BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2164_g1_i2 len=639 path=[2015:0-13 399:14-638]

Length=639
                                                                      Score     E

gb|KDO71125.1|  hypothetical protein CISIN_1g001693mg                 95.1    1e-18   
gb|KDO71124.1|  hypothetical protein CISIN_1g001693mg                 95.1    1e-18   
ref|XP_006425531.1|  hypothetical protein CICLE_v10024791mg           94.7    1e-18   
ref|XP_006466916.1|  PREDICTED: kinesin-like protein NACK1-like i...  94.0    2e-18   
ref|XP_006466914.1|  PREDICTED: kinesin-like protein NACK1-like i...  94.4    2e-18   
ref|XP_004512117.1|  PREDICTED: kinesin-related protein 4-like is...  93.2    5e-18   
ref|XP_004512118.1|  PREDICTED: kinesin-related protein 4-like is...  93.2    5e-18   
gb|AAK50070.1|AF372930_1  AT5g66310/K1L20_9                           90.9    5e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313758.2|  kinesin motor family protein                     92.4    8e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011047336.1|  PREDICTED: kinesin-like protein NACK2 isofor...  92.0    1e-17   
ref|XP_011047311.1|  PREDICTED: kinesin-like protein NACK2 isofor...  91.7    1e-17   
dbj|BAB40703.1|  kinesin-like polypeptides 4                          86.3    2e-17   Nicotiana tabacum [American tobacco]
ref|XP_006854867.1|  hypothetical protein AMTR_s00182p00038530        90.9    2e-17   
ref|XP_009630370.1|  PREDICTED: kinesin-like protein NACK2 isofor...  90.9    3e-17   
ref|XP_011090438.1|  PREDICTED: kinesin-like protein NACK1            90.9    3e-17   
ref|XP_009630368.1|  PREDICTED: kinesin-like protein NACK1 isofor...  90.9    3e-17   
ref|XP_009772334.1|  PREDICTED: kinesin-like protein NACK2            90.5    3e-17   
ref|XP_009767346.1|  PREDICTED: kinesin-like protein NACK2 isofor...  90.5    4e-17   
ref|XP_009767348.1|  PREDICTED: kinesin-like protein NACK2 isofor...  90.5    4e-17   
ref|XP_010113382.1|  Kinesin-related protein 4                        90.5    4e-17   
ref|NP_201432.2|  ATP binding microtubule motor family protein        90.1    4e-17   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10710.1|  kinesin heavy chain DNA binding protein-like         90.1    5e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDO96988.1|  unnamed protein product                              90.1    5e-17   
ref|XP_010315333.1|  PREDICTED: kinesin-like protein NACK2 isofor...  89.7    6e-17   
ref|XP_010315335.1|  PREDICTED: kinesin-like protein NACK2 isofor...  89.7    6e-17   
ref|XP_010317234.1|  PREDICTED: kinesin-like protein NACK1 isofor...  89.7    7e-17   
gb|EYU34880.1|  hypothetical protein MIMGU_mgv1a024217mg              86.3    7e-17   
ref|XP_010317235.1|  PREDICTED: kinesin-like protein NACK1 isofor...  89.4    7e-17   
gb|EYU19439.1|  hypothetical protein MIMGU_mgv1a021560mg              85.5    9e-17   
ref|XP_009597015.1|  PREDICTED: kinesin-like protein NACK1            89.0    1e-16   
gb|KDP27640.1|  hypothetical protein JCGZ_19645                       89.0    1e-16   
gb|EPS64209.1|  hypothetical protein M569_10571                       87.4    1e-16   
emb|CDY30779.1|  BnaC07g16790D                                        89.0    1e-16   
ref|XP_010647602.1|  PREDICTED: kinesin-like protein NACK1            89.0    1e-16   
emb|CDY45220.1|  BnaA07g12700D                                        88.6    1e-16   
gb|EYU31140.1|  hypothetical protein MIMGU_mgv1a000697mg              88.6    1e-16   
ref|XP_002865077.1|  kinesin motor family protein                     88.6    2e-16   
ref|XP_010649060.1|  PREDICTED: kinesin-like protein NACK1            88.6    2e-16   
ref|XP_006383133.1|  kinesin motor family protein                     88.2    2e-16   
ref|XP_006380794.1|  hypothetical protein POPTR_0007s13860g           88.2    2e-16   
ref|XP_011025920.1|  PREDICTED: kinesin-like protein NACK2            88.2    2e-16   
gb|EYU40392.1|  hypothetical protein MIMGU_mgv1a001117mg              88.2    2e-16   
ref|XP_002512997.1|  ATP binding protein, putative                    87.8    2e-16   Ricinus communis
ref|XP_006296345.1|  hypothetical protein CARUB_v10025517mg           87.8    2e-16   
ref|XP_009345268.1|  PREDICTED: kinesin-like protein NACK1            88.2    2e-16   
ref|XP_010429028.1|  PREDICTED: kinesin-like protein NACK1            87.8    2e-16   
ref|XP_009617690.1|  PREDICTED: kinesin-like protein NACK2            87.8    3e-16   
ref|XP_010416871.1|  PREDICTED: kinesin-like protein NACK1            87.8    3e-16   
ref|XP_010472110.1|  PREDICTED: kinesin-like protein NACK1            87.8    3e-16   
ref|XP_002305465.1|  kinesin motor family protein                     87.8    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_006342008.1|  PREDICTED: kinesin-like protein NACK2-like i...  87.8    3e-16   
ref|XP_002880373.1|  kinesin motor family protein                     87.4    3e-16   
ref|XP_006342006.1|  PREDICTED: kinesin-like protein NACK2-like i...  87.8    3e-16   
ref|XP_011088489.1|  PREDICTED: kinesin-like protein NACK1            87.8    3e-16   
ref|XP_010484663.1|  PREDICTED: kinesin-like protein NACK1 isofor...  87.4    3e-16   
ref|XP_010484662.1|  PREDICTED: kinesin-like protein NACK1 isofor...  87.8    3e-16   
ref|XP_010444813.1|  PREDICTED: kinesin-like protein NACK2            87.8    3e-16   
ref|XP_011037209.1|  PREDICTED: kinesin-like protein NACK1            87.4    3e-16   
gb|KCW53110.1|  hypothetical protein EUGRSUZ_J02401                   87.4    3e-16   
ref|XP_010465682.1|  PREDICTED: kinesin-like protein NACK1            87.4    3e-16   
ref|XP_009587868.1|  PREDICTED: kinesin-like protein NACK2            87.4    4e-16   
ref|XP_009777060.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  87.4    4e-16   
ref|XP_004238322.1|  PREDICTED: kinesin-like protein NACK2            87.4    4e-16   
gb|AES95091.2|  ATP-binding microtubule motor family protein          87.4    4e-16   
ref|XP_010033468.1|  PREDICTED: kinesin-like protein NACK1            87.4    4e-16   
ref|XP_003612133.1|  Kinesin-related protein                          87.4    4e-16   
ref|XP_009760421.1|  PREDICTED: kinesin-like protein NACK2            87.0    5e-16   
gb|KHG01461.1|  Kinesin-related 11                                    87.0    5e-16   
ref|XP_010550454.1|  PREDICTED: kinesin-like protein NACK1 isofor...  87.0    5e-16   
ref|XP_010550452.1|  PREDICTED: kinesin-like protein NACK1 isofor...  87.0    5e-16   
ref|XP_006290553.1|  hypothetical protein CARUB_v10016639mg           87.0    6e-16   
ref|XP_010526582.1|  PREDICTED: kinesin-like protein NACK1 isofor...  86.7    6e-16   
gb|KDP46700.1|  hypothetical protein JCGZ_06488                       87.0    6e-16   
ref|XP_010526578.1|  PREDICTED: kinesin-like protein NACK1 isofor...  86.7    6e-16   
ref|XP_004232466.1|  PREDICTED: kinesin-like protein NACK2            87.0    6e-16   
ref|XP_006340707.1|  PREDICTED: kinesin-like protein NACK1-like       87.0    6e-16   
ref|XP_004509341.1|  PREDICTED: kinesin-related protein 4-like is...  86.7    6e-16   
gb|ABB45845.1|  hypothetical protein                                  86.7    6e-16   Eutrema halophilum
ref|XP_006393829.1|  hypothetical protein EUTSA_v10003607mg           86.7    7e-16   
ref|XP_004509338.1|  PREDICTED: kinesin-related protein 4-like is...  86.7    7e-16   
ref|XP_006281818.1|  hypothetical protein CARUB_v10028003mg           86.7    7e-16   
ref|XP_002531511.1|  conserved hypothetical protein                   86.7    7e-16   Ricinus communis
ref|XP_007046742.1|  ATP binding microtubule motor family protein...  86.7    7e-16   
emb|CDP01925.1|  unnamed protein product                              86.7    7e-16   
gb|EYU35751.1|  hypothetical protein MIMGU_mgv1a020956mg              83.6    8e-16   
ref|XP_009117419.1|  PREDICTED: kinesin-like protein NACK1            86.3    9e-16   
emb|CDY13822.1|  BnaA09g43240D                                        86.3    1e-15   
ref|XP_003516550.1|  PREDICTED: kinesin-like protein NACK2-like i...  86.3    1e-15   
emb|CDX82016.1|  BnaC08g35850D                                        85.9    1e-15   
gb|KCW53111.1|  hypothetical protein EUGRSUZ_J02403                   85.9    1e-15   
ref|XP_006411686.1|  hypothetical protein EUTSA_v10024409mg           85.9    1e-15   
ref|XP_008372766.1|  PREDICTED: kinesin-like protein NACK1            85.9    1e-15   
ref|XP_010091188.1|  Kinesin-related protein 11                       85.9    1e-15   
ref|XP_006404570.1|  hypothetical protein EUTSA_v10000043mg           85.5    1e-15   
ref|XP_008448048.1|  PREDICTED: kinesin-like protein NACK2            85.9    1e-15   
ref|XP_010531480.1|  PREDICTED: kinesin-like protein NACK1            85.5    1e-15   
ref|XP_008382370.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  85.5    1e-15   
ref|XP_010263901.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.5    1e-15   
ref|XP_010547443.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.5    2e-15   
ref|XP_007157943.1|  hypothetical protein PHAVU_002G111200g           85.5    2e-15   
ref|XP_004289095.1|  PREDICTED: uncharacterized protein LOC101300397  85.5    2e-15   
gb|AET03829.2|  ATP-binding microtubule motor family protein          85.5    2e-15   
gb|KEH20388.1|  ATP-binding microtubule motor family protein          85.5    2e-15   
ref|XP_004146557.1|  PREDICTED: uncharacterized protein LOC101218717  85.5    2e-15   
ref|XP_010263900.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.5    2e-15   
ref|XP_004160983.1|  PREDICTED: uncharacterized LOC101218717          85.5    2e-15   
ref|XP_003629353.1|  Kinesin heavy chain DNA binding protein-like...  85.5    2e-15   
ref|XP_010547438.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.5    2e-15   
gb|KGN53326.1|  hypothetical protein Csa_4G047870                     85.5    2e-15   
gb|KHN00495.1|  Kinesin-related protein 11                            85.5    2e-15   
ref|XP_010547436.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.5    2e-15   
ref|XP_009140424.1|  PREDICTED: kinesin-like protein NACK1            85.1    2e-15   
ref|XP_003519876.1|  PREDICTED: kinesin-like protein NACK1-like       85.5    2e-15   
ref|XP_009338641.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.5    2e-15   
ref|XP_010547437.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.5    2e-15   
emb|CDY41952.1|  BnaA01g05240D                                        85.1    2e-15   
ref|XP_009378198.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.5    2e-15   
ref|XP_010547440.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.5    2e-15   
ref|XP_010547439.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.5    2e-15   
ref|XP_009378197.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.5    2e-15   
ref|XP_003538873.1|  PREDICTED: kinesin-like protein NACK1-like i...  85.5    2e-15   
ref|XP_009338640.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.5    2e-15   
gb|KHF98716.1|  Kinesin-related 11                                    85.5    2e-15   
ref|XP_010547441.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.1    2e-15   
ref|XP_010547442.1|  PREDICTED: kinesin-like protein NACK2 isofor...  85.1    2e-15   
emb|CAB62637.1|  putative protein                                     85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009378441.1|  PREDICTED: kinesin-like protein NACK1            85.1    2e-15   
ref|XP_003607070.1|  Kinesin-related protein                          85.1    2e-15   
ref|XP_010426660.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.1    2e-15   
ref|XP_009136600.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.1    2e-15   
ref|NP_001190049.1|  ATP binding microtubule motor family protein     85.1    2e-15   
ref|NP_190684.3|  ATP binding microtubule motor family protein        85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010426656.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.1    2e-15   
emb|CDX90660.1|  BnaA03g41210D                                        85.1    2e-15   
dbj|BAF00728.1|  hypothetical protein                                 85.1    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136598.1|  PREDICTED: kinesin-like protein NACK1 isofor...  85.1    2e-15   
emb|CDY29004.1|  BnaC07g32100D                                        85.1    2e-15   
ref|XP_010271468.1|  PREDICTED: kinesin-like protein NACK2            85.1    2e-15   
ref|XP_007017694.1|  ATP binding microtubule motor family protein...  84.7    3e-15   
ref|XP_006403945.1|  hypothetical protein EUTSA_v10010086mg           84.7    3e-15   
gb|KHN41676.1|  Kinesin-related protein 4                             84.7    3e-15   
ref|XP_006599344.1|  PREDICTED: kinesin-like protein NACK1-like i...  84.7    3e-15   
gb|EPS66111.1|  hypothetical protein M569_08665                       84.7    3e-15   
ref|XP_006599340.1|  PREDICTED: kinesin-like protein NACK1-like i...  84.7    3e-15   
ref|XP_010028653.1|  PREDICTED: kinesin-like protein NACK1 isofor...  84.3    3e-15   
ref|XP_010503800.1|  PREDICTED: kinesin-like protein NACK1            84.7    3e-15   
ref|XP_010028651.1|  PREDICTED: kinesin-like protein NACK1 isofor...  84.3    4e-15   
ref|XP_011092853.1|  PREDICTED: kinesin-like protein NACK1 isofor...  84.3    4e-15   
emb|CDY42594.1|  BnaC01g00060D                                        84.3    4e-15   
ref|XP_007201806.1|  hypothetical protein PRUPE_ppa001038mg           84.3    4e-15   
emb|CDX77978.1|  BnaA09g31730D                                        84.3    4e-15   
ref|XP_002876073.1|  kinesin motor family protein                     84.3    4e-15   
ref|XP_011092849.1|  PREDICTED: kinesin-like protein NACK1 isofor...  84.3    4e-15   
ref|XP_009115792.1|  PREDICTED: kinesin-like protein NACK1 isofor...  84.3    5e-15   
ref|NP_179726.2|  ATP binding microtubule motor family protein        84.0    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010909958.1|  PREDICTED: kinesin-like protein NACK1            84.3    5e-15   
emb|CDX73746.1|  BnaC08g22570D                                        84.3    5e-15   
ref|XP_009115793.1|  PREDICTED: kinesin-like protein NACK1 isofor...  84.0    5e-15   
ref|XP_007203241.1|  hypothetical protein PRUPE_ppa001146mg           84.0    5e-15   
ref|XP_008241798.1|  PREDICTED: kinesin-like protein NACK1            84.0    6e-15   
ref|XP_007156119.1|  hypothetical protein PHAVU_003G260200g           84.0    6e-15   
ref|XP_008236841.1|  PREDICTED: kinesin-like protein NACK2            83.6    6e-15   
emb|CDP07439.1|  unnamed protein product                              83.6    7e-15   
ref|XP_004974128.1|  PREDICTED: kinesin-like protein NACK1-like i...  83.6    7e-15   
ref|XP_004974129.1|  PREDICTED: kinesin-like protein NACK1-like i...  83.6    7e-15   
ref|XP_004974127.1|  PREDICTED: kinesin-like protein NACK1-like i...  83.6    7e-15   
ref|XP_009389113.1|  PREDICTED: kinesin-like protein NACK1            83.6    7e-15   
ref|XP_009407965.1|  PREDICTED: kinesin-like protein NACK2            83.6    7e-15   
ref|XP_004148539.1|  PREDICTED: kinesin-like protein KIN12B-like      83.6    8e-15   
ref|XP_010679850.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    9e-15   
ref|XP_010679851.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    9e-15   
ref|XP_010679852.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    9e-15   
ref|XP_010515506.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    9e-15   
ref|XP_007135918.1|  hypothetical protein PHAVU_009G003000g           83.2    1e-14   
ref|XP_010515505.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    1e-14   
ref|XP_008791672.1|  PREDICTED: kinesin-like protein NACK1 isofor...  83.2    1e-14   
gb|EPS66399.1|  hypothetical protein M569_08373                       81.6    1e-14   
ref|XP_010919403.1|  PREDICTED: kinesin-like protein NACK1 isofor...  82.8    1e-14   
ref|XP_010919401.1|  PREDICTED: kinesin-like protein NACK2 isofor...  83.2    1e-14   
ref|XP_011078149.1|  PREDICTED: kinesin-like protein NACK2            82.8    1e-14   
gb|KDO49885.1|  hypothetical protein CISIN_1g002139mg                 82.8    1e-14   
ref|XP_008791670.1|  PREDICTED: kinesin-like protein NACK2 isofor...  82.8    1e-14   
ref|XP_002280678.2|  PREDICTED: kinesin-like protein NACK1            82.8    1e-14   Vitis vinifera
emb|CBI19799.3|  unnamed protein product                              82.8    1e-14   
ref|XP_002444630.1|  hypothetical protein SORBIDRAFT_07g025040        82.8    2e-14   Sorghum bicolor [broomcorn]
gb|KDO49879.1|  hypothetical protein CISIN_1g002139mg                 82.4    2e-14   
ref|XP_006487385.1|  PREDICTED: kinesin-like protein NACK1-like i...  82.4    2e-14   
ref|XP_003578490.1|  PREDICTED: kinesin-like protein NACK1            82.4    2e-14   
gb|KDO49884.1|  hypothetical protein CISIN_1g002139mg                 82.4    2e-14   
ref|XP_006423484.1|  hypothetical protein CICLE_v10027758mg           82.4    2e-14   
ref|XP_006487377.1|  PREDICTED: kinesin-like protein NACK1-like i...  82.4    2e-14   
gb|KDO49883.1|  hypothetical protein CISIN_1g002139mg                 82.4    2e-14   
ref|XP_006423481.1|  hypothetical protein CICLE_v10027758mg           82.4    2e-14   
ref|XP_006423482.1|  hypothetical protein CICLE_v10027758mg           82.4    2e-14   
dbj|BAK06679.1|  predicted protein                                    82.0    2e-14   
ref|XP_011100938.1|  PREDICTED: kinesin-like protein NACK1            82.4    2e-14   
ref|NP_195606.2|  ATP binding microtubule motor family protein        82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02000.1|  kinesin like protein                                 82.0    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510482.1|  ATP binding protein, putative                    82.0    2e-14   Ricinus communis
ref|XP_002868873.1|  kinesin motor family protein                     82.0    2e-14   
emb|CDX99601.1|  BnaC04g33580D                                        81.6    2e-14   
emb|CDY15900.1|  BnaA04g12110D                                        81.6    3e-14   
ref|XP_008775732.1|  PREDICTED: kinesin-like protein NACK1 isofor...  82.0    3e-14   
ref|XP_010446407.1|  PREDICTED: kinesin-like protein NACK1 isofor...  81.6    3e-14   
ref|XP_010431843.1|  PREDICTED: kinesin-like protein NACK1            81.6    3e-14   
ref|XP_011083601.1|  PREDICTED: kinesin-like protein NACK1            81.6    3e-14   
gb|EMS46463.1|  Kinesin-related protein 11                            81.6    3e-14   
gb|KHN33713.1|  Centromere-associated protein E                       81.6    3e-14   
ref|XP_006659658.1|  PREDICTED: kinesin-like protein NACK2-like       81.6    3e-14   
ref|XP_006661465.1|  PREDICTED: kinesin-like protein NACK2-like       81.6    3e-14   
ref|XP_008775730.1|  PREDICTED: kinesin-like protein NACK1 isofor...  81.6    3e-14   
ref|XP_010933747.1|  PREDICTED: kinesin-like protein NACK1            81.6    4e-14   
ref|XP_009398104.1|  PREDICTED: kinesin-like protein NACK1            81.6    4e-14   
gb|KHN36049.1|  Kinesin-related protein 4                             81.3    4e-14   
ref|XP_006413467.1|  hypothetical protein EUTSA_v10026976mg           81.3    4e-14   
gb|ADQ43205.1|  kinesin motor family protein                          81.3    4e-14   
gb|KGN43176.1|  hypothetical protein Csa_7G006260                     81.3    4e-14   
ref|XP_009140272.1|  PREDICTED: kinesin-like protein NACK1            81.3    4e-14   
gb|KEH20389.1|  ATP-binding microtubule motor family protein          81.3    4e-14   
gb|EYU37862.1|  hypothetical protein MIMGU_mgv1a001175mg              80.5    6e-14   
ref|XP_006285338.1|  hypothetical protein CARUB_v10006728mg           80.9    6e-14   
ref|XP_006283113.1|  hypothetical protein CARUB_v10004132mg           80.5    6e-14   
ref|NP_001063734.2|  Os09g0528000                                     80.5    8e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEE70089.1|  hypothetical protein OsJ_30085                        80.5    8e-14   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567695.1|  ATP binding microtubule motor family protein        80.5    8e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436987.1|  PREDICTED: kinesin-like protein NACK1            80.1    8e-14   
emb|CAB51660.1|  putative protein                                     80.5    8e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KDO84748.1|  hypothetical protein CISIN_1g001290mg                 80.1    1e-13   
ref|XP_006473601.1|  PREDICTED: kinesin-like protein NACK1-like i...  80.1    1e-13   
ref|XP_009101918.1|  PREDICTED: kinesin-like protein NACK1            79.7    1e-13   
ref|XP_006435104.1|  hypothetical protein CICLE_v10000097mg           80.1    1e-13   
gb|KDO84747.1|  hypothetical protein CISIN_1g001290mg                 80.1    1e-13   
ref|XP_006473600.1|  PREDICTED: kinesin-like protein NACK1-like i...  80.1    1e-13   
ref|XP_006473602.1|  PREDICTED: kinesin-like protein NACK1-like i...  80.1    1e-13   
gb|EEC83991.1|  hypothetical protein OsI_30145                        80.1    1e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_003527612.1|  PREDICTED: kinesin-like protein NACK1-like i...  79.7    1e-13   
ref|NP_001062429.1|  Os08g0547500                                     79.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69110.1|  hypothetical protein OsJ_28179                        79.7    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452056.1|  PREDICTED: kinesin-like protein NACK1 isofor...  79.7    1e-13   
ref|XP_009386558.1|  PREDICTED: kinesin-like protein NACK1            79.3    2e-13   
gb|EYU38855.1|  hypothetical protein MIMGU_mgv1a000996mg              79.3    2e-13   
