BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21647_g1_i1 len=1981 path=[1959:0-1980]

Length=1981
                                                                      Score     E

ref|XP_009628582.1|  PREDICTED: B3 domain-containing transcriptio...    449   2e-144   
ref|XP_009792996.1|  PREDICTED: B3 domain-containing transcriptio...    448   3e-144   
ref|XP_009609744.1|  PREDICTED: B3 domain-containing transcriptio...    444   3e-143   
ref|XP_009799315.1|  PREDICTED: B3 domain-containing transcriptio...    444   4e-143   
ref|XP_006352828.1|  PREDICTED: B3 domain-containing transcriptio...    410   4e-131   
gb|EYU46359.1|  hypothetical protein MIMGU_mgv1a025237mg                409   4e-129   
emb|CAC84597.2|  VP1-ABI3-like protein                                  404   7e-129   Solanum tuberosum [potatoes]
ref|XP_006443662.1|  hypothetical protein CICLE_v10019039mg             404   9e-127   
ref|XP_006443663.1|  hypothetical protein CICLE_v10019039mg             399   7e-125   
ref|XP_002521137.1|  Abscisic acid-insensitive protein, putative        392   1e-124   Ricinus communis
gb|KDO65858.1|  hypothetical protein CISIN_1g038867mg                   396   7e-124   
ref|XP_007140552.1|  hypothetical protein PHAVU_008G122100g             394   5e-123   
ref|XP_003532309.1|  PREDICTED: B3 domain-containing transcriptio...    392   8e-122   
ref|XP_007049857.1|  ABI3, putative isoform 4                           389   5e-121   
ref|XP_007049854.1|  ABI3, putative isoform 1                           389   7e-121   
dbj|BAB96578.1|  abscisic acid insensitive 3-like factor                387   4e-120   Phaseolus vulgaris [French bean]
ref|XP_006586272.1|  PREDICTED: B3 domain-containing transcriptio...    387   4e-120   
ref|XP_007049855.1|  ABI3, putative isoform 2                           384   5e-119   
ref|XP_003552154.1|  PREDICTED: B3 domain-containing transcriptio...    384   9e-119   
gb|AAA87030.1|  PvAlf                                                   382   3e-118   Phaseolus vulgaris [French bean]
gb|KEH22833.1|  B3 domain transcription factor                          381   2e-117   
dbj|BAD42433.1|  ABI-3 homolog                                          380   2e-117   Psophocarpus tetragonolobus [asparagus bean]
ref|XP_006602556.1|  PREDICTED: B3 domain-containing transcriptio...    379   5e-117   
ref|XP_006602555.1|  PREDICTED: B3 domain-containing transcriptio...    379   9e-117   
gb|AGM20671.1|  ABI3                                                    376   3e-116   
ref|XP_002303088.2|  ABA insensitive 3 family protein                   374   1e-115   Populus trichocarpa [western balsam poplar]
gb|KHN24997.1|  B3 domain-containing transcription factor ABI3          374   2e-115   
emb|CAA05922.1|  ABI3                                                   374   2e-115   Populus trichocarpa [western balsam poplar]
emb|CAA05921.1|  ABI3                                                   373   7e-115   Populus trichocarpa [western balsam poplar]
gb|AEK26581.1|  ABA insensitive 3                                       367   2e-113   
gb|EPS64119.1|  hypothetical protein M569_10660                         355   7e-112   
gb|KHN07827.1|  B3 domain-containing transcription factor ABI3          362   1e-110   
gb|KHG04618.1|  B3 domain-containing transcription factor ABI3 -l...    361   5e-110   
ref|XP_004515628.1|  PREDICTED: B3 domain-containing transcriptio...    361   8e-110   
ref|XP_007049858.1|  ABI3, putative isoform 5                           358   3e-109   
ref|XP_007049856.1|  ABI3, putative isoform 3                           357   5e-109   
dbj|BAA28779.1|  transcription factor Vp1                               348   7e-105   Mesembryanthemum crystallinum
dbj|BAA82596.1|  C-ABI3 protein                                         343   3e-104   Daucus carota [carrots]
ref|XP_011080160.1|  PREDICTED: B3 domain-containing transcriptio...    337   2e-101   
ref|XP_006352829.1|  PREDICTED: B3 domain-containing transcriptio...    332   1e-100   
ref|XP_004242390.1|  PREDICTED: B3 domain-containing transcriptio...    329   2e-99    
emb|CDP03838.1|  unnamed protein product                                333   9e-98    
gb|KDP26424.1|  hypothetical protein JCGZ_17582                         321   6e-97    
emb|CAC84596.1|  VP1/ABI3-like protein                                  305   1e-93    Solanum tuberosum [potatoes]
ref|NP_001234669.1|  ABI3 protein                                       309   1e-92    
