BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21681_g1_i2 len=440 path=[1073:0-89 2440:90-335 2161:336-439]

Length=440
                                                                      Score     E

gb|KGN62233.1|  hypothetical protein Csa_2G337780                     60.5    2e-08   
ref|XP_009787343.1|  PREDICTED: cyclin-C1-2-like isoform X2           59.3    5e-08   
ref|XP_009610781.1|  PREDICTED: cyclin-C1-2-like isoform X2           59.3    5e-08   
ref|XP_009787342.1|  PREDICTED: cyclin-C1-2-like isoform X1           59.3    5e-08   
ref|XP_009610780.1|  PREDICTED: cyclin-C1-2-like isoform X1           59.3    5e-08   
tpg|DAA62196.1|  TPA: hypothetical protein ZEAMMB73_552296            57.0    1e-07   
gb|EMS47807.1|  hypothetical protein TRIUR3_05108                     58.2    1e-07   
ref|XP_003570275.1|  PREDICTED: cyclin-C1-1-like                      58.5    1e-07   
dbj|BAG92963.1|  unnamed protein product                              57.4    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100776.1|  hypothetical protein L484_015805                 58.5    1e-07   
ref|XP_007144279.1|  hypothetical protein PHAVU_007G1431001g          55.5    1e-07   
emb|CDP03920.1|  unnamed protein product                              58.2    1e-07   
gb|KCW58031.1|  hypothetical protein EUGRSUZ_H00759                   57.4    1e-07   
dbj|BAK04698.1|  predicted protein                                    58.2    1e-07   
gb|EMT00854.1|  hypothetical protein F775_07394                       58.2    1e-07   
ref|XP_004957273.1|  PREDICTED: cyclin-C1-1-like isoform X1           58.2    1e-07   
dbj|BAG92962.1|  unnamed protein product                              57.4    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004957274.1|  PREDICTED: cyclin-C1-1-like isoform X2           58.2    1e-07   
gb|EMT26067.1|  hypothetical protein F775_07915                       58.5    2e-07   
gb|KCW58032.1|  hypothetical protein EUGRSUZ_H00759                   57.0    2e-07   
ref|XP_004242420.1|  PREDICTED: cyclin-C1-2-like                      57.8    2e-07   
ref|XP_007140675.1|  hypothetical protein PHAVU_008G132400g           57.0    2e-07   
emb|CAN80455.1|  hypothetical protein VITISV_013570                   56.6    2e-07   Vitis vinifera
gb|EEC84840.1|  hypothetical protein OsI_31940                        57.4    3e-07   Oryza sativa Indica Group [Indian rice]
ref|NP_001175929.1|  Os09g0504400                                     57.4    3e-07   
ref|XP_003578377.1|  PREDICTED: cyclin-C1-1                           57.4    3e-07   
ref|NP_001132453.1|  uncharacterized protein LOC100193909             57.0    3e-07   Zea mays [maize]
ref|XP_009780810.1|  PREDICTED: cyclin-C1-2-like                      57.0    3e-07   
ref|XP_009348370.1|  PREDICTED: cyclin-C1-2-like                      57.0    3e-07   
ref|XP_003635266.1|  PREDICTED: cyclin-C1-2 isoform X1                57.0    3e-07   
ref|XP_008382593.1|  PREDICTED: cyclin-C1-2-like                      57.0    3e-07   
ref|XP_009372218.1|  PREDICTED: cyclin-C1-2-like                      57.0    3e-07   
ref|XP_009618524.1|  PREDICTED: cyclin-C1-2-like                      57.0    3e-07   
gb|ACG44793.1|  cyclin-C                                              57.0    4e-07   Zea mays [maize]
ref|XP_002460486.1|  hypothetical protein SORBIDRAFT_02g029140        57.0    4e-07   Sorghum bicolor [broomcorn]
gb|ACF78432.1|  unknown                                               57.0    4e-07   Zea mays [maize]
ref|XP_008650928.1|  PREDICTED: uncharacterized protein LOC100193...  57.4    4e-07   
ref|XP_010026013.1|  PREDICTED: cyclin-C1-2-like                      57.4    4e-07   
tpg|DAA62199.1|  TPA: hypothetical protein ZEAMMB73_552296            57.4    5e-07   
ref|XP_007049671.1|  Cyclin family protein isoform 1                  56.6    5e-07   
ref|XP_004290173.1|  PREDICTED: cyclin-C1-2-like                      56.2    6e-07   
ref|XP_008792922.1|  PREDICTED: cyclin-C1-1-like                      56.2    6e-07   
ref|XP_002531088.1|  g1/s-specific cyclin C, putative                 54.7    9e-07   Ricinus communis
ref|XP_010274067.1|  PREDICTED: cyclin-C1-1-like                      55.8    1e-06   
ref|XP_009408347.1|  PREDICTED: cyclin-C1-1-like isoform X3           55.5    1e-06   
ref|XP_009408346.1|  PREDICTED: cyclin-C1-1-like isoform X2           55.8    1e-06   
ref|XP_006848487.1|  hypothetical protein AMTR_s00013p00255700        55.5    1e-06   
gb|KDP45294.1|  hypothetical protein JCGZ_15159                       55.5    1e-06   
ref|XP_009408345.1|  PREDICTED: cyclin-C1-1-like isoform X1           55.8    1e-06   
ref|XP_006661409.1|  PREDICTED: cyclin-C1-1-like                      55.5    1e-06   
ref|XP_003532265.1|  PREDICTED: cyclin-C1-2-like isoform X1           55.1    1e-06   
gb|ACU19188.1|  unknown                                               55.1    1e-06   Glycine max [soybeans]
ref|XP_007201393.1|  hypothetical protein PRUPE_ppa010335mg           55.1    1e-06   
ref|XP_003552106.1|  PREDICTED: cyclin-C1-2-like isoformX1            55.1    1e-06   
ref|XP_006586218.1|  PREDICTED: cyclin-C1-2-like isoform X2           55.1    1e-06   
gb|EYU39219.1|  hypothetical protein MIMGU_mgv1a022737mg              54.7    2e-06   
ref|XP_008235425.1|  PREDICTED: cyclin-C1-2-like                      55.1    2e-06   
ref|XP_011089059.1|  PREDICTED: cyclin-C1-2-like isoform X2           54.3    2e-06   
ref|XP_004160343.1|  PREDICTED: cyclin-C1-1-like                      55.1    2e-06   
