KA I G   +  
Sbjct  62   EDLDETINILSPSHIVESNPRKFNLDTMELTKR---------------KAFITGTRQT--  104

Query  525  SVIEMRRELMNLPDPHQIVDKPN----KYS------TANNDDYVAAESDTQLLLIKQQDD  376
             V EM+ + M+ P    + D+ N    KY+       + N  ++  +   Q L+++QQDD
Sbjct  105  -VKEMK-DHMSSPMAQAMSDRKNRQVDKYTRLDRELQSANSQFIEDQQAQQQLIVEQQDD  162

Query  375  ELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASP  196
            +L+ +S SV  +  +   I  EL  Q  +++D   EMD+T +RLD V K++A V    S 
Sbjct  163  QLELVSGSVGVLKNMSQRIGQELDEQAVMLDDFSHEMDNTQSRLDNVMKKLAKVSHMTSD  222

Query  195  KGQF  184
            + Q+
Sbjct  223  RRQW  226



>ref|XP_009166852.1| hypothetical protein T265_03981 [Opisthorchis viverrini]
 gb|KER29413.1| hypothetical protein T265_03981 [Opisthorchis viverrini]
Length=253

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/228 (27%), Positives = 122/228 (54%), Gaps = 10/228 (4%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQQLVKELLAACESISWQVDELDKTISI  661
            DP+Y V++E+ ++++   + ++ W         Q+L   L     SI W ++++ +T+SI
Sbjct  7    DPYYTVQDEVIKNLESARTLYQDWLNAGLPKNLQELSDNLRQLLRSIEWDLEDIQETVSI  66

Query  660  ASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV--IVGQESSGLSV---IEMRRELM  496
               +P+ + ++E ++  RR++  + R  V +VK  +     +E++G S+   + + R L 
Sbjct  67   VEGNPSRFQLSEKDVAARRQFLRETRDIVNSVKSQLQDAGKREANGSSISFKVTIARPLT  126

Query  495  NLPDPHQ-IVDKPNKYSTANNDDYVAAESDT---QLLLIKQQDDELDELSASVRRIGGVG  328
            N   P++  V +P + +T          SD    Q  L++QQD+ +D++ AS+  + G+ 
Sbjct  127  NGSGPNRDPVSQPLR-TTDTRPIAFPVPSDPLTEQKHLLRQQDERIDQIGASISTLKGMS  185

Query  327  LTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              I DEL  Q  +++D  +EM  T T+LD V KR A ++  ++ + Q+
Sbjct  186  RRIGDELEDQVALLDDFSNEMTHTETKLDAVTKRTARLLHLSTSRRQW  233



>ref|XP_006985712.1| PREDICTED: syntaxin-6 [Peromyscus maniculatus bairdii]
Length=254

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 121/234 (52%), Gaps = 17/234 (7%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDE  682
            +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +  
Sbjct  64   LDETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQM---SASSVQALAERKNR  120

Query  501  LMNLPDPHQIVDK--PNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
               L D  Q  +    ++Y   +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGDSSQTWNAGVTDRYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDSVMKKLAKVSHMTSDRRQW  234



>ref|XP_004578893.1| PREDICTED: syntaxin-6 [Ochotona princeps]
Length=255

 Score = 87.0 bits (214),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/241 (25%), Positives = 121/241 (50%), Gaps = 26/241 (11%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS +  +  R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQM----SSSSVQALAER  117

Query  507  RELMNL-------------PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            R    L             PD +  +D   + +   N  ++  +   Q L+++QQD++L+
Sbjct  118  RNRQALLGDSGSQSWSSRAPDKYGRLDHELQLA---NSHFIEEQQAQQQLIVEQQDEQLE  174

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
             +S S+  +  +   I  EL  Q  +++    E++ST +RLD V K++A V    S + Q
Sbjct  175  LVSGSIGVLKSMSQRIGGELEEQAVMLDSFSHELESTQSRLDNVMKKLAKVSHMTSDRRQ  234

Query  186  F  184
            +
Sbjct  235  W  235



>ref|NP_001017879.1| syntaxin-6 [Danio rerio]
 gb|AAH92969.1| Syntaxin 6 [Danio rerio]
 gb|AAI58194.1| Stx6 protein [Danio rerio]
 gb|AAI65503.1| Stx6 protein [Danio rerio]
Length=256

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/239 (28%), Positives = 121/239 (51%), Gaps = 21/239 (9%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQW-ERIPNSG-----EHQQLVKELLAACESISWQV  688
            + +DPF++VK E+Q++++      ++W E + ++G     E      EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLHQRWIELLQDAGGASKEEVDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM-  511
            ++LD+TISI   +P  + ++ +EL KR+ + +  R  V  +K  +        ++V E  
Sbjct  62   EDLDETISIVEANPKKFNLDAMELAKRKAFITSTRQTVREMKDHMT---SPMAITVPEKK  118

Query  510  -RRELMN---------LPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDEL  361
             R+ LM           P   +     N+  TAN+  ++  +   Q L+ ++QD+ L+ +
Sbjct  119  NRQTLMGEGGSRGPIWQPSGEKYTRLDNELQTANSQ-FIEEQQTQQQLIAEKQDEHLELV  177

Query  360  SASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S ++  +  +   I  EL  Q  +++D   EMDST +RLD V K++A V    S K Q+
Sbjct  178  SGTIGVLKNMSQRIGQELDEQAVMLDDFSHEMDSTQSRLDNVMKKLAKVSHMTSDKRQW  236



