BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21682_g1_i1 len=958 path=[936:0-475 1412:476-521 1458:522-567
1504:568-574 1511:575-626 1563:627-679 1616:680-749 1686:750-957]

Length=958
                                                                      Score     E

ref|XP_011095911.1|  PREDICTED: uncharacterized protein LOC105175232    135   2e-34   
ref|XP_009631224.1|  PREDICTED: uncharacterized protein LOC104121033    130   1e-32   
ref|XP_004250260.2|  PREDICTED: uncharacterized protein LOC101254753    129   3e-32   
ref|XP_009773625.1|  PREDICTED: uncharacterized protein LOC104223821    129   4e-32   
ref|XP_006352362.1|  PREDICTED: uncharacterized protein LOC102598521    129   5e-32   
ref|XP_009757696.1|  PREDICTED: uncharacterized protein LOC104210486    129   9e-32   
ref|XP_002275440.1|  PREDICTED: uncharacterized protein LOC100263809    125   2e-30   Vitis vinifera
ref|XP_010039483.1|  PREDICTED: uncharacterized protein LOC104428178    122   7e-30   
ref|XP_009590285.1|  PREDICTED: uncharacterized protein LOC104087498    123   8e-30   
ref|XP_011086267.1|  PREDICTED: uncharacterized protein LOC105168050    122   1e-29   
gb|EYU33834.1|  hypothetical protein MIMGU_mgv1a025015mg                117   1e-27   
gb|KDP35508.1|  hypothetical protein JCGZ_08946                         115   3e-27   
ref|XP_010686624.1|  PREDICTED: uncharacterized protein LOC104900801    115   7e-27   
ref|XP_010087660.1|  hypothetical protein L484_010612                   113   3e-26   
ref|XP_006449928.1|  hypothetical protein CICLE_v10016770mg             112   7e-26   
ref|XP_002322501.2|  hypothetical protein POPTR_0016s00790g             112   8e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011002371.1|  PREDICTED: uncharacterized protein LOC105109369    112   1e-25   
ref|XP_011040166.1|  PREDICTED: uncharacterized protein LOC105136486    112   1e-25   
emb|CDP04533.1|  unnamed protein product                                110   2e-25   
ref|XP_007026368.1|  Pollen Ole e 1 allergen and extensin family ...    111   2e-25   
ref|XP_010039440.1|  PREDICTED: uncharacterized protein LOC104428144    110   2e-25   
emb|CBI18639.3|  unnamed protein product                                110   2e-25   
ref|XP_006467274.1|  PREDICTED: uncharacterized protein LOC102611527    111   2e-25   
gb|AFK48643.1|  unknown                                                 110   2e-25   
ref|XP_002307854.1|  hypothetical protein POPTR_0006s00740g             110   6e-25   Populus trichocarpa [western balsam poplar]
ref|XP_010057789.1|  PREDICTED: uncharacterized protein LOC104445586    109   8e-25   
ref|NP_001235461.1|  uncharacterized protein LOC100527138 precursor     107   2e-24   
gb|KCW75105.1|  hypothetical protein EUGRSUZ_E03855                     107   2e-24   
ref|XP_010440040.1|  PREDICTED: uncharacterized protein LOC104723382    105   7e-24   
ref|XP_010517410.1|  PREDICTED: uncharacterized protein LOC104792861    105   1e-23   
ref|XP_006295116.1|  hypothetical protein CARUB_v10024190mg             105   1e-23   
ref|XP_010505718.1|  PREDICTED: uncharacterized protein LOC104782478    105   2e-23   
ref|XP_010508913.1|  PREDICTED: uncharacterized protein LOC104785405    105   2e-23   
gb|KFK31357.1|  hypothetical protein AALP_AA6G101900                    104   2e-23   
ref|XP_006281226.1|  hypothetical protein CARUB_v10027269mg             104   3e-23   
ref|XP_004139527.1|  PREDICTED: uncharacterized protein LOC101215830    103   1e-22   
gb|KHG07811.1|  Elongation factor Ts                                    103   1e-22   
ref|XP_010481298.1|  PREDICTED: uncharacterized protein LOC104760...    102   1e-22   
ref|XP_006411260.1|  hypothetical protein EUTSA_v10017342mg             100   5e-22   
ref|XP_010252764.1|  PREDICTED: uncharacterized protein LOC104594245    101   5e-22   
ref|XP_002879845.1|  hypothetical protein ARALYDRAFT_483053             100   6e-22   
ref|XP_009396441.1|  PREDICTED: uncharacterized protein LOC103981437    101   7e-22   
emb|CDY61707.1|  BnaC04g56700D                                          100   7e-22   
ref|XP_009143252.1|  PREDICTED: uncharacterized protein LOC103866982    100   8e-22   
emb|CDX74807.1|  BnaA05g05530D                                          100   8e-22   
ref|XP_004166075.1|  PREDICTED: uncharacterized protein LOC101231184    100   1e-21   
ref|XP_007154046.1|  hypothetical protein PHAVU_003G086700g           99.8    1e-21   
ref|XP_010441432.1|  PREDICTED: uncharacterized protein LOC104724601  99.4    2e-21   
ref|XP_010495000.1|  PREDICTED: uncharacterized protein LOC104772052  99.0    2e-21   
emb|CDY20519.1|  BnaC04g05250D                                        99.4    2e-21   
ref|XP_010530071.1|  PREDICTED: uncharacterized protein LOC104806736  98.2    4e-21   
ref|XP_010449652.1|  PREDICTED: uncharacterized protein LOC104731856  97.8    4e-21   
ref|XP_002522879.1|  conserved hypothetical protein                   98.2    5e-21   Ricinus communis
ref|XP_010481300.1|  PREDICTED: uncharacterized protein LOC104760...  97.8    6e-21   
ref|XP_002863328.1|  hypothetical protein ARALYDRAFT_330672           97.4    7e-21   
ref|XP_006398462.1|  hypothetical protein EUTSA_v10001056mg           97.8    7e-21   
ref|NP_568686.1|  pollen Ole e 1 allergen and extensin family pro...  97.1    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDY25956.1|  BnaC09g20310D                                        97.1    1e-20   
ref|XP_008463598.1|  PREDICTED: uncharacterized protein LOC103501709  97.4    2e-20   
emb|CDY07055.1|  BnaA04g22600D                                        96.3    2e-20   
ref|XP_010939224.1|  PREDICTED: uncharacterized protein LOC105058...  96.7    2e-20   
ref|XP_010434705.1|  PREDICTED: uncharacterized protein LOC104718625  95.5    2e-20   
emb|CDY17718.1|  BnaA06g35370D                                        95.9    3e-20   
gb|EYU27658.1|  hypothetical protein MIMGU_mgv1a025896mg              95.5    3e-20   
gb|AAM62822.1|  unknown                                               95.9    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850326.2|  pollen Ole e 1 allergen and extensin family pro...  95.9    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101400.1|  PREDICTED: uncharacterized protein LOC103827630  95.5    4e-20   
ref|XP_008790321.1|  PREDICTED: uncharacterized protein LOC103707566  95.9    5e-20   
ref|XP_010936417.1|  PREDICTED: uncharacterized protein LOC105056054  95.1    7e-20   
ref|XP_008785642.1|  PREDICTED: uncharacterized protein LOC103704219  95.1    8e-20   
ref|XP_009114262.1|  PREDICTED: uncharacterized protein LOC103839515  94.0    1e-19   
ref|XP_008224628.1|  PREDICTED: uncharacterized protein LOC103324359  95.9    1e-19   
ref|XP_009374857.1|  PREDICTED: uncharacterized protein LOC103963728  95.1    2e-19   
ref|XP_009141865.1|  PREDICTED: uncharacterized protein LOC103865...  93.2    3e-19   
ref|XP_004293399.1|  PREDICTED: uncharacterized protein LOC101300...  94.4    3e-19   
ref|XP_010518741.1|  PREDICTED: uncharacterized protein LOC104798379  92.4    3e-19   
gb|KEH32686.1|  pollen Ole e I family allergen                        93.6    4e-19   
emb|CDY41060.1|  BnaA09g18390D                                        92.4    5e-19   
ref|XP_004250296.1|  PREDICTED: uncharacterized protein LOC101265501  92.0    7e-19   
ref|XP_006856296.1|  hypothetical protein AMTR_s00047p00112050        92.4    7e-19   
ref|XP_008384181.1|  PREDICTED: uncharacterized protein LOC103446815  93.2    7e-19   
emb|CDY69950.1|  BnaCnng66060D                                        90.9    2e-18   
ref|XP_008345789.1|  PREDICTED: uncharacterized protein LOC103408743  92.4    2e-18   
ref|XP_006352324.1|  PREDICTED: uncharacterized protein LOC102586293  90.5    2e-18   
ref|XP_009372506.1|  PREDICTED: uncharacterized protein LOC103961353  92.0    2e-18   
ref|XP_009144665.1|  PREDICTED: uncharacterized protein LOC103868310  89.7    3e-18   
ref|NP_001064319.1|  Os10g0208600                                     89.7    8e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571441.1|  PREDICTED: uncharacterized protein LOC100842350  89.7    8e-18   
gb|EEC66705.1|  hypothetical protein OsI_33026                        88.6    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009141866.1|  PREDICTED: uncharacterized protein LOC103865...  87.0    2e-17   
ref|XP_004507594.1|  PREDICTED: uncharacterized protein LOC101497330  88.2    2e-17   
gb|AAM67093.1|  unknown                                               87.0    2e-17   Arabidopsis thaliana [mouse-ear cress]
gb|ABD65108.1|  hypothetical protein 31.t00008                        86.7    4e-17   Brassica oleracea
ref|XP_006284709.1|  hypothetical protein CARUB_v10005967mg           85.5    9e-17   
ref|XP_002870116.1|  hypothetical protein ARALYDRAFT_493155           85.5    1e-16   
ref|NP_567524.1|  pollen Ole e 1 allergen and extensin family pro...  85.1    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136830.1|  PREDICTED: uncharacterized protein LOC103860901  83.6    4e-16   
ref|XP_009419523.1|  PREDICTED: uncharacterized protein LOC103999488  83.2    1e-15   
dbj|BAJ99708.1|  predicted protein                                    82.0    3e-15   
gb|EEC66696.1|  hypothetical protein OsI_33016                        82.0    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006665084.1|  PREDICTED: uncharacterized protein LOC102720850  82.8    4e-15   
ref|NP_001064313.1|  Os10g0206500                                     81.6    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABD65131.1|  hypothetical protein 40.t00006                        80.5    5e-15   Brassica oleracea
ref|XP_006414259.1|  hypothetical protein EUTSA_v10026465mg           80.5    7e-15   
ref|XP_002466758.1|  hypothetical protein SORBIDRAFT_01g013620        81.3    1e-14   Sorghum bicolor [broomcorn]
ref|NP_001131971.2|  uncharacterized protein LOC100193369             77.8    6e-14   Zea mays [maize]
tpg|DAA50324.1|  TPA: hypothetical protein ZEAMMB73_534968            77.8    2e-13   
ref|XP_004956162.1|  PREDICTED: uncharacterized protein LOC101776137  76.3    3e-13   
ref|XP_007212536.1|  hypothetical protein PRUPE_ppa019383mg           73.9    1e-12   
gb|AAM18169.1|AC092172_29  Unknown protein                            59.7    6e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMT25847.1|  hypothetical protein F775_16133                       54.7    4e-06   
gb|AAL82668.2|AC092387_16  expressed protein                          53.9    1e-05   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18143.1|AC092172_3  Hypothetical protein                        53.9    1e-05   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_011095911.1| PREDICTED: uncharacterized protein LOC105175232 [Sesamum indicum]
Length=180

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 93/137 (68%), Gaps = 10/137 (7%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTID---EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSD  394
            + + FI LV L SPA A   +D   E+Y RE++VK AGYG++K+STVLI+G+++C     
Sbjct  14   VFMVFIVLVFLGSPAIATGKLDLLAELYGREDMVKWAGYGDEKLSTVLIDGKLLCHGSGG  73

Query  395  GDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLEN  574
             DE+   HP+SGA+VG+ C   G+        W KGSTD  G F+ID+PSHLHAIPNLE 
Sbjct  74   KDEA---HPVSGATVGVFCGARGKAKQA----WSKGSTDSYGEFVIDVPSHLHAIPNLEK  126

Query  575  ACLVRVLHLPKASICTQ  625
             C V+V+HLP++S C Q
Sbjct  127  ICHVKVVHLPRSSPCRQ  143



>ref|XP_009631224.1| PREDICTED: uncharacterized protein LOC104121033 [Nicotiana tomentosiformis]
Length=216

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 100/157 (64%), Gaps = 19/157 (12%)
 Frame = +2

Query  251  ILESPATANLTIDE-VYSREELVKMAGYGEDKISTVLIEGEVVCQTCSD--------GDE  403
            +LES A   ++I E +  RE+++KMAGYGE+K+STV I G+VVC   S          DE
Sbjct  34   VLESLAIKRVSIVESITMREDMIKMAGYGEEKLSTVFIHGKVVCDNDSGCNNNNNNIKDE  93

Query  404  SSSLHP--ISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENA  577
             S L P  + GASV + C  SG+        W + +TDEDG FLIDLPSHLHAIPNLE  
Sbjct  94   ISELGPRAVPGASVAVFCGSSGKARRS----WARNTTDEDGEFLIDLPSHLHAIPNLEKT  149

Query  578  CLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            CLV+VLHLP+ +IC +H +     KHKG++L  + +G
Sbjct  150  CLVKVLHLPRNTIC-EHSFRG---KHKGLELTSIGDG  182



>ref|XP_004250260.2| PREDICTED: uncharacterized protein LOC101254753 [Solanum lycopersicum]
Length=186

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 103/159 (65%), Gaps = 18/159 (11%)
 Frame = +2

Query  284  IDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSD--------GDESSSLH--PISGA  433
            ++ +Y R++++KMAGYGE+K+STV I G++VC    D         D++  L   PI GA
Sbjct  25   VESIYMRDDVIKMAGYGEEKLSTVFIHGKIVCHEYDDHGCNNIIIKDDNFQLESTPIQGA  84

Query  434  SVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKAS  613
            SVG+ C  SG+        W + +TDEDG FLIDLPSHLHAIPNLE  CLV+VL LP+ +
Sbjct  85   SVGVFCGSSGKTRRS----WARNTTDEDGDFLIDLPSHLHAIPNLEKTCLVKVLRLPRNT  140

Query  614  ICTQHYYYSRAPKHKGIQLIGVEEGtrtytthtihltPK  730
            IC   +      KHKG++LI +  G RTYT  TIHLTPK
Sbjct  141  ICEHAF----TGKHKGLELISIGGGIRTYTIQTIHLTPK  175