dbj|BAD09937.1|  putative kinesin heavy chain                         79.3    2e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008452051.1|  PREDICTED: kinesin-like protein NACK1 isofor...  79.3    2e-13   
ref|XP_009386197.1|  PREDICTED: kinesin-like protein NACK1            79.0    2e-13   
emb|CDY34261.1|  BnaA01g13640D                                        79.0    2e-13   
ref|XP_010672217.1|  PREDICTED: kinesin-like protein NACK2            79.0    2e-13   
ref|XP_002301999.2|  kinesin motor family protein                     79.0    2e-13   Populus trichocarpa [western balsam poplar]
gb|KHG01762.1|  Kinesin-related 11                                    79.0    3e-13   
ref|XP_011028953.1|  PREDICTED: kinesin-like protein NACK1 isofor...  79.0    3e-13   
ref|XP_011028954.1|  PREDICTED: kinesin-like protein NACK1 isofor...  79.0    3e-13   
ref|XP_010535298.1|  PREDICTED: kinesin-like protein NACK1            79.0    3e-13   
gb|KHN20030.1|  Kinesin-related protein 4                             78.6    3e-13   
gb|AAD23678.1|  putative kinesin heavy chain                          78.2    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137750.1|  PREDICTED: kinesin-like protein NACK2            78.6    3e-13   
emb|CDY03482.1|  BnaC01g16000D                                        78.2    4e-13   
ref|XP_010690757.1|  PREDICTED: kinesin-like protein NACK1            77.8    5e-13   
ref|XP_011074636.1|  PREDICTED: kinesin-like protein NACK2 isofor...  77.8    5e-13   
ref|XP_008668212.1|  PREDICTED: uncharacterized protein LOC100304...  77.8    5e-13   
ref|XP_008668211.1|  PREDICTED: uncharacterized protein LOC100304...  77.8    5e-13   
ref|XP_011074638.1|  PREDICTED: kinesin-like protein NACK1 isofor...  77.8    5e-13   
gb|KHN25430.1|  Centromere-associated protein E                       77.8    6e-13   
ref|XP_010448602.1|  PREDICTED: kinesin-like protein NACK1            77.8    6e-13   
ref|XP_010906990.1|  PREDICTED: kinesin-like protein NACK1            77.8    6e-13   
ref|XP_008796871.1|  PREDICTED: kinesin-like protein NACK1            77.8    6e-13   
ref|XP_010445917.1|  PREDICTED: kinesin-like protein NACK1            77.0    7e-13   
ref|XP_004958729.1|  PREDICTED: kinesin-like protein NACK1-like       77.4    7e-13   
gb|EMS48622.1|  Kinesin-related protein 4                             77.4    9e-13   
gb|EYU24075.1|  hypothetical protein MIMGU_mgv1a001308mg              77.0    1e-12   
ref|XP_006842375.1|  hypothetical protein AMTR_s00079p00190770        77.0    1e-12   
ref|XP_007131750.1|  hypothetical protein PHAVU_011G038800g           77.0    1e-12   
ref|XP_007131749.1|  hypothetical protein PHAVU_011G038800g           77.0    1e-12   
ref|XP_008444776.1|  PREDICTED: kinesin-like protein NACK1            76.6    1e-12   
ref|XP_006403375.1|  hypothetical protein EUTSA_v10003349mg           77.0    1e-12   
ref|XP_004152764.1|  PREDICTED: uncharacterized protein LOC101212680  76.6    1e-12   
ref|XP_004167109.1|  PREDICTED: uncharacterized LOC101212680          76.6    1e-12   
ref|XP_008792831.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  76.3    2e-12   
ref|XP_007226270.1|  hypothetical protein PRUPE_ppa019074mg           76.3    2e-12   
gb|KHF98979.1|  Kinesin-related 11                                    76.3    2e-12   
ref|XP_008652983.1|  PREDICTED: kinesin-like protein NACK1 isofor...  76.3    2e-12   
ref|XP_008652981.1|  PREDICTED: kinesin-like protein NACK1 isofor...  76.3    2e-12   
ref|XP_008775906.1|  PREDICTED: kinesin-like protein NACK1            76.3    2e-12   
ref|XP_008221318.1|  PREDICTED: kinesin-like protein NACK1            76.3    2e-12   
ref|XP_010922342.1|  PREDICTED: kinesin-like protein NACK1            76.3    2e-12   
ref|XP_008388154.1|  PREDICTED: kinesin-like protein NACK1            74.7    2e-12   
ref|XP_010481985.1|  PREDICTED: kinesin-like protein NACK1            75.9    2e-12   
ref|XP_010494185.1|  PREDICTED: kinesin-like protein NACK2            75.9    2e-12   
ref|XP_007042026.1|  ATP binding microtubule motor family protein...  75.9    2e-12   
ref|XP_007154542.1|  hypothetical protein PHAVU_003G127400g           75.5    3e-12   
gb|EMT22069.1|  Kinesin-related protein 4                             75.1    4e-12   
ref|XP_004508036.1|  PREDICTED: centromere-associated protein E-l...  75.1    4e-12   
ref|XP_004508037.1|  PREDICTED: centromere-associated protein E-l...  75.1    4e-12   
ref|XP_009336756.1|  PREDICTED: kinesin-like protein NACK1            75.1    5e-12   
ref|XP_010687583.1|  PREDICTED: kinesin-like protein NACK2            74.7    5e-12   
ref|XP_001779285.1|  predicted protein                                74.3    6e-12   
ref|XP_009359691.1|  PREDICTED: kinesin-like protein NACK2            74.3    6e-12   
ref|XP_008337807.1|  PREDICTED: kinesin-like protein NACK2 isofor...  74.3    7e-12   
ref|XP_008337808.1|  PREDICTED: kinesin-like protein NACK2 isofor...  74.3    7e-12   
gb|KDP33977.1|  hypothetical protein JCGZ_07548                       74.3    7e-12   
ref|XP_010235379.1|  PREDICTED: kinesin-like protein NACK2 isofor...  74.3    8e-12   
ref|XP_010235378.1|  PREDICTED: kinesin-like protein NACK2 isofor...  74.3    8e-12   
ref|XP_009791027.1|  PREDICTED: kinesin-like protein NACK1            74.3    8e-12   
ref|XP_006381563.1|  TETRASPORE family protein                        73.9    9e-12   
ref|XP_011039916.1|  PREDICTED: kinesin-like protein NACK2            73.9    1e-11   
ref|XP_009336747.1|  PREDICTED: kinesin-like protein NACK1            73.9    1e-11   
gb|EEC84919.1|  hypothetical protein OsI_32119                        73.9    1e-11   
gb|EPS71432.1|  hypothetical protein M569_03327                       73.6    1e-11   
ref|XP_010433806.1|  PREDICTED: kinesin-like protein NACK1            73.9    1e-11   
ref|XP_008388149.1|  PREDICTED: kinesin-like protein NACK2            73.9    1e-11   
ref|XP_008388151.1|  PREDICTED: kinesin-like protein NACK1            73.6    1e-11   
gb|AFW86156.1|  LOW QUALITY PROTEIN: kinesin heavy chain              73.6    1e-11   
ref|XP_010107075.1|  Kinesin-related protein 4                        73.6    1e-11   
ref|XP_008659376.1|  PREDICTED: kinesin-like protein NACK1            73.6    1e-11   
gb|EEC77720.1|  hypothetical protein OsI_16807                        73.2    2e-11   
ref|NP_001053433.1|  Os04g0538800                                     73.2    2e-11   
emb|CAE03025.3|  OSJNBa0091D06.23                                     73.2    2e-11   
dbj|BAD18096.1|  kinesin heavy chain-like protein                     72.8    2e-11   
ref|XP_004953277.1|  PREDICTED: kinesin-like protein NACK1-like i...  73.2    2e-11   
ref|XP_009123681.1|  PREDICTED: kinesin-like protein NACK1            73.2    2e-11   
ref|XP_003541319.1|  PREDICTED: kinesin-like protein NACK2-like i...  73.2    2e-11   
ref|XP_002863777.1|  kinesin motor family protein                     73.2    2e-11   
ref|XP_006647603.1|  PREDICTED: kinesin-like protein NACK1-like       72.8    2e-11   
gb|EEC73693.1|  hypothetical protein OsI_08272                        72.8    2e-11   
ref|NP_001047571.1|  Os02g0645100                                     72.8    2e-11   
gb|EEE57470.1|  hypothetical protein OsJ_07710                        72.4    3e-11   
ref|XP_010261715.1|  PREDICTED: kinesin-like protein NACK2            72.4    3e-11   
gb|EYU28300.1|  hypothetical protein MIMGU_mgv1a001029mg              72.0    4e-11   
ref|XP_006652585.1|  PREDICTED: kinesin-like protein NACK1-like       72.0    4e-11   
ref|XP_006279726.1|  hypothetical protein CARUB_v10027496mg           72.0    4e-11   
ref|XP_010110084.1|  Kinesin-related protein 4                        72.0    4e-11   
ref|XP_002987833.1|  hypothetical protein SELMODRAFT_126650           71.6    4e-11   
ref|XP_004293191.1|  PREDICTED: uncharacterized protein LOC101301847  72.0    4e-11   
ref|XP_004968822.1|  PREDICTED: kinesin-like protein NACK1-like i...  72.0    5e-11   
ref|XP_002992286.1|  hypothetical protein SELMODRAFT_135047           71.6    5e-11   
ref|XP_002437695.1|  hypothetical protein SORBIDRAFT_10g001010        71.6    5e-11   
ref|XP_009407329.1|  PREDICTED: kinesin-like protein NACK1            71.6    5e-11   
gb|AAK91812.1|AF272749_1  kinesin heavy chain                         71.2    6e-11   
ref|XP_009393646.1|  PREDICTED: kinesin-like protein NACK1            71.2    6e-11   
gb|AFW63202.1|  hypothetical protein ZEAMMB73_949881                  71.2    6e-11   
ref|XP_007012545.1|  ATP binding microtubule motor family protein...  71.2    6e-11   
ref|XP_008678883.1|  PREDICTED: kinesin-like protein NACK1 isofor...  71.2    6e-11   
ref|XP_008678882.1|  PREDICTED: kinesin-like protein NACK1 isofor...  71.2    7e-11   
ref|XP_007012544.1|  ATP binding microtubule motor family protein...  71.2    7e-11   
gb|EYU21085.1|  hypothetical protein MIMGU_mgv1a000841mg              70.9    9e-11   
gb|KHG14242.1|  Kinesin-related 4                                     70.9    9e-11   
ref|NP_199064.1|  ATP binding microtubule motor family protein        70.9    1e-10   
ref|XP_003568740.1|  PREDICTED: kinesin-like protein NACK1            70.9    1e-10   
gb|EMT03728.1|  Kinesin-related protein 4                             70.5    1e-10   
ref|XP_010279346.1|  PREDICTED: kinesin-like protein NACK1            70.5    1e-10   
ref|XP_003569980.1|  PREDICTED: kinesin-like protein NACK2            70.5    1e-10   
gb|EMS53749.1|  Kinesin-related protein 4                             70.5    1e-10   
dbj|BAK03253.1|  predicted protein                                    70.5    1e-10   
gb|EMT18151.1|  Kinesin-related protein 4                             70.5    1e-10   
ref|XP_009418072.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|XP_006341574.1|  PREDICTED: kinesin-like protein NACK1-like i...  70.1    2e-10   
ref|XP_002318539.1|  hypothetical protein POPTR_0012s05060g           70.1    2e-10   
ref|XP_010498223.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|XP_010250094.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|XP_002279228.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|XP_009589619.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|XP_004235748.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|XP_009804137.1|  PREDICTED: kinesin-like protein NACK1            70.1    2e-10   
ref|NP_173273.2|  kinesin HINKEL                                      70.1    2e-10   
ref|XP_008460562.1|  PREDICTED: kinesin-like protein NACK2 isofor...  70.1    2e-10   
ref|XP_008460563.1|  PREDICTED: kinesin-like protein NACK2 isofor...  70.1    2e-10   
gb|EYU35741.1|  hypothetical protein MIMGU_mgv1a019603mg              66.6    2e-10   
emb|CBI15491.3|  unnamed protein product                              70.1    2e-10   
ref|XP_010477014.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
emb|CBI27754.3|  unnamed protein product                              69.7    2e-10   
ref|XP_006416611.1|  hypothetical protein EUTSA_v10006702mg           69.7    2e-10   
emb|CDY19208.1|  BnaC05g14090D                                        69.7    2e-10   
gb|KGN51423.1|  hypothetical protein Csa_5G537000                     69.7    2e-10   
ref|XP_010459448.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
ref|XP_002275046.2|  PREDICTED: kinesin-like protein NACK2            69.7    2e-10   
ref|XP_009347467.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
ref|XP_007210400.1|  hypothetical protein PRUPE_ppa000865mg           69.7    2e-10   
ref|XP_006303901.1|  hypothetical protein CARUB_v10008207mg           69.7    2e-10   
ref|XP_008356658.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
ref|XP_008240232.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
ref|XP_008393328.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
ref|XP_009360131.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
gb|KHG07572.1|  kif4                                                  69.7    2e-10   
ref|XP_004300503.1|  PREDICTED: uncharacterized protein LOC101315243  69.7    2e-10   
gb|KHG07573.1|  kif4                                                  69.7    2e-10   
ref|XP_002893000.1|  hypothetical protein ARALYDRAFT_472057           69.7    2e-10   
ref|XP_006644227.1|  PREDICTED: kinesin-like protein NACK1-like       69.7    2e-10   
ref|XP_010535793.1|  PREDICTED: kinesin-like protein NACK2 isofor...  69.7    2e-10   
gb|EEC70753.1|  hypothetical protein OsI_02166                        69.7    2e-10   
ref|XP_010535794.1|  PREDICTED: kinesin-like protein NACK2 isofor...  69.7    2e-10   
ref|NP_001043186.1|  Os01g0513900                                     69.7    2e-10   
ref|XP_009149278.1|  PREDICTED: kinesin-like protein NACK1            69.7    2e-10   
emb|CDY26167.1|  BnaA06g12500D                                        69.7    2e-10   
emb|CDY21709.1|  BnaA09g44600D                                        69.3    3e-10   
ref|XP_009117616.1|  PREDICTED: kinesin-like protein NACK1            69.3    3e-10   
ref|XP_007036598.1|  ATP binding microtubule motor family protein...  69.3    3e-10   
ref|XP_003534160.1|  PREDICTED: kinesin-like protein NACK1-like i...  69.3    3e-10   
gb|KHN23757.1|  Kinesin-related protein 4                             69.3    3e-10   
gb|KHN20772.1|  Kinesin-related protein 4                             69.3    3e-10   
ref|XP_003528955.1|  PREDICTED: kinesin-like protein NACK1-like i...  69.3    3e-10   
ref|XP_004512893.1|  PREDICTED: kinesin-II 95 kDa subunit-like is...  69.3    3e-10   
gb|KDP35186.1|  hypothetical protein JCGZ_10720                       68.9    4e-10   
ref|XP_007036597.1|  ATP binding microtubule motor family protein...  68.9    4e-10   
ref|XP_011045825.1|  PREDICTED: kinesin-like protein NACK1 isofor...  68.9    4e-10   
ref|XP_011045827.1|  PREDICTED: kinesin-like protein NACK1 isofor...  68.6    4e-10   
ref|XP_003620405.1|  Kinesin-like protein KIF3A                       68.6    5e-10   
gb|AES76623.2|  ATP-binding microtubule motor family protein          68.6    5e-10   
ref|XP_008460891.1|  PREDICTED: kinesin-like protein NACK1            68.6    5e-10   
gb|AES92142.2|  ATP-binding microtubule motor family protein          68.6    6e-10   
ref|XP_004287670.1|  PREDICTED: uncharacterized protein LOC101306666  68.6    6e-10   
gb|KHG01962.1|  Kinesin-related 4                                     68.2    6e-10   
ref|XP_011008305.1|  PREDICTED: kinesin-like protein NACK1            68.2    6e-10   
ref|XP_006474579.1|  PREDICTED: kinesin-like protein NACK2-like       68.2    6e-10   
ref|XP_002321490.2|  nodulin-25 precursor family protein              68.2    6e-10   
ref|XP_010323978.1|  PREDICTED: kinesin-like protein NACK2            68.2    7e-10   
ref|XP_006452892.1|  hypothetical protein CICLE_v10007377mg           68.2    7e-10   
emb|CDO98410.1|  unnamed protein product                              68.2    7e-10   
ref|XP_006353764.1|  PREDICTED: kinesin-like protein NACK2-like       68.2    7e-10   
emb|CDX81870.1|  BnaC08g37310D                                        68.2    7e-10   
gb|KDO73778.1|  hypothetical protein CISIN_1g003967mg                 68.2    7e-10   
ref|XP_010540004.1|  PREDICTED: kinesin-like protein NACK1            68.2    7e-10   
ref|XP_010227940.1|  PREDICTED: kinesin-like protein NACK1            68.2    7e-10   
ref|XP_002516209.1|  microtubule motor, putative                      68.2    7e-10   
ref|XP_003609945.1|  Kinesin-like protein                             68.2    7e-10   
gb|KHN45051.1|  Kinesin-related protein 4                             67.8    8e-10   
ref|XP_010537459.1|  PREDICTED: kinesin-like protein NACK1 isofor...  67.8    8e-10   
ref|XP_011072914.1|  PREDICTED: kinesin-like protein NACK1            67.8    9e-10   
emb|CDP03034.1|  unnamed protein product                              67.8    1e-09   
ref|XP_007203229.1|  hypothetical protein PRUPE_ppa000925mg           67.8    1e-09   
gb|KDO49802.1|  hypothetical protein CISIN_1g002128mg                 67.8    1e-09   
ref|XP_006477781.1|  PREDICTED: kinesin-like protein NACK1-like       67.4    1e-09   
ref|XP_006442593.1|  hypothetical protein CICLE_v10018724mg           67.4    1e-09   
ref|XP_007152726.1|  hypothetical protein PHAVU_004G154300g           67.4    1e-09   
ref|XP_010693857.1|  PREDICTED: kinesin-like protein NACK1            67.4    1e-09   
dbj|BAJ94998.1|  predicted protein                                    67.0    1e-09   
dbj|BAJ95863.1|  predicted protein                                    67.0    2e-09   
gb|EMS68002.1|  Kinesin-related protein 11                            67.0    2e-09   
ref|XP_008242294.1|  PREDICTED: kinesin-like protein NACK2            67.0    2e-09   
gb|EMT24668.1|  Kinesin-related protein 11                            66.6    2e-09   
ref|XP_008367780.1|  PREDICTED: kinesin-like protein NACK1            66.2    2e-09   
gb|AAF25984.1|AC013354_3  F15H18.12                                   66.2    3e-09   
ref|XP_009786272.1|  PREDICTED: kinesin-like protein NACK2 isofor...  66.2    3e-09   
ref|XP_009786270.1|  PREDICTED: kinesin-like protein NACK2 isofor...  66.2    3e-09   
ref|XP_009786269.1|  PREDICTED: kinesin-like protein NACK2 isofor...  66.2    3e-09   
ref|XP_009786271.1|  PREDICTED: kinesin-like protein NACK2 isofor...  65.9    3e-09   
sp|Q8S949.1|NACK2_TOBAC  RecName: Full=Kinesin-like protein NACK2...  65.9    3e-09   
ref|XP_010240186.1|  PREDICTED: kinesin-like protein NACK1 isofor...  65.9    3e-09   
ref|XP_010240187.1|  PREDICTED: kinesin-like protein NACK1 isofor...  65.9    3e-09   
ref|XP_010240185.1|  PREDICTED: kinesin-like protein NACK1 isofor...  65.9    3e-09   
ref|XP_010036903.1|  PREDICTED: kinesin-like protein NACK1            65.9    4e-09   
gb|KHG01464.1|  Kinesin-related 4                                     65.9    4e-09   
ref|XP_008361127.1|  PREDICTED: kinesin-like protein NACK1            65.5    4e-09   
ref|XP_009365403.1|  PREDICTED: uncharacterized protein LOC103955247  65.5    5e-09   
ref|XP_004137483.1|  PREDICTED: uncharacterized protein LOC101215425  65.5    5e-09   
gb|KGN64145.1|  hypothetical protein Csa_1G042550                     65.5    6e-09   
ref|XP_004166306.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.5    6e-09   
gb|KHN09110.1|  Kinesin-related protein 4                             65.1    6e-09   
emb|CAB38815.1|  kinesin like protein                                 65.1    6e-09   
ref|XP_007136058.1|  hypothetical protein PHAVU_009G014400g           65.1    7e-09   
ref|XP_002448243.1|  hypothetical protein SORBIDRAFT_06g023880        64.7    8e-09   
gb|EMS62599.1|  Kinesin-related protein 4                             64.7    1e-08   
ref|XP_004976382.1|  PREDICTED: kinesin-like protein NACK1-like i...  64.7    1e-08   
ref|XP_008663418.1|  PREDICTED: kinesin-like protein NACK1 isofor...  64.3    1e-08   
ref|XP_008663419.1|  PREDICTED: kinesin-like protein NACK1 isofor...  64.3    1e-08   
ref|XP_008392715.1|  PREDICTED: kinesin-like protein NACK2            61.2    1e-08   
gb|KCW81847.1|  hypothetical protein EUGRSUZ_C03198                   63.5    2e-08   
ref|XP_010051345.1|  PREDICTED: kinesin-like protein NACK2            63.5    2e-08   
emb|CDY22404.1|  BnaA06g37260D                                        63.2    3e-08   
gb|KHN45902.1|  Kinesin-related protein 11                            63.2    3e-08   
tpg|DAA36661.1|  TPA: hypothetical protein ZEAMMB73_386599            62.8    3e-08   
ref|XP_008669084.1|  PREDICTED: kinesin-like protein NACK1 isofor...  62.8    3e-08   
tpg|DAA36662.1|  TPA: hypothetical protein ZEAMMB73_386599            62.8    3e-08   
ref|XP_008669081.1|  PREDICTED: kinesin-like protein NACK1 isofor...  62.8    3e-08   
ref|XP_008669086.1|  PREDICTED: kinesin-like protein NACK1 isofor...  62.8    3e-08   
ref|XP_008669085.1|  PREDICTED: kinesin-like protein NACK1 isofor...  62.8    4e-08   
ref|XP_009625447.1|  PREDICTED: kinesin-like protein NACK2            62.4    4e-08   
ref|XP_006419132.1|  hypothetical protein EUTSA_v10002392mg           62.0    6e-08   
ref|XP_006290563.1|  hypothetical protein CARUB_v10016650mg           61.2    1e-07   
emb|CAB89042.1|  kinesin-like protein                                 60.8    2e-07   
emb|CDY44836.1|  BnaCnng11920D                                        60.8    2e-07   
emb|CAD42234.1|  kinesin-like protein                                 60.8    2e-07   
ref|NP_189907.2|  kinesin TETRASPORE                                  60.8    2e-07   
emb|CAD42658.1|  kinesin-like protein                                 60.8    2e-07   
ref|XP_002875601.1|  hypothetical protein ARALYDRAFT_323079           60.5    2e-07   
ref|XP_009150293.1|  PREDICTED: kinesin-like protein NACK2            60.5    2e-07   
emb|CDY30956.1|  BnaA06g19570D                                        60.5    2e-07   
gb|AES73979.2|  ATP-binding microtubule motor family protein          60.1    3e-07   
ref|XP_011045826.1|  PREDICTED: kinesin-like protein NACK1 isofor...  58.5    1e-06   
ref|XP_006582466.1|  PREDICTED: kinesin-like protein NACK1-like       57.8    1e-06   
ref|XP_010514712.1|  PREDICTED: kinesin-like protein NACK2            57.8    2e-06   
ref|XP_010430934.1|  PREDICTED: kinesin-like protein NACK2            57.8    2e-06   
ref|XP_010537463.1|  PREDICTED: kinesin-like protein NACK1 isofor...  57.4    2e-06   
ref|XP_010503028.1|  PREDICTED: kinesin-like protein NACK2            57.8    2e-06   
ref|XP_003603728.1|  Kinesin-related protein                          56.2    5e-06   
gb|AAK91813.1|AF272750_1  kinesin heavy chain                         53.5    4e-05   
gb|AAK91822.1|AF272759_1  kinesin heavy chain                         52.4    1e-04   