ref|XP_010323010.1|  PREDICTED: ABI3 protein isoform X1                 310   1e-92    
ref|XP_010109682.1|  B3 domain-containing transcription factor ABI3     315   2e-92    
ref|XP_003632397.1|  PREDICTED: B3 domain-containing transcriptio...    313   2e-92    
ref|XP_010245692.1|  PREDICTED: B3 domain-containing transcriptio...    311   1e-91    
ref|XP_010652462.1|  PREDICTED: B3 domain-containing transcriptio...    309   1e-90    
gb|AAQ04076.1|AF426832_1  ABI3-like transcription factor                309   4e-90    Prunus avium [gean]
gb|AAQ03210.1|AF411073_1  viviparous protein                            309   4e-90    Prunus avium [gean]
ref|XP_011024550.1|  PREDICTED: B3 domain-containing transcriptio...    305   3e-89    
ref|XP_007200956.1|  hypothetical protein PRUPE_ppa001608mg             306   4e-89    
ref|XP_006602557.1|  PREDICTED: B3 domain-containing transcriptio...    303   4e-89    
ref|XP_008235529.1|  PREDICTED: B3 domain-containing transcriptio...    305   6e-89    
ref|XP_008235526.1|  PREDICTED: B3 domain-containing transcriptio...    305   8e-89    
ref|XP_010026024.1|  PREDICTED: B3 domain-containing transcriptio...    303   3e-88    
emb|CBI37258.3|  unnamed protein product                                296   1e-87    
gb|AFN22068.1|  ABI3                                                    300   2e-87    
ref|XP_009372412.1|  PREDICTED: B3 domain-containing transcriptio...    300   7e-87    
gb|ABW03095.1|  ABI3-like factor                                        291   2e-86    Pisum sativum [garden pea]
ref|XP_008372613.1|  PREDICTED: B3 domain-containing transcriptio...    296   3e-85    
gb|ABW03096.1|  ABI3-like factor                                        293   4e-85    Pisum sativum [garden pea]
ref|XP_008382790.1|  PREDICTED: B3 domain-containing transcriptio...    293   2e-84    
gb|ABW03094.1|  ABI3-like factor                                        291   5e-84    Pisum sativum [garden pea]
dbj|BAC10553.1|  ABA insensitive 3                                      291   5e-84    Pisum sativum [garden pea]
dbj|BAC78904.1|  transcription factor VP-1 homologue                    279   2e-79    Fagopyrum esculentum
gb|AEK05624.1|  abscisic acid insensitivity 3                           276   9e-79    
gb|AEK05612.1|  abscisic acid insensitivity 3                           275   2e-78    
gb|AEK05613.1|  abscisic acid insensitivity 3                           275   2e-78    
gb|KGN44572.1|  hypothetical protein Csa_7G336510                       275   4e-78    
gb|AEK05615.1|  abscisic acid insensitivity 3                           274   4e-78    
gb|AEK05611.1|  abscisic acid insensitivity 3                           273   6e-78    
ref|XP_010532867.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...    275   7e-78    
ref|XP_004139719.1|  PREDICTED: B3 domain-containing transcriptio...    277   8e-78    
gb|AEK05625.1|  abscisic acid insensitivity 3                           273   8e-78    
gb|AEK05621.1|  abscisic acid insensitivity 3                           273   9e-78    
gb|AEK05614.1|  abscisic acid insensitivity 3                           273   9e-78    
emb|CAA04184.1|  VP1 protein homologue                                  272   2e-77    Craterostigma plantagineum
ref|XP_008458109.1|  PREDICTED: B3 domain-containing transcriptio...    271   6e-77    
ref|XP_006418703.1|  hypothetical protein EUTSA_v10003110mg             271   1e-76    
gb|KFK39784.1|  hypothetical protein AALP_AA3G287300                    270   2e-76    
emb|CDY15121.1|  BnaC03g44820D                                          266   2e-75    
dbj|BAD93896.1|  abscisic acid-insensitive protein 3                    267   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|NP_189108.1|  B3 domain-containing transcription factor ABI3        267   3e-75    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD94272.1|  abscisic acid-insensitive protein 3                    267   3e-75    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136082.1|  PREDICTED: B3 domain-containing transcriptio...    267   3e-75    
gb|AHC02486.1|  abscisic acid insensitive 3                             266   5e-75    
dbj|BAE96106.1|  abscisic acid insensitive 3                            266   5e-75    Arabidopsis thaliana [mouse-ear cress]
emb|CDX93029.1|  BnaA03g37510D                                          266   5e-75    
ref|XP_002883542.1|  hypothetical protein ARALYDRAFT_342636             261   6e-73    