>ref|XP_009773625.1| PREDICTED: uncharacterized protein LOC104223821 [Nicotiana sylvestris]
Length=187

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 107/165 (65%), Gaps = 6/165 (4%)
 Frame = +2

Query  206  RVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVC--  379
            +++   +++ F F++ + S   +   + E+ + EEL KMAGYGE+K+STV+I G ++C  
Sbjct  2    KIILLRIIVVFFFILPIYSAILSENPLVELSNGEELGKMAGYGEEKLSTVIIHGTLLCHH  61

Query  380  -QTCSDG-DESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLH  553
             Q+C+D  D     HP+SGA V + C  S  +   SS  W K  T+E+G FLIDLPSHLH
Sbjct  62   HQSCADIIDTQLPPHPVSGAYVAVYCGTSEGKVRGSS--WSKNITNENGKFLIDLPSHLH  119

Query  554  AIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            +IPNLEN+C ++VLHLPK S+C +HY ++     + I+L  + +G
Sbjct  120  SIPNLENSCKIQVLHLPKDSLCHRHYSFTTKQYKRSIKLTSIGDG  164



>ref|XP_006352362.1| PREDICTED: uncharacterized protein LOC102598521 [Solanum tuberosum]
Length=200

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 106/159 (67%), Gaps = 18/159 (11%)
 Frame = +2

Query  284  IDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSD--------GDESSSL--HPISGA  433
            ++ +  R++++KMAGYGE+K+STV I G++VC    D         D++  L   PI GA
Sbjct  38   VESISMRDDVIKMAGYGEEKLSTVFIHGKIVCHEYDDHGCNNNIIKDDNFELGSTPIQGA  97

Query  434  SVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKAS  613
            SVG+ C  SG+        W + +TDEDG FLIDLPSHLHAIPNLE  CLV+VLHLP+ +
Sbjct  98   SVGVFCGSSGKTRRS----WARNTTDEDGDFLIDLPSHLHAIPNLEKTCLVKVLHLPRNT  153

Query  614  ICTQHYYYSRAPKHKGIQLIGVEEGtrtytthtihltPK  730
            IC +H +     KHKG++LI +  G RTYTT TIHLTPK
Sbjct  154  IC-EHAFRG---KHKGLELISIGGGIRTYTTQTIHLTPK  188



>ref|XP_009757696.1| PREDICTED: uncharacterized protein LOC104210486 [Nicotiana sylvestris]
Length=214

 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 110/170 (65%), Gaps = 17/170 (10%)
 Frame = +2

Query  248  VILESPATANLTIDE-VYSREELVKMAGYGEDKISTVLIEGEVVCQTCSD------GDES  406
            ++LES A   ++I E +   E+++KMAGYGE+K+STV I G+VVC   S        DE 
Sbjct  33   LVLESLAIERVSIVESIIMSEDMIKMAGYGEEKLSTVFIHGKVVCDNNSGCNNNNIKDEI  92

Query  407  SSL--HPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENAC  580
            S L   PI GASV + C  SG+        W + +TDEDG FLIDLPSHLHAIPNLE  C
Sbjct  93   SELGPRPIPGASVAVFCGSSGKARRS----WARNTTDEDGEFLIDLPSHLHAIPNLEKTC  148

Query  581  LVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEGtrtytthtihltPK  730
            LV+VLHLP+ +IC   +      KHKG++L  + +G RTYTT TIHLTPK
Sbjct  149  LVKVLHLPRNTICGHAFR----GKHKGLELTSIGDGIRTYTTDTIHLTPK  194



>ref|XP_002275440.1| PREDICTED: uncharacterized protein LOC100263809 [Vitis vinifera]
Length=196

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 101/166 (61%), Gaps = 8/166 (5%)
 Frame = +2

Query  194  FLICRVMASPLLLAFIFLVILESPATANLTI-DEVYSREELVKMAGYGEDKISTVLIEGE  370
            F +C+     ++L F+      S A    ++  E++SRE++V++AGYGE+K+STVL+ G 
Sbjct  4    FCVCKYNNLVIMLVFLVFFFGTSGAAGRESLLPELWSREDMVQVAGYGEEKLSTVLVTGT  63

Query  371  VVCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHL  550
            V+C TC D +  +   PISGASV + C  SG++   +     +G TDE+G F+IDLPS L
Sbjct  64   VLCHTCLDKESQNPSLPISGASVSVTCHASGKKRRSTL---AQGVTDENGDFIIDLPSEL  120

Query  551  HAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            HA+PNLE  C V V  LP+ S+C   +      KH+GI+L  V  G
Sbjct  121  HAVPNLEKTCSVEVHQLPRNSLCQPGFVR----KHRGIRLSSVGNG  162



>ref|XP_010039483.1| PREDICTED: uncharacterized protein LOC104428178 [Eucalyptus grandis]
 gb|KCW45987.1| hypothetical protein EUGRSUZ_L00155 [Eucalyptus grandis]
Length=175

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 9/157 (6%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            L + FIFLVI +  A+   ++ +  SR+ELV+MAGYGE K+ST+L+ G V+C      + 
Sbjct  4    LFIFFIFLVISDGAASTEGSLLKFSSRDELVEMAGYGEKKVSTILVVGSVLCVARLPREA  63

Query  404  SSSLH--PISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENA  577
               LH  P+SGA +G+ C +S  R   +   W +GSTDE G F IDLPSHLHA+P+L   
Sbjct  64   HHQLHAWPVSGALIGVKCQKSKSRIRSN---WTQGSTDEFGDFTIDLPSHLHAVPDLPKK  120

Query  578  CLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            C VR+L +P++S C   + +    +HK ++L  V +G
Sbjct  121  CSVRLLRVPRSSTCRPAHGH----RHKRLKLASVRDG  153



>ref|XP_009590285.1| PREDICTED: uncharacterized protein LOC104087498 [Nicotiana tomentosiformis]
Length=195

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 106/165 (64%), Gaps = 7/165 (4%)
 Frame = +2

Query  206  RVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVC--  379
            +++   +++ F F++ + S   ++  + E  + EEL KMAGYGE+K+STV+I G ++C  
Sbjct  2    KIILLRIIVVFFFVLPIYSAILSDNPLVEFSNGEELGKMAGYGEEKLSTVIIHGTLLCHH  61

Query  380  -QTCSDG-DESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLH  553
             Q+C+D  D     HP+SGA+V + C  S  +   SS  W K  T+E G F+IDLPSHLH
Sbjct  62   HQSCADIIDTHLPPHPVSGANVAVFCGTSEGKVRGSS--WSKNITNESGKFVIDLPSHLH  119

Query  554  AIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            +IPNLEN C +++LHLPK S+C +H  ++R    + I+L  + +G
Sbjct  120  SIPNLENTCKIQLLHLPKDSLCRRH-SFTRKQYKRSIKLTSIGDG  163



>ref|XP_011086267.1| PREDICTED: uncharacterized protein LOC105168050 [Sesamum indicum]
Length=199

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 12/162 (7%)
 Frame = +2

Query  257  ESPATANLTID----EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPI  424
            ++P T  +  D    E+    ++VK AGYGE+K+STV+I G+++C   +    SS  HP+
Sbjct  27   QTPTTHAMGEDDMAVELSGSNDVVKWAGYGEEKLSTVVIGGKLLCHATASHKLSSHPHPV  86

Query  425  SGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLP  604
            SGA V + C+  G+        W KGST+  G FLIDLPSHLHAIPNLE  C+V+VLHLP
Sbjct  87   SGALVAVFCAMGGKTRKS----WAKGSTNSYGEFLIDLPSHLHAIPNLEKVCIVQVLHLP  142

Query  605  KASICTQHYYYSRAPKHKGIQLIGVEEGtrtytthtihltPK  730
            ++S C     +S   KHK ++L  V EG R+YTTH IHL PK
Sbjct  143  RSSPC----RHSFTGKHKAMKLTSVGEGVRSYTTHNIHLMPK  180



>gb|EYU33834.1| hypothetical protein MIMGU_mgv1a025015mg [Erythranthe guttata]
Length=209

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 94/154 (61%), Gaps = 12/154 (8%)
 Frame = +2

Query  236  FIFLVILESPATANLTID----EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
             I LV L++PATA    +    E+  REELV   GYGE+K+STV+I G+++C   +    
Sbjct  16   MICLVFLQTPATAAGKAEGLAAELPRREELVHWGGYGEEKLSTVVISGKLLCHAGAHDKL  75

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            S   +P+SGAS+ + C  S ++       W  G T+  G F+IDLPSHLHAIPNLE  C+
Sbjct  76   SGHPYPVSGASMAVFCGTSEKKKKS----WAVGRTNNYGEFVIDLPSHLHAIPNLEKTCV  131

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEE  685
            V+VLH+PK+S C + +      K+K I+L  V E
Sbjct  132  VKVLHVPKSSPCGRAF----TGKNKRIKLKSVGE  161



>gb|KDP35508.1| hypothetical protein JCGZ_08946 [Jatropha curcas]
Length=181

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/160 (41%), Positives = 87/160 (54%), Gaps = 17/160 (11%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            +   F+ ++I    +++     E  SREE+V+ AGYGE+K+STVLI G ++C+ C     
Sbjct  1    MTFNFLLMMIFLQRSSSMAEGFEFSSREEMVRFAGYGEEKLSTVLITGSILCEACLHSQP  60

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGS-----TDEDGGFLIDLPSHLHAIPNL  568
                 P+SGA V I C             W+K S     TDE G F IDLPSHLHAIPNL
Sbjct  61   KLQTWPLSGALVAINC--------DMKGKWIKASSAQAVTDEYGDFQIDLPSHLHAIPNL  112

Query  569  ENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            E+ C V+VL +PK S C   +    A KHK + L    +G
Sbjct  113  ESTCSVKVLRIPKNSACKPAF----ARKHKALTLSSAGDG  148



>ref|XP_010686624.1| PREDICTED: uncharacterized protein LOC104900801 [Beta vulgaris 
subsp. vulgaris]
Length=215

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 103/177 (58%), Gaps = 19/177 (11%)
 Frame = +2

Query  194  FLICRVMASPLLLAFIFLVILESPATAN-LTID---EVYSREELVKMAGYGEDKISTVLI  361
             L+  ++AS +L +   L++ + P   + L +    E+ SR+E+V++AGYGE+K+STVLI
Sbjct  16   LLVALILASMILNSQCRLIVSQLPGEEDDLGMKWALEMSSRDEIVQLAGYGEEKLSTVLI  75

Query  362  EGEVVC-QTCSDGDESSSLH-------PISGASVGILCsrsgrrasfssssWVKGSTDED  517
             G VVC + C     SS+ H       PISGA VG+ C     +++     WVK  TD  
Sbjct  76   TGGVVCNKACLATKHSSNHHQLQLSPQPISGALVGVACHTKKDKSTH----WVKAVTDNF  131

Query  518  GGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            G F IDLPSHLH IP+L+ AC V++L LPK S C Q    + A KHK I+L     G
Sbjct  132  GDFTIDLPSHLHGIPDLDKACSVKILDLPKDSSCHQ---SASASKHKEIKLASTRNG  185



>ref|XP_010087660.1| hypothetical protein L484_010612 [Morus notabilis]
 gb|EXB29553.1| hypothetical protein L484_010612 [Morus notabilis]
Length=203

 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 97/158 (61%), Gaps = 11/158 (7%)
 Frame = +2

Query  224  LLLAFIFL---VILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSD  394
            +L++F FL    + E     N  + E YSREELVK+AGYGE+K+STVLI G V C+ C +
Sbjct  20   ILISFFFLNGISMAEHDHEDNNHLFESYSREELVKIAGYGEEKLSTVLITGSVHCEACLN  79

Query  395  GDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLEN  574
              +  +  P+SGA V + C  +G++   S   W K  TDE G F +DLPS+LHAIPNL+ 
Sbjct  80   EAQLYAW-PVSGALVAVNCHINGKKGKSS---WTKCVTDEYGDFAVDLPSNLHAIPNLDR  135

Query  575  ACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
             C V+VL +PK S+C      +   ++KG++ + V  G
Sbjct  136  KCSVKVLRVPKNSLCRP----ANVRRNKGLRFLSVGNG  169



>ref|XP_006449928.1| hypothetical protein CICLE_v10016770mg [Citrus clementina]
 gb|ESR63168.1| hypothetical protein CICLE_v10016770mg [Citrus clementina]
Length=200

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 9/131 (7%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDG-DESSSLHPISGASVGILCsrsgrras  475
            +REELV+MAGYGE+K+STVL+ G V+C+ C  G D+     PI+GA V + C  S R+  
Sbjct  44   TREELVQMAGYGEEKLSTVLVTGSVLCEACLHGQDDQLRAWPITGALVSVYCHNSHRKKI  103

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKH  655
              + ++    TDE G F+IDLPSHLHA PNL+  C V+VL LPK S C   Y      KH
Sbjct  104  SKTQTF----TDEYGDFMIDLPSHLHATPNLDKTCSVKVLRLPKNSHCRPAY----VKKH  155

Query  656  KGIQLIGVEEG  688
            KG++L  V  G
Sbjct  156  KGLKLSSVGNG  166



>ref|XP_002322501.2| hypothetical protein POPTR_0016s00790g [Populus trichocarpa]
 gb|EEF04262.2| hypothetical protein POPTR_0016s00790g [Populus trichocarpa]
Length=201

 Score =   112 bits (280),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 95/153 (62%), Gaps = 11/153 (7%)
 Frame = +2

Query  239  IFLVILE-SPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSL  415
            IF++  + S A A   + E  +REELV++AGYGE+K+STVL+ G ++C+ C +G  +  L
Sbjct  23   IFIITFQASMAKAENPLQEFSNREELVQLAGYGEEKLSTVLVTGTILCEACLNGG-TQLL  81

Query  416  H--PISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVR  589
            H  P+SGA V + C    + +  +SS   +  TDE G FLIDLPSHLH IPNLE  C V+
Sbjct  82   HAWPVSGALVYVECHTGVKWSKTTSS---QAMTDEYGDFLIDLPSHLHGIPNLERTCSVK  138

Query  590  VLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            VL LP+ S+C      + A K K ++L  V  G
Sbjct  139  VLRLPQNSVCRP----AHARKQKALELSSVGNG  167



>ref|XP_011002371.1| PREDICTED: uncharacterized protein LOC105109369 [Populus euphratica]
Length=197

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 87/143 (61%), Gaps = 7/143 (5%)
 Frame = +2