>gb|KDO71125.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=909

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+K W+H+ +LLS C+AQRQIGET L++ SSRSHQ++RLT
Sbjct  48   PLRLLDDPERGTIVEKLTEETLKDWNHLKELLSTCEAQRQIGETSLNETSSRSHQILRLT  107

Query  178  VERKRCQDSEHLCNKPCTVSC*AILIKMRSARK  80
            VE   C   E + N P +++     + +  + +
Sbjct  108  VESSAC---EFIGNDPSSLTATVNFVDLAGSER  137



>gb|KDO71124.1| hypothetical protein CISIN_1g001693mg [Citrus sinensis]
Length=1027

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+K W+H+ +LLS C+AQRQIGET L++ SSRSHQ++RLT
Sbjct  166  PLRLLDDPERGTIVEKLTEETLKDWNHLKELLSTCEAQRQIGETSLNETSSRSHQILRLT  225

Query  178  VERKRCQDSEHLCNKPCTVSC*AILIKMRSARK  80
            VE   C   E + N P +++     + +  + +
Sbjct  226  VESSAC---EFIGNDPSSLTATVNFVDLAGSER  255



>ref|XP_006425531.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
 gb|ESR38771.1| hypothetical protein CICLE_v10024791mg [Citrus clementina]
Length=1028

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+K W+H+ +LL +C+AQRQIGET L++ SSRSHQ++RLT
Sbjct  166  PLRLLDDPERGTIVEKLTEETLKDWNHLTELLFICEAQRQIGETSLNETSSRSHQILRLT  225

Query  178  VERKRCQDSEHLCNKPCTVSC*AILIKMRSARK  80
            VE   C   E + N P +++     + +  + +
Sbjct  226  VESSAC---EFIGNDPSSLTATVNFVDLAGSER  255



>ref|XP_006466916.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=910

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+K W+H+ +LL +C+AQRQIGET L++ SSRSHQ++RLT
Sbjct  48   PLRLLDDPERGTIVEKLTEETLKDWNHLKELLFICEAQRQIGETSLNETSSRSHQILRLT  107

Query  178  VERKRCQDSEHLCNKPCTVSC*AILIKMRSARK  80
            VE   C   E + N P +++     + +  + +
Sbjct  108  VESSAC---EFIGNDPSSLTATVNFVDLAGSER  137



>ref|XP_006466914.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006466915.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1028

 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+K W+H+ +LL +C+AQRQIGET L++ SSRSHQ++RLT
Sbjct  166  PLRLLDDPERGTIVEKLTEETLKDWNHLKELLFICEAQRQIGETSLNETSSRSHQILRLT  225

Query  178  VERKRCQDSEHLCNKPCTVSC*AILIKMRSARK  80
            VE   C   E + N P +++     + +  + +
Sbjct  226  VESSAC---EFIGNDPSSLTATVNFVDLAGSER  255



>ref|XP_004512117.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
Length=948

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVEK T ET++ W+H A+L+S C+ QRQIGET L+  SSRSHQ++RLT
Sbjct  165  PLRLLDDPERGTVVEKLTDETLRDWNHFAELISFCETQRQIGETSLNDASSRSHQILRLT  224

Query  178  VERKRCQDSEHLCNKPCTV  122
            VE   C   E L N+ C+ 
Sbjct  225  VESSAC---EFLGNEKCST  240



>ref|XP_004512118.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
Length=937

 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 3/79 (4%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVEK T ET++ W+H A+L+S C+ QRQIGET L+  SSRSHQ++RLT
Sbjct  154  PLRLLDDPERGTVVEKLTDETLRDWNHFAELISFCETQRQIGETSLNDASSRSHQILRLT  213

Query  178  VERKRCQDSEHLCNKPCTV  122
            VE   C   E L N+ C+ 
Sbjct  214  VESSAC---EFLGNEKCST  229



>gb|AAK50070.1|AF372930_1 AT5g66310/K1L20_9 [Arabidopsis thaliana]
Length=425

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVCKAQRQIGET L+++SSRSHQ++RLT
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCKAQRQIGETALNEVSSRSHQILRLT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>ref|XP_002313758.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE87713.2| kinesin motor family protein [Populus trichocarpa]
Length=975

 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/87 (51%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRLLD+ E+  VVEK T ET+K W H+ +LLSVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSTDSTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRR  206

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQ  158
            IGET L++ SSRSHQ++RLTVE   C+
Sbjct  207  IGETSLNEKSSRSHQILRLTVESSACE  233



>ref|XP_011047336.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Populus euphratica]
Length=976

 Score = 92.0 bits (227),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRLLD+ E+  VVEK T ET+K W H+ +LLSVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSTDSTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRR  206

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQ  158
            IGET L++ SSRSHQ++RLT+E   C+
Sbjct  207  IGETSLNEKSSRSHQILRLTIESSACE  233



>ref|XP_011047311.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047320.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
 ref|XP_011047328.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Populus euphratica]
Length=983

 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRLLD+ E+  VVEK T ET+K W H+ +LLSVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSTDSTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRR  206

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQ  158
            IGET L++ SSRSHQ++RLT+E   C+
Sbjct  207  IGETSLNEKSSRSHQILRLTIESSACE  233



>dbj|BAB40703.1| kinesin-like polypeptides 4 [Nicotiana tabacum]
Length=150

 Score = 86.3 bits (212),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -3

Query  391  VPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKM  212
            V R  +   + PLR+LD+ E   ++EK T ET+  W H+ +LLS+C+AQRQ GET L+K 
Sbjct  51   VFRDLLSSDSTPLRMLDDPENGTIIEKLTEETLLDWDHLKELLSICEAQRQTGETYLNKA  110