ref|XP_004147331.1|  PREDICTED: cyclin-C1-1-like                      55.1    2e-06   
ref|XP_008460811.1|  PREDICTED: cyclin-C1-1-like                      54.7    2e-06   
ref|XP_010906182.1|  PREDICTED: cyclin-C1-1-like                      54.7    2e-06   
ref|XP_010067504.1|  PREDICTED: cyclin-C1-1-like                      53.5    3e-06   
ref|XP_001784865.1|  predicted protein                                54.3    3e-06   
ref|XP_011089058.1|  PREDICTED: cyclin-C1-2-like isoform X1           53.9    4e-06   
ref|XP_006602480.1|  PREDICTED: cyclin-C1-2-like isoform X2           53.9    5e-06   
ref|XP_011100105.1|  PREDICTED: cyclin-C1-2-like                      51.2    8e-06   
ref|XP_011089651.1|  PREDICTED: cyclin-C1-2-like                      52.8    1e-05   
gb|EPS62492.1|  hypothetical protein M569_12301                       52.8    1e-05   
ref|XP_010678185.1|  PREDICTED: cyclin-C1-1-like                      52.8    1e-05   
ref|XP_010696234.1|  PREDICTED: cyclin-C1-1-like                      52.8    1e-05   
emb|CDY05665.1|  BnaC02g38720D                                        50.4    1e-05   
gb|KDO65990.1|  hypothetical protein CISIN_1g024567mg                 52.4    2e-05   
gb|ACJ84323.1|  unknown                                               52.0    2e-05   Medicago truncatula
ref|XP_003622864.1|  Cyclin-C1-2                                      52.0    2e-05   
ref|XP_006443546.1|  hypothetical protein CICLE_v10021820mg           52.0    2e-05   
ref|XP_010493699.1|  PREDICTED: cyclin-C1-1-like isoform X2           51.2    2e-05   
ref|XP_006395154.1|  hypothetical protein EUTSA_v10004814mg           50.8    3e-05   
ref|XP_006395158.1|  hypothetical protein EUTSA_v10004803mg           51.6    3e-05   
ref|XP_006291727.1|  hypothetical protein CARUB_v10017896mg           51.6    3e-05   
ref|XP_010493698.1|  PREDICTED: cyclin-C1-1-like isoform X1           51.6    3e-05   
ref|XP_010482116.1|  PREDICTED: cyclin-C1-1                           51.6    3e-05   
ref|NP_199675.2|  cyclin-C1-1                                         51.6    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865656.1|  cyclin family protein                            51.6    3e-05   
dbj|BAB10697.1|  cyclin C-like protein                                51.2    4e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129741.1|  PREDICTED: cyclin-C1-2                           51.2    4e-05   
ref|XP_006375642.1|  hypothetical protein POPTR_0014s18510g           50.8    4e-05   
gb|KEH22571.1|  amino-terminal domain cyclin                          51.2    5e-05   
ref|XP_002320618.1|  hypothetical protein POPTR_0014s18510g           50.8    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006395155.1|  hypothetical protein EUTSA_v10004814mg           50.8    5e-05   
ref|XP_002865654.1|  hypothetical protein ARALYDRAFT_357071           48.9    6e-05   
ref|XP_010493695.1|  PREDICTED: cyclin-C1-2 isoform X1                50.8    6e-05   
ref|XP_010442297.1|  PREDICTED: cyclin-C1-2-like                      50.8    6e-05   
ref|XP_002865655.1|  cyclin family protein                            50.8    6e-05   
ref|NP_199674.1|  cyclin-C1-2                                         50.4    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482115.1|  PREDICTED: cyclin-C1-2-like                      50.4    6e-05   
ref|XP_011024604.1|  PREDICTED: cyclin-C1-2-like                      50.4    7e-05   
ref|NP_001190493.1|  cyclin-C1-2                                      50.4    7e-05   
ref|XP_010999792.1|  PREDICTED: cyclin-C1-2-like                      50.4    7e-05   
ref|XP_006291726.1|  hypothetical protein CARUB_v10017895mg           50.4    7e-05   
ref|XP_002301804.1|  hypothetical protein POPTR_0002s24820g           50.4    7e-05   Populus trichocarpa [western balsam poplar]
ref|XP_004515040.1|  PREDICTED: cyclin-C1-2-like isoform X1           50.4    7e-05   
emb|CDY69301.1|  BnaC02g48270D                                        50.4    8e-05   
ref|XP_010552038.1|  PREDICTED: cyclin-C1-1                           50.4    8e-05   
gb|KFK31301.1|  hypothetical protein AALP_AA6G094600                  50.1    9e-05   
ref|XP_006280988.1|  hypothetical protein CARUB_v10026989mg           50.1    9e-05   
ref|XP_010547124.1|  PREDICTED: cyclin-C1-2-like isoform X7           49.7    1e-04   
emb|CDY66082.1|  BnaCnng49540D                                        50.1    1e-04   
emb|CDY51052.1|  BnaA02g30360D                                        50.1    1e-04   
ref|XP_006279729.1|  hypothetical protein CARUB_v10027517mg           49.7    1e-04   
ref|XP_010547121.1|  PREDICTED: cyclin-C1-2-like isoform X5           49.7    1e-04   
ref|XP_010547123.1|  PREDICTED: cyclin-C1-2-like isoform X6           49.7    2e-04   
ref|XP_010547116.1|  PREDICTED: cyclin-C1-2-like isoform X2           49.7    2e-04   
ref|XP_010547118.1|  PREDICTED: cyclin-C1-2-like isoform X4           49.7    2e-04   
ref|XP_010547117.1|  PREDICTED: cyclin-C1-2-like isoform X3           49.7    2e-04   
ref|XP_010493697.1|  PREDICTED: cyclin-C1-2 isoform X2                49.3    2e-04   
ref|XP_010547111.1|  PREDICTED: cyclin-C1-2-like isoform X1           49.7    2e-04   
gb|KFK31302.1|  hypothetical protein AALP_AA6G094700                  48.9    3e-04   
gb|KFK31300.1|  hypothetical protein AALP_AA6G094600                  48.9    3e-04   
ref|XP_010552037.1|  PREDICTED: cyclin-C1-2                           47.4    0.001   