Query  260  SPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASV  439
            S A A   + E  SREELV+ AGYGE+K+STVL+ G V+C+ C  G+      PISGA V
Sbjct  32   STAKAENPLHEFSSREELVQWAGYGEEKLSTVLVTGTVLCEACLHGENQLHAWPISGALV  91

Query  440  GILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
             + C    +R+  SS+  +   TDE G FLIDLPSHLH IP+LE  C V+ L LP+ S+C
Sbjct  92   NVECHTGTKRSKKSSAQAI---TDEYGDFLIDLPSHLHGIPHLERICSVQALRLPQNSVC  148

Query  620  TQHYYYSRAPKHKGIQLIGVEEG  688
            T     + A K K ++L  V  G
Sbjct  149  TP----AHARKQKALELSSVGNG  167



>ref|XP_011040166.1| PREDICTED: uncharacterized protein LOC105136486 [Populus euphratica]
Length=200

 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 85/148 (57%), Gaps = 17/148 (11%)
 Frame = +2

Query  260  SPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASV  439
            S A A   + E  +REELV++AGYGEDK+STVL+ G ++C+ C +G       P+SGASV
Sbjct  31   SMAKAENPLQEFSNREELVQLAGYGEDKLSTVLVTGTILCEACLNGGTQLHAWPVSGASV  90

Query  440  GILCsrsgrrasfssssWVKGS-----TDEDGGFLIDLPSHLHAIPNLENACLVRVLHLP  604
             + C         +   W K S     TDE G FLIDLPS LH IPNLE  C V+VL LP
Sbjct  91   YVEC--------HTGGKWSKTSSSQAMTDEYGDFLIDLPSPLHGIPNLERTCSVKVLRLP  142

Query  605  KASICTQHYYYSRAPKHKGIQLIGVEEG  688
            + S+C      + A K K ++L  +  G
Sbjct  143  QNSVCR----LAHARKQKALELSSLGNG  166



>emb|CDP04533.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 82/134 (61%), Gaps = 19/134 (14%)
 Frame = +2

Query  320  MAGYGEDKISTVLIEGEVVCQTCSD----GDESSSLH-------PISGASVGILCsrsgr  466
            MAGYGE+K+STV I G+++C  C+D      +++ L        P+SGASV + C  S +
Sbjct  1    MAGYGEEKLSTVTISGKLLCHACADIHDHHHQANQLDQPLPAPAPVSGASVAVFCGTSWK  60

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRA  646
                      +G+TDE G FLIDLPSHLHAIPNLE  CLVRVLHL K S C   +     
Sbjct  61   SRKS----CARGTTDEYGDFLIDLPSHLHAIPNLEKVCLVRVLHLSKNSDCRPAF----T  112

Query  647  PKHKGIQLIGVEEG  688
             KHK I+L+ +E+G
Sbjct  113  GKHKAIRLLSIEDG  126



>ref|XP_007026368.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY28990.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=187

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/165 (41%), Positives = 93/165 (56%), Gaps = 10/165 (6%)
 Frame = +2

Query  194  FLICRVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEV  373
            F  C+ +   ++L  I   + ES    +  + E  SREE+++MAGYGE+K+STVL+ G V
Sbjct  5    FCYCKTLGVVVMLLLIQSSMAES--DEHPLLYESSSREEMMQMAGYGEEKLSTVLVTGTV  62

Query  374  VCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLH  553
            +C+ C   +      PISGA V + C    +R S S     +  TDE G FLIDLPSHLH
Sbjct  63   LCEACLHAEPQLRAWPISGALVAVKCQTPCKRISGS----AQAVTDEYGDFLIDLPSHLH  118

Query  554  AIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
             IPNL   C V+VL +PK S+C   +      KHKG++   V  G
Sbjct  119  GIPNLPKICAVKVLRIPKNSMCRPAF----VKKHKGLRFSSVGNG  159



>ref|XP_010039440.1| PREDICTED: uncharacterized protein LOC104428144 [Eucalyptus grandis]
 gb|KCW45986.1| hypothetical protein EUGRSUZ_L00154 [Eucalyptus grandis]
Length=184

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 92/150 (61%), Gaps = 9/150 (6%)
 Frame = +2

Query  245  LVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH--  418
            LV+ +  A+   ++ E  S++ELV+MAGYG  K+STVL+ G V C     G     LH  
Sbjct  11   LVVSDGAASTEGSLLEFSSQDELVEMAGYGVKKVSTVLVAGSVSCVARLPGAAHHRLHAW  70

Query  419  PISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLH  598
            P+SGA VG+ C +S  R S +   W +GSTDE G F +DLPSHLHA+P+L   C VR+L 
Sbjct  71   PVSGALVGVKCQKSKSRISSN---WTRGSTDEFGDFTMDLPSHLHAVPDLPKKCSVRLLR  127

Query  599  LPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            +P++S C   + +    +HK ++L  V +G
Sbjct  128  VPRSSPCRPTHGH----RHKRLKLASVRDG  153



>emb|CBI18639.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 78/126 (62%), Gaps = 7/126 (6%)
 Frame = +2

Query  311  LVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssss  490
            +V++AGYGE+K+STVL+ G V+C TC D +  +   PISGASV + C           S+
Sbjct  1    MVQVAGYGEEKLSTVLVTGTVLCHTCLDKESQNPSLPISGASVSVTC---HASGKKRRST  57

Query  491  WVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQL  670
              +G TDE+G F+IDLPS LHA+PNLE  C V V  LP+ S+C   +      KH+GI+L
Sbjct  58   LAQGVTDENGDFIIDLPSELHAVPNLEKTCSVEVHQLPRNSLCQPGFVR----KHRGIRL  113

Query  671  IGVEEG  688
              V  G
Sbjct  114  SSVGNG  119



>ref|XP_006467274.1| PREDICTED: uncharacterized protein LOC102611527 [Citrus sinensis]
 gb|KDO78556.1| hypothetical protein CISIN_1g029046mg [Citrus sinensis]
Length=200

 Score =   111 bits (277),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/131 (49%), Positives = 83/131 (63%), Gaps = 9/131 (7%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDG-DESSSLHPISGASVGILCsrsgrras  475
            +REELV+MAGYGE+K+STVL+ G V+C+ C  G D+     PI+GA V + C  S R+  
Sbjct  44   TREELVQMAGYGEEKLSTVLVTGFVLCEACLHGQDDQLRAWPITGALVSVYCHNSHRKII  103

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKH  655
              + ++    TDE G F+IDLPSHLHA PNL+  C V+VL LPK S C   Y      KH
Sbjct  104  SKTQTF----TDEYGDFMIDLPSHLHATPNLDKTCSVKVLRLPKNSHCRPAY----VKKH  155

Query  656  KGIQLIGVEEG  688
            KG++L  V  G
Sbjct  156  KGLKLSSVGNG  166



>gb|AFK48643.1| unknown [Lotus japonicus]
Length=182

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 79/125 (63%), Gaps = 5/125 (4%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            ++ SR+E+V+MAGYGE+K+STVLI G V CQ      +     PI GA VG+ C  S   
Sbjct  40   QLSSRDEVVQMAGYGEEKLSTVLITGSVNCQARFHNGDQPHAWPIPGAWVGVHCHSSASE  99

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
                S   V+G TDE G F++DLPSHLH+IPNLEN C+V+V  +PK S+C      +   
Sbjct  100  RKGKSME-VRGVTDEFGDFMVDLPSHLHSIPNLENICVVKVHRIPKGSLCQP----AHVK  154

Query  650  KHKGI  664
            KHKG+
Sbjct  155  KHKGV  159



>ref|XP_002307854.1| hypothetical protein POPTR_0006s00740g [Populus trichocarpa]
 gb|EEE91377.1| hypothetical protein POPTR_0006s00740g [Populus trichocarpa]
Length=201

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 86/143 (60%), Gaps = 7/143 (5%)
 Frame = +2

Query  260  SPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASV  439
            S A A   + E  S EELV+ AGYGE+K+STVL+ G V+C+ C  G+      PISGA V
Sbjct  32   STAKAENPLQEFSSTEELVQWAGYGEEKLSTVLVTGTVLCEACLHGENQLHAWPISGALV  91

Query  440  GILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
             + C  S +R+  SS    +  TDE G FLIDLPSHLH IP+LE  C V+VL LP+ S+C
Sbjct  92   NVECHTSTKRSKKSS---AQAITDEYGDFLIDLPSHLHGIPHLERICSVKVLRLPQNSVC  148

Query  620  TQHYYYSRAPKHKGIQLIGVEEG  688
                  + A K K ++L  V  G
Sbjct  149  RP----AHARKQKALKLSSVGNG  167



>ref|XP_010057789.1| PREDICTED: uncharacterized protein LOC104445586 [Eucalyptus grandis]
Length=212

 Score =   109 bits (273),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 97/183 (53%), Gaps = 22/183 (12%)
 Frame = +2

Query  185  STAFLICRVMASPLLLAFIFLVILESPATA---------------NLTIDEVYSREELVK  319
            ++ F  CR + + LL    F  ++ + A +               +L  +    R+E+V+
Sbjct  2    TSCFRGCRNLMTMLLFFINFFTVVVTAANSSAAPAVMEAVAGVEEDLQPELSVRRDEMVE  61

Query  320  MAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssssWVK  499
            MAGYGE+K+STVL+ G V+C+ C  GD      P+SGASV + C    + +  S    + 
Sbjct  62   MAGYGEEKLSTVLVTGSVLCEACLPGDPQLHAWPLSGASVAVNCHADDKESKSSR---IH  118

Query  500  GSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGV  679
            G TDE+G F IDLPS LHA+PNL   C V ++ +P+ S+C   +      KHK ++L  V
Sbjct  119  GLTDENGDFFIDLPSELHAVPNLNKRCSVNLVRMPRNSLCRPAHIR----KHKRVRLSSV  174

Query  680  EEG  688
              G
Sbjct  175  GNG  177



>ref|NP_001235461.1| uncharacterized protein LOC100527138 precursor [Glycine max]
 gb|ACU16187.1| unknown [Glycine max]
 gb|KHN03546.1| hypothetical protein glysoja_004572 [Glycine soja]
Length=176

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 91/160 (57%), Gaps = 20/160 (13%)
 Frame = +2

Query  239  IFLVILESPATANLT---IDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESS  409
            I LV++ SPA        ++ + SR+E+V++AGYGE+K+STVLI G V C+  +      
Sbjct  13   IILVLIASPAEGEDNHPLLELLSSRDEVVQIAGYGEEKLSTVLITGSVTCE--APHRPQP  70

Query  410  SLHPISGASVGILCsrsgrrasfssssWVKGS-------TDEDGGFLIDLPSHLHAIPNL  568
               PI GASVG+ C   GR        W KG        TDE G F+IDLPSHLHAIPNL
Sbjct  71   HAWPIQGASVGVNCKSHGRNNK-----WNKGKSMVATGVTDEFGDFMIDLPSHLHAIPNL  125

Query  569  ENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            E  C+V++  +PKAS+C   +      KHKG+ L     G
Sbjct  126  EKVCIVKIHRIPKASLCRPAHVIK---KHKGLTLSSFGNG  162



>gb|KCW75105.1| hypothetical protein EUGRSUZ_E03855 [Eucalyptus grandis]
Length=175

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 79/129 (61%), Gaps = 7/129 (5%)
 Frame = +2

Query  302  REELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasfs  481
            R+E+V+MAGYGE+K+STVL+ G V+C+ C  GD      P+SGASV + C    + +  S
Sbjct  19   RDEMVEMAGYGEEKLSTVLVTGSVLCEACLPGDPQLHAWPLSGASVAVNCHADDKESKSS  78

Query  482  sssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKG  661
                + G TDE+G F IDLPS LHA+PNL   C V ++ +P+ S+C   +      KHK 
Sbjct  79   R---IHGLTDENGDFFIDLPSELHAVPNLNKRCSVNLVRMPRNSLCRPAHIR----KHKR  131

Query  662  IQLIGVEEG  688
            ++L  V  G
Sbjct  132  VRLSSVGNG  140



>ref|XP_010440040.1| PREDICTED: uncharacterized protein LOC104723382 [Camelina sativa]
Length=146

 Score =   105 bits (262),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 91/155 (59%), Gaps = 24/155 (15%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            LL++   ++++ S   A     E ++R E+V+MAGYGE K+S+VL+   ++         
Sbjct  4    LLMSMTLVLVVASGEAAR----ERWTRNEMVEMAGYGEQKLSSVLLTATLL---------  50

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            SSS  PI GA+VGI C    R+ S     W+KG T+E G F+IDLPSHLHAIP+L+ AC+
Sbjct  51   SSSPSPIHGATVGIKCHTRYRKGSK----WIKGVTNESGKFVIDLPSHLHAIPDLDKACI  106

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ L +PK   C+          H+GI+L+    G
Sbjct  107  IKTLSVPKPYRCSSKI-------HRGIKLLSSSSG  134



>ref|XP_010517410.1| PREDICTED: uncharacterized protein LOC104792861 [Camelina sativa]
Length=171

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 16/133 (12%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            +++S  E+ +MAGYGE K+S+V+I G V+C T           P+SGA+V I C    ++
Sbjct  28   KLWSIREMSEMAGYGEHKLSSVVITGSVLCNT-----------PVSGATVAIKCHTEFKK  76

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     WVKG TD+ G F+I LPSHLHAIP LE AC V+ +H+PK      H +Y ++ 
Sbjct  77   RSK----WVKGVTDDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYRRCYHTFY-KSN  131

Query  650  KHKGIQLIGVEEG  688
             HKGI+L+    G
Sbjct  132  THKGIKLLSSRNG  144



>ref|XP_006295116.1| hypothetical protein CARUB_v10024190mg [Capsella rubella]
 gb|EOA28014.1| hypothetical protein CARUB_v10024190mg [Capsella rubella]
Length=168

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 16/133 (12%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            +++S  E+ +MAGYGE K+S+V+I G V+C T           P+SGA+V I C    ++
Sbjct  26   KLWSIREMSEMAGYGEHKLSSVVITGSVLCNT-----------PVSGATVAIKCHTGFKK  74

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     WVKG TD+ G F+I LPSHLHAIP LE AC V+ +H+PK      H +Y ++ 
Sbjct  75   RSK----WVKGVTDDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHTFY-KSN  129

Query  650  KHKGIQLIGVEEG  688
             HKGI+L+    G
Sbjct  130  THKGIKLVSSRNG  142



>ref|XP_010505718.1| PREDICTED: uncharacterized protein LOC104782478 [Camelina sativa]
Length=170