gb|ABW03098.1|  ABI3-like factor                                        248   2e-72    Pisum sativum [garden pea]
ref|XP_006299887.1|  hypothetical protein CARUB_v10016094mg             258   6e-72    
ref|XP_009411203.1|  PREDICTED: B3 domain-containing protein VP1-...    256   7e-72    
ref|XP_010488574.1|  PREDICTED: B3 domain-containing transcriptio...    258   8e-72    
ref|XP_010466887.1|  PREDICTED: B3 domain-containing transcriptio...    258   9e-72    
ref|XP_010684987.1|  PREDICTED: B3 domain-containing transcriptio...    258   2e-71    
ref|XP_010513655.1|  PREDICTED: B3 domain-containing transcriptio...    255   8e-71    
ref|XP_010684986.1|  PREDICTED: B3 domain-containing transcriptio...    253   1e-69    
emb|CAA05484.1|  ABI3 protein                                           250   3e-69    Arabidopsis thaliana [mouse-ear cress]
tpg|DAA56193.1|  TPA: viviparous1                                       248   1e-68    
ref|XP_009387503.1|  PREDICTED: regulatory protein viviparous-1-like    249   3e-68    
ref|NP_001105540.1|  regulatory protein viviparous-1                    244   4e-67    Zea mays [maize]
ref|XP_004971015.1|  PREDICTED: regulatory protein viviparous-1-like    244   5e-67    
ref|XP_006852120.1|  hypothetical protein AMTR_s00049p00034730          242   1e-66    
ref|XP_010527216.1|  PREDICTED: B3 domain-containing transcriptio...    243   1e-66    
ref|XP_008673439.1|  PREDICTED: regulatory protein viviparous-1 i...    242   3e-66    
gb|ABE73191.1|  viviparous 1                                            235   3e-66    Avena fatua
gb|ABE73186.1|  viviparous 1                                            235   4e-66    Avena fatua
gb|ABE73187.1|  viviparous 1                                            234   4e-66    Avena fatua
gb|ABE73193.1|  viviparous 1                                            234   5e-66    Avena fatua
ref|XP_002458965.1|  hypothetical protein SORBIDRAFT_03g043480          241   7e-66    Sorghum bicolor [broomcorn]
gb|ABE73195.1|  viviparous 1                                            234   1e-65    Avena fatua
gb|ABE73197.1|  viviparous 1                                            233   1e-65    Avena fatua
gb|ABE73189.1|  viviparous 1                                            233   1e-65    Avena fatua
gb|ABE73196.1|  viviparous 1                                            233   3e-65    Avena fatua
ref|XP_004290234.1|  PREDICTED: B3 domain-containing transcriptio...    238   1e-64    
gb|ABE73194.1|  viviparous 1                                            230   3e-64    Avena fatua
dbj|BAA04066.1|  VP1 protein                                            236   8e-64    Oryza sativa Japonica Group [Japonica rice]
pir||S43768  transcription activator VP1 - rice                         235   9e-64 
gb|ABE73188.1|  viviparous 1                                            228   9e-64    Avena fatua
gb|EAY76922.1|  hypothetical protein OsI_04880                          235   9e-64    Oryza sativa Indica Group [Indian rice]
gb|EEE55867.1|  hypothetical protein OsJ_04504                          235   9e-64    Oryza sativa Japonica Group [Japonica rice]
gb|KCW58090.1|  hypothetical protein EUGRSUZ_H00815                     232   7e-63    
dbj|BAM75181.1|  B3-type transcription factor                           232   2e-62    
ref|XP_006645206.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...    229   1e-61    
emb|CAA04553.1|  VP 1                                                   228   1e-61    Avena fatua
sp|P37398.3|VIV_ORYSJ  RecName: Full=B3 domain-containing protein...    229   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001045162.2|  Os01g0911700                                       229   2e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008787720.1|  PREDICTED: regulatory protein viviparous-1 i...    229   3e-61    
ref|XP_010926605.1|  PREDICTED: regulatory protein viviparous-1 i...    227   2e-60    
gb|AAG22585.1|AF175576_1  transcription factor viviparous 1             225   1e-59    Picea abies
emb|CAC19186.1|  VP1/ABI3-like protein                                  223   6e-59    Callitropsis nootkatensis [Nootka cypress]
ref|XP_010926606.1|  PREDICTED: regulatory protein viviparous-1 i...    218   2e-57    
gb|EMT07173.1|  hypothetical protein F775_43744                         204   4e-57    
gb|ABE73192.1|  viviparous 1                                            210   6e-57    Avena fatua
ref|XP_010232723.1|  PREDICTED: B3 domain-containing protein VP1 ...    212   1e-55    