>gb|KGN62233.1| hypothetical protein Csa_2G337780 [Cucumis sativus]
Length=251

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV*LLQTKSC  118
            IALACIYIASVL++K+ T+WFEEL  DMNVV LL+ K C
Sbjct  190  IALACIYIASVLREKDTTAWFEELHVDMNVVSLLKAKLC  228



>ref|XP_009787343.1| PREDICTED: cyclin-C1-2-like isoform X2 [Nicotiana sylvestris]
Length=250

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVLKDKETTAWFEELRVDMNVV  218



>ref|XP_009610781.1| PREDICTED: cyclin-C1-2-like isoform X2 [Nicotiana tomentosiformis]
Length=250

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVLKDKETTAWFEELRVDMNVV  218



>ref|XP_009787342.1| PREDICTED: cyclin-C1-2-like isoform X1 [Nicotiana sylvestris]
Length=251

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVLKDKETTAWFEELRVDMNVV  218



>ref|XP_009610780.1| PREDICTED: cyclin-C1-2-like isoform X1 [Nicotiana tomentosiformis]
Length=251

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVLKDKETTAWFEELRVDMNVV  218



>tpg|DAA62196.1| TPA: hypothetical protein ZEAMMB73_552296 [Zea mays]
Length=127

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   IALACIYIASVLKDKEITSWFEELQADMNVV  94
           IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  59  IALACIYIASVLKDKDTTAWFEELRVDMNIV  89



>gb|EMS47807.1| hypothetical protein TRIUR3_05108 [Triticum urartu]
Length=245

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL  DMN+V
Sbjct  177  IALACIYIASVLKDKDTTSWFEELHVDMNIV  207



>ref|XP_003570275.1| PREDICTED: cyclin-C1-1-like [Brachypodium distachyon]
Length=257

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTSWFEELRVDMNIV  219



>dbj|BAG92963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=180

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+IT WFEEL+ DMN+V
Sbjct  112  IALACIYIASVLKDKDITLWFEELRVDMNIV  142



>ref|XP_010100776.1| hypothetical protein L484_015805 [Morus notabilis]
 gb|EXB84474.1| hypothetical protein L484_015805 [Morus notabilis]
Length=266

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL+DK+ TSWFEEL+ DMNVV
Sbjct  190  IALACIYIASVLRDKDTTSWFEELRVDMNVV  220



>ref|XP_007144279.1| hypothetical protein PHAVU_007G1431001g, partial [Phaseolus vulgaris]
 gb|ESW16273.1| hypothetical protein PHAVU_007G1431001g, partial [Phaseolus vulgaris]
Length=66

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2   IALACIYIASVLKDKEITSWFEELQADMNV  91
           IALACIYIASVL+DK+ T+WFEEL+ DMNV
Sbjct  30  IALACIYIASVLRDKDTTAWFEELRVDMNV  59



>emb|CDP03920.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVLKDKENTAWFEELRVDMNVV  218



>gb|KCW58031.1| hypothetical protein EUGRSUZ_H00759 [Eucalyptus grandis]
Length=195

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDK+ TSWFEEL+ DMNVV
Sbjct  132  IALACIYIASVYKDKDTTSWFEELRVDMNVV  162



>dbj|BAK04698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTSWFEELRVDMNIV  219



>gb|EMT00854.1| hypothetical protein F775_07394 [Aegilops tauschii]
Length=257

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL  DMN+V
Sbjct  189  IALACIYIASVLKDKDTTSWFEELHVDMNIV  219



>ref|XP_004957273.1| PREDICTED: cyclin-C1-1-like isoform X1 [Setaria italica]
Length=260

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL+ DMN+V
Sbjct  192  IALACIYIASVLKDKDTTSWFEELRVDMNIV  222



>dbj|BAG92962.1| unnamed protein product [Oryza sativa Japonica Group]
Length=214

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+IT WFEEL+ DMN+V
Sbjct  146  IALACIYIASVLKDKDITLWFEELRVDMNIV  176



>ref|XP_004957274.1| PREDICTED: cyclin-C1-1-like isoform X2 [Setaria italica]
Length=258

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL+ DMN+V
Sbjct  190  IALACIYIASVLKDKDTTSWFEELRVDMNIV  220



>gb|EMT26067.1| hypothetical protein F775_07915 [Aegilops tauschii]
Length=336

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ TSWFEEL+ DMN+V
Sbjct  268  IALACIYIASVLKDKDTTSWFEELRVDMNIV  298



>gb|KCW58032.1| hypothetical protein EUGRSUZ_H00759 [Eucalyptus grandis]
Length=210

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDK+ TSWFEEL+ DMNVV
Sbjct  147  IALACIYIASVYKDKDTTSWFEELRVDMNVV  177