>ref|XP_010750970.1| PREDICTED: syntaxin-6 [Larimichthys crocea]
Length=255

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 117/237 (49%), Gaps = 22/237 (9%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+Q++++   S   +W  +   G      E      EL  +  SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNAAQSLHHRWSELLQEGGGASKEEMDWTTNELRNSLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL KR+ + +  R  V  +K+     Q SS  +    R+ 
Sbjct  64   LDETISIVESNPKKFNLDAAELSKRKAFITSTRQTVKEMKE-----QMSSPAAASVDRKN  118

Query  501  LMNL--------PDPHQIVDKPNK--YSTAN-NDDYVAAESDTQLLLIKQQDDELDELSA  355
               L        P      DK N+  +   N N  ++  +   Q L+ +QQD++L+ +S 
Sbjct  119  KQALLGERGAQGPIWQPGADKYNRLDHQLQNANSQFIEEQQVQQQLIAEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            ++  +  +   I  EL  Q  +++D G EMD+T +RLD V K++A V    S + Q+
Sbjct  179  TIGVLKNMSERIGMELDEQAVMLDDFGHEMDNTQSRLDNVMKKLAKVSHMTSDRRQW  235



>gb|ELK37133.1| Syntaxin-6 [Myotis davidii]
Length=255

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 121/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TI+I   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETINILEANPRKFNLDATELSIRKSFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D          P+KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQKWSTGTPDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTHSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_001120630.1| syntaxin 10 [Xenopus (Silurana) tropicalis]
 gb|AAI61783.1| LOC100145797 protein [Xenopus (Silurana) tropicalis]
Length=250

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/231 (28%), Positives = 116/231 (50%), Gaps = 13/231 (6%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQW------ERIPNSGEHQQLVKELLAACESISWQVDEL  679
            DPF +V+ E+Q++++     +++W       ++ ++ E      EL  +  SI W +++L
Sbjct  5    DPFSVVRGEVQKALNTSRGLYQRWCELLQESQVTSAEEFDWTTNELRNSLRSIEWDLEDL  64

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR-RE  502
            ++TISI   +   + I   EL +RR +    R  V  ++  +        L+  E + RE
Sbjct  65   EETISIVESNSRKFKITGTELSERRSFVEQTRNSVKEMRDHI---SSPRSLAFSERKNRE  121

Query  501  LMNLPDPHQIVDKPNKYS---TANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGV  331
            ++       I D+ ++      + N  YV  +   Q L+I  QD EL+ +S S+R +  +
Sbjct  122  VLLGAGQQPINDRFSRLDEEIISGNSRYVEEQQAQQQLIIDGQDAELEMVSGSIRVLKDM  181

Query  330  GLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
               I DEL  Q  +++D   EMD+T TR+D V KR+A V   +S + Q+ +
Sbjct  182  SSRIGDELEEQTVMLDDFTHEMDNTRTRVDSVFKRMAKVSHISSDRRQWCV  232



>ref|XP_006907831.1| PREDICTED: syntaxin-6 isoform X2 [Pteropus alecto]
Length=234

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 117/232 (50%), Gaps = 18/232 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+S   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSSATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  +  E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQAFAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +     P+KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSTGTPDKYGRFDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKAS  199
            S+  +  +   I  EL  Q  +++D   E++ T +RLD V K++A V    S
Sbjct  179  SIGVLKSMSQRIGGELEEQAVMLDDFSHELEGTQSRLDNVMKKLAKVSHMTS  230



>ref|XP_002196537.1| PREDICTED: syntaxin-6 [Taeniopygia guttata]
Length=253

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/231 (26%), Positives = 117/231 (51%), Gaps = 14/231 (6%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDEL  679
            DP ++VK  +Q++++     F++W  +   P+    +++     EL     SI W +++L
Sbjct  5    DPLFVVKG-VQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDLEDL  63

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            D+TISI   +P  + ++  ELG R+ + +  R  V ++K   +       L+  + R+ L
Sbjct  64   DETISIVEANPRKFNLDATELGIRKAFITSTRQVVRDMKDQ-MSNSSVQALAERKNRQAL  122

Query  498  MNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
            +           P+KYS  +      N  ++  +   Q L+++QQD++L+ +S S+  + 
Sbjct  123  LGESGSQSWSSGPDKYSRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSIGVLK  182

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +   I  EL  Q  +++D   E+DST +RLD V K++A V    S + Q+
Sbjct  183  NMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKVSHMTSDRRQW  233



>ref|XP_003259022.1| PREDICTED: syntaxin-6 isoform 1 [Nomascus leucogenys]
Length=255

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERR  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTTDKYGRVDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_008293660.1| PREDICTED: syntaxin-6 [Stegastes partitus]
Length=255

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 120/238 (50%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQV  688
            + +DPF++VK E+Q++++   S   +W  +   G      E      EL  +  SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNAAQSLHHRWRELLQEGGGASKEEIDWTTNELRNSLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEM-  511
            ++LD+TISI   +P  + ++  EL KR+ + +  R  V  +K+ +     S G +  +  
Sbjct  62   EDLDETISIVESNPKKFNLDAAELSKRKAFITSTRLTVKEMKEQM----SSPGAASADRK  117

Query  510  -RRELMNLPDPHQIVDKP--NKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELS  358
             R+ L+        + +P  +KYS  +      N  ++  +   Q L+ +QQD++L+ +S
Sbjct  118  NRQALLGEHGAQGPIWQPGSDKYSRLDRQLENANSQFIEEQQVQQQLIAEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             ++  +  +   I  EL  Q  +++D   EMD+T +RLD V K++A V    S + Q+
Sbjct  178  GTIGVLKNMSERIGMELDEQAVMLDDFSHEMDNTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_004688595.1| PREDICTED: syntaxin-6 [Condylura cristata]
Length=255