Query  211  SSRSHQVIRLTVE  173
            SSRSHQ++RLT+E
Sbjct  111  SSRSHQILRLTIE  123



>ref|XP_006854867.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
 gb|ERN16334.1| hypothetical protein AMTR_s00182p00038530 [Amborella trichopoda]
Length=969

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER  +VEK T ET+  W H+  LLS+C+AQRQ
Sbjct  147  SAIEIYNEAV-RDLLSPDSTPLRLLDDPERGTIVEKLTEETLNDWDHLCKLLSICEAQRQ  205

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++MSSRSHQ++RLT+E
Sbjct  206  IGETSLNEMSSRSHQILRLTIE  227



>ref|XP_009630370.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana tomentosiformis]
Length=1023

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET++ W+HV  LLS+C+AQRQIGET L++ SS
Sbjct  154  RDLLSADSTPLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSS  213

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  214  RSHQIIRLTIE  224



>ref|XP_011090438.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=991

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T E ++ W HV  LLSVC+AQRQIGET L++MSS
Sbjct  154  RDLLSVDSTPLRLLDDPERGTIVEKLTEEILRDWDHVVQLLSVCEAQRQIGETSLNEMSS  213

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  214  RSHQIIRLTIE  224



>ref|XP_009630368.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nicotiana tomentosiformis]
Length=1028

 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET++ W+HV  LLS+C+AQRQIGET L++ SS
Sbjct  154  RDLLSADSTPLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSS  213

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  214  RSHQIIRLTIE  224



>ref|XP_009772334.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=1027

 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET++ W+HV  LLS+C+AQRQIGET L++ SS
Sbjct  154  RDLLSADSTPLRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSS  213

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  214  RSHQIIRLTIE  224



>ref|XP_009767346.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
 ref|XP_009767347.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Nicotiana sylvestris]
Length=907

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  VVEK T  T+K W+H+ +LLSVC+AQR+IGET
Sbjct  152  IYNEVV-RDLLTPDDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++MSSRSHQ++RLTVE
Sbjct  211  ALNEMSSRSHQILRLTVE  228



>ref|XP_009767348.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Nicotiana sylvestris]
Length=905

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  VVEK T  T+K W+H+ +LLSVC+AQR+IGET
Sbjct  152  IYNEVV-RDLLTPDDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++MSSRSHQ++RLTVE
Sbjct  211  ALNEMSSRSHQILRLTVE  228



>ref|XP_010113382.1| Kinesin-related protein 4 [Morus notabilis]
 gb|EXC35389.1| Kinesin-related protein 4 [Morus notabilis]
Length=1016

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVEK T ET++ W+H  +LLSVC+AQRQIGET L++ SS
Sbjct  155  RDLLSADSTPLRLLDDPERGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETSLNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>ref|NP_201432.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AED98197.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1063

 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVCKAQRQIGET L+++SSRSHQ++RLT
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCKAQRQIGETALNEVSSRSHQILRLT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>dbj|BAB10710.1| kinesin heavy chain DNA binding protein-like [Arabidopsis thaliana]
Length=1037

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVCKAQRQIGET L+++SSRSHQ++RLT
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCKAQRQIGETALNEVSSRSHQILRLT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>emb|CDO96988.1| unnamed protein product [Coffea canephora]
Length=961

 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            A + I++ +V R  +     PLRLLD+ ER  ++E+ T ET++ W+H+ +LLS+C+AQRQ
Sbjct  149  AAMEIYNEVV-RDLLSTDNTPLRLLDDPERGTIIERLTEETLRDWNHLKELLSICEAQRQ  207

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  208  IGETSLNETSSRSHQILRLTIE  229



>ref|XP_010315333.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Solanum lycopersicum]
 ref|XP_010315334.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Solanum lycopersicum]
Length=924

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +   + PLRLLD+ E+  ++EK T ET++ W H+ DLLSVC+AQRQIGET
Sbjct  153  IYNEVV-RDLLSSDSSPLRLLDDPEKGTIIEKLTEETLRDWDHLKDLLSVCEAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  YLNENSSRSHQILRLTIE  229



>ref|XP_010315335.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Solanum lycopersicum]
Length=922

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +   + PLRLLD+ E+  ++EK T ET++ W H+ DLLSVC+AQRQIGET
Sbjct  153  IYNEVV-RDLLSSDSSPLRLLDDPEKGTIIEKLTEETLRDWDHLKDLLSVCEAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  YLNENSSRSHQILRLTIE  229



>ref|XP_010317234.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Solanum lycopersicum]
Length=964

 Score = 89.7 bits (221),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  V+EK T ET++ W+HV  LLS+C+AQRQIGET L++ SS
Sbjct  138  RDLLSEDNTPLRLLDDPERGTVIEKLTEETLRDWNHVIHLLSICEAQRQIGETSLNETSS  197

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  198  RSHQIIRLTIE  208



>gb|EYU34880.1| hypothetical protein MIMGU_mgv1a024217mg, partial [Erythranthe 
guttata]
Length=247

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD++ER  VVE  T E ++ W HV  L  +C+AQRQIGET L+ MSSRSHQ+IRLT
Sbjct  129  PLRLLDDTERGTVVEMLTEEILRDWSHVIHLFCICEAQRQIGETSLNDMSSRSHQIIRLT  188

Query  178  VE  173
            +E
Sbjct  189  IE  190



>ref|XP_010317235.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Solanum lycopersicum]
Length=865

 Score = 89.4 bits (220),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  V+EK T ET++ W+HV  LLS+C+AQRQIGET L++ SS
Sbjct  39   RDLLSEDNTPLRLLDDPERGTVIEKLTEETLRDWNHVIHLLSICEAQRQIGETSLNETSS  98

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  99   RSHQIIRLTIE  109



>gb|EYU19439.1| hypothetical protein MIMGU_mgv1a021560mg, partial [Erythranthe 
guttata]
Length=209

 Score = 85.5 bits (210),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD++E+  VVE  T E ++ W HV  L  +C+AQRQIGET L++MSSRSHQ+IRLT
Sbjct  129  PLRLLDDTEKGTVVEMLTEEILRDWSHVIHLFCICEAQRQIGETSLNEMSSRSHQIIRLT  188

Query  178  VE  173
            +E
Sbjct  189  IE  190



>ref|XP_009597015.1| PREDICTED: kinesin-like protein NACK1 [Nicotiana tomentosiformis]
Length=1007

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVEK T ET++ W HV  LLS+C+AQRQIGET  ++ SS
Sbjct  155  RDLLSEDSAPLRLLDDPERGTVVEKLTEETLRDWGHVIQLLSICEAQRQIGETAFNETSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  215  RSHQIIRLTIE  225



>gb|KDP27640.1| hypothetical protein JCGZ_19645 [Jatropha curcas]
Length=965

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  + R + PLRLLD+ E+  +VEK T ET++ W+H+ +LLSVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSRDSAPLRLLDDPEKGTIVEKVTEETLRDWNHLQELLSVCEAQRR  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L+  SSRSHQ++RLT+E
Sbjct  207  IGETSLNDKSSRSHQILRLTIE  228



>gb|EPS64209.1| hypothetical protein M569_10571, partial [Genlisea aurea]
Length=466

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  +VE+ + E +  W+HV  LLS+C+AQRQIGET L++MSS
Sbjct  138  RDLLSMDTTPLRLLDDPERGTIVERLSEEVLSDWNHVIHLLSICEAQRQIGETSLNEMSS  197

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLT+E
Sbjct  198  RSHQIIRLTIE  208



>emb|CDY30779.1| BnaC07g16790D [Brassica napus]
Length=989

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SS
Sbjct  157  RDLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  217  RSHQILRLTVE  227



>ref|XP_010647602.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647606.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647611.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647615.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647617.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010647621.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CAN75924.1| hypothetical protein VITISV_029516 [Vitis vinifera]
 emb|CBI37987.3| unnamed protein product [Vitis vinifera]
Length=969

 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +    +PLRLLD+ ER  +VEK T ET++ W H+ +LLS+C+AQRQIGET
Sbjct  152  IYNEAV-RDLLSTDNLPLRLLDDPERGTIVEKLTEETLRDWSHLKNLLSICEAQRQIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  211  SLNETSSRSHQILRLTIE  228



>emb|CDY45220.1| BnaA07g12700D [Brassica napus]
Length=1015

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SS
Sbjct  157  RDLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  217  RSHQILRLTVE  227



>gb|EYU31140.1| hypothetical protein MIMGU_mgv1a000697mg [Erythranthe guttata]
Length=1015

 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T E ++ W HV  LLS+C+AQRQIGET L++MSSRSHQ+IRLT
Sbjct  154  PLRLLDDPERGTIVEKLTEEILRDWSHVIHLLSICEAQRQIGETSLNEMSSRSHQIIRLT  213

Query  178  VE  173
            +E
Sbjct  214  IE  215



>ref|XP_002865077.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41336.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1039

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SSRSHQ++RLT
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSRSHQILRLT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>ref|XP_010649060.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649061.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649062.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649063.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649064.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649065.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649066.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649067.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649068.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010649069.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 emb|CBI17403.3| unnamed protein product [Vitis vinifera]
Length=973

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  +VEK T ET++ W+H+ +LLS+C+AQRQIGET L++ SS
Sbjct  155  RDLLSSDTAPLRLLDDPERGTIVEKLTEETLRDWNHLIELLSLCEAQRQIGETALNETSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  215  RSHQILRLTVE  225



>ref|XP_006383133.1| kinesin motor family protein [Populus trichocarpa]
 gb|ERP60930.1| kinesin motor family protein [Populus trichocarpa]
Length=910

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   A PLRLLD+ ER  VVE+ T E+++ W+H  +LLSVC+AQRQIGET L++ SS
Sbjct  147  RDLLGADATPLRLLDDPERGTVVERLTEESIRDWNHFKELLSVCEAQRQIGETSLNEASS  206

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  207  RSHQILRLTVE  217



>ref|XP_006380794.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380795.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 ref|XP_006380796.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58591.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58592.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
 gb|ERP58593.1| hypothetical protein POPTR_0007s13860g [Populus trichocarpa]
Length=998

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  VVE+ T ET++ W+H  +LLSVC+AQRQIGET L++ SS
Sbjct  160  RDLLSTDTTPLRLLDDPERGTVVERLTEETIRDWNHFKELLSVCEAQRQIGETSLNEASS  219

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  220  RSHQILRLTIE  230



>ref|XP_011025920.1| PREDICTED: kinesin-like protein NACK2 [Populus euphratica]
Length=998

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  VVE+ T ET++ W+H  +LLSVC+AQRQIGET L++ SS
Sbjct  160  RDLLSTDTTPLRLLDDPERGTVVERLTEETIRDWNHFKELLSVCEAQRQIGETSLNEASS  219

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  220  RSHQILRLTIE  230



>gb|EYU40392.1| hypothetical protein MIMGU_mgv1a001117mg [Erythranthe guttata]
Length=884

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLR+LD+ ER  ++EK T ET++ W+H+ +LLS+C+AQRQ+GET
Sbjct  153  IYNEVV-RDLLSTENTPLRMLDDPERGTIIEKLTEETLRDWNHLKELLSICEAQRQVGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  SLNEASSRSHQILRLTIE  229



>ref|XP_002512997.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49500.1| ATP binding protein, putative [Ricinus communis]
Length=842

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRLLD+ E+  VVEK T ET+K W+H+ +LLS+C+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSADSTPLRLLDDPEKGTVVEKVTEETLKDWNHLQELLSICEAQRR  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  207  IGETSLNEKSSRSHQILRLTIE  228



>ref|XP_006296345.1| hypothetical protein CARUB_v10025517mg [Capsella rubella]
 gb|EOA29243.1| hypothetical protein CARUB_v10025517mg [Capsella rubella]
Length=862

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T ET++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_009345268.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345269.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009345270.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ +V R  +     PLRLLD+ ER  ++EK T ET++ W+H+ +LLS+C+AQRQ
Sbjct  148  SAIEIYNEVV-RDLLSTDNTPLRLLDDPERGTIIEKITEETLRDWNHLKELLSICEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+L +E
Sbjct  207  IGETALNEKSSRSHQIIKLAIE  228



>ref|XP_010429028.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429029.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010429030.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T ET++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_009617690.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009617691.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=928

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +   + PLRLLD+ E+  ++EK T ET++ W H+ +LLS+C+AQRQIGET
Sbjct  153  IYNEVV-RDLLSSDSTPLRLLDDPEKGTIIEKLTEETLRDWDHLKELLSICEAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  YLNENSSRSHQILRLTIE  229



>ref|XP_010416871.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416872.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010416873.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T ET++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_010472110.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010472111.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=862

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T ET++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_002305465.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE85976.1| kinesin motor family protein [Populus trichocarpa]
Length=842

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +     PLRLLD+ E+  VVEK T ET+K W H+ +LLSVC+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSTDDTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRR  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  196  IGETSLNEKSSRSHQILRLTIE  217



>ref|XP_006342008.1| PREDICTED: kinesin-like protein NACK2-like isoform X3 [Solanum 
tuberosum]
Length=922

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  VVEK T  T+K W+H+ +LLSVC+AQR+IGET
Sbjct  154  IYNEVV-RDLLTPEDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGET  212

Query  226  KLSKMSSRSHQVIRLTVE  173
             L+++SSRSHQ++RLTVE
Sbjct  213  ALNEVSSRSHQILRLTVE  230



>ref|XP_002880373.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56632.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=862

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T ET++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKATEETLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_006342006.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342007.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Solanum 
tuberosum]
Length=924

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  VVEK T  T+K W+H+ +LLSVC+AQR+IGET
Sbjct  154  IYNEVV-RDLLTPEDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLSVCEAQRKIGET  212

Query  226  KLSKMSSRSHQVIRLTVE  173
             L+++SSRSHQ++RLTVE
Sbjct  213  ALNEVSSRSHQILRLTVE  230



>ref|XP_011088489.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088490.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088491.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011088492.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=909

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  ++EK T ET++ W+H+  LLS C+AQRQIGET
Sbjct  153  IYNEVV-RDLLSTDNTPLRLLDDPERGTIIEKLTEETLRDWNHLKQLLSTCEAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  SLNETSSRSHQILRLTIE  229



>ref|XP_010484663.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
Length=925

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SSRSHQ++R T
Sbjct  48   PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSRSHQILRFT  107

Query  178  VE  173
            VE
Sbjct  108  VE  109



>ref|XP_010484662.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SSRSHQ++R T
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSRSHQILRFT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>ref|XP_010444813.1| PREDICTED: kinesin-like protein NACK2 [Camelina sativa]
Length=1040

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SSRSHQ++R T
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSRSHQILRFT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>ref|XP_011037209.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037210.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037211.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037212.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037214.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
 ref|XP_011037215.1| PREDICTED: kinesin-like protein NACK1 [Populus euphratica]
Length=973

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +     PLRLLD+ E+  VVEK T ET+K W H+ +LLSVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSTDDTPLRLLDDPEKGTVVEKATEETLKDWDHLKELLSVCEAQRR  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  207  IGETSLNEKSSRSHQILRLTIE  228



>gb|KCW53110.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=849

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET+K W H  +LLSVC+AQRQ+GET L++ SS
Sbjct  155  RDLLSADSSPLRLLDDPERGTIVEKLTEETLKDWSHFQELLSVCEAQRQVGETCLNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>ref|XP_010465682.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1039

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+AQRQIGET L+++SSRSHQ++R T
Sbjct  163  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCEAQRQIGETALNEVSSRSHQILRFT  222

Query  178  VE  173
            VE
Sbjct  223  VE  224



>ref|XP_009587868.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
 ref|XP_009587869.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana tomentosiformis]
Length=907

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  VVEK T  T+K W+H+ +LL VC+AQR+IGET
Sbjct  152  IYNEVV-RDLLTPDDTPLRLLDDPERGTVVEKLTEVTLKDWNHLKELLLVCEAQRKIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++MSSRSHQ++RLTVE
Sbjct  211  ALNEMSSRSHQILRLTVE  228



>ref|XP_009777060.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Nicotiana 
sylvestris]
Length=889

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +   + PLR+LD+ E+  ++EK T ET++GW H+ +LLS+C+AQRQ GET
Sbjct  153  IYNEVV-RDLLSSDSTPLRMLDDPEKGTIIEKLTEETLRGWDHLKELLSICEAQRQTGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L+  SSRSHQ++RLT+E
Sbjct  212  YLNLASSRSHQILRLTIE  229



>ref|XP_004238322.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
 ref|XP_010320414.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=926

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 60/78 (77%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  VVEK T  T+K W+H+ +LLSVC+AQR+IGET
Sbjct  154  IYNEVV-RDLLTPEDTPLRLLDDPERGTVVEKLTEITLKDWNHLKELLSVCEAQRKIGET  212

Query  226  KLSKMSSRSHQVIRLTVE  173
             L+++SSRSHQ++RLTVE
Sbjct  213  ALNEVSSRSHQILRLTVE  230



>gb|AES95091.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=956

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  VVEK T ET++ W+H  +L+S C+ QRQ
Sbjct  146  SAIEIYNESV-RDLLSADYTPLRLLDDPERGTVVEKLTEETIRDWNHFTELISFCETQRQ  204

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQDSEHLCNKPCT  125
            IGET L++ SSRSHQ++RLTVE       E L N  C+
Sbjct  205  IGETSLNEASSRSHQILRLTVE---SSAREFLGNDKCS  239



>ref|XP_010033468.1| PREDICTED: kinesin-like protein NACK1 [Eucalyptus grandis]
 gb|KCW53109.1| hypothetical protein EUGRSUZ_J02401 [Eucalyptus grandis]
Length=952