>ref|XP_004242420.1| PREDICTED: cyclin-C1-2-like [Solanum lycopersicum]
 ref|XP_006352673.1| PREDICTED: cyclin-C1-2-like [Solanum tuberosum]
Length=250

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASVLKDKE T+WFEEL+ DMNVV
Sbjct  188  ITLACIYIASVLKDKETTAWFEELRVDMNVV  218



>ref|XP_007140675.1| hypothetical protein PHAVU_008G132400g [Phaseolus vulgaris]
 gb|ESW12669.1| hypothetical protein PHAVU_008G132400g [Phaseolus vulgaris]
Length=226

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL+DK+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLRDKDTTAWFEELRVDMNVV  220



>emb|CAN80455.1| hypothetical protein VITISV_013570 [Vitis vinifera]
Length=195

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDKE T+WFEEL+ DMNVV
Sbjct  132  IALACIYIASVHKDKETTAWFEELRVDMNVV  162



>gb|EEC84840.1| hypothetical protein OsI_31940 [Oryza sativa Indica Group]
Length=257

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+IT WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDITLWFEELRVDMNIV  219



>ref|NP_001175929.1| Os09g0504400 [Oryza sativa Japonica Group]
 sp|P93411.1|CCC11_ORYSJ RecName: Full=Cyclin-C1-1; Short=CycC1;1 [Oryza sativa Japonica 
Group]
 dbj|BAA13181.1| C-type cyclin [Oryza sativa Japonica Group]
 dbj|BAG92961.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94657.1| Os09g0504400 [Oryza sativa Japonica Group]
Length=257

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+IT WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDITLWFEELRVDMNIV  219



>ref|XP_003578377.1| PREDICTED: cyclin-C1-1 [Brachypodium distachyon]
Length=257

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTTWFEELRVDMNIV  219



>ref|NP_001132453.1| uncharacterized protein LOC100193909 [Zea mays]
 gb|ACF81298.1| unknown [Zea mays]
 tpg|DAA62197.1| TPA: hypothetical protein ZEAMMB73_552296 [Zea mays]
Length=249

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  154  IALACIYIASVLKDKDTTAWFEELRVDMNIV  184



>ref|XP_009780810.1| PREDICTED: cyclin-C1-2-like [Nicotiana sylvestris]
Length=250

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ D+NVV
Sbjct  188  IALACIYIASVLKDKETTAWFEELRVDVNVV  218



>ref|XP_009348370.1| PREDICTED: cyclin-C1-2-like [Pyrus x bretschneideri]
Length=253

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL+DK+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLRDKDTTAWFEELRVDMNVV  220



>ref|XP_003635266.1| PREDICTED: cyclin-C1-2 isoform X1 [Vitis vinifera]
 ref|XP_002271774.2| PREDICTED: cyclin-C1-2 isoform X2 [Vitis vinifera]
 emb|CBI41021.3| unnamed protein product [Vitis vinifera]
Length=251

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDKE T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVHKDKETTAWFEELRVDMNVV  218



>ref|XP_008382593.1| PREDICTED: cyclin-C1-2-like [Malus domestica]
Length=253

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL+DK+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLRDKDTTAWFEELRVDMNVV  220



>ref|XP_009372218.1| PREDICTED: cyclin-C1-2-like [Pyrus x bretschneideri]
Length=253

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL+DK+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLRDKDTTAWFEELRVDMNVV  220



>ref|XP_009618524.1| PREDICTED: cyclin-C1-2-like [Nicotiana tomentosiformis]
Length=250

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDKE T+WFEEL+ D+NVV
Sbjct  188  IALACIYIASVLKDKETTAWFEELRVDVNVV  218



>gb|ACG44793.1| cyclin-C [Zea mays]
Length=257

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTAWFEELRVDMNIV  219



>ref|XP_002460486.1| hypothetical protein SORBIDRAFT_02g029140 [Sorghum bicolor]
 gb|EER97007.1| hypothetical protein SORBIDRAFT_02g029140 [Sorghum bicolor]
Length=257

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTAWFEELRVDMNIV  219



>gb|ACF78432.1| unknown [Zea mays]
 gb|ACF85927.1| unknown [Zea mays]
Length=257

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTAWFEELRVDMNIV  219



>ref|XP_008650928.1| PREDICTED: uncharacterized protein LOC100193909 isoform X1 [Zea 
mays]
 tpg|DAA62200.1| TPA: cyclin-C [Zea mays]
Length=297

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  229  IALACIYIASVLKDKDTTAWFEELRVDMNIV  259



>ref|XP_010026013.1| PREDICTED: cyclin-C1-2-like [Eucalyptus grandis]
Length=312

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDK+ TSWFEEL+ DMNVV
Sbjct  249  IALACIYIASVYKDKDTTSWFEELRVDMNVV  279



>tpg|DAA62199.1| TPA: hypothetical protein ZEAMMB73_552296 [Zea mays]
Length=324

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T+WFEEL+ DMN+V
Sbjct  229  IALACIYIASVLKDKDTTAWFEELRVDMNIV  259



>ref|XP_007049671.1| Cyclin family protein isoform 1 [Theobroma cacao]
 ref|XP_007049672.1| Cyclin family protein isoform 1 [Theobroma cacao]
 gb|EOX93828.1| Cyclin family protein isoform 1 [Theobroma cacao]
 gb|EOX93829.1| Cyclin family protein isoform 1 [Theobroma cacao]
Length=253

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV K+K+ITSWFEEL+ DMNVV
Sbjct  190  IALACIYIASVHKEKDITSWFEELRVDMNVV  220



>ref|XP_004290173.1| PREDICTED: cyclin-C1-2-like [Fragaria vesca subsp. vesca]
Length=253

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL+D++ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLRDRDTTAWFEELRVDMNVV  220