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 80/133 (60%), Gaps = 16/133 (12%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
             ++S  E+ +MAGYGE K+S+V+I G V+C T           P+SGA+V I C    ++
Sbjct  27   RLWSIREMSEMAGYGEHKLSSVVITGSVLCNT-----------PVSGATVAIKCHTGFKK  75

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     WVKG TD+ G F+I LPSHLHAIP LE AC V+ +H+PK      H +Y ++ 
Sbjct  76   RSK----WVKGVTDDSGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHPFY-KSN  130

Query  650  KHKGIQLIGVEEG  688
             HKGI+L+    G
Sbjct  131  THKGIKLLSSRNG  143



>ref|XP_010508913.1| PREDICTED: uncharacterized protein LOC104785405 [Camelina sativa]
Length=169

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 16/133 (12%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            +++S  E+ +MAGYGE K+S+V+I G V+C T           P+SGA+V I C    ++
Sbjct  26   KLWSIREMSEMAGYGEHKLSSVVITGSVLCNT-----------PVSGATVAIKCHTGLKK  74

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     WVKG TD+ G F+I LPSHLHAIP LE AC V+ +H+PK      H +Y ++ 
Sbjct  75   RSK----WVKGVTDDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHTFY-KSN  129

Query  650  KHKGIQLIGVEEG  688
             HKGI+L+  + G
Sbjct  130  THKGIKLLSSKNG  142



>gb|KFK31357.1| hypothetical protein AALP_AA6G101900 [Arabis alpina]
Length=161

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 84/135 (62%), Gaps = 15/135 (11%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPIS--GASVGILCsrsg  463
            +++SR E+V+MAGYGE K+S+V+I G ++C +      +  LH I+  GA+V I C+   
Sbjct  21   KIWSRTEMVEMAGYGEQKLSSVIITGSLLCDS-----SNPRLHSIAIPGATVAIKCNNGS  75

Query  464  rrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSR  643
            +R S     W+K  TDE G F IDLPS LHAIPNLEN CL++ +H+PK   C    Y++ 
Sbjct  76   KRRSK----WIKAVTDEFGEFEIDLPSQLHAIPNLENTCLIKPVHVPKLYRC----YHTS  127

Query  644  APKHKGIQLIGVEEG  688
               HK I+L+    G
Sbjct  128  TNIHKRIKLVSSTNG  142



>ref|XP_006281226.1| hypothetical protein CARUB_v10027269mg [Capsella rubella]
 gb|EOA14124.1| hypothetical protein CARUB_v10027269mg [Capsella rubella]
Length=162

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 89/161 (55%), Gaps = 19/161 (12%)
 Frame = +2

Query  212  MASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCS  391
            M S  +L  +F++I       N     +++R E+V++AGYGE K+S+VLI G ++C    
Sbjct  1    MGSFFILRCVFIIIF----FFNGAFGNIWTRTEMVELAGYGEQKLSSVLITGSLICDI--  54

Query  392  DGDESSSLHPIS--GASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPN  565
                   LH I+  GA+V I C    ++ S     W+K  TD+ G F IDLPS LHAIP+
Sbjct  55   ---SRPRLHSIAIPGATVAIKCHTGSKKRSR----WIKAVTDDSGEFEIDLPSQLHAIPD  107

Query  566  LENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            LEN C ++ LH+PK   C    Y++    HK I+L+    G
Sbjct  108  LENTCFIKPLHVPKPYRC----YHTSTNIHKRIKLVSSTNG  144



>ref|XP_004139527.1| PREDICTED: uncharacterized protein LOC101215830 [Cucumis sativus]
 gb|KGN65025.1| hypothetical protein Csa_1G181380 [Cucumis sativus]
Length=205

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 91/166 (55%), Gaps = 6/166 (4%)
 Frame = +2

Query  155  IEMLRKLQGSSTAFLICRVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYG  334
            +  +     S   F +C       L+   F +++ES A     + ++ SR+   ++AGYG
Sbjct  2    VNRVWSFHSSVNLFWLCIFFF--YLIGHGFPMVIES-AEDETPVSDLLSRDHWREIAGYG  58

Query  335  EDKISTVLIEGEVVCQTCSDGDESS-SLHPISGASVGILCsrsgrrasfssssWVKGSTD  511
            E+++STVL+ G V+C+ C  GDE      PI GA VG+ C  +G+ +  S   WV G TD
Sbjct  59   EERLSTVLVTGSVLCEACLHGDEPQVHAWPIKGAMVGVNCHNTGKNSKSSD--WVHGVTD  116

Query  512  EDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
            E G F+ID+PSHLHA  + EN C +++L  PK + C   +   R P
Sbjct  117  EFGDFVIDIPSHLHATRSFENVCSIKILRTPKNTHCRPAHLAGRKP  162



>gb|KHG07811.1| Elongation factor Ts [Gossypium arboreum]
Length=212

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/182 (35%), Positives = 94/182 (52%), Gaps = 27/182 (15%)
 Frame = +2

Query  200  ICRVMASPLLLAFIFLVILESPATANL--------------TIDEVYSREELVKMAGYGE  337
             C  MA  + + F FL + ++P  A                T+ E  SR+E+V +AGYGE
Sbjct  4    FCSAMAMTVTVVFFFLFLQQTPLMAEAAKLEEDHFIIKNKPTLYEFSSRDEMVHLAGYGE  63

Query  338  DKISTVLIEGEVVCQTC-----SDGDESSSLHPISGASVGILCsrsgrrasfssssWVKG  502
            +K+STVL+ G V+C+ C      D        PISGA V + C    +  S +     + 
Sbjct  64   EKLSTVLVTGTVLCEACHGRRRRDPQPQLRSWPISGALVSVKCETPCKTKSST----TRA  119

Query  503  STDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVE  682
            +TDE G F+IDLPSHLH + +L+  C V+V+ +PK S+C   +      KH+ ++L  V 
Sbjct  120  TTDEYGDFMIDLPSHLHGVADLQKICTVKVIGIPKESMCRPVF----VKKHEHLRLSSVG  175

Query  683  EG  688
             G
Sbjct  176  NG  177



>ref|XP_010481298.1| PREDICTED: uncharacterized protein LOC104760129 isoform X1 [Camelina 
sativa]
 ref|XP_010481299.1| PREDICTED: uncharacterized protein LOC104760129 isoform X1 [Camelina 
sativa]
Length=165

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 83/138 (60%), Gaps = 9/138 (7%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            N     +++R E+V+MAGYGE K+S+V+I G ++C T      S ++ P++GA+V I C 
Sbjct  19   NGAFGNMWTRMEMVEMAGYGEQKLSSVIITGSLLCDTSHPRFHSIAI-PVTGATVAIKCR  77

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
               ++ S     W+K  TD+ G F IDLPS LHAIP+LEN C ++ +H+PK   C    Y
Sbjct  78   TGSKKRSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCFIKPVHVPKPYRC----Y  129

Query  635  YSRAPKHKGIQLIGVEEG  688
            ++    HK I+L+    G
Sbjct  130  HTYTNIHKRIKLVSSTNG  147



>ref|XP_006411260.1| hypothetical protein EUTSA_v10017342mg [Eutrema salsugineum]
 gb|ESQ52713.1| hypothetical protein EUTSA_v10017342mg [Eutrema salsugineum]
Length=164

 Score =   100 bits (250),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 26/138 (19%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            + +SR E+ +M GYGE K+S+V+I G ++C T           P+SGA+V I C    ++
Sbjct  22   KFWSRIEMAEMNGYGEHKLSSVVITGSILCNT-----------PVSGATVAIKCHTGFKK  70

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY-----  634
             S     WVK  TD+ G F+I LPSHLHAIP+LE AC ++ +H+PK      HY      
Sbjct  71   RSK----WVKAVTDDFGEFVIHLPSHLHAIPHLEKACFIKPVHVPK------HYQSCYKT  120

Query  635  YSRAPKHKGIQLIGVEEG  688
            +S++  HKGI+L+    G
Sbjct  121  FSKSNIHKGIKLVSSRNG  138



>ref|XP_010252764.1| PREDICTED: uncharacterized protein LOC104594245 [Nelumbo nucifera]
Length=208

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 94/159 (59%), Gaps = 16/159 (10%)
 Frame = +2

Query  239  IFLVIL------ESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGD  400
            IFLV++       S A     + E+ +  +L+++AGYG +K+S+VL+ G ++C+ C  G+
Sbjct  14   IFLVVIFSLGVKASVAGRKNPLVELSTHTDLIQLAGYGLEKLSSVLVTGTLLCEACLHGE  73

Query  401  ESSSLH--PISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLEN  574
                L   PISGA +G+ C  S R+ S     W +G TDE G F+IDLPS LHAIP L+ 
Sbjct  74   MEPELRQWPISGAVIGVACKTSRRKMSKY---WARGKTDEYGEFIIDLPSQLHAIPELDK  130

Query  575  ACLVRVLHLPK-ASICTQHYYYSRAPKHKGIQLIGVEEG  688
            AC V+V+ LPK  S C++ +      K +GI+L  V  G
Sbjct  131  ACSVKVVALPKIKSACSRAF----VGKSQGIRLSSVGNG  165



>ref|XP_002879845.1| hypothetical protein ARALYDRAFT_483053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56104.1| hypothetical protein ARALYDRAFT_483053 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score =   100 bits (250),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 82/139 (59%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
             +++S  E+  MAGYGE K+S+V+I G ++C T           PISGA+V I C    +
Sbjct  26   SKLWSIREMSDMAGYGEHKLSSVVITGSLLCNT-----------PISGATVAIKCHTGFQ  74

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY----  634
            + S     W+KG T++ G F+I LPSHLHAIP LE AC ++ +H+PK      HY+    
Sbjct  75   KRSK----WIKGVTNDFGEFVIHLPSHLHAIPQLEKACFIKPIHVPK------HYHRCYH  124

Query  635  -YSRAPKHKGIQLIGVEEG  688
             +S++  HKGI+L+    G
Sbjct  125  TFSKSNIHKGIKLVSSRNG  143



>ref|XP_009396441.1| PREDICTED: uncharacterized protein LOC103981437 [Musa acuminata 
subsp. malaccensis]
Length=192

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 71/110 (65%), Gaps = 2/110 (2%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasf  478
            +R ELV++AGYGE++IS+VL+ G ++C  C          P+ GA +G+ C  +G     
Sbjct  41   TRAELVRLAGYGEERISSVLVAGTLLCDACLRPGSDPVTFPVPGARIGVGCRTNGESTRK  100

Query  479  ssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQH  628
            ++  W  G+TDE G FL+DLPSHLHA P LE +C+VRVL +PK  +C  +
Sbjct  101  TN--WTCGTTDEFGEFLVDLPSHLHAAPWLEESCMVRVLLMPKECLCRSN  148



>emb|CDY61707.1| BnaC04g56700D [Brassica napus]
Length=166

 Score =   100 bits (249),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 83/139 (60%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
             + +SR E+ +M GYGE K+S+V+I G ++C T           P+SGA+V I C    +
Sbjct  23   SKFWSRLEMAEMNGYGEHKLSSVVITGSLLCNT-----------PVSGATVAIKCHTGFK  71

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYY---  637
            + S     W+K  TD+ G F+I LPSHLHAIP+LE AC V+ +H+PK      HY+    
Sbjct  72   KRSN----WIKAVTDDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPK------HYHRCYK  121

Query  638  --SRAPKHKGIQLIGVEEG  688
              S++  HKGI+L+  ++G
Sbjct  122  ALSKSNLHKGIKLVSSKDG  140



>ref|XP_009143252.1| PREDICTED: uncharacterized protein LOC103866982 [Brassica rapa]
Length=170

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (59%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
            ++ +SR E+ +M GYGE K+S+V+I G ++C +           P+SGA+V I C    +
Sbjct  27   EKFWSRIEMAEMNGYGEHKLSSVVITGSLLCNS-----------PVSGATVAIKCHTGFK  75

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY----  634
            R S     W+K  TDE G F+I LPSHLHAIP+LE AC V+ +H+PK      HY     
Sbjct  76   RRSN----WIKAVTDEFGEFVIHLPSHLHAIPHLEKACFVKPVHVPK------HYRRCYK  125

Query  635  -YSRAPKHKGIQLIGVEEG  688
             +S++  HKGI+L+    G
Sbjct  126  TFSKSNIHKGIKLVSSSNG  144



>emb|CDX74807.1| BnaA05g05530D [Brassica napus]
Length=170

 Score =   100 bits (249),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 82/139 (59%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
            ++ +SR E+ +M GYGE K+S+V+I G ++C +           P+SGA+V I C    +
Sbjct  27   EKFWSRIEMAEMNGYGEHKLSSVVITGSLLCNS-----------PVSGATVAIKCHTGFK  75

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY----  634
            R S     W+K  TDE G F+I LPSHLHAIP+LE AC V+ +H+PK      HY     
Sbjct  76   RRSN----WIKAVTDEFGEFVIHLPSHLHAIPHLEKACFVKPVHVPK------HYRRCYK  125

Query  635  -YSRAPKHKGIQLIGVEEG  688
             +S++  HKGI+L+    G
Sbjct  126  TFSKSNIHKGIKLVSSSNG  144



>ref|XP_004166075.1| PREDICTED: uncharacterized protein LOC101231184 [Cucumis sativus]
Length=205

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/156 (37%), Positives = 88/156 (56%), Gaps = 6/156 (4%)
 Frame = +2

Query  155  IEMLRKLQGSSTAFLICRVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYG  334
            +  +     S   F +C       L+   F +++ES A     + ++ SR+   ++AGYG
Sbjct  2    VNRVWSFHSSVNLFWLCIFFF--YLIGHGFPMVIES-AEDETPVSDLLSRDHWREIAGYG  58

Query  335  EDKISTVLIEGEVVCQTCSDGDESS-SLHPISGASVGILCsrsgrrasfssssWVKGSTD  511
            E+++STVL+ G V+C+ C  GDE      PI GA VG+ C  +G+ +  S   WV G TD
Sbjct  59   EERLSTVLVTGSVLCEACLHGDEPQVHAWPIKGAMVGVNCHNTGKNSKSSD--WVHGVTD  116

Query  512  EDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
            E G F+ID+PSHLHA  + EN C +++L  PK + C
Sbjct  117  EFGDFVIDIPSHLHATRSFENVCSIKILRTPKNTHC  152



>ref|XP_007154046.1| hypothetical protein PHAVU_003G086700g [Phaseolus vulgaris]
 gb|ESW26040.1| hypothetical protein PHAVU_003G086700g [Phaseolus vulgaris]
Length=174

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 85/135 (63%), Gaps = 10/135 (7%)
 Frame = +2