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET+K W H  +LLSVC+AQRQ+GET L++ SS
Sbjct  155  RDLLSADSSPLRLLDDPERGTIVEKLTEETLKDWSHFQELLSVCEAQRQVGETCLNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>ref|XP_003612133.1| Kinesin-related protein [Medicago truncatula]
Length=963

 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 63/98 (64%), Gaps = 4/98 (4%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  VVEK T ET++ W+H  +L+S C+ QRQ
Sbjct  153  SAIEIYNESV-RDLLSADYTPLRLLDDPERGTVVEKLTEETIRDWNHFTELISFCETQRQ  211

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQDSEHLCNKPCT  125
            IGET L++ SSRSHQ++RLTVE       E L N  C+
Sbjct  212  IGETSLNEASSRSHQILRLTVE---SSAREFLGNDKCS  246



>ref|XP_009760421.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760422.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
 ref|XP_009760423.1| PREDICTED: kinesin-like protein NACK2 [Nicotiana sylvestris]
Length=929

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ E+  ++EK T ET++ W H+ +LLS+C+AQRQIGET
Sbjct  153  IYNEVV-RDLLGSDTTPLRLLDDPEKGTIIEKLTEETLRDWDHLKELLSICEAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  YLNENSSRSHQILRLTIE  229



>gb|KHG01461.1| Kinesin-related 11 [Gossypium arboreum]
Length=953

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER  VVEK T ET++ W+H   LLSVC+AQRQ
Sbjct  143  SAIEIYNESV-RDLLSADSTPLRLLDDPERGIVVEKLTEETLRDWNHFKGLLSVCEAQRQ  201

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++R+T+E
Sbjct  202  IGETSLNEASSRSHQILRVTIE  223



>ref|XP_010550454.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=948

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T  T++ W+H  +LLSVCKAQRQIGET L+++SSRSHQ++RLT
Sbjct  48   PLRLLDDPEKGTVVEKITEATLRDWNHFKELLSVCKAQRQIGETALNEVSSRSHQILRLT  107

Query  178  VE  173
            +E
Sbjct  108  IE  109



>ref|XP_010550452.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010550453.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=1064

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T  T++ W+H  +LLSVCKAQRQIGET L+++SSRSHQ++RLT
Sbjct  164  PLRLLDDPEKGTVVEKITEATLRDWNHFKELLSVCKAQRQIGETALNEVSSRSHQILRLT  223

Query  178  VE  173
            +E
Sbjct  224  IE  225



>ref|XP_006290553.1| hypothetical protein CARUB_v10016639mg [Capsella rubella]
 gb|EOA23451.1| hypothetical protein CARUB_v10016639mg [Capsella rubella]
Length=981

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC AQRQIGET L+++SSRSHQ++RLT
Sbjct  97   PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCIAQRQIGETALNEVSSRSHQILRLT  156

Query  178  VE  173
            VE
Sbjct  157  VE  158



>ref|XP_010526582.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=732

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ ++ R  +     PLRL D+ E+  +VEK T E ++ W+H+ DLLS+C+AQR+
Sbjct  148  SAIEIYNEVI-RDLLSSDNTPLRLRDDPEKGTIVEKTTEEVLRDWNHLKDLLSICEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  207  IGETSLNERSSRSHQIIRLTVE  228



>gb|KDP46700.1| hypothetical protein JCGZ_06488 [Jatropha curcas]
Length=1012

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVE+ T ET++ W+H  +LLS+C+AQRQIGET +++ SSRSHQ++RLT
Sbjct  160  PLRLLDDPERGTVVERLTEETLRDWNHFIELLSICEAQRQIGETSMNETSSRSHQILRLT  219

Query  178  VE  173
            +E
Sbjct  220  IE  221



>ref|XP_010526578.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526579.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526580.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526581.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=840

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ ++ R  +     PLRL D+ E+  +VEK T E ++ W+H+ DLLS+C+AQR+
Sbjct  148  SAIEIYNEVI-RDLLSSDNTPLRLRDDPEKGTIVEKTTEEVLRDWNHLKDLLSICEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  207  IGETSLNERSSRSHQIIRLTVE  228



>ref|XP_004232466.1| PREDICTED: kinesin-like protein NACK2 [Solanum lycopersicum]
Length=1019

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  355  LRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLTV  176
            LRLLD+ ER  +VEK T ET++ W+HV  LLS+C+AQRQIGET L++ SSRSHQ+IRLT+
Sbjct  163  LRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSRSHQIIRLTI  222

Query  175  E  173
            E
Sbjct  223  E  223



>ref|XP_006340707.1| PREDICTED: kinesin-like protein NACK1-like [Solanum tuberosum]
Length=1023

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  355  LRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLTV  176
            LRLLD+ ER  +VEK T ET++ W+HV  LLS+C+AQRQIGET L++ SSRSHQ+IRLT+
Sbjct  167  LRLLDDPERGTIVEKLTEETLRDWNHVIQLLSICEAQRQIGETALNETSSRSHQIIRLTI  226

Query  175  E  173
            E
Sbjct  227  E  227



>ref|XP_004509341.1| PREDICTED: kinesin-related protein 4-like isoform X4 [Cicer arietinum]
Length=960

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ETM+ W+H  +L+S C+ QRQIGET L++ SS
Sbjct  155  RDLLSTDSTPLRLLDDPEKGTVVEKLTEETMRDWNHFIELISFCETQRQIGETSLNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>gb|ABB45845.1| hypothetical protein [Eutrema halophilum]
Length=1061

 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ET++ W+H  +LL VC+AQRQIGET L+++SS
Sbjct  153  RDLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLCVCEAQRQIGETALNEVSS  212

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  213  RSHQILRLTVE  223



>ref|XP_006393829.1| hypothetical protein EUTSA_v10003607mg [Eutrema salsugineum]
 gb|ESQ31115.1| hypothetical protein EUTSA_v10003607mg [Eutrema salsugineum]
Length=947

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ET++ W+H  +LL VC+AQRQIGET L+++SS
Sbjct  39   RDLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLCVCEAQRQIGETALNEVSS  98

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  99   RSHQILRLTVE  109



>ref|XP_004509338.1| PREDICTED: kinesin-related protein 4-like isoform X1 [Cicer arietinum]
 ref|XP_004509339.1| PREDICTED: kinesin-related protein 4-like isoform X2 [Cicer arietinum]
 ref|XP_004509340.1| PREDICTED: kinesin-related protein 4-like isoform X3 [Cicer arietinum]
Length=985

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ETM+ W+H  +L+S C+ QRQIGET L++ SS
Sbjct  180  RDLLSTDSTPLRLLDDPEKGTVVEKLTEETMRDWNHFIELISFCETQRQIGETSLNEASS  239

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  240  RSHQILRLTIE  250



>ref|XP_006281818.1| hypothetical protein CARUB_v10028003mg [Capsella rubella]
 gb|EOA14716.1| hypothetical protein CARUB_v10028003mg [Capsella rubella]
Length=1049

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET+  W+H  +LLSVC+AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVEKLTEETLLDWNHFKELLSVCEAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_002531511.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30865.1| conserved hypothetical protein [Ricinus communis]
Length=959

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVE+ T ET++ W+H  +LLSVC+AQRQIGET +++ SSRSHQ++RLT
Sbjct  160  PLRLLDDPERGTVVERLTEETLRDWNHFKELLSVCEAQRQIGETSMNETSSRSHQILRLT  219

Query  178  VE  173
            +E
Sbjct  220  ME  221



>ref|XP_007046742.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
 gb|EOX90899.1| ATP binding microtubule motor family protein, putative [Theobroma 
cacao]
Length=982

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVE+ T ET++ W+H   LLSVC+AQRQIGET L++ SS
Sbjct  155  RDLLSADSTPLRLLDDPERGTVVERLTEETLQDWNHFKVLLSVCEAQRQIGETSLNETSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>emb|CDP01925.1| unnamed protein product [Coffea canephora]
Length=959

 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 56/78 (72%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +     PLRLLD+ ER  +VEK T E ++ W HV +LLSVC+AQRQIGET
Sbjct  146  IYNECV-RDLLSTDTTPLRLLDDPERGTIVEKLTEEVVRDWDHVVELLSVCEAQRQIGET  204

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ+IRL VE
Sbjct  205  VLNETSSRSHQIIRLMVE  222



>gb|EYU35751.1| hypothetical protein MIMGU_mgv1a020956mg, partial [Erythranthe 
guttata]
Length=311

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD++ER  +VEK   E ++ W HV  LL +C+AQRQIGET L++MS RSHQ+IRLT
Sbjct  179  PLRLLDDTERGTIVEKLREEILRDWSHVIHLLCICEAQRQIGETSLNEMSPRSHQIIRLT  238

Query  178  VE  173
            +E
Sbjct  239  IE  240



>ref|XP_009117419.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
 ref|XP_009117420.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=862

 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T E ++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKTTEEVLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNQKSSRSHQIIKLTVE  228



>emb|CDY13822.1| BnaA09g43240D [Brassica napus]
Length=862

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T E ++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKTTEEVLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNQKSSRSHQIIKLTVE  228



>ref|XP_003516550.1| PREDICTED: kinesin-like protein NACK2-like isoform X1 [Glycine 
max]
 ref|XP_006573564.1| PREDICTED: kinesin-like protein NACK2-like isoform X2 [Glycine 
max]
Length=966

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  VVE+ T ET++ W+H  +L+S C+AQRQ
Sbjct  145  SAIEIYNESV-RDLLSPDCTPLRLLDDPERGTVVERLTEETLRDWNHFTELISFCEAQRQ  203

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  204  IGETALNEASSRSHQILRLTIE  225



>emb|CDX82016.1| BnaC08g35850D [Brassica napus]
Length=862

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T E ++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKTTEEVLRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNQKSSRSHQIIKLTVE  228



>gb|KCW53111.1| hypothetical protein EUGRSUZ_J02403 [Eucalyptus grandis]
Length=875

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVEK T ET+K W H  +LLSVC+AQRQ+GET L++ SS
Sbjct  131  RDLLSADSTPLRLLDDPERGTVVEKLTEETLKDWSHFQELLSVCEAQRQVGETCLNEASS  190

Query  205  RSHQVIRLTVE  173
             SHQ++RLT+E
Sbjct  191  GSHQILRLTIE  201



>ref|XP_006411686.1| hypothetical protein EUTSA_v10024409mg [Eutrema salsugineum]
 gb|ESQ53139.1| hypothetical protein EUTSA_v10024409mg [Eutrema salsugineum]
Length=828

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +     PLRL D+ E+  VVEK T ET++ W+H+ +LLS+C+AQR+
Sbjct  138  SAIEIYNEAI-RDLLSSDGTPLRLRDDPEKGTVVEKATLETLRDWNHLKELLSLCEAQRK  196

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  197  IGETSLNERSSRSHQIIRLTVE  218



>ref|XP_008372766.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
 ref|XP_008372767.1| PREDICTED: kinesin-like protein NACK1 [Malus domestica]
Length=963

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  +VEK T ET+  W+H  +LLS+C+AQRQIGET L++ SS
Sbjct  155  RDLLSADTTPLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RL +E
Sbjct  215  RSHQILRLVIE  225



>ref|XP_010091188.1| Kinesin-related protein 11 [Morus notabilis]
 gb|EXB43288.1| Kinesin-related protein 11 [Morus notabilis]
Length=940

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ +R  +VEK T ET++ W H+ +LLS+C+AQRQ
Sbjct  148  SAIEIYNEAV-RDLLSTDNTPLRLLDDPDRGTIVEKLTEETLRDWSHLKELLSICEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRL +E
Sbjct  207  IGETSLNEKSSRSHQIIRLGIE  228



>ref|XP_006404570.1| hypothetical protein EUTSA_v10000043mg [Eutrema salsugineum]
 gb|ESQ46023.1| hypothetical protein EUTSA_v10000043mg [Eutrema salsugineum]
Length=862

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK T E ++ W+H+ DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAVVEKTTEEILRDWNHLKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_008448048.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448049.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
 ref|XP_008448050.1| PREDICTED: kinesin-like protein NACK2 [Cucumis melo]
Length=930

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  +VEK T ET++ W+H+ +L+S+C+AQR+
Sbjct  147  SAIEIYNEAV-RDLLSTDTSPLRLLDDQERGTIVEKVTEETLRDWNHLRELISICEAQRR  205

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LT+E
Sbjct  206  IGETSLNEKSSRSHQIIKLTIE  227



>ref|XP_010531480.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531481.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
 ref|XP_010531482.1| PREDICTED: kinesin-like protein NACK1 [Tarenaya hassleriana]
Length=830

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRL D+ E+  +VEK T E ++ W+H+ DLLS+C+AQR+IGET L++ SS
Sbjct  158  RDLLSSDGTPLRLRDDPEKGTIVEKATEEILRDWNHLKDLLSICEAQRKIGETSLNERSS  217

Query  205  RSHQVIRLTVE  173
            RSHQ+IRLTVE
Sbjct  218  RSHQIIRLTVE  228



>ref|XP_008382370.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-like protein NACK1 [Malus 
domestica]
Length=929

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  ++EK T ET++ W H+ +LLS C+AQRQ
Sbjct  148  SAIEIYNEAV-RDLLSTDNTPLRLLDDPERGTIIEKITEETLRDWSHLKELLSTCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRL +E
Sbjct  207  IGETALNEKSSRSHQIIRLAIE  228



>ref|XP_010263901.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Nelumbo nucifera]
Length=894

 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   + PLRLLD+ ER  VVE+ T ET++ W H+ +LL +C+AQRQIGET
Sbjct  152  IYNEAV-RDLLGFDSTPLRLLDDPERGTVVERLTEETLRDWSHLQELLCICEAQRQIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  211  SLNETSSRSHQILRLTIE  228



>ref|XP_010547443.1| PREDICTED: kinesin-like protein NACK2 isoform X8 [Tarenaya hassleriana]
Length=895

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  39   RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  98

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  99   RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  138



>ref|XP_007157943.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
 gb|ESW29937.1| hypothetical protein PHAVU_002G111200g [Phaseolus vulgaris]
Length=963

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 59/87 (68%), Gaps = 1/87 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  VVEK T ET++ W H  +L+S  +AQRQ
Sbjct  145  SAIEIYNESV-RDLLSPDCTPLRLLDDPERGTVVEKLTEETLRDWEHFIELISFSEAQRQ  203

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQ  158
            IGET L++ SSRSHQ++RLT+E   C+
Sbjct  204  IGETALNEASSRSHQILRLTIESSACE  230



>ref|XP_004289095.1| PREDICTED: uncharacterized protein LOC101300397 [Fragaria vesca 
subsp. vesca]
Length=1040

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  +VE+ T ET++ W+H  +LLSVC+AQRQIGET L++ SS
Sbjct  154  RDLLSADTTPLRLLDDPERGTIVERLTEETLRDWNHFRELLSVCEAQRQIGETSLNEASS  213

Query  205  RSHQVIRLTVE  173
            RSHQ++RL +E
Sbjct  214  RSHQILRLVIE  224



>gb|AET03829.2| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1139

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T ET++ W+H  +L+S C+ QRQIGET L+++SS
Sbjct  155  RDLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++R+T+E
Sbjct  215  RSHQILRMTIE  225



>gb|KEH20388.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=1146

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T ET++ W+H  +L+S C+ QRQIGET L+++SS
Sbjct  155  RDLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++R+T+E
Sbjct  215  RSHQILRMTIE  225



>ref|XP_004146557.1| PREDICTED: uncharacterized protein LOC101218717 [Cucumis sativus]
Length=1000

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER   VEK T ET++ W+H   LLS+C+AQRQ
Sbjct  151  SAIEIYNESV-RDLLSVDSSPLRLLDDPERGTTVEKLTEETLRDWNHFRQLLSLCEAQRQ  209

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  210  IGETSLNEASSRSHQILRLTIE  231



>ref|XP_010263900.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Nelumbo nucifera]
Length=972

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   + PLRLLD+ ER  VVE+ T ET++ W H+ +LL +C+AQRQIGET
Sbjct  152  IYNEAV-RDLLGFDSTPLRLLDDPERGTVVERLTEETLRDWSHLQELLCICEAQRQIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  211  SLNETSSRSHQILRLTIE  228



>ref|XP_004160983.1| PREDICTED: uncharacterized LOC101218717 [Cucumis sativus]
Length=992

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER   VEK T ET++ W+H   LLS+C+AQRQ
Sbjct  144  SAIEIYNESV-RDLLSVDSSPLRLLDDPERGTTVEKLTEETLRDWNHFRQLLSLCEAQRQ  202

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  203  IGETSLNEASSRSHQILRLTIE  224



>ref|XP_003629353.1| Kinesin heavy chain DNA binding protein-like protein [Medicago 
truncatula]
Length=1167

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T ET++ W+H  +L+S C+ QRQIGET L+++SS
Sbjct  183  RDLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSS  242

Query  205  RSHQVIRLTVE  173
            RSHQ++R+T+E
Sbjct  243  RSHQILRMTIE  253



>ref|XP_010547438.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Tarenaya hassleriana]
Length=1007

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>gb|KGN53326.1| hypothetical protein Csa_4G047870 [Cucumis sativus]
Length=993

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER   VEK T ET++ W+H   LLS+C+AQRQ
Sbjct  144  SAIEIYNESV-RDLLSVDSSPLRLLDDPERGTTVEKLTEETLRDWNHFRQLLSLCEAQRQ  202

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  203  IGETSLNEASSRSHQILRLTIE  224



>gb|KHN00495.1| Kinesin-related protein 11 [Glycine soja]
Length=914

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET++ W+H  +L+S C+AQRQIGET L+++SS
Sbjct  105  RDLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWNHFQELISFCEAQRQIGETALNEVSS  164