>ref|XP_008792922.1| PREDICTED: cyclin-C1-1-like [Phoenix dactylifera]
Length=259

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYI SVLKDKE T+WFEEL+ DMN V
Sbjct  188  IALACIYIGSVLKDKETTAWFEELRVDMNAV  218



>ref|XP_002531088.1| g1/s-specific cyclin C, putative [Ricinus communis]
 gb|EEF31302.1| g1/s-specific cyclin C, putative [Ricinus communis]
Length=185

 Score = 54.7 bits (130),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFEEL  DMNVV
Sbjct  122  IALACIYIASVYREKDITAWFEELHVDMNVV  152



>ref|XP_010274067.1| PREDICTED: cyclin-C1-1-like [Nelumbo nucifera]
Length=257

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLK+K+ T+WFEEL+ DMNVV
Sbjct  188  IALACIYIASVLKEKDTTAWFEELRVDMNVV  218



>ref|XP_009408347.1| PREDICTED: cyclin-C1-1-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=248

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIA VLKDK++T+WFEEL+ DMN+V
Sbjct  178  IALACIYIACVLKDKDLTTWFEELRVDMNIV  208



>ref|XP_009408346.1| PREDICTED: cyclin-C1-1-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=261

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIA VLKDK++T+WFEEL+ DMN+V
Sbjct  191  IALACIYIACVLKDKDLTTWFEELRVDMNIV  221



>ref|XP_006848487.1| hypothetical protein AMTR_s00013p00255700 [Amborella trichopoda]
 gb|ERN10068.1| hypothetical protein AMTR_s00013p00255700 [Amborella trichopoda]
Length=251

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I+LACIYIASVLKDK+  SWFEEL+ DMNV+
Sbjct  188  ISLACIYIASVLKDKDTNSWFEELRVDMNVI  218



>gb|KDP45294.1| hypothetical protein JCGZ_15159 [Jatropha curcas]
Length=253

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVFREKDITTWFEELRVDMNVV  220



>ref|XP_009408345.1| PREDICTED: cyclin-C1-1-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=263

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIA VLKDK++T+WFEEL+ DMN+V
Sbjct  193  IALACIYIACVLKDKDLTTWFEELRVDMNIV  223



>ref|XP_006661409.1| PREDICTED: cyclin-C1-1-like [Oryza brachyantha]
Length=257

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLKDK+ T WFEEL+ DMN+V
Sbjct  189  IALACIYIASVLKDKDTTLWFEELRVDMNIV  219



>ref|XP_003532265.1| PREDICTED: cyclin-C1-2-like isoform X1 [Glycine max]
Length=237

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL+ DMNVV
Sbjct  174  IALACIYIASVLREKDTTAWFEELRVDMNVV  204



>gb|ACU19188.1| unknown [Glycine max]
Length=237

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL+ DMNVV
Sbjct  174  IALACIYIASVLREKDTTAWFEELRVDMNVV  204



>ref|XP_007201393.1| hypothetical protein PRUPE_ppa010335mg [Prunus persica]
 gb|EMJ02592.1| hypothetical protein PRUPE_ppa010335mg [Prunus persica]
Length=253

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLREKDTTAWFEELRVDMNVV  220



>ref|XP_003552106.1| PREDICTED: cyclin-C1-2-like isoformX1 [Glycine max]
 gb|KHN12310.1| Cyclin-C1-2 [Glycine soja]
Length=253

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLREKDTTAWFEELRVDMNVV  220



>ref|XP_006586218.1| PREDICTED: cyclin-C1-2-like isoform X2 [Glycine max]
 ref|XP_006586219.1| PREDICTED: cyclin-C1-2-like isoform X3 [Glycine max]
 gb|KHN10957.1| Cyclin-C1-2 [Glycine soja]
Length=253

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLREKDTTAWFEELRVDMNVV  220



>gb|EYU39219.1| hypothetical protein MIMGU_mgv1a022737mg [Erythranthe guttata]
Length=228

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV KDKE T+WFEEL+ DMNVV
Sbjct  167  IALACLYIASVQKDKENTAWFEELRVDMNVV  197



>ref|XP_008235425.1| PREDICTED: cyclin-C1-2-like [Prunus mume]
Length=253

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVLREKDTTAWFEELRVDMNVV  220



>ref|XP_011089059.1| PREDICTED: cyclin-C1-2-like isoform X2 [Sesamum indicum]
Length=204

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV K+KE T WFEELQ DMNVV
Sbjct  143  IALACIYIASVQKNKENTVWFEELQVDMNVV  173



>ref|XP_004160343.1| PREDICTED: cyclin-C1-1-like [Cucumis sativus]
Length=264

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL  DMNVV
Sbjct  201  IALACIYIASVLREKDTTAWFEELHVDMNVV  231



>ref|XP_004147331.1| PREDICTED: cyclin-C1-1-like [Cucumis sativus]
Length=253

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL  DMNVV
Sbjct  190  IALACIYIASVLREKDTTAWFEELHVDMNVV  220



>ref|XP_008460811.1| PREDICTED: cyclin-C1-1-like [Cucumis melo]
Length=268

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T+WFEEL  DMNVV
Sbjct  205  IALACIYIASVLREKDTTAWFEELHVDMNVV  235



>ref|XP_010906182.1| PREDICTED: cyclin-C1-1-like [Elaeis guineensis]
Length=263

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIA VLK+KE T+WFEEL+ DMNVV
Sbjct  192  IALACIYIAVVLKEKETTAWFEELRVDMNVV  222



>ref|XP_010067504.1| PREDICTED: cyclin-C1-1-like [Eucalyptus grandis]
Length=176

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIAS+ K K+ TSWFEEL+ DMNVV
Sbjct  111  IALACVYIASIYKGKDTTSWFEELRVDMNVV  141