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/237 (26%), Positives = 123/237 (52%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
               + L D    +      +KYS  +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQVLLGDSGGQNWNSRTTDKYSRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_008579776.1| PREDICTED: syntaxin-6 isoform X1 [Galeopterus variegatus]
Length=255

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALTERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GSQNWSTGTTDTYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_004425027.1| PREDICTED: syntaxin-6 [Ceratotherium simum simum]
Length=255

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 123/238 (52%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +        L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTS-SVQALAERKNR  120

Query  507  RELM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L+           + D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S
Sbjct  121  QALLGDSGGQTWSTGMTDKYGHLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>gb|AAY18872.1| syntaxin 6 [synthetic construct]
Length=279

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/243 (26%), Positives = 123/243 (51%), Gaps = 18/243 (7%)
 Frame = -2

Query  867  LGHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACE  706
            L  + S+ +DPF++VK E+Q++++     F++W  +   P++   +++     EL     
Sbjct  20   LYFQGSSMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLR  79

Query  705  SISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL  526
            SI W +++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  
Sbjct  80   SIEWDLEDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQ  136

Query  525  SVIEMRRELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDE  373
            ++ E +     L D    +      +KY   +      N  ++  +   Q L+++QQD++
Sbjct  137  ALAERKNRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQ  196

Query  372  LDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPK  193
            L+ +S S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S +
Sbjct  197  LELVSGSIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDR  256

Query  192  GQF  184
             Q+
Sbjct  257  RQW  259



>ref|XP_006887839.1| PREDICTED: syntaxin-6 [Elephantulus edwardii]
Length=255

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 60/238 (25%), Positives = 122/238 (51%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +        L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTS-SVQALAERKSR  120

Query  507  REL----------MNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L          M   D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S
Sbjct  121  QALLGESGGQSWNMGTADKYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_006048665.1| PREDICTED: syntaxin-6 [Bubalus bubalis]
Length=255

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSA---SSVQALTERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_005622446.1| PREDICTED: syntaxin-6 isoform X1 [Canis lupus familiaris]
Length=255

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_004767955.1| PREDICTED: syntaxin-6 [Mustela putorius furo]
 ref|XP_004808110.1| PREDICTED: syntaxin-6 [Mustela putorius furo]
Length=255

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_010953234.1| PREDICTED: syntaxin-6 [Camelus bactrianus]
 ref|XP_010986849.1| PREDICTED: syntaxin-6 [Camelus dromedarius]
Length=255

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_007105189.1| PREDICTED: syntaxin-6 isoform X2 [Physeter catodon]
Length=255

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|NP_001039240.1| syntaxin 6 [Xenopus (Silurana) tropicalis]
 emb|CAJ82644.1| syntaxin 6 [Xenopus (Silurana) tropicalis]
 gb|AAI58964.1| syntaxin 6 [Xenopus (Silurana) tropicalis]
Length=254

 Score = 85.1 bits (209),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/234 (25%), Positives = 120/234 (51%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++V+ E+Q++++     F++W  +   P+    ++L     EL     SI W +
Sbjct  2    SMEDPFFVVRGEVQKAVNTAQGLFQRWTDLLQDPSISTREELDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL +R+ + S+ R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVESNPRKFSLDPAELRQRKAFISETRQCVKDMKDR-MTSPSVQALTEKKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+     H    +  KY   +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  121  QALLGEGTKHGWNLETEKYKALDQELENANSQFLDGQVGQQQLIMEQQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D   E+D+  +R+D V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGSELDEQAVMLDDFSHELDTAQSRMDNVLKKLAKVSHMTSDRRQW  234



>ref|XP_001615864.1| hypothetical protein [Plasmodium vivax Sal-1]
 gb|EDL46137.1| hypothetical protein, conserved [Plasmodium vivax]
Length=212

 Score = 84.7 bits (208),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/221 (26%), Positives = 108/221 (49%), Gaps = 42/221 (19%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERIPNSG-----EHQQLVKELLAACESISWQVDELD  676
            DPF+  K E+  S+ +L S +  W  IP+       E   L+KE     + ++  +D+LD
Sbjct  7    DPFHEAKHEVDVSVKKLQSLYNNWSSIPDKNSMLAKEKYSLIKE---EIKYLNEDLDDLD  63

Query  675  KTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRELM  496
             ++++  K+   + I+  EL  R     + RT + ++         SS L+         
Sbjct  64   NSVNVVKKNLFKFNISNEELENRASSLKNIRTVLNDI---------SSNLT---------  105

Query  495  NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIGGVGLTIH  316
                          Y   N    +  E D   +++K+QD++LDEL+ S  R+    +TI+
Sbjct  106  --------------YKVLNYSGDIKGEYDA--VVLKRQDNDLDELAESAERLHNAAITIN  149

Query  315  DELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPK  193
             EL+ Q +++++L +EMD ++ +++FV K++A  +K  +PK
Sbjct  150  TELKDQQRLLDELENEMDYSNEKMNFVTKKIADYLKTNNPK  190



>ref|XP_006142379.1| PREDICTED: syntaxin-6 [Tupaia chinensis]
Length=255

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 121/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTADKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_001085148.1| syntaxin 6 [Xenopus laevis]
 gb|AAH72075.1| MGC78971 protein [Xenopus laevis]
Length=254