Query  227  LLAFIFLVILESPATA--NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGD  400
            L+  +F+ +L S A    N  ++ + +R+E+V +AGYGE+K+STVLI G V C+      
Sbjct  12   LVTLLFIFVLASLAAGEDNPLLELLSNRDEVVHIAGYGEEKLSTVLITGSVSCEA-----  66

Query  401  ESSSLH--PISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLEN  574
                LH  P+ GA VG+ C R GR+     S+  +G +DE G F++D+PSHLHAIPN E 
Sbjct  67   -PHQLHAWPLQGAWVGLKCQRHGRKWKGKWSTVARGVSDEFGEFIVDVPSHLHAIPNFEK  125

Query  575  ACLVRVLHLPKASIC  619
             C VR+  +PKAS+C
Sbjct  126  ECSVRIDRIPKASLC  140



>ref|XP_010441432.1| PREDICTED: uncharacterized protein LOC104724601 [Camelina sativa]
Length=163

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 86/155 (55%), Gaps = 15/155 (10%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            +L  FI +  L      N     +++R E+V+MAGYGE K+S+V+I G ++C T      
Sbjct  6    ILRCFIIIFFL----LFNGAFGNIWTRMEMVEMAGYGEQKLSSVIITGSLLCDTSRPRFH  61

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            S +   I GA+V I C    ++ S     W+K  TD+ G F IDLPS LHAIP+LEN C 
Sbjct  62   SIA---IPGATVAIKCHTGSKKRSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCF  114

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ +H+PK   C    Y++    HK I+L+    G
Sbjct  115  IKPVHVPKPYRC----YHTSTNIHKRIKLVSSTNG  145



>ref|XP_010495000.1| PREDICTED: uncharacterized protein LOC104772052 [Camelina sativa]
Length=163

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 81/138 (59%), Gaps = 11/138 (8%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            N     +++R E+V+MAGYGE K+S+V+I G ++C T      S +   I GA+V I CS
Sbjct  19   NGAFGNIWTRTEMVEMAGYGEQKLSSVIITGSLLCDTSRPRFHSIA---IPGATVAIKCS  75

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
               ++ S     W+K  TD+ G F IDLPS LHAIP+LEN C ++ +H+PK   C    Y
Sbjct  76   TGSKKRSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCFIKPVHVPKPYRC----Y  127

Query  635  YSRAPKHKGIQLIGVEEG  688
            ++    HK I+L+    G
Sbjct  128  HTSTNIHKRIKLVSSTSG  145



>emb|CDY20519.1| BnaC04g05250D [Brassica napus]
Length=170

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 82/139 (59%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
            ++ +SR E+ +M GYGE K+S+V+I G ++C +           P+SGA+V I C    +
Sbjct  27   EKFWSRIEMAEMNGYGEHKLSSVVITGSLLCNS-----------PVSGATVAIKCHTGLK  75

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY----  634
            + S     W+K  TD+ G F+I LPSHLHAIP+LE AC V+ +H+PK      HY     
Sbjct  76   KRSN----WIKAVTDDFGEFIIHLPSHLHAIPHLEKACFVKPVHVPK------HYRRCYK  125

Query  635  -YSRAPKHKGIQLIGVEEG  688
             +S++  HKGI+L+    G
Sbjct  126  TFSKSNIHKGIKLVSSSNG  144



>ref|XP_010530071.1| PREDICTED: uncharacterized protein LOC104806736 [Tarenaya hassleriana]
Length=155

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 83/134 (62%), Gaps = 12/134 (9%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
            +  +SR E+V MAGYGE+K+S+V++ G ++C   SD   S  + P+ GA+V I C    +
Sbjct  20   ERQWSRREMVAMAGYGEEKLSSVVVTGTLLC---SDHPLSFPI-PVPGATVAIKCQTGVK  75

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRA  646
            R S     W+K  TDE G F++DLPSHLH IP++   CLV+ +H+PK   C    + S +
Sbjct  76   RRSR----WIKTVTDELGEFVMDLPSHLHGIPDMGKTCLVKPVHVPKPYKC----HPSAS  127

Query  647  PKHKGIQLIGVEEG  688
             KH+G++L+    G
Sbjct  128  KKHRGLKLVSSSNG  141



>ref|XP_010449652.1| PREDICTED: uncharacterized protein LOC104731856 [Camelina sativa]
Length=146

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 91/155 (59%), Gaps = 24/155 (15%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            LL++   ++++ S   A     E ++R E+V+MAGYGE K+S+VL+   ++         
Sbjct  4    LLMSMTLVLVVASGEAAR----ERWTRNEMVEMAGYGEQKLSSVLLTATLL---------  50

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            SSS  PI GA+VGI C    R+ S     W+KG T+E G F+IDLPSHLHAIP+L+ AC+
Sbjct  51   SSSSSPIHGATVGIKCHTRYRKGSK----WIKGVTNESGKFVIDLPSHLHAIPDLDKACI  106

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ L +PK   C+          H+GIQL+    G
Sbjct  107  IKTLSVPKPYRCSSKI-------HRGIQLLSSSSG  134



>ref|XP_002522879.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39479.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 75/115 (65%), Gaps = 9/115 (8%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            N  + E +SREELV++AGYGE+K+STVLI G V+C    DG    +  P+SGA VGI C 
Sbjct  39   NNHLQEFWSREELVRLAGYGEEKLSTVLITGTVLC----DGTPLGA-SPVSGALVGINCG  93

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
               +++S +     +  TDE G F IDLPS LHAI NLE AC ++VL +PK S C
Sbjct  94   EWSQQSSAA----AEAVTDEYGEFQIDLPSQLHAILNLEKACSLKVLRMPKNSAC  144



>ref|XP_010481300.1| PREDICTED: uncharacterized protein LOC104760129 isoform X2 [Camelina 
sativa]
Length=163

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 80/138 (58%), Gaps = 11/138 (8%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            N     +++R E+V+MAGYGE K+S+V+I G ++C T      S +   I GA+V I C 
Sbjct  19   NGAFGNMWTRMEMVEMAGYGEQKLSSVIITGSLLCDTSHPRFHSIA---IPGATVAIKCR  75

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
               ++ S     W+K  TD+ G F IDLPS LHAIP+LEN C ++ +H+PK   C    Y
Sbjct  76   TGSKKRSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCFIKPVHVPKPYRC----Y  127

Query  635  YSRAPKHKGIQLIGVEEG  688
            ++    HK I+L+    G
Sbjct  128  HTYTNIHKRIKLVSSTNG  145



>ref|XP_002863328.1| hypothetical protein ARALYDRAFT_330672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39587.1| hypothetical protein ARALYDRAFT_330672 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 79/134 (59%), Gaps = 15/134 (11%)
 Frame = +2

Query  293  VYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH--PISGASVGILCsrsgr  466
             ++R E+V+MAGYGE K+S+V+I G ++C T         LH  PI GA+V I C    +
Sbjct  25   TWTRTEMVEMAGYGEQKLSSVIIAGSLLCDT-----SRPYLHSVPIPGATVAIKCQTGSK  79

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRA  646
            R S     W+K  TDE G F IDLPS LHAIP+LEN C ++ +++P+   C    Y++  
Sbjct  80   RRSK----WIKAVTDELGEFEIDLPSQLHAIPDLENKCFIKPVYVPRHYRC----YHTST  131

Query  647  PKHKGIQLIGVEEG  688
              HK I+L+    G
Sbjct  132  NIHKRIKLVSSTNG  145



>ref|XP_006398462.1| hypothetical protein EUTSA_v10001056mg [Eutrema salsugineum]
 gb|ESQ39915.1| hypothetical protein EUTSA_v10001056mg [Eutrema salsugineum]
Length=167

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 81/135 (60%), Gaps = 14/135 (10%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPIS--GASVGILCsrsg  463
            ++++R E+V+MAGYGE K+S+V+I G ++C    D      LH I+  GA+V I C    
Sbjct  27   KIWTRTEMVEMAGYGEQKLSSVIITGSLLC----DDTSHPHLHSIAIPGATVAIKCHTGY  82

Query  464  rrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSR  643
            ++ S     W+K  TD+ G F IDLPS LHAIP++EN C ++ +H+PK   C    Y++ 
Sbjct  83   KKRSK----WIKAVTDDLGEFEIDLPSQLHAIPDMENKCFIKPVHVPKRYRC----YHNS  134

Query  644  APKHKGIQLIGVEEG  688
               HK I+L+    G
Sbjct  135  TNIHKRIKLVSSTNG  149



>ref|NP_568686.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|ABD60708.1| At5g47635 [Arabidopsis thaliana]
 gb|AED95544.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=164

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH--PISGASVGILCsrs  460
            + +++R E+V+MAGYGE K+S+V+I G ++C T         LH  PI GA+V I C   
Sbjct  24   NNLWTRTEMVEMAGYGEQKLSSVVITGSLLCDT-----SRPHLHSIPIPGATVAIKCHTG  78

Query  461  grrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYS  640
             +R S     W+K  TDE G F IDLPS LHAIP+LEN C ++ +++P+   C    Y +
Sbjct  79   SKRRSK----WIKAVTDELGEFEIDLPSQLHAIPHLENTCFIKPVYVPRPYRC----YNT  130

Query  641  RAPKHKGIQLIGVEEG  688
                HK I+L+    G
Sbjct  131  STNIHKPIKLVSSTNG  146



>emb|CDY25956.1| BnaC09g20310D [Brassica napus]
Length=165

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/130 (42%), Positives = 82/130 (63%), Gaps = 15/130 (12%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPIS--GASVGILCsrsg  463
            +++SR E+++MAGYGE K+S+V+I G ++C T       S LH I+  GA+V I C    
Sbjct  26   KIWSRTEMLEMAGYGEQKLSSVIITGSLICNT-----SPSHLHSIAIPGATVAIKCHTGY  80

Query  464  rrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSR  643
            +R S     W+K  TD+ G F IDLPS LHAIP+LEN C+++ +H+P+   C    +++ 
Sbjct  81   KRRSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCVIKPIHVPELYRC----HHNS  132

Query  644  APKHKGIQLI  673
               HK I+L+
Sbjct  133  TNTHKRIKLV  142



>ref|XP_008463598.1| PREDICTED: uncharacterized protein LOC103501709 [Cucumis melo]
Length=205

 Score = 97.4 bits (241),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 84/145 (58%), Gaps = 8/145 (6%)
 Frame = +2

Query  203  CRVMASPLLLAFIFLV-----ILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEG  367
            C V    L + F +L+     ++   A     + ++ +R+   ++AGYGE+++STVL+ G
Sbjct  10   CSVNLFWLCIFFFYLIGHGFPMVTESAEDETPVSDLLNRDHWREIAGYGEERLSTVLVTG  69

Query  368  EVVCQTCSDGDESS-SLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPS  544
             V+C++C  GDE      PI GA VG+ C  +G+ +  S   WV G TDE G F+ID+PS
Sbjct  70   SVLCESCLHGDEPQVHAWPIRGAMVGVNCHNTGKNSKSSD--WVHGVTDEFGDFVIDIPS  127

Query  545  HLHAIPNLENACLVRVLHLPKASIC  619
             LHA  + EN C +++L  PK + C
Sbjct  128  RLHATQSFENVCSIKILRTPKNTHC  152



>emb|CDY07055.1| BnaA04g22600D [Brassica napus]
Length=167

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 82/139 (59%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
             + +SR E+ +M GYGE K+S+V+I G ++C T           P+S A+V I C    +
Sbjct  24   SKFWSRLEMAEMNGYGEHKLSSVVITGSLLCNT-----------PVSDATVAIKCHTGFK  72

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYY---  637
            + S     W+K  T++ G F+I LPSHLHAIP+LE AC V+ +H+PK      HY+    
Sbjct  73   KRSN----WIKAVTNDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPK------HYHRCYK  122

Query  638  --SRAPKHKGIQLIGVEEG  688
              S++  HKGI+L+  ++G
Sbjct  123  ALSKSNLHKGIKLVSSKDG  141



>ref|XP_010939224.1| PREDICTED: uncharacterized protein LOC105058125 isoform X1 [Elaeis 
guineensis]
Length=188

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 6/110 (5%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTC-SDGDESSSLHPISGASVGILCsrsgrras  475
            SR ELV++AGYGE+++S+VL+ G ++C  C   G    S H +S A V + C        
Sbjct  34   SRAELVRLAGYGEERLSSVLVTGAILCDACLQAGSHLLSSH-VSDAKVAVAC---KTEGR  89

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQ  625
               + WV G TD+ G F+IDLPSHLHAIP LE  C+VRVL +PK S C Q
Sbjct  90   RRKAYWVYGMTDDYGEFIIDLPSHLHAIP-LEEDCIVRVLRMPKNSYCQQ  138



>ref|XP_010434705.1| PREDICTED: uncharacterized protein LOC104718625 [Camelina sativa]
Length=146

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 89/155 (57%), Gaps = 24/155 (15%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            LL++   ++++ S   A     E ++R E+V+MAGYGE K+S+VL+   +          
Sbjct  4    LLMSMTLVLVVASGEAAR----ERWTRNEMVEMAGYGEQKLSSVLLTATL---------L  50

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            SSS  PI GA+VGI C    R+ S     W+KG TD  G F+IDLPSHLHAIP+L+ AC+
Sbjct  51   SSSSSPIHGATVGIKCHTRYRKGSK----WIKGVTDVSGKFVIDLPSHLHAIPDLDKACI  106

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ L +PK   C+          H+GIQL+    G
Sbjct  107  IKSLSVPKPYRCSSKI-------HRGIQLLSSSSG  134



>emb|CDY17718.1| BnaA06g35370D [Brassica napus]
Length=166

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 80/137 (58%), Gaps = 18/137 (13%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH----PISGASVGILCsr  457
            +++SR E+V+MAGYGE K+S+V+I G ++C      D +S  H     I GA+V I C  
Sbjct  26   KIWSRTEMVEMAGYGEQKLSSVIITGSLLC------DNTSRPHLPSIAIPGATVAIKCHT  79

Query  458  sgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYY  637
              +R S     W+K  TD+ G F IDLPS LHAIP++EN C+V+ +H+PK   C     +
Sbjct  80   GYKRRSK----WIKAVTDDLGEFEIDLPSQLHAIPDMENTCVVKPVHVPKLYRCN----H  131

Query  638  SRAPKHKGIQLIGVEEG  688
              +  HK I L+    G
Sbjct  132  RSSNTHKRINLVSSTNG  148



>gb|EYU27658.1| hypothetical protein MIMGU_mgv1a025896mg [Erythranthe guttata]
Length=151