>ref|XP_001784865.1| predicted protein [Physcomitrella patens]
 gb|EDQ50328.1| predicted protein [Physcomitrella patens]
Length=263

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVLK+K+  SWFEEL+ DMNV+
Sbjct  200  IALACIYIASVLKEKDTRSWFEELRVDMNVI  230



>ref|XP_011089058.1| PREDICTED: cyclin-C1-2-like isoform X1 [Sesamum indicum]
Length=249

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV K+KE T WFEELQ DMNVV
Sbjct  188  IALACIYIASVQKNKENTVWFEELQVDMNVV  218



>ref|XP_006602480.1| PREDICTED: cyclin-C1-2-like isoform X2 [Glycine max]
Length=249

 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 28/30 (93%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNV  91
            IALACIYIASVL++K+ T+WFEEL+ DMNV
Sbjct  190  IALACIYIASVLREKDTTAWFEELRVDMNV  219



>ref|XP_011100105.1| PREDICTED: cyclin-C1-2-like [Sesamum indicum]
Length=118

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   IALACIYIASVLKDKEITSWFEELQADMNVV  94
           I+LACIYIASV K+KE T+WFEEL+ DMN+V
Sbjct  57  ISLACIYIASVQKEKENTAWFEELRVDMNLV  87



>ref|XP_011089651.1| PREDICTED: cyclin-C1-2-like [Sesamum indicum]
Length=249

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I+LACIYIASV K+KE T+WFEEL+ DMNVV
Sbjct  188  ISLACIYIASVQKEKENTAWFEELRVDMNVV  218



>gb|EPS62492.1| hypothetical protein M569_12301, partial [Genlisea aurea]
Length=247

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I+LACIYIAS  KDKE T+WFEEL  DMNVV
Sbjct  188  ISLACIYIASAQKDKENTAWFEELHVDMNVV  218



>ref|XP_010678185.1| PREDICTED: cyclin-C1-1-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDK+  +WFEEL+ DMNVV
Sbjct  189  IALACIYIASVSKDKDTIAWFEELRVDMNVV  219



>ref|XP_010696234.1| PREDICTED: cyclin-C1-1-like [Beta vulgaris subsp. vulgaris]
Length=252

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV KDK+  +WFEEL+ DMNVV
Sbjct  189  IALACIYIASVSKDKDTIAWFEELRVDMNVV  219



>emb|CDY05665.1| BnaC02g38720D [Brassica napus]
Length=109

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   IALACIYIASVLKDKEITSWFEELQADMNVV  94
           I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  65  ITLACIYIASVYKEKDIRTWFEELSVDMNIV  95



>gb|KDO65990.1| hypothetical protein CISIN_1g024567mg [Citrus sinensis]
Length=265

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+ T+WFEEL+ DMNVV
Sbjct  233  IALACIYIASVYREKDNTAWFEELRVDMNVV  263



>gb|ACJ84323.1| unknown [Medicago truncatula]
 gb|AFK33930.1| unknown [Medicago truncatula]
Length=249

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T W+EEL+ DMNV+
Sbjct  190  IALACIYIASVLREKDTTVWYEELRVDMNVI  220



>ref|XP_003622864.1| Cyclin-C1-2 [Medicago truncatula]
 gb|AES79082.1| amino-terminal domain cyclin [Medicago truncatula]
Length=249

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T W+EEL+ DMNV+
Sbjct  190  IALACIYIASVLREKDTTVWYEELRVDMNVI  220



>ref|XP_006443546.1| hypothetical protein CICLE_v10021820mg [Citrus clementina]
 ref|XP_006479219.1| PREDICTED: cyclin-C1-2-like [Citrus sinensis]
 gb|ESR56786.1| hypothetical protein CICLE_v10021820mg [Citrus clementina]
Length=253

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYIASVYREKDNTAWFEELRVDMNVV  220



>ref|XP_010493699.1| PREDICTED: cyclin-C1-1-like isoform X2 [Camelina sativa]
Length=214

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  151  IALACIYIASVHREKDITAWFEDLHEDMNLV  181



>ref|XP_006395154.1| hypothetical protein EUTSA_v10004814mg [Eutrema salsugineum]
 gb|ESQ32440.1| hypothetical protein EUTSA_v10004814mg [Eutrema salsugineum]
Length=184

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIAS+ ++K+IT+WFE+L  DMN+V
Sbjct  121  IALACIYIASIHREKDITAWFEDLHEDMNLV  151



>ref|XP_006395158.1| hypothetical protein EUTSA_v10004803mg [Eutrema salsugineum]
 gb|ESQ32444.1| hypothetical protein EUTSA_v10004803mg [Eutrema salsugineum]
Length=254

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I+LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  190  ISLACIYIASVYKEKDIRTWFEELSVDMNIV  220



>ref|XP_006291727.1| hypothetical protein CARUB_v10017896mg [Capsella rubella]
 gb|EOA24625.1| hypothetical protein CARUB_v10017896mg [Capsella rubella]
Length=252

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  189  IALACIYIASVHREKDITAWFEDLHEDMNLV  219



>ref|XP_010493698.1| PREDICTED: cyclin-C1-1-like isoform X1 [Camelina sativa]
Length=252

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  189  IALACIYIASVHREKDITAWFEDLHEDMNLV  219



>ref|XP_010482116.1| PREDICTED: cyclin-C1-1 [Camelina sativa]
Length=252

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  189  IALACIYIASVHREKDITAWFEDLHEDMNLV  219



>ref|NP_199675.2| cyclin-C1-1 [Arabidopsis thaliana]
 sp|Q9FJK6.2|CCC11_ARATH RecName: Full=Cyclin-C1-1; Short=CycC1;1 [Arabidopsis thaliana]
 gb|AED95701.1| cyclin-C1-1 [Arabidopsis thaliana]
Length=253