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  165  RSHQILRLTIE  175



>ref|XP_010547436.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Tarenaya hassleriana]
Length=1008

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>ref|XP_009140424.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
 ref|XP_009141054.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
 ref|XP_009141709.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=803

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VVEK T ET++ W+H+ DLLSVC+AQR+
Sbjct  135  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDWNHLKDLLSVCEAQRK  193

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  194  IGETSLNERSSRSHQIIRLTVE  215



>ref|XP_003519876.1| PREDICTED: kinesin-like protein NACK1-like [Glycine max]
Length=949

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET++ W+H  +L+S C+AQRQIGET L+++SS
Sbjct  155  RDLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWNHFQELISFCEAQRQIGETALNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>ref|XP_009338641.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+  W+H  +LLS+C+AQRQIGET L++ SSRSHQ++RL 
Sbjct  164  PLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSRSHQILRLV  223

Query  178  VE  173
            +E
Sbjct  224  IE  225



>ref|XP_010547437.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Tarenaya hassleriana]
Length=1007

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>emb|CDY41952.1| BnaA01g05240D [Brassica napus]
Length=813

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VVEK T ET++ W+H+ DLLSVC+AQR+
Sbjct  149  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDWNHLKDLLSVCEAQRK  207

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  208  IGETSLNERSSRSHQIIRLTVE  229



>ref|XP_009378198.1| PREDICTED: kinesin-like protein NACK2 isoform X2 [Pyrus x bretschneideri]
Length=945

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+  W+H  +LLS+C+AQRQIGET L++ SSRSHQ++RL 
Sbjct  164  PLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSRSHQILRLV  223

Query  178  VE  173
            +E
Sbjct  224  IE  225



>ref|XP_010547440.1| PREDICTED: kinesin-like protein NACK2 isoform X5 [Tarenaya hassleriana]
Length=990

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>ref|XP_010547439.1| PREDICTED: kinesin-like protein NACK2 isoform X4 [Tarenaya hassleriana]
Length=1005

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>ref|XP_009378197.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+  W+H  +LLS+C+AQRQIGET L++ SSRSHQ++RL 
Sbjct  164  PLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSRSHQILRLV  223

Query  178  VE  173
            +E
Sbjct  224  IE  225



>ref|XP_003538873.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006590716.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 gb|KHN41913.1| Kinesin-related protein 4 [Glycine soja]
Length=953

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  VVE+ T ET+  W+H  +L+S C+AQRQ
Sbjct  145  SAIEIYNESV-RDLLSPDCTPLRLLDDPERGTVVERLTEETLGDWNHFTELISFCEAQRQ  203

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  204  IGETALNEASSRSHQILRLTIE  225



>ref|XP_009338640.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Pyrus x bretschneideri]
Length=976

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T ET+  W+H  +LLS+C+AQRQIGET L++ SSRSHQ++RL 
Sbjct  164  PLRLLDDPERGTIVEKLTEETLTDWNHFKELLSICEAQRQIGETALNEASSRSHQILRLV  223

Query  178  VE  173
            +E
Sbjct  224  IE  225



>gb|KHF98716.1| Kinesin-related 11 [Gossypium arboreum]
Length=978

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVEK T ET++ W+H   LLSVC+AQRQIGET L++ SS
Sbjct  155  RDLLSADSTPLRLLDDPERGTVVEKLTEETLQDWNHFKQLLSVCEAQRQIGETSLNETSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++R+ +E
Sbjct  215  RSHQILRVMIE  225



>ref|XP_010547441.1| PREDICTED: kinesin-like protein NACK2 isoform X6 [Tarenaya hassleriana]
Length=965

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>ref|XP_010547442.1| PREDICTED: kinesin-like protein NACK2 isoform X7 [Tarenaya hassleriana]
Length=962

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 66/103 (64%), Gaps = 4/103 (4%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRL D+ E+  VVEK T ET+   +H  +LLSVCKAQRQIGET L+++SS
Sbjct  152  RDLLSTDSTPLRLRDDPEKGTVVEKLTEETLHDLNHFKELLSVCKAQRQIGETALNEVSS  211

Query  205  RSHQVIRLTVERKRCQDSEHLCN-KPCTVSC*AILIKMRSARK  80
            RSHQ++RLT+E   C   E+L N K  T+S     I +  + +
Sbjct  212  RSHQILRLTIESMAC---EYLTNDKSSTLSATVNFIDLAGSER  251



>emb|CAB62637.1| putative protein [Arabidopsis thaliana]
Length=968

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_009378441.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378442.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378443.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
 ref|XP_009378444.1| PREDICTED: kinesin-like protein NACK1 [Pyrus x bretschneideri]
Length=928

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  ++EK T ET++ W H+ +LLS C+AQRQ
Sbjct  148  SAIEIYNEAV-RDLLSTDNTPLRLLDDPERGTIIEKITEETLRDWSHLKELLSTCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L+  SSRSHQ+IRL +E
Sbjct  207  IGETALNDKSSRSHQIIRLAIE  228



>ref|XP_003607070.1| Kinesin-related protein [Medicago truncatula]
 gb|AES89267.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=853

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ IV R  +     PLRL D+ ER  V+EK T ET++ W H  +LLS C+AQRQ
Sbjct  148  SAIEIYNEIV-RDLLSTDNTPLRLRDDPERGPVLEKLTEETLQDWGHFQELLSFCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            +GET L++ SSRSHQ+IRLT+E
Sbjct  207  VGETYLNEKSSRSHQIIRLTIE  228



>ref|XP_010426660.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
Length=926

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L++ SSRSHQ++RLT
Sbjct  48   PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEDSSRSHQILRLT  107

Query  178  VE  173
            VE
Sbjct  108  VE  109



>ref|XP_009136600.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Brassica rapa]
Length=910

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++GW+H  +LLS+C  QR IGET L+++SSRSHQ++RLT
Sbjct  48   PLRLLDDPEKGTVVEKLTEETLRGWNHFKELLSICIDQRHIGETALNEVSSRSHQILRLT  107

Query  178  VE  173
            VE
Sbjct  108  VE  109



>ref|NP_001190049.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78757.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1054

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|NP_190684.3| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE78756.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1052

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_010426656.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426657.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426658.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010426659.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1040

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L++ SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEDSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>emb|CDX90660.1| BnaA03g41210D [Brassica napus]
Length=1024

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++GW+H  +LLS+C  QR IGET L+++SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVEKLTEETLRGWNHFKELLSICIDQRHIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>dbj|BAF00728.1| hypothetical protein [Arabidopsis thaliana]
Length=940

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  48   PLRVLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  107

Query  178  VE  173
            VE
Sbjct  108  VE  109



>ref|XP_009136598.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
 ref|XP_009136599.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
Length=1026

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++GW+H  +LLS+C  QR IGET L+++SSRSHQ++RLT
Sbjct  164  PLRLLDDPEKGTVVEKLTEETLRGWNHFKELLSICIDQRHIGETALNEVSSRSHQILRLT  223

Query  178  VE  173
            VE
Sbjct  224  VE  225



>emb|CDY29004.1| BnaC07g32100D [Brassica napus]
Length=1011

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++GW+H  +LLS+C  QR IGET L+++SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVEKLTEETLRGWNHFKELLSICIDQRHIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_010271468.1| PREDICTED: kinesin-like protein NACK2 [Nelumbo nucifera]
Length=976

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   + PLRLLD+ ER  VVEK T E ++ W+H+ +LLS+C+AQR+IGET
Sbjct  152  IYNEAV-RDLLSVDSTPLRLLDDPERGTVVEKLTEEILRDWNHLKELLSICEAQRKIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  211  SLNETSSRSHQILRLTIE  228



>ref|XP_007017694.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007017695.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14919.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY14920.1| ATP binding microtubule motor family protein, putative isoform 
1 [Theobroma cacao]
Length=1062

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   + PLRLLD+ ER  VVEK T ET++   H+ +LLS+C+AQRQIGET
Sbjct  149  IYNEAV-RDLLSSDSTPLRLLDDPERGTVVEKLTEETLRDRDHLQELLSICEAQRQIGET  207

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLTVE
Sbjct  208  SLNETSSRSHQILRLTVE  225



>ref|XP_006403945.1| hypothetical protein EUTSA_v10010086mg [Eutrema salsugineum]
 gb|ESQ45398.1| hypothetical protein EUTSA_v10010086mg [Eutrema salsugineum]
Length=1032

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  VVEK   ET++GW+H  +LL++C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRVLDDPEKGTVVEKLMEETLRGWNHFKELLAICIAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>gb|KHN41676.1| Kinesin-related protein 4 [Glycine soja]
Length=935

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET++ W H  +L+S C+AQRQIGET L+++SS
Sbjct  155  RDLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWSHFQELISFCEAQRQIGETALNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>ref|XP_006599344.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Glycine 
max]
Length=866

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET++ W H  +L+S C+AQRQIGET L+++SS
Sbjct  86   RDLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWSHFQELISFCEAQRQIGETALNEVSS  145

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  146  RSHQILRLTIE  156



>gb|EPS66111.1| hypothetical protein M569_08665, partial [Genlisea aurea]
Length=856

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            A + I++  V R  +   A  LRLLD+ ER  V++K T  ++KG +H+ +LLS+C+AQRQ
Sbjct  128  AAIEIYNESV-RDLLSPDATSLRLLDDPERGTVIDKLTEISLKGCNHLKELLSICEAQRQ  186

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++MSSRSHQ++RLT+E
Sbjct  187  IGETSLNEMSSRSHQILRLTIE  208



>ref|XP_006599340.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006599341.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
 ref|XP_006599342.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Glycine 
max]
 ref|XP_006599343.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Glycine 
max]
Length=935

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET++ W H  +L+S C+AQRQIGET L+++SS
Sbjct  155  RDLLSVDSTPLRLLDDPEKGTVVERLTEETLRDWSHFQELISFCEAQRQIGETALNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  215  RSHQILRLTIE  225



>ref|XP_010028653.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Eucalyptus 
grandis]
Length=809

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ +V R  +   +  LRLLD+ ER  +VEK T ET++ W+H  +L+S+C+AQRQ
Sbjct  29   SAIEIYNEVV-RDLLSTDSTSLRLLDDPERGTIVEKVTEETLRDWNHFNELVSICEAQRQ  87

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+++LTVE
Sbjct  88   IGETLLNERSSRSHQILKLTVE  109



>ref|XP_010503800.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=1040

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLS+C AQRQIGET L++ SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVEKLTEETVRDWNHFKELLSICIAQRQIGETALNEDSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_010028651.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55426.1| hypothetical protein EUGRSUZ_I01329 [Eucalyptus grandis]
Length=928

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ +V R  +   +  LRLLD+ ER  +VEK T ET++ W+H  +L+S+C+AQRQ
Sbjct  148  SAIEIYNEVV-RDLLSTDSTSLRLLDDPERGTIVEKVTEETLRDWNHFNELVSICEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+++LTVE
Sbjct  207  IGETLLNERSSRSHQILKLTVE  228



>ref|XP_011092853.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Sesamum indicum]
Length=762

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  ++EK T ET++  +H+ +LLS+C+AQRQIGET
Sbjct  3    IYNEVV-RDLLSTDNTPLRLLDDPERGTIIEKLTEETLRDRNHLKELLSICEAQRQIGET  61

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  62   SLNETSSRSHQILRLTIE  79



>emb|CDY42594.1| BnaC01g00060D [Brassica napus]
Length=822

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VVEK T ET++ W+H+ DLLSVC+AQR+
Sbjct  136  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDWNHLKDLLSVCEAQRK  194

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  195  IGETSLNERSSRSHQIIKLTVE  216



>ref|XP_007201806.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
 gb|EMJ03005.1| hypothetical protein PRUPE_ppa001038mg [Prunus persica]
Length=926

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  ++EK T E ++ W H+ +LLS+C+AQRQ
Sbjct  148  SAIEIYNEAV-RDLLSSDNTPLRLLDDPERGTIIEKITEEVLRDWSHLKELLSICEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRL +E
Sbjct  207  IGETALNEKSSRSHQIIRLAIE  228



>emb|CDX77978.1| BnaA09g31730D [Brassica napus]
Length=987

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  +VEK T ET++ W H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRILDDPEKGTIVEKLTEETLRDWKHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_002876073.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52332.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=1008

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VVEK T ET++ W+H  +LLS+C AQR IGET L+++SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSICIAQRHIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_011092849.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
 ref|XP_011092850.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
 ref|XP_011092851.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Sesamum indicum]
Length=912

 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 59/78 (76%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRLLD+ ER  ++EK T ET++  +H+ +LLS+C+AQRQIGET
Sbjct  153  IYNEVV-RDLLSTDNTPLRLLDDPERGTIIEKLTEETLRDRNHLKELLSICEAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  SLNETSSRSHQILRLTIE  229



>ref|XP_009115792.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Brassica rapa]
Length=1008

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  +VEK T ET++ W H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  164  PLRILDDPEKGTIVEKLTEETLRDWKHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  223

Query  178  VE  173
            VE
Sbjct  224  VE  225



>ref|NP_179726.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 ref|NP_001031385.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEC07157.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEC07158.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=862

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ A VEK T ET++ W+H+ +L+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSTPLRLRDDPEKGAAVEKATEETLRDWNHLKELISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_010909958.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=970

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER  +VEK T ET++   H+ +LLS+C+AQRQ
Sbjct  123  SAMEIYNEAV-RDLLSMDSSPLRLLDDPERGTIVEKLTEETLRDQSHLKELLSLCEAQRQ  181

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++MSSRSHQ++RLT+E
Sbjct  182  IGETSLNEMSSRSHQILRLTIE  203



>emb|CDX73746.1| BnaC08g22570D [Brassica napus]
Length=968

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  +VEK T ET++ W H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRILDDPEKGTIVEKLTEETLRDWKHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_009115793.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Brassica rapa]
Length=892

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLR+LD+ E+  +VEK T ET++ W H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  48   PLRILDDPEKGTIVEKLTEETLRDWKHFKELLSICIAQRQIGETALNEVSSRSHQILRLT  107

Query  178  VE  173
            VE
Sbjct  108  VE  109



>ref|XP_007203241.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
 gb|EMJ04440.1| hypothetical protein PRUPE_ppa001146mg [Prunus persica]
Length=896

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  +VEK T ET++ W H  +LLSVC+ QRQIGET L++ SS
Sbjct  155  RDLLSADTTPLRLLDDPERGTIVEKLTEETLRDWDHFKELLSVCEDQRQIGETALNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RL +E
Sbjct  215  RSHQILRLVIE  225



>ref|XP_008241798.1| PREDICTED: kinesin-like protein NACK1 [Prunus mume]
Length=960

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ ER  +VEK T ET++ W H  +LLSVC+ QRQIGET L++ SS
Sbjct  155  RDLLSADTTPLRLLDDPERGTIVEKLTEETLRDWDHFKELLSVCEDQRQIGETALNEASS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RL +E
Sbjct  215  RSHQILRLVIE  225



>ref|XP_007156119.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 ref|XP_007156120.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28113.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
 gb|ESW28114.1| hypothetical protein PHAVU_003G260200g [Phaseolus vulgaris]
Length=961

 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET++ W+H  +L+  C+AQRQIGET L+++SS
Sbjct  155  RDLLSVDSTPLRLLDDPEKGTVVERLTEETLRNWNHFQELIFFCEAQRQIGETALNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  215  RSHQILRLTVE  225



>ref|XP_008236841.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
 ref|XP_008236842.1| PREDICTED: kinesin-like protein NACK2 [Prunus mume]
Length=926

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +    IPLRLLD+ ER  ++EK   E ++ W H+ +LLS+C+AQRQ
Sbjct  148  SAIEIYNEAV-RDLLSSDNIPLRLLDDPERGTIIEKIREEVLRDWSHLKELLSICEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRL +E
Sbjct  207  IGETALNEKSSRSHQIIRLAIE  228



>emb|CDP07439.1| unnamed protein product [Coffea canephora]
Length=937

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   A PLRLLD+ +R  VVEK T   ++ W H+ +LLS+C AQR+IGET
Sbjct  153  IYNEAV-RDLLSSDATPLRLLDDPDRGTVVEKITEVALRDWSHLKELLSLCAAQRKIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++MSSRSHQ++RLTV+
Sbjct  212  SLNEMSSRSHQILRLTVD  229



>ref|XP_004974128.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Setaria 
italica]
Length=1044

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ E+   VE+ T ET++ + H+ DLL+VC+AQRQ
Sbjct  155  SAIEIYNEAV-RDLLSHDSTPLRLLDDPEKGTTVERLTEETLRDYDHLRDLLAVCEAQRQ  213

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  214  IGETALNETSSRSHQILRLTIE  235



>ref|XP_004974129.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Setaria 
italica]
 ref|XP_004974130.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Setaria 
italica]
Length=1028

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ E+   VE+ T ET++ + H+ DLL+VC+AQRQ
Sbjct  138  SAIEIYNEAV-RDLLSHDSTPLRLLDDPEKGTTVERLTEETLRDYDHLRDLLAVCEAQRQ  196

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  197  IGETALNETSSRSHQILRLTIE  218



>ref|XP_004974127.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Setaria 
italica]
Length=1045

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ E+   VE+ T ET++ + H+ DLL+VC+AQRQ
Sbjct  155  SAIEIYNEAV-RDLLSHDSTPLRLLDDPEKGTTVERLTEETLRDYDHLRDLLAVCEAQRQ  213

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  214  IGETALNETSSRSHQILRLTIE  235



>ref|XP_009389113.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009389114.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=947