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 12/138 (9%)
 Frame = +2

Query  284  IDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSL--HPISGASVGILCsr  457
            + E+  REELVK AGYGE+K+STV+I G+++C   +  ++ +S+  +PISG  +      
Sbjct  4    LGELSGREELVKWAGYGEEKLSTVVIGGKLLCHAGAAPNDKTSIQPYPISGIYI------  57

Query  458  sgrrasfssssWV-KGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
              +        W  +GSTD  G F ID+PSHLHA PNLEN C VRVL LP +S   Q   
Sbjct  58   -HKYGKKKGLKWAGRGSTDSSGEFQIDVPSHLHANPNLENICHVRVLRLPSSSAYRQ--S  114

Query  635  YSRAPKHKGIQLIGVEEG  688
             +R    K I+L  V EG
Sbjct  115  CTRNHGKKPIKLDSVGEG  132



>gb|AAM62822.1| unknown [Arabidopsis thaliana]
Length=164

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (59%), Gaps = 15/136 (11%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH--PISGASVGILCsrs  460
            + +++R E+V+MAGYG+ K+S+V+I G ++C T         LH  PI GA+V I C   
Sbjct  24   NNLWTRTEMVEMAGYGKQKLSSVVITGSLLCDT-----SRPHLHSIPIPGATVAIKCHTG  78

Query  461  grrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYS  640
             +R S     W+K  TDE G F IDLPS LHAIP+LEN C ++ +++P+   C    Y +
Sbjct  79   SKRRSK----WIKAVTDELGEFEIDLPSQLHAIPHLENTCFIKPVYVPRPYRC----YNT  130

Query  641  RAPKHKGIQLIGVEEG  688
                HK I+L+    G
Sbjct  131  STNIHKPIKLVSSTNG  146



>ref|NP_850326.2| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAX55149.1| hypothetical protein At2g40113 [Arabidopsis thaliana]
 gb|AEC09782.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=169

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/139 (39%), Positives = 80/139 (58%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
             +++S  E+  MAGYGE K+S+V+I G ++C T           P+SGA+V I C    +
Sbjct  25   SKLWSIREMSDMAGYGEHKLSSVVITGSLLCNT-----------PVSGATVAIKCHTGLK  73

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY----  634
            + S     W+K  T++ G F+I LPSHLHAIP LE AC V+ +H+PK      HY+    
Sbjct  74   QRSK----WIKSVTNDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPK------HYHRCYH  123

Query  635  -YSRAPKHKGIQLIGVEEG  688
             +S++  HK I+L+    G
Sbjct  124  TFSKSNIHKDIKLVSSRNG  142



>ref|XP_009101400.1| PREDICTED: uncharacterized protein LOC103827630 [Brassica rapa]
Length=166

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 80/137 (58%), Gaps = 18/137 (13%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH----PISGASVGILCsr  457
            +++SR E+V+MAGYGE K+S+V+I G ++C      D +S  H     I GA+V I C  
Sbjct  26   KIWSRTEMVEMAGYGEQKLSSVIITGSLLC------DNTSCPHLPSIAIPGATVAIKCHT  79

Query  458  sgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYY  637
              +R S     W+K  TD+ G F IDLPS LHAIP++EN C+V+ +H+PK   C     +
Sbjct  80   GYKRRSK----WIKAVTDDLGEFEIDLPSQLHAIPDMENTCVVKPIHVPKLYRCN----H  131

Query  638  SRAPKHKGIQLIGVEEG  688
                 HK I+L+    G
Sbjct  132  RSTNTHKRIKLVSSTNG  148



>ref|XP_008790321.1| PREDICTED: uncharacterized protein LOC103707566 [Phoenix dactylifera]
Length=187

 Score = 95.9 bits (237),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 74/128 (58%), Gaps = 10/128 (8%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTC-SDGDESSSLHPISGASVGILCsrsgrras  475
            SR ELV  AGYGE+++S+VLI G ++C  C   G    S H + GA V I C        
Sbjct  33   SRAELVHQAGYGEERLSSVLITGTILCDACLQPGSHLLSSH-VRGAKVAIAC---KTEER  88

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKH  655
               ++W  G  DE G F+ID+PSHLHAIP LE  C++RVL +PK S C Q    +    H
Sbjct  89   RRKTNWAYGMADEYGEFIIDVPSHLHAIP-LEEDCVIRVLRMPKNSCCRQMSEMN----H  143

Query  656  KGIQLIGV  679
            KGI+L  V
Sbjct  144  KGIKLSSV  151



>ref|XP_010936417.1| PREDICTED: uncharacterized protein LOC105056054 [Elaeis guineensis]
Length=182

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 74/128 (58%), Gaps = 10/128 (8%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTC-SDGDESSSLHPISGASVGILCsrsgrras  475
            SR E V +AGYGE+++S+VLI G ++C  C   G    S H + GA V I C        
Sbjct  28   SRAEHVHLAGYGEERLSSVLITGTILCDACLQPGSHLLSSH-VQGAKVAIAC---KTEER  83

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKH  655
               ++W  G TDE G F+IDLPSHLHAIP LE  C++RVL +PK S C Q    +    H
Sbjct  84   RRKANWAYGMTDEYGEFIIDLPSHLHAIP-LEEDCIIRVLRMPKNSYCRQ----TSGMNH  138

Query  656  KGIQLIGV  679
             GI+L  V
Sbjct  139  VGIKLSSV  146



>ref|XP_008785642.1| PREDICTED: uncharacterized protein LOC103704219 [Phoenix dactylifera]
Length=189

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 67/109 (61%), Gaps = 4/109 (4%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasf  478
            SR ELV++AGYGE+++S+VL+ G V+C  C          P++ A V + C         
Sbjct  35   SRAELVRLAGYGEERLSSVLVTGTVLCDACLQAASHVLSSPVADAKVAVAC---KTEGQR  91

Query  479  ssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQ  625
              + W  G+TD+ G F+I+LPSHLHAIP LE  C+V VL +PK+S C Q
Sbjct  92   RKAYWTYGTTDDYGEFIINLPSHLHAIP-LEEDCIVGVLRMPKSSYCQQ  139



>ref|XP_009114262.1| PREDICTED: uncharacterized protein LOC103839515 [Brassica rapa]
Length=159

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 82/133 (62%), Gaps = 14/133 (11%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            +++SR ++V+MAGYGE K+S+V+I G ++C      D S S+  I GA+V I C    +R
Sbjct  26   KIWSRTDMVEMAGYGEQKLSSVIITGSLLC------DTSHSI-SIPGATVAIKCHTGCKR  78

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     W+K  TD+ G F IDLPS LHAIP+LEN C+++ +H+P   +C  H+  +   
Sbjct  79   RSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCVIKPMHVPH-ELCRCHHNSTNT-  132

Query  650  KHKGIQLIGVEEG  688
             HK I+L+    G
Sbjct  133  -HKRIKLVSSTSG  144



>ref|XP_008224628.1| PREDICTED: uncharacterized protein LOC103324359 [Prunus mume]
Length=266

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 84/140 (60%), Gaps = 17/140 (12%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDG--------DESSSLH--PISGASVGIL  448
            S++++V++AGYGE+K+STVLI G V C+   +         D    LH  P+SGA V + 
Sbjct  106  SQQDMVQIAGYGEEKLSTVLITGSVHCEEACNNLHAQTHHPDHQLHLHAWPLSGALVSVN  165

Query  449  CsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQH  628
            C  SGR+   S   + +G TDE G F+IDLPS+LHAIPNL   C VRV+ +PK + C   
Sbjct  166  CHVSGRKRKSS---FAQGFTDEFGDFIIDLPSNLHAIPNLHKTCSVRVVRIPKNTQCRPA  222

Query  629  YYYSRAPKHKGIQLIGVEEG  688
            Y      +HKG++L  V  G
Sbjct  223  Y----VRRHKGLKLSSVGNG  238



>ref|XP_009374857.1| PREDICTED: uncharacterized protein LOC103963728 [Pyrus x bretschneideri]
Length=226

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 87/146 (60%), Gaps = 23/146 (16%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVC-QTCSDGDESSSLH---------------PISG  430
            S+E+++++AGYGE+K+STVLI G V C Q C + +  +SLH               P+SG
Sbjct  57   SQEDMMQVAGYGEEKLSTVLITGSVHCEQACINPNNLNSLHSDQTDRDHQLHRHAWPLSG  116

Query  431  ASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKA  610
            A V + C  SGRR   S +  V   TDE G F+IDLPS+LHAIPNL+  C VRVL +PK 
Sbjct  117  ALVSVNCRVSGRRRKSSLAQSV---TDEFGEFMIDLPSNLHAIPNLDKTCCVRVLGIPKN  173

Query  611  SICTQHYYYSRAPKHKGIQLIGVEEG  688
            + C      +   +HKG++L  V  G
Sbjct  174  AQCRP----ASVRRHKGLKLSSVGNG  195



>ref|XP_009141865.1| PREDICTED: uncharacterized protein LOC103865767 isoform X1 [Brassica 
rapa]
Length=167

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 26/139 (19%)
 Frame = +2

Query  287  DEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgr  466
             + +SR E+ +M GY E K+S+V+I G ++C T           P+S A+V I C    +
Sbjct  24   SKFWSRLEMAEMNGYEEHKLSSVVITGSLLCNT-----------PVSDATVAIKCHTGFK  72

Query  467  rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYY---  637
            + S     W+K  T++ G F+I LPSHLHAIP+LE AC V+ +H+PK      HY+    
Sbjct  73   KRSN----WIKAVTNDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPK------HYHRCYK  122

Query  638  --SRAPKHKGIQLIGVEEG  688
              S++  HKGI+L+  ++G
Sbjct  123  ALSKSNLHKGIKLVSSKDG  141



>ref|XP_004293399.1| PREDICTED: uncharacterized protein LOC101300601 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=220

 Score = 94.4 bits (233),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 84/138 (61%), Gaps = 15/138 (11%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQ-TCS---DGDESSSLH----PISGASVGILCs  454
            SR++LV++AGYGE+K+STVLI G V C+  CS   D +++  LH    P+SGA V + C 
Sbjct  58   SRKDLVQIAGYGEEKLSTVLITGSVHCEEACSLSDDHEQAHQLHLHAWPVSGAVVSVNCR  117

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
              GR+   S S    G  DE G F+I+LPS LHA+PNL+  C  RV+ +PK + C   + 
Sbjct  118  VGGRKRKSSRSL---GVADEYGDFMIELPSDLHAVPNLDKLCCARVIRVPKNTQCKAAF-  173

Query  635  YSRAPKHKGIQLIGVEEG  688
                 +HKG++L  V  G
Sbjct  174  ---VKRHKGLKLSSVGNG  188



>ref|XP_010518741.1| PREDICTED: uncharacterized protein LOC104798379 [Tarenaya hassleriana]
Length=151

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 85/154 (55%), Gaps = 25/154 (16%)
 Frame = +2

Query  227  LLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDES  406
            L  F+ L I    A +    + ++SREE+  +AGYGE+K+S+V++ G ++         S
Sbjct  4    LSVFLLLCIFSETAVS----ERIWSREEMAALAGYGEEKLSSVVVTGSLL---------S  50

Query  407  SSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLV  586
            S   P+ GA VG+ C   G+R +     W+K  TDE G F I+LPS LHAIP+L NACLV
Sbjct  51   SGSLPVPGAVVGVKCEAEGKRRTG----WIKAVTDEHGEFEIELPSSLHAIPDLANACLV  106

Query  587  RVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            + +H+P+   C         P  +G+ L+    G
Sbjct  107  KPVHVPEPYKCF--------PSARGLTLVSSSHG  132



>gb|KEH32686.1| pollen Ole e I family allergen [Medicago truncatula]
Length=206

 Score = 93.6 bits (231),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 75/122 (61%), Gaps = 5/122 (4%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasf  478
            SREE+V++AGYGE+K+STVLI G + C   ++   S++  PI GA V + C       + 
Sbjct  49   SREEVVEIAGYGEEKLSTVLITGSLHCDGPNNNHHSNAW-PIPGALVSVNCQSHATERTG  107

Query  479  ssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKHK  658
             +     G TDE G F++DLPS+LHAIPNLE  C V+V  +PK S+C    + +   K K
Sbjct  108  KAMV-ANGVTDEFGDFMVDLPSYLHAIPNLEKICRVKVHKIPKGSLCRPARHVN---KQK  163

Query  659  GI  664
            G+
Sbjct  164  GL  165



>emb|CDY41060.1| BnaA09g18390D [Brassica napus]
Length=159

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 81/133 (61%), Gaps = 14/133 (11%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            +++SR ++V+MAGYGE K+S+V+I G ++C      D S S+  I GA+V I C    +R
Sbjct  26   KIWSRTDMVEMAGYGEQKLSSVIITGSLLC------DTSHSI-SIPGATVAIKCHTGYKR  78

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     W+K  TD+ G F IDLPS LHAIP+LEN C+++ +H+P   +C  H+  +   
Sbjct  79   RSK----WIKAVTDDLGEFEIDLPSQLHAIPDLENTCVIKPIHVPH-ELCRCHHNSTNT-  132

Query  650  KHKGIQLIGVEEG  688
             HK I+L     G
Sbjct  133  -HKRIKLASSTSG  144



>ref|XP_004250296.1| PREDICTED: uncharacterized protein LOC101265501 [Solanum lycopersicum]
Length=166

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 10/119 (8%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            N  + E+ SREEL K+AGYGE+K+STV + G ++C          + HP+ GASV + C 
Sbjct  23   NNPLIELSSREELAKIAGYGEEKLSTVFLHGTLLC--------GHTPHPVPGASVAVYCG  74

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKA-SICTQH  628
             SG      SS W K  T+E G F+ID+PSHLHA  +  N C +++LHLPK  S+C  H
Sbjct  75   TSGPGRVRKSS-WAKNVTNESGDFIIDVPSHLHANIHDPNLCHIQILHLPKDYSLCHHH  132



>ref|XP_006856296.1| hypothetical protein AMTR_s00047p00112050 [Amborella trichopoda]
 gb|ERN17763.1| hypothetical protein AMTR_s00047p00112050 [Amborella trichopoda]
Length=191

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 84/142 (59%), Gaps = 9/142 (6%)
 Frame = +2

Query  215  ASPLLLAFIFLVILESPATANLTIDE----VYSREELVKMAGYGEDKISTVLIEGEVVCQ  382
             S L +  +FL   +   +A+ + D+    +++  ++V+ AGYG +K+S+VL+ G V C 
Sbjct  7    GSFLAITALFLASAQPIRSADYSEDDASSVLFAGSDVVRTAGYGIEKLSSVLVTGTVTCD  66