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  190  IALACIYIASVHREKDITAWFEDLHEDMNLV  220



>ref|XP_002865656.1| cyclin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41915.1| cyclin family protein [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  190  IALACIYIASVHREKDITAWFEDLHEDMNLV  220



>dbj|BAB10697.1| cyclin C-like protein [Arabidopsis thaliana]
Length=259

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE+L  DMN+V
Sbjct  196  IALACIYIASVHREKDITAWFEDLHEDMNLV  226



>ref|XP_009129741.1| PREDICTED: cyclin-C1-2 [Brassica rapa]
 emb|CDY51053.1| BnaA02g30350D [Brassica napus]
Length=253

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I +ACIY+ASV K+K+I +WFEEL ADMN+V
Sbjct  190  ITIACIYVASVYKEKDIKTWFEELSADMNIV  220



>ref|XP_006375642.1| hypothetical protein POPTR_0014s18510g [Populus trichocarpa]
 gb|ERP53439.1| hypothetical protein POPTR_0014s18510g [Populus trichocarpa]
Length=215

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+ T+WFEEL+ D+NVV
Sbjct  154  IALACIYIASVYREKDSTAWFEELRVDLNVV  184



>gb|KEH22571.1| amino-terminal domain cyclin [Medicago truncatula]
Length=270

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNV  91
            IALACIYIASVL++K+ T W+EEL+ DMNV
Sbjct  190  IALACIYIASVLREKDTTVWYEELRVDMNV  219



>ref|XP_002320618.1| hypothetical protein POPTR_0014s18510g [Populus trichocarpa]
 gb|ABK96032.1| unknown [Populus trichocarpa]
 gb|EEE98933.1| hypothetical protein POPTR_0014s18510g [Populus trichocarpa]
Length=251

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+ T+WFEEL+ D+NVV
Sbjct  190  IALACIYIASVYREKDSTAWFEELRVDLNVV  220



>ref|XP_006395155.1| hypothetical protein EUTSA_v10004814mg [Eutrema salsugineum]
 gb|ESQ32441.1| hypothetical protein EUTSA_v10004814mg [Eutrema salsugineum]
Length=252

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIAS+ ++K+IT+WFE+L  DMN+V
Sbjct  189  IALACIYIASIHREKDITAWFEDLHEDMNLV  219



>ref|XP_002865654.1| hypothetical protein ARALYDRAFT_357071 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41913.1| hypothetical protein ARALYDRAFT_357071 [Arabidopsis lyrata subsp. 
lyrata]
Length=124

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2   IALACIYIASVLKDKEITSWFEELQADMNVV  94
           I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  61  ITLACIYIASVHKEKDIRTWFEELFLDMNIV  91



>ref|XP_010493695.1| PREDICTED: cyclin-C1-2 isoform X1 [Camelina sativa]
Length=253

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  190  ITLACIYIASVHKEKDIRTWFEELSVDMNIV  220



>ref|XP_010442297.1| PREDICTED: cyclin-C1-2-like [Camelina sativa]
Length=253

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  190  ITLACIYIASVHKEKDIRTWFEELSVDMNIV  220



>ref|XP_002865655.1| cyclin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41914.1| cyclin family protein [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  190  ITLACIYIASVHKEKDIRTWFEELSVDMNIV  220



>ref|NP_199674.1| cyclin-C1-2 [Arabidopsis thaliana]
 sp|Q9FJK7.1|CCC12_ARATH RecName: Full=Cyclin-C1-2; Short=CycC1;2 [Arabidopsis thaliana]
 dbj|BAB10696.1| cyclin C-like protein [Arabidopsis thaliana]
 gb|AAM63187.1| cyclin C-like protein [Arabidopsis thaliana]
 gb|ABD19654.1| At5g48630 [Arabidopsis thaliana]
 gb|AED95699.1| cyclin-C1-2 [Arabidopsis thaliana]
Length=253

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  190  ITLACIYIASVHKEKDIKTWFEELSVDMNIV  220



>ref|XP_010482115.1| PREDICTED: cyclin-C1-2-like [Camelina sativa]
Length=252

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  189  ITLACIYIASVHKEKDIRTWFEELSVDMNIV  219



>ref|XP_011024604.1| PREDICTED: cyclin-C1-2-like [Populus euphratica]
Length=251

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIY ASV ++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYTASVYREKDKTAWFEELRVDMNVV  220



>ref|NP_001190493.1| cyclin-C1-2 [Arabidopsis thaliana]
 gb|AED95700.1| cyclin-C1-2 [Arabidopsis thaliana]
Length=256

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  193  ITLACIYIASVHKEKDIKTWFEELSVDMNIV  223



>ref|XP_010999792.1| PREDICTED: cyclin-C1-2-like [Populus euphratica]
Length=251

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV ++K+ T+WFEEL  DMNVV
Sbjct  190  IALACMYIASVYREKDSTAWFEELSVDMNVV  220



>ref|XP_006291726.1| hypothetical protein CARUB_v10017895mg [Capsella rubella]
 gb|EOA24624.1| hypothetical protein CARUB_v10017895mg [Capsella rubella]
Length=253

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV K+K+I +WFEEL  DMN+V
Sbjct  190  ITLACIYIASVHKEKDIRTWFEELSVDMNIV  220



>ref|XP_002301804.1| hypothetical protein POPTR_0002s24820g [Populus trichocarpa]
 gb|EEE81077.1| hypothetical protein POPTR_0002s24820g [Populus trichocarpa]
Length=251

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIY ASV ++K+ T+WFEEL+ DMNVV
Sbjct  190  IALACIYTASVYREKDKTAWFEELRVDMNVV  220