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 58/234 (25%), Positives = 121/234 (52%), Gaps = 13/234 (6%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++V+ E+Q++++     F++W  +   P+    ++L     EL     SI W +
Sbjct  2    SMEDPFFVVRGEVQKAVNTAQGLFQRWTDLLQDPSISTREELDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL +R+ + +D R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVESNPRKFSLDPAELRQRKAFINDTRQCVKDMKDR-MTSPSVQALTEKKNR  120

Query  507  RELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            + L+     H    +  KY   +      N  ++  +   Q L++++QD++L+ +S S+ 
Sbjct  121  QALLGEGTKHGWNLETEKYKALDQELENVNSQFLDGQVGQQQLIMEEQDEQLELVSGSIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I +EL  Q  +++D   E+D+  +R+D V K++A V    S + Q+
Sbjct  181  VLKNMSQRIGNELDEQAVMLDDFSHELDTAQSRMDNVLKKLAKVSHMTSDRRQW  234



>ref|XP_004013893.1| PREDICTED: syntaxin-6 [Ovis aries]
 ref|XP_005962127.1| PREDICTED: syntaxin-6 [Pantholops hodgsonii]
Length=255

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 121/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSAGTSDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_010628586.1| PREDICTED: syntaxin-6 isoform X1 [Fukomys damarensis]
Length=255

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWMELLQDPSAATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GSQNWSTGTTDQYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|NP_001088686.1| uncharacterized protein LOC495950 [Xenopus laevis]
 gb|AAH87319.1| LOC495950 protein [Xenopus laevis]
Length=250

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 116/233 (50%), Gaps = 17/233 (7%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWE------RIPNSGEHQQLVKELLAACESISWQVDEL  679
            DPF +V+ E+Q++++     +++W       ++ ++ E      EL  +  SI W +++L
Sbjct  5    DPFSVVRGEVQKALNTSRGLYQRWSELLQESQVSSAEEFDWTTNELRNSLRSIEWDLEDL  64

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            ++TISI   +P  + I   EL +RR +    R  V  ++  +     SS  SV    R+ 
Sbjct  65   EETISIVESNPRKFKITGAELSERRGFVEQTRNSVKEMRDHI-----SSPRSVAFTERKN  119

Query  498  MNLPDPHQIVDKPNKYS------TANNDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
              +        + +++S       + N  Y+  +   Q L+I  QD EL+ +S S+R + 
Sbjct  120  REVLLGAAQQPRTDRFSRLDEEIISGNSRYMEEQQAQQQLIIDGQDAELEMVSGSIRVLK  179

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQFMM  178
             +   I DEL  Q  +++D   EMD+T TR+D V KR+A V   ++ + Q+ +
Sbjct  180  DMSSRIGDELEEQTVMLDDFTHEMDNTRTRVDSVFKRMAKVSHISNDRRQWCV  232



>ref|XP_004396913.1| PREDICTED: syntaxin-6 [Odobenus rosmarus divergens]
Length=255

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 119/237 (50%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTAN---------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D         K  T+          N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSAGKMDTSGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_008612609.1| hypothetical protein SDRG_08497 [Saprolegnia diclina VS20]
 gb|EQC33814.1| hypothetical protein SDRG_08497 [Saprolegnia diclina VS20]
Length=249

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 57/226 (25%), Positives = 122/226 (54%), Gaps = 27/226 (12%)
 Frame = -2

Query  852  SAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNSGEHQ----------QLVKELLAACES  703
            SA+ DP+Y+ KE+++  +  +   +++W+ + ++ +            +L KEL  A  S
Sbjct  13   SASGDPYYVFKEDLESKVSSIHQKYKRWKHLLDARDASPTKDFGKLTDELTKELATAERS  72

Query  702  ISWQVDELDKTISIASKDPAWYG-INEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGL  526
            + +    L+++I     D   Y  I+ V++  R+ + SD R  +  +  A+     +S  
Sbjct  73   LGF----LEQSIRAIEADRTKYAHIDRVQVSSRKSFVSDTRQDLMAMTAAL-----TSDA  123

Query  525  SVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            +  ++RR+   +  P  +   P      + +  +A E   Q  +IK+QD +LDEL  SV 
Sbjct  124  AKSKVRRDERKMLAP--LTPAP-----IDRNSILADEKQHQQQIIKEQDKDLDELHTSVN  176

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMK  208
            R+G V +TI+ E+++Q++++ D+ +++D T+ R++FV  +++ ++K
Sbjct  177  RLGQVAVTINSEIKSQNEMLKDVDADLDDTTERMNFVMAKMSRLLK  222



>ref|XP_001488966.2| PREDICTED: syntaxin-6 [Equus caballus]
 ref|XP_008541917.1| PREDICTED: syntaxin-6 isoform X1 [Equus przewalskii]
Length=255

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/235 (26%), Positives = 120/235 (51%), Gaps = 18/235 (8%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDE  682
            +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSAATREEIDWTTNELRNNLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +  
Sbjct  64   LDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERKNR  120

Query  501  LMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASV  349
               L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S S+
Sbjct  121  QALLGDSGSQNWSTGTADKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSGSI  180

Query  348  RRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
              +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  181  GVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_003785700.1| PREDICTED: syntaxin-6 [Otolemur garnettii]
Length=255

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 121/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWNTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_001230649.1| syntaxin-6 [Sus scrofa]
Length=255

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 119/242 (49%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P +   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPTTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSIQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_005363947.1| PREDICTED: syntaxin-6 [Microtus ochrogaster]
Length=255

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/241 (25%), Positives = 122/241 (51%), Gaps = 26/241 (11%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS +  +  R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQM----SSSSVQALTER  117

Query  507  RELMNL-------------PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            +    L              D +  +D+  + +   N  ++  +   Q L+++QQD++L+
Sbjct  118  KNRQALLGDSSSQNWSTGVTDRYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLE  174