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 61/82 (74%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V +  +   + PLRLLD+ E+  V+EK T ET++ W+H+  L+SVC+AQR+
Sbjct  157  SAIEIYNEAV-KDLLSTDSAPLRLLDDPEKGTVIEKLTEETLRDWNHLKALISVCEAQRK  215

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  216  IGETSLNETSSRSHQILRLTIE  237



>ref|XP_009407965.1| PREDICTED: kinesin-like protein NACK2 [Musa acuminata subsp. 
malaccensis]
Length=959

 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ +V R  +     PLRLLD+ ER  +VEK T ET++  +H+ +LLS C+AQRQ
Sbjct  150  SAMEIYNEVV-RDLLSMDGSPLRLLDDPERGTIVEKLTEETLRDENHLKELLSTCEAQRQ  208

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
             GET L++MSSRSHQ++RLT+E
Sbjct  209  TGETSLNEMSSRSHQILRLTIE  230



>ref|XP_004148539.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
 ref|XP_004167100.1| PREDICTED: kinesin-like protein KIN12B-like [Cucumis sativus]
Length=930

 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  +VEK T E ++ W+H+ +L+S+C+AQR+
Sbjct  147  SAIEIYNEAV-RDLLSTDTSPLRLLDDQERGTIVEKVTEEILRDWNHLRELISICEAQRR  205

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LT+E
Sbjct  206  IGETSLNEKSSRSHQIIKLTIE  227



>ref|XP_010679850.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=1052

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVEK   ET++ W H  +LL+VC+AQRQIGET L++ SSRSHQ++RLT
Sbjct  157  PLRLLDDPERGTVVEKLMEETLRDWTHFKELLAVCEAQRQIGETLLNEASSRSHQILRLT  216

Query  178  VE  173
            +E
Sbjct  217  IE  218



>ref|XP_010679851.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=1050

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVEK   ET++ W H  +LL+VC+AQRQIGET L++ SSRSHQ++RLT
Sbjct  157  PLRLLDDPERGTVVEKLMEETLRDWTHFKELLAVCEAQRQIGETLLNEASSRSHQILRLT  216

Query  178  VE  173
            +E
Sbjct  217  IE  218



>ref|XP_010679852.1| PREDICTED: kinesin-like protein NACK1 isoform X3 [Beta vulgaris 
subsp. vulgaris]
Length=943

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVEK   ET++ W H  +LL+VC+AQRQIGET L++ SSRSHQ++RLT
Sbjct  48   PLRLLDDPERGTVVEKLMEETLRDWTHFKELLAVCEAQRQIGETLLNEASSRSHQILRLT  107

Query  178  VE  173
            +E
Sbjct  108  IE  109



>ref|XP_010515506.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
Length=918

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VV+K T E ++ W+H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  48   PLRLLDDPEKGTVVDKLTEEILRDWNHFKELLSICIAQRQIGETTLNEVSSRSHQILRLT  107

Query  178  VE  173
            VE
Sbjct  108  VE  109



>ref|XP_007135918.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 ref|XP_007135919.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07912.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
 gb|ESW07913.1| hypothetical protein PHAVU_009G003000g [Phaseolus vulgaris]
Length=888

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ I+ R  +     PLRL D+ ER  +VEK   ET++ W H+ +LLS C+AQRQ
Sbjct  148  SAIEIYNEII-RDLLSSENTPLRLRDDPERGPIVEKLIEETLRDWMHLKELLSFCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            +GET L+  SSRSHQ+IRLT+E
Sbjct  207  VGETYLNDKSSRSHQIIRLTIE  228



>ref|XP_010515505.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=1032

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ E+  VV+K T E ++ W+H  +LLS+C AQRQIGET L+++SSRSHQ++RLT
Sbjct  162  PLRLLDDPEKGTVVDKLTEEILRDWNHFKELLSICIAQRQIGETTLNEVSSRSHQILRLT  221

Query  178  VE  173
            VE
Sbjct  222  VE  223



>ref|XP_008791672.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=867

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            + PLRLLD+ E+  +VEK T E ++ W+H+ +L+SVC+AQR+IGET L++ SSRSHQ++R
Sbjct  180  STPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSRSHQILR  239

Query  184  LTVE  173
            LT+E
Sbjct  240  LTIE  243



>gb|EPS66399.1| hypothetical protein M569_08373, partial [Genlisea aurea]
Length=430

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + V I++ +V R  +      LRLLD+ E+  ++EK T ET++ W H+ +LLS+C+AQR+
Sbjct  150  SAVEIYNEVV-RDLLATDGTSLRLLDDPEKGTIIEKLTEETLRDWSHLRELLSICEAQRR  208

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RL++E
Sbjct  209  IGETLLNETSSRSHQILRLSIE  230



>ref|XP_010919403.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Elaeis guineensis]
Length=803

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            + PLRLLD+ E+  +VEK T E ++ W+H+ +L+SVC+AQR+IGET L++ SSRSHQ++R
Sbjct  16   STPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSRSHQILR  75

Query  184  LTVE  173
            LT+E
Sbjct  76   LTIE  79



>ref|XP_010919401.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
 ref|XP_010919402.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Elaeis guineensis]
Length=966

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            + PLRLLD+ E+  +VEK T E ++ W+H+ +L+SVC+AQR+IGET L++ SSRSHQ++R
Sbjct  179  STPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSRSHQILR  238

Query  184  LTVE  173
            LT+E
Sbjct  239  LTIE  242



>ref|XP_011078149.1| PREDICTED: kinesin-like protein NACK2 [Sesamum indicum]
Length=943

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -3

Query  376  VERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSH  197
            + R + PLRLLD+ ER  +V+K T E +KG  H+  L+S+C+AQRQ+GET L+  SSRSH
Sbjct  166  LNRDSGPLRLLDDPERGTIVDKLTEEVVKGDQHLRHLISICEAQRQVGETALNDKSSRSH  225

Query  196  QVIRLTVERKRCQDSE  149
            Q+IRLT+E    +DSE
Sbjct  226  QIIRLTIESSLREDSE  241



>gb|KDO49885.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=758

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 57/78 (73%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  + R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET
Sbjct  152  IYNEAI-RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ+IRL +E
Sbjct  211  LLNEKSSRSHQIIRLMIE  228



>ref|XP_008791670.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
 ref|XP_008791671.1| PREDICTED: kinesin-like protein NACK2 isoform X1 [Phoenix dactylifera]
Length=975

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            + PLRLLD+ E+  +VEK T E ++ W+H+ +L+SVC+AQR+IGET L++ SSRSHQ++R
Sbjct  180  STPLRLLDDPEKGTIVEKLTEEVLRDWNHLKELISVCEAQRKIGETSLNETSSRSHQILR  239

Query  184  LTVE  173
            LT+E
Sbjct  240  LTIE  243



>ref|XP_002280678.2| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664763.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
 ref|XP_010664764.1| PREDICTED: kinesin-like protein NACK1 [Vitis vinifera]
Length=937

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VV+K T ET++  +H+ +LLS+C+AQRQIGET L++ SS
Sbjct  156  RDLLSSDSAPLRLLDDPERGTVVDKLTEETLRDRNHLQELLSICEAQRQIGETALNETSS  215

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  216  RSHQILRLTIE  226



>emb|CBI19799.3| unnamed protein product [Vitis vinifera]
Length=1008

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 55/71 (77%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VV+K T ET++  +H+ +LLS+C+AQRQIGET L++ SS
Sbjct  156  RDLLSSDSAPLRLLDDPERGTVVDKLTEETLRDRNHLQELLSICEAQRQIGETALNETSS  215

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  216  RSHQILRLTIE  226



>ref|XP_002444630.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
 gb|EES14125.1| hypothetical protein SORBIDRAFT_07g025040 [Sorghum bicolor]
Length=1032

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ E+   VE+ T ET++ + H+ DLL+VC+AQRQ
Sbjct  144  SAIEIYNEAV-RDLLSHDPTPLRLLDDPEKGTTVERLTEETLRDYGHLRDLLAVCEAQRQ  202

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  203  IGETALNETSSRSHQILRLTIE  224



>gb|KDO49879.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49880.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49881.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
 gb|KDO49882.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=960

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  158  RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  217

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  218  RSHQIIRLMIE  228



>ref|XP_006487385.1| PREDICTED: kinesin-like protein NACK1-like isoform X9 [Citrus 
sinensis]
Length=960

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  158  RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  217

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  218  RSHQIIRLMIE  228



>ref|XP_003578490.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
 ref|XP_010238416.1| PREDICTED: kinesin-like protein NACK1 [Brachypodium distachyon]
Length=880

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   A PLRLLD+ E+  VVEK T ET++   H+ +LL+VC+AQRQIGET
Sbjct  135  IYNEAV-RDLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGET  193

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLTVE
Sbjct  194  ALNETSSRSHQILRLTVE  211



>gb|KDO49884.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=841

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  39   RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  98

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  99   RSHQIIRLMIE  109



>ref|XP_006423484.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423485.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36724.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36725.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=843

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  39   RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  98

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  99   RSHQIIRLMIE  109



>ref|XP_006487377.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006487378.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
 ref|XP_006487379.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
 ref|XP_006487380.1| PREDICTED: kinesin-like protein NACK1-like isoform X4 [Citrus 
sinensis]
 ref|XP_006487381.1| PREDICTED: kinesin-like protein NACK1-like isoform X5 [Citrus 
sinensis]
 ref|XP_006487382.1| PREDICTED: kinesin-like protein NACK1-like isoform X6 [Citrus 
sinensis]
 ref|XP_006487383.1| PREDICTED: kinesin-like protein NACK1-like isoform X7 [Citrus 
sinensis]
 ref|XP_006487384.1| PREDICTED: kinesin-like protein NACK1-like isoform X8 [Citrus 
sinensis]
Length=962

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  158  RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  217

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  218  RSHQIIRLMIE  228



>gb|KDO49883.1| hypothetical protein CISIN_1g002139mg [Citrus sinensis]
Length=920

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  118  RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  177

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  178  RSHQIIRLMIE  188



>ref|XP_006423481.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36721.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=960

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  158  RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  217

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  218  RSHQIIRLMIE  228



>ref|XP_006423482.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423483.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 ref|XP_006423486.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36722.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36723.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
 gb|ESR36726.1| hypothetical protein CICLE_v10027758mg [Citrus clementina]
Length=962

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T E +K W+H+ +LLS+C+AQR+IGET L++ SS
Sbjct  158  RDLLSTDNTPLRLLDDPEKGVVVEKVTEEILKDWNHLKELLSICEAQRRIGETLLNEKSS  217

Query  205  RSHQVIRLTVE  173
            RSHQ+IRL +E
Sbjct  218  RSHQIIRLMIE  228



>dbj|BAK06679.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=891

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 60/82 (73%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   A PLRLLD+ E+  VVEK T ET++   H+ +LL+VC+AQRQ
Sbjct  135  SAMEIYNEAV-RDLLSSDAAPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQ  193

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLTVE
Sbjct  194  IGETALNETSSRSHQILRLTVE  215



>ref|XP_011100938.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=998

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 51/71 (72%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T E +   +H   LLSVC+AQRQIGET L++MSS
Sbjct  154  RDLLSADSTPLRLLDDPERGTIVEKLTEEILTDRNHATQLLSVCEAQRQIGETSLNQMSS  213

Query  205  RSHQVIRLTVE  173
            RSH +IRLT+E
Sbjct  214  RSHHIIRLTIE  224



>ref|NP_195606.2| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 ref|NP_001119143.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE86997.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE86998.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=836

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VVEK T ET++ W+H+ +LLS+C+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDWNHLKELLSICEAQRK  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  196  IGETSLNERSSRSHQMIRLTVE  217



>dbj|BAF02000.1| kinesin like protein [Arabidopsis thaliana]
Length=836

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VVEK T ET++ W+H+ +LLS+C+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDWNHLKELLSICEAQRK  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  196  IGETSLNERSSRSHQMIRLTVE  217



>ref|XP_002510482.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF52669.1| ATP binding protein, putative [Ricinus communis]
Length=939

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   + PLR+LD+ E+  VVE+   ET+  W+H+ +LL++C+AQRQIGET
Sbjct  155  IYNEAV-RDLLSSDSTPLRVLDDPEKGTVVERLIEETLIDWNHLQELLTICEAQRQIGET  213

Query  226  KLSKMSSRSHQVIRLTVE  173
             +++ SSRSHQVIRLT+E
Sbjct  214  SMNENSSRSHQVIRLTIE  231



>ref|XP_002868873.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45132.1| kinesin motor family protein [Arabidopsis lyrata subsp. lyrata]
Length=836

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VVEK T ET++ W+H+ +LLS+C+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVEKATEETLRDWNHLKELLSICEAQRK  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  196  IGETSLNERSSRSHQMIRLTVE  217



>emb|CDX99601.1| BnaC04g33580D [Brassica napus]
Length=818

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 51/64 (80%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            + PLRL D+ E+ AVVEK   E ++ W+H  DL+S+C+AQR+IGET L++ SSRSHQ+I+
Sbjct  165  STPLRLRDDPEKGAVVEKTREEVLRDWNHFKDLISICEAQRKIGETSLNERSSRSHQIIK  224

Query  184  LTVE  173
            LTVE
Sbjct  225  LTVE  228



>emb|CDY15900.1| BnaA04g12110D [Brassica napus]
Length=844

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +   + PLRL D+ E+ AVVEK   E ++ W+H  DL+SVC+AQR+
Sbjct  148  SAIEIYNEAI-RDLLSPDSPPLRLRDDPEKGAVVEKNREEILRDWNHFKDLISVCEAQRK  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+I+LTVE
Sbjct  207  IGETSLNERSSRSHQIIKLTVE  228



>ref|XP_008775732.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Phoenix dactylifera]
Length=918

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET++   H+ +LLS+C+AQRQIGET L++MSS
Sbjct  188  RDLLSTDSSPLRLLDDPERGTIVEKLTEETLRDQSHLKELLSLCEAQRQIGETSLNEMSS  247

Query  205  RSHQVIRLTVE  173
            RSHQ++RL +E
Sbjct  248  RSHQILRLMIE  258



>ref|XP_010446407.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446408.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446410.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446411.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Camelina sativa]
 ref|XP_010446412.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
 ref|XP_010446413.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Camelina sativa]
Length=837

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VV+K T ET++ W+H+ +LLS+C+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVDKATEETLRDWNHLKELLSICEAQRK  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  196  IGETSLNERSSRSHQIIRLTVE  217



>ref|XP_010431843.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=837

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VV+K T ET++ W+H+ +LLS+C+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVDKATEETLRDWNHLKELLSICEAQRK  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRLTVE
Sbjct  196  IGETSLNERSSRSHQIIRLTVE  217



>ref|XP_011083601.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
 ref|XP_011083602.1| PREDICTED: kinesin-like protein NACK1 [Sesamum indicum]
Length=913

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VV+K T  T++ + H+ +LLSVC+AQRQIGET L++MSSRSHQ++RLT
Sbjct  169  PLRLLDDPERGTVVDKLTEVTLRDFDHLRELLSVCEAQRQIGETTLNEMSSRSHQILRLT  228

Query  178  VE  173
            V+
Sbjct  229  VD  230



>gb|EMS46463.1| Kinesin-related protein 11 [Triticum urartu]
Length=857

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            A PLRLLD+ E+  VVEK T ET++   H+ +LL+VC+AQRQIGET L++ SSRSHQ++R
Sbjct  144  ATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGETALNETSSRSHQILR  203

Query  184  LTVE  173
            LTVE
Sbjct  204  LTVE  207



>gb|KHN33713.1| Centromere-associated protein E [Glycine soja]
Length=899

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ I+ R  +      LRL D+ ER  +VEK T ET++ W H+ +LLS C+AQRQ
Sbjct  148  SAIEIYNEII-RDLLSTENTSLRLRDDPERGPIVEKLTEETLRNWVHLKELLSFCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            +GET L+  SSRSHQ+IRLT+E
Sbjct  207  VGETYLNDKSSRSHQIIRLTIE  228



>ref|XP_006659658.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=998

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ E+   VEK T ET++   H+ DLL+VC+AQRQ
Sbjct  143  SAIEIYNEAV-RDLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKEHLRDLLAVCEAQRQ  201

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  202  IGETALNETSSRSHQILRLTIE  223



>ref|XP_006661465.1| PREDICTED: kinesin-like protein NACK2-like [Oryza brachyantha]
Length=881

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   A PLRLLD+ E+  VVEK T ET++   H+ +LL+VC+AQRQIGET
Sbjct  152  IYNEAV-RDLLSPDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGET  210

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLTVE
Sbjct  211  ALNEASSRSHQILRLTVE  228



>ref|XP_008775730.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Phoenix dactylifera]
Length=1022

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  +VEK T ET++   H+ +LLS+C+AQRQIGET L++MSS
Sbjct  188  RDLLSTDSSPLRLLDDPERGTIVEKLTEETLRDQSHLKELLSLCEAQRQIGETSLNEMSS  247

Query  205  RSHQVIRLTVE  173
            RSHQ++RL +E
Sbjct  248  RSHQILRLMIE  258



>ref|XP_010933747.1| PREDICTED: kinesin-like protein NACK1 [Elaeis guineensis]
Length=961

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
            + PLRLLD+ E+  +VEK T E ++ W+H+ +L+SVC+AQR+IGET L++ SSRSHQ+++
Sbjct  174  STPLRLLDDPEKGTIVEKLTEEILRDWNHLKELISVCEAQRKIGETSLNETSSRSHQILK  233

Query  184  LTVE  173
            LT+E
Sbjct  234  LTIE  237



>ref|XP_009398104.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398105.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009398106.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=957