>ref|XP_004515040.1| PREDICTED: cyclin-C1-2-like isoform X1 [Cicer arietinum]
 ref|XP_004515041.1| PREDICTED: cyclin-C1-2-like isoform X2 [Cicer arietinum]
 ref|XP_004515042.1| PREDICTED: cyclin-C1-2-like isoform X3 [Cicer arietinum]
Length=249

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASVL++K+ T W+EEL+ DMN +
Sbjct  190  IALACIYIASVLREKDTTVWYEELRVDMNAI  220



>emb|CDY69301.1| BnaC02g48270D [Brassica napus]
Length=253

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I +ACIY+ASV K+++I +WFEEL ADMN+V
Sbjct  190  ITIACIYVASVYKERDIKTWFEELSADMNIV  220



>ref|XP_010552038.1| PREDICTED: cyclin-C1-1 [Tarenaya hassleriana]
Length=253

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC++IASV KD++IT+WFE+L  DMN V
Sbjct  190  IALACMFIASVYKDRDITAWFEDLHEDMNSV  220



>gb|KFK31301.1| hypothetical protein AALP_AA6G094600 [Arabis alpina]
Length=223

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE L  DMN+V
Sbjct  189  IALACIYIASVHREKDITAWFENLDEDMNLV  219



>ref|XP_006280988.1| hypothetical protein CARUB_v10026989mg [Capsella rubella]
 gb|EOA13886.1| hypothetical protein CARUB_v10026989mg [Capsella rubella]
Length=252

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+W+E+L  DMN+V
Sbjct  189  IALACIYIASVHREKDITAWYEDLHEDMNLV  219



>ref|XP_010547124.1| PREDICTED: cyclin-C1-2-like isoform X7 [Tarenaya hassleriana]
Length=214

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  151  IALACVYIASVYKEKDIRSWLEELCVDMNVV  181



>emb|CDY66082.1| BnaCnng49540D [Brassica napus]
Length=252

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV  +K+IT+WFE+L  DMN+V
Sbjct  189  IALACIYIASVHTEKDITAWFEDLHEDMNLV  219



>emb|CDY51052.1| BnaA02g30360D [Brassica napus]
Length=251

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV  +K+IT+WFE+L  DMN+V
Sbjct  188  IALACIYIASVHTEKDITAWFEDLHEDMNLV  218



>ref|XP_006279729.1| hypothetical protein CARUB_v10027517mg [Capsella rubella]
 gb|EOA12627.1| hypothetical protein CARUB_v10027517mg [Capsella rubella]
Length=254

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIASV ++K+I +WFEEL  DMN+V
Sbjct  191  ITLACIYIASVHREKDIRTWFEELSVDMNIV  221



>ref|XP_010547121.1| PREDICTED: cyclin-C1-2-like isoform X5 [Tarenaya hassleriana]
 ref|XP_010547122.1| PREDICTED: cyclin-C1-2-like isoform X5 [Tarenaya hassleriana]
Length=261

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  198  IALACVYIASVYKEKDIRSWLEELCVDMNVV  228



>ref|XP_010547123.1| PREDICTED: cyclin-C1-2-like isoform X6 [Tarenaya hassleriana]
Length=253

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  190  IALACVYIASVYKEKDIRSWLEELCVDMNVV  220



>ref|XP_010547116.1| PREDICTED: cyclin-C1-2-like isoform X2 [Tarenaya hassleriana]
Length=292

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  229  IALACVYIASVYKEKDIRSWLEELCVDMNVV  259



>ref|XP_010547118.1| PREDICTED: cyclin-C1-2-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010547119.1| PREDICTED: cyclin-C1-2-like isoform X4 [Tarenaya hassleriana]
 ref|XP_010547120.1| PREDICTED: cyclin-C1-2-like isoform X4 [Tarenaya hassleriana]
Length=273

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  210  IALACVYIASVYKEKDIRSWLEELCVDMNVV  240



>ref|XP_010547117.1| PREDICTED: cyclin-C1-2-like isoform X3 [Tarenaya hassleriana]
Length=290

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  227  IALACVYIASVYKEKDIRSWLEELCVDMNVV  257



>ref|XP_010493697.1| PREDICTED: cyclin-C1-2 isoform X2 [Camelina sativa]
Length=225

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNV  91
            I LACIYIASV K+K+I +WFEEL  DMN+
Sbjct  190  ITLACIYIASVHKEKDIRTWFEELSVDMNI  219



>ref|XP_010547111.1| PREDICTED: cyclin-C1-2-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010547112.1| PREDICTED: cyclin-C1-2-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010547113.1| PREDICTED: cyclin-C1-2-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010547115.1| PREDICTED: cyclin-C1-2-like isoform X1 [Tarenaya hassleriana]
Length=329

 Score = 49.7 bits (117),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+YIASV K+K+I SW EEL  DMNVV
Sbjct  266  IALACVYIASVYKEKDIRSWLEELCVDMNVV  296



>gb|KFK31302.1| hypothetical protein AALP_AA6G094700 [Arabis alpina]
Length=253

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            I LACIYIA V K+K+I +WFEEL  DMN+V
Sbjct  190  ITLACIYIAYVYKEKDIRTWFEELSVDMNIV  220



>gb|KFK31300.1| hypothetical protein AALP_AA6G094600 [Arabis alpina]
Length=252

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALACIYIASV ++K+IT+WFE L  DMN++
Sbjct  189  IALACIYIASVHREKDITAWFENLDEDMNLL  219



>ref|XP_010552037.1| PREDICTED: cyclin-C1-2 [Tarenaya hassleriana]
Length=253

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    IALACIYIASVLKDKEITSWFEELQADMNVV  94
            IALAC+Y+ASV K+K++ SWFEEL  D+N+V
Sbjct  190  IALACVYVASVYKEKDLRSWFEELCVDINLV  220



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517550111424