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
             +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q
Sbjct  175  LVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQ  234

Query  186  F  184
            +
Sbjct  235  W  235



>ref|XP_004643487.1| PREDICTED: syntaxin-6 [Octodon degus]
Length=255

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 123/238 (52%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSAATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +        L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSTS-SVQALAERKNR  120

Query  507  RELM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L+           + D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S
Sbjct  121  QALLGDSGSQNWSTGVTDQYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_008250553.1| PREDICTED: syntaxin-6 [Oryctolagus cuniculus]
Length=255

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 60/241 (25%), Positives = 121/241 (50%), Gaps = 26/241 (11%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P+    +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSIATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     +S +  +  R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSVRKAFITSTRQVVRDMKDQM----SASSVQALAER  117

Query  507  RELMNL-------------PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            R    L             PD +  +D+  + +   N  ++  +   Q L+++QQD++L+
Sbjct  118  RNRQALLGDSGGQSWSSRAPDKYGRLDRELQVA---NSHFIEEQQAQQQLIVEQQDEQLE  174

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
             +S S+  +  +   I  EL  Q  +++    E++ST +RLD V K++A V    S + Q
Sbjct  175  LVSGSIGVLKSMSQRIGGELEEQAVMLDGFSHELESTQSRLDNVMKKLAKVSHMTSDRRQ  234

Query  186  F  184
            +
Sbjct  235  W  235



>ref|XP_004372939.1| PREDICTED: syntaxin-6 [Trichechus manatus latirostris]
Length=255

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 122/241 (51%), Gaps = 26/241 (11%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     +S +  +  R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQM----STSSVQALAER  117

Query  507  RELMNL-------------PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            +    L              D +  +D+  + +   N  ++  +   Q L+++QQD++L+
Sbjct  118  KNRQALLGESGGQNWNTGTTDKYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLE  174

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
             +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q
Sbjct  175  LVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQ  234

Query  186  F  184
            +
Sbjct  235  W  235



>ref|XP_008699353.1| PREDICTED: syntaxin-6 isoform X1 [Ursus maritimus]
Length=255

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 122/238 (51%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDQ-MSASSVQALAERKNR  120

Query  507  RELM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L+             D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S
Sbjct  121  QALLGDSGGQNWSSGTTDKYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_007609029.1| PREDICTED: syntaxin-6 isoform X2 [Cricetulus griseus]
Length=255

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 123/238 (52%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQ-MSASSVQALTERKNR  120

Query  507  RELM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L+           + D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S
Sbjct  121  QALLGDSSSQNWNTGVTDRYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_004269872.1| PREDICTED: syntaxin-6 [Orcinus orca]
 ref|XP_007188250.1| PREDICTED: syntaxin-6 isoform X1 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007448573.1| PREDICTED: syntaxin-6 [Lipotes vexillifer]
Length=255

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 121/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSTGTMDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_067408.1| syntaxin-6 [Mus musculus]
 sp|Q9JKK1.1|STX6_MOUSE RecName: Full=Syntaxin-6 [Mus musculus]
 gb|AAF40221.1|AF237814_1 syntaxin 6 [Mus musculus]
 dbj|BAB31549.1| unnamed protein product [Mus musculus]
 gb|AAH29205.1| Syntaxin 6 [Mus musculus]
 dbj|BAC27505.1| unnamed protein product [Mus musculus]
 dbj|BAC32135.1| unnamed protein product [Mus musculus]
 dbj|BAC33556.1| unnamed protein product [Mus musculus]
Length=255

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 122/236 (52%), Gaps = 20/236 (8%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDE  682
            +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL  R+ + +  R  V ++K   +       L+  + R+ 
Sbjct  64   LDETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQ-MSASSVQALAERKNRQA  122

Query  501  LM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSAS  352
            L+           + D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S S
Sbjct  123  LLGDSSSQSWNAGVADRYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVSGS  179

Query  351  VRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  180  IGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>emb|CCI40246.1| unnamed protein product [Albugo candida]
Length=227

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 56/227 (25%), Positives = 116/227 (51%), Gaps = 17/227 (7%)
 Frame = -2

Query  867  LGHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERI------PNSGEHQQLVKELLAACE  706
            +   + A+ DPFY+ K+E++ +I  +   +  W+ I      P S E  QL  E+     
Sbjct  1    MSSNVEASSDPFYVFKDEMESTIAAVNVKYTHWKLIMELEDSPMSKELPQLTTEIEKKIA  60

Query  705  SISWQVDELDKTISIASKD-PAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSG  529
            +    +  LD+TI I   +   +  I++ E+ KRR + +  + ++ ++ K +        
Sbjct  61   AAEHSLQFLDQTIVIVEANRKKFEHIDQTEIFKRREFVATKKMELVSISKEI--------  112

Query  528  LSVIEMRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASV  349
             S IE+RR +    +  Q++ K       + D+ +A     Q  L+++QD+ L+ LS SV
Sbjct  113  -STIEVRRRIEK-EEKKQLMPKEFPMYEPSGDNVIATHDRVQQQLMEEQDESLNGLSESV  170

Query  348  RRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMK  208
              +  V + I++E+  Q+K++++L  ++D    R+++V  R++ ++K
Sbjct  171  SHLNSVAVEINNEISTQNKMLDELSHDVDEAQDRMNYVLDRISRLLK  217



>emb|CAG46671.1| STX6 [Homo sapiens]
Length=255

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRRFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_007188251.1| PREDICTED: syntaxin-6 isoform X2 [Balaenoptera acutorostrata 
scammoni]
Length=253