Query  383  TCSDGDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIP  562
             C D  +S     +SGA+V + C  +G + S      V+G TDE G F+ID+PSH+HA P
Sbjct  67   ACRDTGKSPF---VSGATVAVRCQTNGGKRSRHFR--VRGKTDEYGDFMIDIPSHMHATP  121

Query  563  NLENACLVRVLHLPKASICTQH  628
             LEN C V V+ +P+ S C ++
Sbjct  122  RLENTCHVTVVQIPENSDCRRN  143



>ref|XP_008384181.1| PREDICTED: uncharacterized protein LOC103446815 [Malus domestica]
Length=226

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 86/146 (59%), Gaps = 23/146 (16%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQ-TCSDGDESSSLH---------------PISG  430
            S+E+++++AGYGE+K+STVLI G V C+  C + +  +SLH               P+ G
Sbjct  57   SQEDMMQVAGYGEEKLSTVLITGSVHCEEACINRNNLNSLHSDQTDRDHQLHRHAWPLPG  116

Query  431  ASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKA  610
            A V + C  SGRR   S     +G TDE G F+IDLPS+LHAIPNL+  C VRVL +PK 
Sbjct  117  ALVSVNCRVSGRRRKSS---LAQGVTDEFGEFMIDLPSNLHAIPNLDKTCCVRVLGIPKN  173

Query  611  SICTQHYYYSRAPKHKGIQLIGVEEG  688
            + C      +   +HKG++L  V  G
Sbjct  174  AQCRP----ASVRRHKGLKLSSVGNG  195



>emb|CDY69950.1| BnaCnng66060D [Brassica napus]
Length=173

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/136 (39%), Positives = 79/136 (58%), Gaps = 11/136 (8%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSL---HPISGASVGILCsrs  460
            +++SR E+V+MAGYGE K+S+V+I G ++C T      S ++   +    A+V I C   
Sbjct  28   KIWSRTEMVEMAGYGEQKLSSVIIAGSLLCDTWRPHLPSIAIPGTYLFMSATVAIKCHTG  87

Query  461  grrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYS  640
             +R S     W+K  TD+ G F IDLPS LHAIP++EN C+V+ +H+PK   C     + 
Sbjct  88   YKRRSK----WIKAVTDDLGEFEIDLPSQLHAIPDMENTCVVKPVHVPKLYRCN----HR  139

Query  641  RAPKHKGIQLIGVEEG  688
                HK I+L+    G
Sbjct  140  STNTHKRIKLVSSTNG  155



>ref|XP_008345789.1| PREDICTED: uncharacterized protein LOC103408743 [Malus domestica]
Length=245

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 85/145 (59%), Gaps = 23/145 (16%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQ-TCSDGDESSSLHP--------------ISGA  433
            S+E+++++AGYGE+K+STVLI G V C+  C D +  + LHP              +SG 
Sbjct  77   SQEDMMQVAGYGEEKLSTVLITGSVHCEEACIDHNNLNILHPDQTDRDQLHLHAWPLSGV  136

Query  434  SVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKAS  613
             V + C  SGRR S       +G TDE G F+IDLPS+LHAIPNL+  C VRVL +PK +
Sbjct  137  LVSVNCRVSGRRKSS----LAQGITDEFGVFMIDLPSNLHAIPNLDKTCCVRVLGIPKNA  192

Query  614  ICTQHYYYSRAPKHKGIQLIGVEEG  688
             C      +   +HKG++L  V  G
Sbjct  193  QCRP----ASVRRHKGLKLSSVGNG  213



>ref|XP_006352324.1| PREDICTED: uncharacterized protein LOC102586293 [Solanum tuberosum]
Length=167

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 74/124 (60%), Gaps = 10/124 (8%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            N  + E+ SREEL K+AGYGE+K+STV + G ++C          + +P+ GASV + C 
Sbjct  23   NNPLIELSSREELAKIAGYGEEKLSTVFLHGTLLC--------GHTPYPVPGASVAVFCG  74

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKA-SICTQHY  631
             SG      SS W K  T+E G F+ID+PSHLHA  +  N C +++LHLPK  S C  H 
Sbjct  75   TSGPGRVRKSS-WAKNVTNESGEFIIDVPSHLHANIHDPNLCHIQILHLPKDYSHCHHHS  133

Query  632  YYSR  643
            +  R
Sbjct  134  FTKR  137



>ref|XP_009372506.1| PREDICTED: uncharacterized protein LOC103961353 [Pyrus x bretschneideri]
Length=245

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 85/145 (59%), Gaps = 23/145 (16%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQ-TCSDGDESSSLHP--------------ISGA  433
            S+E+++++AGYGE+K+STVLI G V C+  C + +  + LHP              +SGA
Sbjct  77   SQEDMMQVAGYGEEKLSTVLITGSVHCEEACINHNNLNILHPDQTDRDQLHLHAWPLSGA  136

Query  434  SVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKAS  613
             V + C  SGRR S       +G TDE G F+IDLPS+LH IPNL+  C VRVL +PK +
Sbjct  137  LVSVNCRVSGRRKSS----LAQGVTDEFGDFMIDLPSNLHTIPNLDKTCCVRVLGIPKNA  192

Query  614  ICTQHYYYSRAPKHKGIQLIGVEEG  688
             C      +   +HKG++L  V  G
Sbjct  193  QCRP----ASVRRHKGLKLSSVGNG  213



>ref|XP_009144665.1| PREDICTED: uncharacterized protein LOC103868310 [Brassica rapa]
Length=157

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 89/165 (54%), Gaps = 29/165 (18%)
 Frame = +2

Query  194  FLICRVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEV  373
            FL+C        L  +F++ L   A   +     ++R+E+V+MAGYGEDK+S+VL+   +
Sbjct  5    FLLCSS------LTLVFMLALGEAAGEIMR----WNRKEMVEMAGYGEDKLSSVLVTASL  54

Query  374  VCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLH  553
            +         SSS  PI GA+VGI C    R+ S     W+K  T+  G F IDLPSHLH
Sbjct  55   L---------SSSSSPIPGATVGIKCHTGYRKRSK----WIKAVTNALGQFTIDLPSHLH  101

Query  554  AIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            AIP+LE AC ++ L +PK   C      S     +GI+L+    G
Sbjct  102  AIPDLEKACSIKPLSVPKPYQC------SPTKTQRGIKLVSSSNG  140



>ref|NP_001064319.1| Os10g0208600 [Oryza sativa Japonica Group]
 gb|ABG65993.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26233.1| Os10g0208600 [Oryza sativa Japonica Group]
 dbj|BAG91000.1| unnamed protein product [Oryza sativa Japonica Group]
Length=197

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 9/139 (6%)
 Frame = +2

Query  278  LTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH-PISGASVGILCs  454
            + ++  +S  ELV++AGYGE+ +STV++ G+VVC+       S  L   + GA+VG+ C 
Sbjct  38   MPMEAYFSPAELVRIAGYGEELVSTVIVSGKVVCKLSLRPPGSDLLSIELPGATVGVACE  97

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
              G +   +S   V   TDE+G F I+LPS LHA PNLE AC V+VL LP    C    +
Sbjct  98   TGGIKTMANSVFTV---TDENGNFTIELPSRLHATPNLEKACSVKVLQLPLDCAC----W  150

Query  635  YSRAPK-HKGIQLIGVEEG  688
              R+P  + GIQL   E+G
Sbjct  151  PRRSPSYYHGIQLSSSEDG  169



>ref|XP_003571441.1| PREDICTED: uncharacterized protein LOC100842350 [Brachypodium 
distachyon]
Length=198

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 69/115 (60%), Gaps = 0/115 (0%)
 Frame = +2

Query  275  NLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            + +++  +S EELV++AGYGE+ +STVL+ G+++C  C           + G+ V + C 
Sbjct  32   STSMEAYFSAEELVRIAGYGEEPVSTVLVSGQILCVLCLRPGSDLLTFQLPGSKVAVTCK  91

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
              G   S  +++    +TDE G F I+LPS LHA PNLE+AC V VL LP  S C
Sbjct  92   SEGPNTSTMAANSAFATTDESGNFTIELPSRLHATPNLEDACSVTVLTLPPDSAC  146



>gb|EEC66705.1| hypothetical protein OsI_33026 [Oryza sativa Indica Group]
Length=197

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 81/139 (58%), Gaps = 9/139 (6%)
 Frame = +2

Query  278  LTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH-PISGASVGILCs  454
            + ++  +S  E V++AGYGE+ +STV++ G+VVC+       S  L   + GA+VG+ C 
Sbjct  38   MPMEAYFSPAEFVRIAGYGEELVSTVIVSGKVVCELSLRPPGSDLLSIELPGATVGVACE  97

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYY  634
              G +   +S   V   TDE+G F I+LPS LHA PNLE AC V+VL LP    C    +
Sbjct  98   TGGIKTMANSVFTV---TDENGNFTIELPSRLHATPNLEKACSVKVLQLPLDCAC----W  150

Query  635  YSRAPK-HKGIQLIGVEEG  688
              R+P  + GIQL   E+G
Sbjct  151  PRRSPSYYHGIQLSSSEDG  169



>ref|XP_009141866.1| PREDICTED: uncharacterized protein LOC103865767 isoform X2 [Brassica 
rapa]
Length=136

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 76/131 (58%), Gaps = 26/131 (20%)
 Frame = +2

Query  311  LVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssss  490
            + +M GY E K+S+V+I G ++C T           P+S A+V I C    ++ S     
Sbjct  1    MAEMNGYEEHKLSSVVITGSLLCNT-----------PVSDATVAIKCHTGFKKRSN----  45

Query  491  WVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYY-----SRAPKH  655
            W+K  T++ G F+I LPSHLHAIP+LE AC V+ +H+PK      HY+      S++  H
Sbjct  46   WIKAVTNDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPK------HYHRCYKALSKSNLH  99

Query  656  KGIQLIGVEEG  688
            KGI+L+  ++G
Sbjct  100  KGIKLVSSKDG  110



>ref|XP_004507594.1| PREDICTED: uncharacterized protein LOC101497330 [Cicer arietinum]
Length=190

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 11/127 (9%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH--PISGASVGILCsrsg  463
            ++ +R+E+V++AGYGE+K+STVLI G + C     G +    H  PI GA V I C    
Sbjct  43   DLSNRDEVVEIAGYGEEKLSTVLITGSLHC-----GGDHHHPHAMPIPGALVAINCQSHA  97

Query  464  rrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSR  643
            +     S    +G TDE G F++DLPS+LHAIPNLE  C V+V  +PK S C    + + 
Sbjct  98   KERKGKSMV-ARGVTDEFGDFMVDLPSYLHAIPNLEKICRVKVHRIPKGSPCRPARHVN-  155

Query  644  APKHKGI  664
              KHKG+
Sbjct  156  --KHKGL  160



>gb|AAM67093.1| unknown [Arabidopsis thaliana]
Length=150

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 91/155 (59%), Gaps = 24/155 (15%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            LL++   ++I+    T    + + +SR+E+V+MAGYGE K+S+VL+   ++  + S    
Sbjct  4    LLMSMTLVLIV----TFGEALSDRWSRDEMVEMAGYGEQKLSSVLLTASLLSSSSS----  55

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
                 PI GA+VGI C    RR S     W+K  T+E G F+IDLPSHLHAIP+L+ AC+
Sbjct  56   -----PIHGATVGINCHSGHRRRSK----WIKAVTNELGQFVIDLPSHLHAIPDLDKACI  106

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ L +PK   C+       +  H+GIQL+    G
Sbjct  107  IKTLSVPKPYRCS-------SKIHRGIQLLSSSNG  134



>gb|ABD65108.1| hypothetical protein 31.t00008 [Brassica oleracea]
Length=157

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 88/165 (53%), Gaps = 29/165 (18%)
 Frame = +2

Query  194  FLICRVMASPLLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEV  373
            FL+C        L  +F++ L   A   +     +SR+E+V+MAGYGEDK+S+VL+   +
Sbjct  5    FLLCSS------LTLVFMLALGEAAGDIMR----WSRKEMVEMAGYGEDKLSSVLVTASL  54

Query  374  VCQTCSDGDESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLH  553
            +         SSS  PI GA+VGI C    R+ S     W+K  T+  G F IDLPSHLH
Sbjct  55   L---------SSSSSPIPGATVGIKCHTGYRKRSK----WIKAVTNALGQFTIDLPSHLH  101

Query  554  AIPNLENACLVRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            AI +LE AC ++ L +PK   C      S     +GI+L+    G
Sbjct  102  AIHDLEKACSIKPLSVPKPYQC------SPTKTQRGIKLVSSSNG  140



>ref|XP_006284709.1| hypothetical protein CARUB_v10005967mg [Capsella rubella]
 gb|EOA17607.1| hypothetical protein CARUB_v10005967mg [Capsella rubella]
Length=147

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 80/133 (60%), Gaps = 20/133 (15%)
 Frame = +2

Query  290  EVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrr  469
            E ++R E+V+MAGYGE K+S+VL+   ++         SSS  PI GA+VGI C    ++
Sbjct  23   ERWTRNEMVEMAGYGEQKLSSVLLTASLL---------SSSSSPIPGATVGIKCRSGHKK  73

Query  470  asfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAP  649
             S     W+KG T++ G F+IDLPSHLHAIP+L  AC+++ L +PK   C+         
Sbjct  74   RSK----WIKGVTNDLGQFVIDLPSHLHAIPDLNKACIIKPLSVPKPYQCSSKI------  123

Query  650  KHKGIQLIGVEEG  688
             H+GIQL+    G
Sbjct  124  -HRGIQLLSSSNG  135



>ref|XP_002870116.1| hypothetical protein ARALYDRAFT_493155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46375.1| hypothetical protein ARALYDRAFT_493155 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 62/155 (40%), Positives = 91/155 (59%), Gaps = 23/155 (15%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
             LL  + LV++ +   A   + + +SR+E+V+MAGYGE K+S+VL+   ++         
Sbjct  3    FLLMSMTLVLMMTFGEA---VRDRWSRDEMVEMAGYGEQKLSSVLLTASLL---------  50

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            SSS  PI GA++GI C    RR S     W+K  T+E G F+IDLPSHLHAIP+L+ AC+
Sbjct  51   SSSSSPIHGATIGIKCHIGYRRISK----WIKAVTNELGQFVIDLPSHLHAIPDLDKACI  106

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ L +PK   C+          H+GIQL+    G
Sbjct  107  IKPLSVPKPYRCSSKI-------HRGIQLLSSSNG  134



>ref|NP_567524.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAL85007.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45078.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83863.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=150

 Score = 85.1 bits (209),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 90/155 (58%), Gaps = 24/155 (15%)
 Frame = +2