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  355  LRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLTV  176
            LRLLD+ E+  V+EK T ET+K W+H+  L+SVC+AQR+IGET L++ SSRSHQ++RLT+
Sbjct  178  LRLLDDPEKGTVIEKLTEETLKDWNHLKALISVCEAQRKIGETSLNETSSRSHQILRLTI  237

Query  175  E  173
            E
Sbjct  238  E  238



>gb|KHN36049.1| Kinesin-related protein 4 [Glycine soja]
Length=928

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ ER  VVE+ T ET++ W+H  +L+S C+AQRQ
Sbjct  145  SAIEIYNESV-RDLLSPDCTPLRLLDDPERGTVVERLTEETLRDWNHFTELISFCEAQRQ  203

Query  238  IGETKLSKMSSRSHQVIRL  182
            IGET L++ SSRSHQ++RL
Sbjct  204  IGETALNEASSRSHQILRL  222



>ref|XP_006413467.1| hypothetical protein EUTSA_v10026976mg [Eutrema salsugineum]
 gb|ESQ54920.1| hypothetical protein EUTSA_v10026976mg [Eutrema salsugineum]
Length=997

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 0/89 (0%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V     E    PLRLLD+ ER  VVEK   ET+   +H+ +LLS+C+ QR+
Sbjct  130  SAMEIYNEAVRDLLCEDSNTPLRLLDDPERGTVVEKLREETLTDRNHLEELLSICETQRK  189

Query  238  IGETKLSKMSSRSHQVIRLTVERKRCQDS  152
            IGET L++ SSRSHQ++RLT+E    +DS
Sbjct  190  IGETSLNETSSRSHQILRLTIESSNREDS  218



>gb|ADQ43205.1| kinesin motor family protein [Eutrema parvulum]
Length=984

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 55/71 (77%), Gaps = 1/71 (1%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVEK T ET++ W+H  +LLSVC+ QRQIGET L+++SS
Sbjct  151  RDLLSTDSSPLRLLDDPEKGTVVEKLTEETLRDWNHFKELLSVCE-QRQIGETALNEVSS  209

Query  205  RSHQVIRLTVE  173
            RSHQ+++LTVE
Sbjct  210  RSHQILKLTVE  220



>gb|KGN43176.1| hypothetical protein Csa_7G006260 [Cucumis sativus]
Length=1027

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/62 (58%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  +VEK T E ++ W+H+ +L+S+C+AQR+IGET L++ SSRSHQ+I+LT
Sbjct  356  PLRLLDDQERGTIVEKVTEEILRDWNHLRELISICEAQRRIGETSLNEKSSRSHQIIKLT  415

Query  178  VE  173
            +E
Sbjct  416  IE  417



>ref|XP_009140272.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=842

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRL D+ E+ AVVEK   E ++ W+H  DL+S+C+AQR+IGET L++ SSRSHQ+I+LT
Sbjct  167  PLRLRDDPEKGAVVEKNREEILRDWNHFKDLISICEAQRKIGETSLNERSSRSHQIIKLT  226

Query  178  VE  173
            VE
Sbjct  227  VE  228



>gb|KEH20389.1| ATP-binding microtubule motor family protein [Medicago truncatula]
Length=954

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +     PLRLLD+ E+  VVEK T ET++ W+H  +L+S C+ QRQIGET L+++SS
Sbjct  155  RDLLSNDTTPLRLLDDPEKGTVVEKLTEETLRDWNHFTELISFCETQRQIGETSLNEVSS  214

Query  205  RSHQVIRLTVE  173
            RSHQ++R+T+E
Sbjct  215  RSHQILRMTIE  225



>gb|EYU37862.1| hypothetical protein MIMGU_mgv1a001175mg [Erythranthe guttata]
Length=872

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++ +V R  +     PLRL+D+ E+  ++EK T ET++  +H+ +LLS+C AQRQIGET
Sbjct  153  IYNEVV-RDLLSTDNTPLRLMDDPEKGTIIEKLTEETLRDRNHLKELLSICAAQRQIGET  211

Query  226  KLSKMSSRSHQVIRLTVE  173
             L++ SSRSHQ++RLT+E
Sbjct  212  LLNETSSRSHQILRLTIE  229



>ref|XP_006285338.1| hypothetical protein CARUB_v10006728mg [Capsella rubella]
 gb|EOA18236.1| hypothetical protein CARUB_v10006728mg [Capsella rubella]
Length=1014

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V     E   IPLRLLD+ ER  VVEK   ET+   +H+ +LLS+C+ QR+
Sbjct  130  SAMEIYNEAVRDLLCEDSNIPLRLLDDPERGTVVEKLREETLTDRNHLQELLSICETQRK  189

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  190  IGETSLNETSSRSHQILRLTIE  211



>ref|XP_006283113.1| hypothetical protein CARUB_v10004132mg [Capsella rubella]
 gb|EOA16011.1| hypothetical protein CARUB_v10004132mg [Capsella rubella]
Length=831

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  +V+K T ET++ W+H+ +LLS+C+AQR+
Sbjct  133  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTIVDKATEETLRDWNHLKELLSICEAQRK  191

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L+  SSRSHQ+IRLTVE
Sbjct  192  IGETALNDRSSRSHQIIRLTVE  213



>ref|NP_001063734.2| Os09g0528000 [Oryza sativa Japonica Group]
 dbj|BAD46370.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAG93071.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF25648.2| Os09g0528000 [Oryza sativa Japonica Group]
Length=862

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   A PLRLLD+ E+  VVEK T ET++   H+ +LL+VC+AQRQIGET
Sbjct  137  IYNEAV-RDLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGET  195

Query  226  KLSKMSSRSHQVIRLTVE  173
             +++ SSRSHQ++R+TVE
Sbjct  196  AMNEASSRSHQILRMTVE  213



>gb|EEE70089.1| hypothetical protein OsJ_30085 [Oryza sativa Japonica Group]
Length=870

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = -3

Query  406  IWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGET  227
            I++  V R  +   A PLRLLD+ E+  VVEK T ET++   H+ +LL+VC+AQRQIGET
Sbjct  137  IYNEAV-RDLLSSDATPLRLLDDPEKGTVVEKLTEETLRDKGHLLELLAVCEAQRQIGET  195

Query  226  KLSKMSSRSHQVIRLTVE  173
             +++ SSRSHQ++R+TVE
Sbjct  196  AMNEASSRSHQILRMTVE  213



>ref|NP_567695.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
 gb|AEE84858.1| ATP binding microtubule motor family protein [Arabidopsis thaliana]
Length=1004

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V     E  + PLRLLD+ ER  VVEK   ET++   H+ +LLS+C+ QR+
Sbjct  128  SAMEIYNEAVRDLLCEDSSTPLRLLDDPERGTVVEKLREETLRDRSHLEELLSICETQRK  187

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L+++SSRSHQ++RLT+E
Sbjct  188  IGETSLNEISSRSHQILRLTIE  209



>ref|XP_010436987.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010436988.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
 ref|XP_010436989.1| PREDICTED: kinesin-like protein NACK1 [Camelina sativa]
Length=837

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 59/82 (72%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  + R  +      LRL D+ E+  VV+K T ET++ W+H+ +LLS+C+AQR+
Sbjct  137  SAIEIYNEAI-RDLLSSDGTSLRLRDDPEKGTVVDKATEETLRDWNHLKELLSICEAQRK  195

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ+IRL+VE
Sbjct  196  IGETSLNERSSRSHQIIRLSVE  217



>emb|CAB51660.1| putative protein [Arabidopsis thaliana]
 emb|CAB79327.1| putative protein [Arabidopsis thaliana]
Length=1263

 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V     E  + PLRLLD+ ER  VVEK   ET++   H+ +LLS+C+ QR+
Sbjct  128  SAMEIYNEAVRDLLCEDSSTPLRLLDDPERGTVVEKLREETLRDRSHLEELLSICETQRK  187

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L+++SSRSHQ++RLT+E
Sbjct  188  IGETSLNEISSRSHQILRLTIE  209



>gb|KDO84748.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1104

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET+    H+ +LL+VC+AQRQIGET L++ SS
Sbjct  157  RDLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>ref|XP_006473601.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Citrus 
sinensis]
Length=1112

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET+    H+ +LL+VC+AQRQIGET L++ SS
Sbjct  157  RDLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>ref|XP_009101918.1| PREDICTED: kinesin-like protein NACK1 [Brassica rapa]
Length=763

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +      LRL D+ E+  VVEK   ET++ W+H  +LLSVC AQR+IGET L++ SS
Sbjct  147  RDLLNSDGTSLRLRDDPEKGTVVEKAREETLRDWNHFKELLSVCAAQRKIGETSLNERSS  206

Query  205  RSHQVIRLTVERKRCQ  158
            RSHQ+I+LTVE   C+
Sbjct  207  RSHQIIKLTVESCACE  222



>ref|XP_006435104.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
 gb|ESR48344.1| hypothetical protein CICLE_v10000097mg [Citrus clementina]
Length=1104

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET+    H+ +LL+VC+AQRQIGET L++ SS
Sbjct  157  RDLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>gb|KDO84747.1| hypothetical protein CISIN_1g001290mg [Citrus sinensis]
Length=1106

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET+    H+ +LL+VC+AQRQIGET L++ SS
Sbjct  157  RDLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>ref|XP_006473600.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Citrus 
sinensis]
Length=1114

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET+    H+ +LL+VC+AQRQIGET L++ SS
Sbjct  157  RDLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>ref|XP_006473602.1| PREDICTED: kinesin-like protein NACK1-like isoform X3 [Citrus 
sinensis]
Length=1100

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ E+  VVE+ T ET+    H+ +LL+VC+AQRQIGET L++ SS
Sbjct  157  RDLLSTDSTPLRLLDDPEKGTVVERLTEETLTDMSHLMELLAVCEAQRQIGETALNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>gb|EEC83991.1| hypothetical protein OsI_30145 [Oryza sativa Indica Group]
Length=969

 Score = 80.1 bits (196),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ E+   VEK T ET++   H+ +LL+VC+AQRQ
Sbjct  143  SAIEIYNEAV-RDLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQ  201

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  202  IGETALNETSSRSHQILRLTIE  223



>ref|XP_003527612.1| PREDICTED: kinesin-like protein NACK1-like isoform X1 [Glycine 
max]
 ref|XP_006581109.1| PREDICTED: kinesin-like protein NACK1-like isoform X2 [Glycine 
max]
Length=880

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ I+ R  +      LRL D+ ER  +VEK T ET++ W H+ +LLS C+AQRQ
Sbjct  148  SAIEIYNEII-RDLLITKNTSLRLRDDPERGPIVEKLTEETLRDWVHLKELLSFCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            +GET L+  SSRSHQ+IRLT+E
Sbjct  207  VGETYLNDKSSRSHQIIRLTIE  228



>ref|NP_001062429.1| Os08g0547500 [Oryza sativa Japonica Group]
 dbj|BAD09938.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF24343.1| Os08g0547500 [Oryza sativa Japonica Group]
Length=986

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ E+   VEK T ET++   H+ +LL+VC+AQRQ
Sbjct  143  SAIEIYNEAV-RDLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQ  201

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  202  IGETALNETSSRSHQILRLTIE  223



>gb|EEE69110.1| hypothetical protein OsJ_28179 [Oryza sativa Japonica Group]
Length=987

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ E+   VEK T ET++   H+ +LL+VC+AQRQ
Sbjct  143  SAIEIYNEAV-RDLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQ  201

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  202  IGETALNETSSRSHQILRLTIE  223



>ref|XP_008452056.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Cucumis melo]
Length=891

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER   VEK T ET++  +H   LLS+C+AQRQ
Sbjct  144  SAIEIYNESV-RDLLSVDSSPLRLLDDPERGTTVEKLTEETLRDRNHFRQLLSLCEAQRQ  202

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  203  IGETSLNEASSRSHQILRLTIE  224



>ref|XP_009386558.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=933

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 58/81 (72%), Gaps = 1/81 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ +V R  +     PLRLLD++ER  VVEK T ET++   H+ +LL VC+AQRQ
Sbjct  180  SAMEIYNELV-RDLLSTDTSPLRLLDDAERGTVVEKLTEETLRDQWHLKELLCVCEAQRQ  238

Query  238  IGETKLSKMSSRSHQVIRLTV  176
            +GET L++MSSRSHQ++RL  
Sbjct  239  VGETSLNEMSSRSHQILRLNF  259



>gb|EYU38855.1| hypothetical protein MIMGU_mgv1a000996mg [Erythranthe guttata]
Length=917

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 52/64 (81%), Gaps = 0/64 (0%)
 Frame = -3

Query  364  AIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIR  185
              PLRLLD+ ER  VV+K T  T++  +H+ +LLS+C+AQRQIGET L+++SSRSHQ+++
Sbjct  164  GTPLRLLDDPERGTVVDKLTEVTLRDENHLYELLSICEAQRQIGETTLNELSSRSHQILK  223

Query  184  LTVE  173
            LTVE
Sbjct  224  LTVE  227



>dbj|BAD09937.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
Length=1003

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +     PLRLLD+ E+   VEK T ET++   H+ +LL+VC+AQRQ
Sbjct  159  SAIEIYNEAV-RDLLSHDTTPLRLLDDPEKGTTVEKLTEETLRDKDHLRNLLAVCEAQRQ  217

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  218  IGETALNETSSRSHQILRLTIE  239



>ref|XP_008452051.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452052.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452053.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452054.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
 ref|XP_008452055.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Cucumis melo]
Length=993

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V R  +   + PLRLLD+ ER   VEK T ET++  +H   LLS+C+AQRQ
Sbjct  144  SAIEIYNESV-RDLLSVDSSPLRLLDDPERGTTVEKLTEETLRDRNHFRQLLSLCEAQRQ  202

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
            IGET L++ SSRSHQ++RLT+E
Sbjct  203  IGETSLNEASSRSHQILRLTIE  224



>ref|XP_009386197.1| PREDICTED: kinesin-like protein NACK1 [Musa acuminata subsp. 
malaccensis]
Length=941

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVEK T ET++   H+ +L+  C AQRQ+GET L++MSS
Sbjct  157  RDLLSTDSSPLRLLDDPERGTVVEKLTEETLRDQRHLKELVFTCAAQRQVGETSLNEMSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLT+E
Sbjct  217  RSHQILRLTIE  227



>emb|CDY34261.1| BnaA01g13640D [Brassica napus]
Length=847

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++  V     E +  PLRLLD+ ER  VVEK   ET++  +H+ +L+S+C+ QR+
Sbjct  131  SAMEIYNEAVRDLLCEDNNNPLRLLDDPERGTVVEKLKEETIRDRNHLEELISICETQRK  190

Query  238  IGETKLSKMSSRSHQVIRLTVERKR  164
            IGET L++ SSRSHQ++RLT+E  +
Sbjct  191  IGETSLNETSSRSHQILRLTIESSK  215



>ref|XP_010672217.1| PREDICTED: kinesin-like protein NACK2 [Beta vulgaris subsp. vulgaris]
Length=1052

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 58/82 (71%), Gaps = 1/82 (1%)
 Frame = -3

Query  418  AVVGIWHSIVPRQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQ  239
            + + I++ +V R  +     PLRLLD+ ER  VVEK   ET++   H+ +L++VC+AQRQ
Sbjct  148  SAIEIYNELV-RDLLSADTNPLRLLDDPERGTVVEKLIEETLEDKSHLLELIAVCEAQRQ  206

Query  238  IGETKLSKMSSRSHQVIRLTVE  173
             GET L++ SSRSHQ++RLTVE
Sbjct  207  TGETNLNETSSRSHQILRLTVE  228



>ref|XP_002301999.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE81272.2| kinesin motor family protein [Populus trichocarpa]
Length=915

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = -3

Query  385  RQAVERHAIPLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSS  206
            R  +   + PLRLLD+ ER  VVE    +T+  W+H+ +L+S+C+ QRQIGET L++ SS
Sbjct  157  RDLLSTSSSPLRLLDDPERGTVVEGLIEDTLVDWNHLLELISICEDQRQIGETTLNETSS  216

Query  205  RSHQVIRLTVE  173
            RSHQ++RLTVE
Sbjct  217  RSHQILRLTVE  227



>gb|KHG01762.1| Kinesin-related 11 [Gossypium arboreum]
Length=909

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  355  LRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLTV  176
            LRL D+ ER  +VEK T E +K W+H+ +LL++C+AQR+IGET L++ SSRSHQ+IRLT+
Sbjct  171  LRLRDDPERGTIVEKVTEEPLKDWNHLKELLAICEAQRRIGETSLNERSSRSHQIIRLTI  230

Query  175  E  173
            E
Sbjct  231  E  231



>ref|XP_011028953.1| PREDICTED: kinesin-like protein NACK1 isoform X1 [Populus euphratica]
Length=915

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVE    +T+  W+H+ +L+S+C+ QRQIGET L++ SSRSHQ++RLT
Sbjct  166  PLRLLDDPERGTVVEGLIEDTLVDWNHLLELISICEDQRQIGETTLNETSSRSHQILRLT  225

Query  178  VE  173
            VE
Sbjct  226  VE  227



>ref|XP_011028954.1| PREDICTED: kinesin-like protein NACK1 isoform X2 [Populus euphratica]
Length=912

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  358  PLRLLDNSERRAVVEKPT*ETMKGWHHVADLLSVCKAQRQIGETKLSKMSSRSHQVIRLT  179
            PLRLLD+ ER  VVE    +T+  W+H+ +L+S+C+ QRQIGET L++ SSRSHQ++RLT
Sbjct  166  PLRLLDDPERGTVVEGLIEDTLVDWNHLLELISICEDQRQIGETTLNETSSRSHQILRLT  225

Query  178  VE  173
            VE
Sbjct  226  VE  227



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 889286245264