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 119/234 (51%), Gaps = 18/234 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSTGTMDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPK  193
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S K
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSGK  232



>ref|XP_005319791.1| PREDICTED: syntaxin-6 [Ictidomys tridecemlineatus]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 119/242 (49%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSAATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDY--------------VAAESDTQLLLIKQQDDEL  370
                 L D          +ST   D Y              +  +   Q L+++QQD++L
Sbjct  119  NRQALLGDS-----GSQTWSTGTTDQYGRLDRELHLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>gb|AAX37103.1| syntaxin 6 [synthetic construct]
Length=256

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRRFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_005375048.1| PREDICTED: syntaxin-6 [Chinchilla lanigera]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/242 (26%), Positives = 119/242 (49%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P +   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPPAATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GSQNWSTGTTDQYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>gb|ESA10383.1| hypothetical protein GLOINDRAFT_348219 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX75091.1| Tlg1p [Rhizophagus irregularis DAOM 197198w]
Length=253

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/224 (23%), Positives = 117/224 (52%), Gaps = 14/224 (6%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERIPNS------GEHQQLVKELLAACESISWQVDEL  679
            DPF+ VKE+I+ ++   L+ F  W RI N+       E ++  +EL    + I   +D++
Sbjct  5    DPFFTVKEDIENNVATALTLFNSWNRIYNTVSSRNNEELKRTEEELRTTLQEIITDLDDV  64

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            ++TI +   +P  +G+ + E+  RR +    R ++  ++  + +      L+     +EL
Sbjct  65   EETIKVVESNPDKFGLTKTEIESRREFVEQTRQRLQEIR--LTLDDPPKRLNSTGNHQEL  122

Query  498  MNLPDPHQIVDK---PNKYSTA---NNDDYVAAESDTQLLLIKQQDDELDELSASVRRIG  337
            ++     ++ ++    ++Y      +N  ++  E+  Q +L+++QD++L+ L  + + I 
Sbjct  123  IDGYKSTKVFEQVRSKSRYEEVIEMDNTRFIENEAQQQTILMREQDEQLESLYGTAKNIH  182

Query  336  GVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKK  205
             +  T+  EL  Q+ ++++ G ++D    RL+   K+VA V+K+
Sbjct  183  EIATTVGTELEDQNMLLSEFGEQVDRAQGRLERAMKKVAYVIKQ  226



>ref|NP_001248229.1| syntaxin-6 [Macaca mulatta]
 ref|XP_005540213.1| PREDICTED: syntaxin-6 [Macaca fascicularis]
 ref|XP_007987494.1| PREDICTED: syntaxin-6 [Chlorocebus sabaeus]
 ref|XP_010373941.1| PREDICTED: syntaxin-6 [Rhinopithecus roxellana]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTADKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_005810.1| syntaxin-6 isoform 1 [Homo sapiens]
 ref|NP_001126499.1| syntaxin-6 [Pongo abelii]
 ref|XP_514037.2| PREDICTED: syntaxin-6 [Pan troglodytes]
 ref|XP_003824773.1| PREDICTED: syntaxin-6 isoform X1 [Pan paniscus]
 ref|XP_003925366.1| PREDICTED: syntaxin-6 [Saimiri boliviensis boliviensis]
 ref|XP_004028050.1| PREDICTED: syntaxin-6 [Gorilla gorilla gorilla]
 sp|O43752.1|STX6_HUMAN RecName: Full=Syntaxin-6 [Homo sapiens]
 sp|Q5R6Q2.1|STX6_PONAB RecName: Full=Syntaxin-6 [Pongo abelii]
 emb|CAA05177.1| syntaxin 6 [Homo sapiens]
 gb|AAH09944.1| Syntaxin 6 [Homo sapiens]
 emb|CAG46654.1| STX6 [Homo sapiens]
 emb|CAH92558.1| hypothetical protein [Pongo abelii]
 gb|AAX36644.1| syntaxin 6 [synthetic construct]
 gb|EAW91091.1| syntaxin 6, isoform CRA_a [Homo sapiens]
 gb|ABM82858.1| syntaxin 6 [synthetic construct]
 gb|ABM86045.1| syntaxin 6 [synthetic construct]
 dbj|BAG35349.1| unnamed protein product [Homo sapiens]
 dbj|BAJ20352.1| syntaxin 6 [synthetic construct]
 gb|AIC50553.1| STX6, partial [synthetic construct]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_001075900.1| syntaxin-6 [Bos taurus]
 ref|XP_005901627.1| PREDICTED: syntaxin-6 [Bos mutus]
 ref|XP_010848477.1| PREDICTED: syntaxin-6 [Bison bison bison]
 gb|AAI33526.1| STX6 protein [Bos taurus]
 tpg|DAA21045.1| TPA: syntaxin 6 [Bos taurus]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 122/238 (51%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQ-MSASSVQALAERKNR  120

Query  507  RELM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L+             D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S
Sbjct  121  QALLGDSGGQNWSSGTTDKYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_006736912.1| PREDICTED: syntaxin-6 [Leptonychotes weddellii]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPD------PHQIVDKPNKYS---TANNDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D          +DK  +        N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGGQNWSAGTMDKSGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|NP_113853.1| syntaxin-6 [Rattus norvegicus]
 sp|Q63635.1|STX6_RAT RecName: Full=Syntaxin-6 [Rattus norvegicus]
 gb|AAC52709.1| syntaxin 6 [Rattus norvegicus]
 gb|AAH81769.1| Syntaxin 6 [Rattus norvegicus]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/236 (25%), Positives = 122/236 (52%), Gaps = 20/236 (8%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDE  682
            +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNTAQGLFQRWTELLQGPSAATREEIDWTTNELRNNLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL  R+ + +  R  V ++K   +       L+  + R+ 
Sbjct  64   LDETISIVEANPRKFNLDATELSIRKAFITSTRQIVRDMKDQ-MSASSVQALAERKNRQA  122