Query  224  LLLAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDE  403
            LL++   ++I+    T      + +SR+E+V+MAGYGE K+S+VL+   ++         
Sbjct  4    LLMSMTLVLIV----TFGEAFSDRWSRDEMVEMAGYGEQKLSSVLLTASLL---------  50

Query  404  SSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACL  583
            SSS  PI GA++G  C    RR S     W+K  T+E G F+IDLPSHLHAIP+L+ AC+
Sbjct  51   SSSSSPIHGATIGFKCHTGHRRRSK----WIKAVTNELGQFVIDLPSHLHAIPDLDKACI  106

Query  584  VRVLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
            ++ L +PK   C+       +  H+GIQL+    G
Sbjct  107  IKTLSVPKPYRCS-------SKIHRGIQLLSSSNG  134



>ref|XP_009136830.1| PREDICTED: uncharacterized protein LOC103860901 [Brassica rapa]
Length=148

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 85/153 (56%), Gaps = 24/153 (16%)
 Frame = +2

Query  230  LAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESS  409
            L  +F+V L       +     ++R+E+V++AGYGE K+S+V++   +          SS
Sbjct  8    LTLVFMVALGEAVGDRMR----WTRKEMVEIAGYGELKLSSVILTASL---------LSS  54

Query  410  SLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVR  589
            S HPISGA+VGI+C    RR S      +K  T++ G F IDLPS LHAIP+L+ AC ++
Sbjct  55   SSHPISGATVGIMCHTGHRRRSKV----IKAVTNDFGQFTIDLPSDLHAIPDLDKACSIK  110

Query  590  VLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
             L +PK   C+          H+GI+L+    G
Sbjct  111  PLSVPKPYRCSHKI-------HRGIKLVSSSNG  136



>ref|XP_009419523.1| PREDICTED: uncharacterized protein LOC103999488 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 73/134 (54%), Gaps = 7/134 (5%)
 Frame = +2

Query  227  LLAFIFLVILESPATANLTIDEVY--SREELVKMAGYGEDKISTVLIEGEVVCQTCSDGD  400
            +L  + L +  +P  A ++       +  ELV++AGYG++++STVL+ G ++C       
Sbjct  12   VLMAVLLFVFPTPCAAVMSEGTAMQLAHAELVRVAGYGDERLSTVLVTGTLLCSARMHRS  71

Query  401  ESSSLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENAC  580
                   + GA V + C   GRR       W  G TD+ G F++DLPSHLHA P LE  C
Sbjct  72   PGLFTSNVPGAKVAVACKTEGRRELS----WAYGLTDDYGEFIVDLPSHLHANPKLEEDC  127

Query  581  LVRVLHLP-KASIC  619
            +VRVL +P K S C
Sbjct  128  IVRVLRVPTKGSFC  141



>dbj|BAJ99708.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 64/108 (59%), Gaps = 3/108 (3%)
 Frame = +2

Query  296  YSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrras  475
            +S+ EL ++AGYGE+ +STVL+ G+V CQ C           + G+ V + C+  G    
Sbjct  30   FSQAELARIAGYGEEPVSTVLVSGQVACQLCLRPGSDLLTFDLPGSKVAVTCTTEGPNTM  89

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
             +S+     + +E G F I+LPS LHA P+LENAC V+VL LP  S C
Sbjct  90   ANSAF---ATANEYGNFTIELPSRLHATPSLENACSVKVLELPPDSAC  134



>gb|EEC66696.1| hypothetical protein OsI_33016 [Oryza sativa Indica Group]
Length=188

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = +2

Query  266  ATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGI  445
            A + + ++  +S  EL ++AGYGE+ +STV++ G+V C+ C           + GA V +
Sbjct  20   AISTMPMELYFSPGELARIAGYGEEPVSTVVVSGQVACELCLCPGSDLLTFELPGAKVEV  79

Query  446  LCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
             C   G     +S   V  +TDE G F   LPS LHA P+LENAC+V+VL LP  S C
Sbjct  80   ACETEGPNTQANS---VFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPPDSAC  134



>ref|XP_006665084.1| PREDICTED: uncharacterized protein LOC102720850 [Oryza brachyantha]
Length=240

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 67/115 (58%), Gaps = 4/115 (3%)
 Frame = +2

Query  278  LTIDEVYSREELVKMAGYGEDK-ISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCs  454
            ++++  +S  EL ++AGYGE+  +STV++ G+V C+ C           + GA + + C 
Sbjct  93   ISMEHYFSPGELARIAGYGEEPPVSTVVVSGQVACEFCVRPGSDLLTFELPGAKIAVACQ  152

Query  455  rsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
              G     +S+    G+TDE G F I LPS LHA P LENAC+VRVL LP  S C
Sbjct  153  TEGPIRRANSAF---GATDELGNFTIHLPSRLHATPRLENACVVRVLRLPPDSAC  204



>ref|NP_001064313.1| Os10g0206500 [Oryza sativa Japonica Group]
 gb|ABG65991.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26227.1| Os10g0206500 [Oryza sativa Japonica Group]
 gb|EEE50721.1| hypothetical protein OsJ_31019 [Oryza sativa Japonica Group]
Length=188

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 3/118 (3%)
 Frame = +2

Query  266  ATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGI  445
            A + + ++  +S  EL ++AGYGE+ +STV++ G+V C+ C           + GA V +
Sbjct  20   AISTMPMELYFSPGELARIAGYGEEPVSTVVVSGQVACELCLCPGSDLLTFELPGAKVEV  79

Query  446  LCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
             C   G     +S   V  +TDE G F   LPS LHA P+LENAC+V+VL LP  S C
Sbjct  80   ACETEGPNTQANS---VFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPPDSAC  134



>gb|ABD65131.1| hypothetical protein 40.t00006 [Brassica oleracea]
Length=148

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/153 (35%), Positives = 83/153 (54%), Gaps = 24/153 (16%)
 Frame = +2

Query  230  LAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESS  409
            L  +F+V L       +     ++R+E+V++AGYGE K+S+V++   ++  +        
Sbjct  8    LTLVFMVALGEAVGDRMR----WTRKEMVEIAGYGELKLSSVILTASLLSSSSD------  57

Query  410  SLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVR  589
               PISGA+VGI+C    RR S      +K  T++ G F IDLPS LHAIP+L+ AC ++
Sbjct  58   ---PISGATVGIMCHTGHRRRSKV----IKAVTNDFGQFTIDLPSDLHAIPDLDKACSIK  110

Query  590  VLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
             L +PK   C+          H+GI+L+    G
Sbjct  111  PLSVPKPYRCSHKI-------HRGIKLVSSSNG  136



>ref|XP_006414259.1| hypothetical protein EUTSA_v10026465mg [Eutrema salsugineum]
 gb|ESQ55712.1| hypothetical protein EUTSA_v10026465mg [Eutrema salsugineum]
Length=155

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 87/153 (57%), Gaps = 24/153 (16%)
 Frame = +2

Query  230  LAFIFLVILESPATANLTIDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESS  409
            L   F+V L       +     +SR+E+V+M+GYGE K+S+VL+   ++         SS
Sbjct  10   LTLFFMVALGEAVGERMR----WSRKEMVEMSGYGELKLSSVLLTASLL---------SS  56

Query  410  SLHPISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVR  589
            S  PI GA++GI C    R+ S     W+K  T++ G F+IDLPSHLHAIP+L+ ACL++
Sbjct  57   SSDPIPGATIGIKCHTGIRKRSN----WIKAVTNDLGQFVIDLPSHLHAIPDLDKACLIK  112

Query  590  VLHLPKASICTQHYYYSRAPKHKGIQLIGVEEG  688
             L +PK   C+ +        H+GI+L+    G
Sbjct  113  PLSVPKQFRCSPNI-------HRGIKLVSSSNG  138



>ref|XP_002466758.1| hypothetical protein SORBIDRAFT_01g013620 [Sorghum bicolor]
 gb|EER93756.1| hypothetical protein SORBIDRAFT_01g013620 [Sorghum bicolor]
Length=224

 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 76/135 (56%), Gaps = 8/135 (6%)
 Frame = +2

Query  290  EVY-SREELVKMAGYGEDKISTVLIEGEVVCQTC-SDGDESSSLHPISGASVGILCsrsg  463
            EVY +  EL ++AGYGE+ +S+V + G++ C+ C   G +  +L  + GA V + C    
Sbjct  65   EVYFTPAELARIAGYGEEPVSSVSVSGQLTCELCLRPGSQLLALD-MPGAKVAVTCKSDR  123

Query  464  rrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSR  643
              ++   S +   +TDE G F IDLP  LHA P+LE AC V+VL LP  S   +H    R
Sbjct  124  TPSNQLDS-FAFATTDEYGNFTIDLPPQLHATPDLEKACTVKVLQLPADSCRLRH----R  178

Query  644  APKHKGIQLIGVEEG  688
                 G++L  VE+G
Sbjct  179  TGDTYGLRLSSVEDG  193



>ref|NP_001131971.2| uncharacterized protein LOC100193369 [Zea mays]
 gb|ACF80619.2| unknown [Zea mays]
Length=171

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 47/139 (34%), Positives = 73/139 (53%), Gaps = 6/139 (4%)
 Frame = +2

Query  284  IDEVYSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsg  463
            ++  +S  EL ++AGYGE+ +S+V + G++ C+ C           ++GA V + C    
Sbjct  1    MEAYFSAAELARIAGYGEEPVSSVSVSGQLTCELCLRPGSPLLALEMAGAKVAVTCDCES  60

Query  464  r----rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHY  631
            +         S + V  +TDE G F IDLP+ LHA P+LE AC V+VL LP  S   +  
Sbjct  61   QHPIPSDEPDSLALVAATTDESGNFTIDLPARLHATPDLEKACAVKVLRLPAGSGSCRLR  120

Query  632  YYSRAPKHKGIQLIGVEEG  688
            +  RA     ++L   E+G
Sbjct  121  H--RAGDAYRLRLASAEDG  137



>tpg|DAA50324.1| TPA: hypothetical protein ZEAMMB73_534968 [Zea mays]
Length=232

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 73/143 (51%), Gaps = 22/143 (15%)
 Frame = +2

Query  296  YSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHP--------ISGASVGILC  451
            +S  EL ++AGYGE+ +S+V + G++ C+ C        L P        ++GA V + C
Sbjct  66   FSAAELARIAGYGEEPVSSVSVSGQLTCELC--------LRPGSPLLALEMAGAKVAVTC  117

Query  452  srsgr----rasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
                +         S + V  +TDE G F IDLP+ LHA P+LE AC V+VL LP  S  
Sbjct  118  DCESQHPIPSDEPDSLALVAATTDESGNFTIDLPARLHATPDLEKACAVKVLRLPAGSGS  177

Query  620  TQHYYYSRAPKHKGIQLIGVEEG  688
             +  +  RA     ++L   E+G
Sbjct  178  CRLRH--RAGDAYRLRLASAEDG  198



>ref|XP_004956162.1| PREDICTED: uncharacterized protein LOC101776137 [Setaria italica]
Length=194

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 69/131 (53%), Gaps = 5/131 (4%)
 Frame = +2

Query  296  YSREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLHPISGASVGILCsrsgrras  475
            +S  EL ++AGYGE+ +S+V + G+V C+ C           + GA V +LC        
Sbjct  38   FSPAELARIAGYGEEPVSSVSVSGQVACELCLRPGSDLLAFELPGAKVAVLCETECPNDQ  97

Query  476  fssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPKH  655
             ++S+    +TDE G F IDLPS LHA  NLE AC V+VL LP  S C   +  S     
Sbjct  98   AANSALA--TTDEFGNFTIDLPSQLHATANLERACTVKVLQLPADSSCRLRHQPSTT---  152

Query  656  KGIQLIGVEEG  688
             G+ L   E+G
Sbjct  153  YGLMLASQEDG  163



>ref|XP_007212536.1| hypothetical protein PRUPE_ppa019383mg, partial [Prunus persica]
 gb|EMJ13735.1| hypothetical protein PRUPE_ppa019383mg, partial [Prunus persica]
Length=163

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 63/104 (61%), Gaps = 13/104 (13%)
 Frame = +2

Query  299  SREELVKMAGYGEDKISTVLIEGEVVCQTCSDGDESSSLH----------PISGASVGIL  448
            S+E++V++AGYGE+K+STVLI G V C+   +   + + H          P+SGA V + 
Sbjct  62   SQEDMVQIAGYGEEKLSTVLITGSVHCEEACNNLHAQTHHPDYQLHLHAWPLSGALVSVN  121

Query  449  CsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENAC  580
            C  SGR+   S     +G  DE G F+IDLPS+LHAIPNL   C
Sbjct  122  CHVSGRKRKSSL---AQGLADEFGDFIIDLPSNLHAIPNLHKTC  162



>gb|AAM18169.1|AC092172_29 Unknown protein [Oryza sativa Japonica Group]
 gb|EAZ15621.1| hypothetical protein OsJ_31029 [Oryza sativa Japonica Group]
Length=94

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 39/62 (63%), Gaps = 5/62 (8%)
 Frame = +2

Query  506  TDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASICTQHYYYSRAPK-HKGIQLIGVE  682
            TDE+G F I+LPS LHA PNLE AC V+VL LP    C    +  R+P  + GIQL   E
Sbjct  9    TDENGNFTIELPSRLHATPNLEKACSVKVLQLPLDCAC----WPRRSPSYYHGIQLSSSE  64

Query  683  EG  688
            +G
Sbjct  65   DG  66



>gb|EMT25847.1| hypothetical protein F775_16133 [Aegilops tauschii]
Length=97

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  500  GSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
             +T+E G F I+LPS LHAIP+LENAC V+VL LP  S C
Sbjct  7    ATTNEYGNFSIELPSRLHAIPSLENACSVKVLELPPDSAC  46



>gb|AAL82668.2|AC092387_16 expressed protein [Oryza sativa Japonica Group]
Length=121

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +2

Query  422  ISGASVGILCsrsgrrasfssssWVKGSTDEDGGFLIDLPSHLHAIPNLENACLVRVLHL  601
            I GA V + C   G     +S   V  +TDE G F   LPS LHA P+LENAC+V+VL L
Sbjct  5    IYGAKVEVACETEGPNTQANS---VFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQL  61

Query  602  PKASIC  619
            P  S C
Sbjct  62   PPDSAC  67



>gb|AAM18143.1|AC092172_3 Hypothetical protein [Oryza sativa Japonica Group]
Length=119

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  503  STDEDGGFLIDLPSHLHAIPNLENACLVRVLHLPKASIC  619
            +TDE G F   LPS LHA P+LENAC+V+VL LP  S C
Sbjct  29   ATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPPDSAC  67



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2109012510310