Query  501  LM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSAS  352
            L+           + D +  +D+  + +   N  ++  +   Q L+++QQD++L+ +S S
Sbjct  123  LLGDSSSQNWDAGVTDRYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLELVSGS  179

Query  351  VRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            +  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  180  IGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_005049933.1| PREDICTED: syntaxin-6 [Ficedula albicollis]
Length=311

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 67/249 (27%), Positives = 124/249 (50%), Gaps = 17/249 (7%)
 Frame = -2

Query  894  MLLQVNIL*LGHKMSAAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---  733
            +LL VN   LG + +A QD       E+Q++++     F++W  +   P+    +++   
Sbjct  48   LLLLVN---LGEQFTA-QDHRACKCREVQKAVNTAQGLFQRWTELLQDPSIATREEIDWT  103

Query  732  VKELLAACESISWQVDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAV  553
              EL     SI W +++LD+TISI   +P  + ++  ELG R+ + +  R  V ++K   
Sbjct  104  TNELRNNLRSIEWDLEDLDETISIVEANPRKFNLDATELGIRKAFITSTRQVVRDMKDQ-  162

Query  552  IVGQESSGLSVIEMRRELMNLPDPHQIVDKPNKYSTAN------NDDYVAAESDTQLLLI  391
            +       L+  + R+ L+           P+KYS  +      N  ++  +   Q L++
Sbjct  163  MSNSSMQALAERKNRQALLGESGSQSWSSGPDKYSRLDRELQLANSHFIEEQQAQQQLIV  222

Query  390  KQQDDELDELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVM  211
            +QQD++L+ +S S+  +  +   I  EL  Q  +++D   E+DST +RLD V K++A V 
Sbjct  223  EQQDEQLELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELDSTQSRLDNVMKKLAKVS  282

Query  210  KKASPKGQF  184
               S + Q+
Sbjct  283  HMTSDRRQW  291



>ref|XP_004998963.1| hypothetical protein PTSG_00414 [Salpingoeca rosetta]
 gb|EGD72394.1| hypothetical protein PTSG_00414 [Salpingoeca rosetta]
Length=247

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/212 (25%), Positives = 114/212 (54%), Gaps = 13/212 (6%)
 Frame = -2

Query  855  MSAAQDPFYIVKEEIQESIDRLLSTFRQWERIPNS-----GEHQQLVKELLAACESISWQ  691
            M+++ DP+++VKEE++ SI      + +W+R+  S      E +   ++L    +SI W 
Sbjct  1    MASSTDPYFVVKEEVENSIANAERLYARWQRMFTSRSADDAEFKHTTEQLKTNIKSIEWD  60

Query  690  VDELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIE-  514
            +++L +T+SIA ++P  + +++ EL  R  +   ++ ++    KA+  G   + +   + 
Sbjct  61   LEDLAETVSIAMREPHKFNLSQSELSNRNDFIETSKQKL----KALKDGTSDARIKAKQE  116

Query  513  --MRRELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELSASVRRI  340
               R +LM     +   +K  +   A N  ++  +  +Q +++++QD +L E+  ++  +
Sbjct  117  KDQRSDLMGRS-KYSRYEKLEREIQAENQGFIDDQQQSQQMVMREQDTQLQEVGQTIGVL  175

Query  339  GGVGLTIHDELRAQDKIINDLGSEMDSTSTRL  244
              +G+ I DEL  Q+ ++ ++  EM STS RL
Sbjct  176  KNMGIMIGDELDEQNDMLEEMDEEMTSTSDRL  207



>ref|XP_003451335.1| PREDICTED: syntaxin-6-like isoform X1 [Oreochromis niloticus]
Length=254

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 119/234 (51%), Gaps = 17/234 (7%)
 Frame = -2

Query  843  QDPFYIVKEEIQESIDRLLSTFRQWERIPNSG------EHQQLVKELLAACESISWQVDE  682
            +DPF++VK E+Q++++   S   +W  +   G      E      EL  +  SI W +++
Sbjct  4    EDPFFVVKGEVQKAVNAAQSLHHRWSELMAEGGGASKEEIDWTTNELRNSLRSIEWDLED  63

Query  681  LDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRRE  502
            LD+TISI   +P  + ++  EL KR+ + +  R  V  +K  + +   +S     + ++ 
Sbjct  64   LDETISIVESNPKKFNLDAAELSKRKAFINSTRVAVKEMKDQMSIPPAASDR---KNKQA  120

Query  501  LMNLPDPHQIVDKP--NKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
            L+        + +P  +KYS  +      N  ++  +   Q L+ +QQ+++L+ +S ++ 
Sbjct  121  LLGERGAQGPIWQPGADKYSRLDHQLQNANSQFIEEQQVQQQLIAEQQEEQLELVSGTIG  180

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  +++D G EMD+T ++LD V K++A V    S + Q+
Sbjct  181  VLKNMSERIGMELDEQAVMLDDFGHEMDNTQSKLDNVMKKLAKVSHMTSDRRQW  234



>ref|XP_007105191.1| PREDICTED: syntaxin-6 isoform X4 [Physeter catodon]
Length=231

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 116/232 (50%), Gaps = 28/232 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMV  214
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKV  225



>ref|XP_002760345.1| PREDICTED: syntaxin-6 [Callithrix jacchus]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 120/237 (51%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_003999333.1| PREDICTED: syntaxin-6 isoform X1 [Felis catus]
 ref|XP_007096260.1| PREDICTED: syntaxin-6 [Panthera tigris altaica]
Length=255

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDHM---SPSSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +S    + YV  + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSAGTTEKYVRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>gb|AAV38194.1| syntaxin 6 [synthetic construct]
 gb|AAX42786.1| syntaxin 6 [synthetic construct]
Length=256

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 118/234 (50%), Gaps = 18/234 (8%)
 Frame = -2

Query  840  DPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQVDEL  679
            DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +++L
Sbjct  5    DPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDLEDL  64

Query  678  DKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMRREL  499
            D+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +   
Sbjct  65   DETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERKNRQ  121

Query  498  MNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSASVR  346
              L D    +      +KY   +      N  ++  +   Q L+++QQD++L+ +S S+ 
Sbjct  122  ALLGDSGSQNWSTGTTDKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSGSIG  181

Query  345  RIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  182  VLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_006876492.1| PREDICTED: syntaxin-6 [Chrysochloris asiatica]
Length=255

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 122/241 (51%), Gaps = 26/241 (11%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     +S +  +  R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQM----STSSVQALAER  117

Query  507  RELMNL-------------PDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELD  367
            +    L              D +  +D+  + +   N  ++  +   Q L+++QQD++L+
Sbjct  118  KNRQALLGESGGQNWNAGTMDKYGRLDRELQLA---NSHFIEEQQAQQQLIVEQQDEQLE  174

Query  366  ELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQ  187
             +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q
Sbjct  175  LVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQ  234

Query  186  F  184
            +
Sbjct  235  W  235



>ref|XP_003893490.1| PREDICTED: syntaxin-6 [Papio anubis]
Length=255

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 61/237 (26%), Positives = 119/237 (50%), Gaps = 18/237 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDP---HQIVDKPNKYSTAN------NDDYVAAESDTQLLLIKQQDDELDELSA  355
                 L D    +       KY   +      N  ++  +   Q L+++QQD++L+ +S 
Sbjct  119  NRQALLGDSGSQNWSTGTAEKYGRLDRELQRANSHFIEEQQAQQQLIVEQQDEQLELVSG  178

Query  354  SVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
            S+  +  +   I  EL  Q  ++ D   E++ST +RLD V K++A V    S + Q+
Sbjct  179  SIGVLKNMSQRIGGELEEQAVMLEDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



>ref|XP_008827965.1| PREDICTED: syntaxin-6 [Nannospalax galili]
Length=255

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/242 (26%), Positives = 120/242 (50%), Gaps = 28/242 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDGTELSIRKAFITSTRQIVRDMKDQMST---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +S+   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----SSQNWSSGTTDQYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKG  190
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + 
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRR  233

Query  189  QF  184
            Q+
Sbjct  234  QW  235



>ref|XP_007105190.1| PREDICTED: syntaxin-6 isoform X3 [Physeter catodon]
Length=241

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 116/232 (50%), Gaps = 28/232 (12%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K  +     SS  ++ E +
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKAFITSTRQVVRDMKDQMSA---SSVQALAERK  118

Query  507  RELMNLPDPHQIVDKPNKYSTANNDDYVAAESDTQL--------------LLIKQQDDEL  370
                 L D          +ST   D Y   + + QL              L+++QQD++L
Sbjct  119  NRQALLGDS-----GGQNWSTGTTDKYGRLDRELQLANSHFIEEQQAQQQLIVEQQDEQL  173

Query  369  DELSASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMV  214
            + +S S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V
Sbjct  174  ELVSGSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKV  225



>ref|XP_002920847.1| PREDICTED: syntaxin-6-like [Ailuropoda melanoleuca]
Length=255

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 59/238 (25%), Positives = 121/238 (51%), Gaps = 20/238 (8%)
 Frame = -2

Query  849  AAQDPFYIVKEEIQESIDRLLSTFRQWERI---PNSGEHQQL---VKELLAACESISWQV  688
            + +DPF++VK E+Q++++     F++W  +   P++   +++     EL     SI W +
Sbjct  2    SMEDPFFVVKGEVQKAVNTAQGLFQRWTELLQDPSTATREEIDWTTNELRNNLRSIEWDL  61

Query  687  DELDKTISIASKDPAWYGINEVELGKRRRWTSDARTQVGNVKKAVIVGQESSGLSVIEMR  508
            ++LD+TISI   +P  + ++  EL  R+ + +  R  V ++K   +       L+  + R
Sbjct  62   EDLDETISIVEANPRKFNLDATELSIRKTFITSTRQVVRDMKDQ-MSASSVQALAERKNR  120

Query  507  RELM----------NLPDPHQIVDKPNKYSTANNDDYVAAESDTQLLLIKQQDDELDELS  358
            + L+             D +  +D+  + +   N  ++  +   Q L+++QQD+ L+ +S
Sbjct  121  QALLGDSGGQNWSSGTTDKYGRLDRELQLA---NSHFIEDQQAQQQLIVEQQDEHLELVS  177

Query  357  ASVRRIGGVGLTIHDELRAQDKIINDLGSEMDSTSTRLDFVQKRVAMVMKKASPKGQF  184
             S+  +  +   I  EL  Q  +++D   E++ST +RLD V K++A V    S + Q+
Sbjct  178  GSIGVLKNMSQRIGGELEEQAVMLDDFSHELESTQSRLDNVMKKLAKVSHMTSDRRQW  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2070268854280