dbj|BAF36505.1|  B3 type transcription factor                           197   1e-54    Triticum monococcum subsp. aegilopoides [wild einkorn]
dbj|BAK06992.1|  predicted protein                                      206   1e-53    
ref|XP_010232722.1|  PREDICTED: B3 domain-containing protein VP1 ...    205   2e-53    
gb|AEZ00784.1|  VIVIPAROUS1 protein                                     204   8e-53    
gb|AEZ00780.1|  VIVIPAROUS1 protein                                     203   9e-53    
gb|AEZ00781.1|  VIVIPAROUS1 protein                                     203   9e-53    
gb|AEZ00777.1|  VIVIPAROUS1 protein                                     203   1e-52    
gb|ABF48530.1|  VIVIPAROUS1 protein                                     203   1e-52    Triticum aestivum [Canadian hard winter wheat]
gb|AEZ00785.1|  VIVIPAROUS1 protein                                     203   1e-52    
gb|AEZ00783.1|  VIVIPAROUS1 protein                                     203   1e-52    
gb|AHE74491.1|  viviparous 1 protein                                    203   1e-52    
gb|AHE74490.1|  viviparous 1 protein                                    203   1e-52    
gb|AEZ00778.1|  VIVIPAROUS1 protein                                     203   1e-52    
gb|AEZ00779.1|  VIVIPAROUS1 protein                                     203   1e-52    
emb|CAB91108.1|  VIVIPAROUS1 protein                                    203   1e-52    Triticum aestivum [Canadian hard winter wheat]
emb|CAB91109.1|  VIVIPAROUS1 protein                                    203   1e-52    Triticum aestivum [Canadian hard winter wheat]
emb|CAB91107.1|  VIVIPAROUS1 protein                                    200   1e-51    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004173839.1|  PREDICTED: B3 domain-containing transcriptio...    197   2e-51    
gb|ACM90520.1|  VIVIPAROUS1 protein                                     197   2e-50    Triticum aestivum [Canadian hard winter wheat]
dbj|BAB40614.1|  transcription factor VP-1 homologue                    197   2e-50    Triticum aestivum [Canadian hard winter wheat]
gb|ACL37467.1|  viviparous 1 protein                                    196   4e-50    Triticum aestivum [Canadian hard winter wheat]
gb|AAO06117.1|  VP1                                                     184   5e-48    Hordeum vulgare subsp. vulgare [barley]
emb|CBJ94490.1|  putative ABI3 homolog                                  167   1e-45    Mangifera indica
emb|CAC80983.1|  transcription factor                                   166   2e-45    Eragrostis tef [tef]
emb|CAA71070.1|  viviparous-1                                           157   3e-42    Hordeum vulgare [barley]
gb|AEQ94109.1|  putative ABA insensitive 3 transcription factor         157   4e-42    
ref|XP_008787722.1|  PREDICTED: regulatory protein viviparous-1 i...    166   4e-40    
ref|XP_002980951.1|  hypothetical protein SELMODRAFT_451614             160   2e-39    
ref|XP_002989308.1|  hypothetical protein SELMODRAFT_427934             160   3e-39    
gb|EMS47815.1|  B3 domain-containing protein VP1                        151   2e-37    
emb|CDW92174.1|  putative abscissic acid insensitive 3                  143   4e-37    
ref|XP_011080161.1|  PREDICTED: B3 domain-containing transcriptio...    155   1e-36    
emb|CAD24413.1|  viviparous-1 protein                                   154   3e-36    Hordeum vulgare [barley]
ref|XP_004150741.1|  PREDICTED: B3 domain-containing transcriptio...    143   2e-35    
ref|XP_009394588.1|  PREDICTED: B3 domain-containing protein LFL1...    143   2e-35    
ref|XP_002973460.1|  hypothetical protein SELMODRAFT_173356             149   6e-35    
ref|XP_002993595.1|  hypothetical protein SELMODRAFT_431656             149   1e-34    
gb|KGN50882.1|  hypothetical protein Csa_5G312320                       142   1e-34    
ref|XP_008466870.1|  PREDICTED: B3 domain-containing transcriptio...    141   5e-34    
ref|XP_010939475.1|  PREDICTED: B3 domain-containing protein LFL1...    141   5e-34    
ref|XP_008775431.1|  PREDICTED: B3 domain-containing protein LFL1...    139   2e-33    
ref|XP_010249172.1|  PREDICTED: B3 domain-containing transcriptio...    140   2e-33    
ref|XP_009413626.1|  PREDICTED: B3 domain-containing protein LFL1...    138   2e-33    
gb|KDO47367.1|  hypothetical protein CISIN_1g041864mg                   139   6e-33    
ref|XP_010925032.1|  PREDICTED: B3 domain-containing protein LFL1...    138   7e-33    
ref|XP_010528138.1|  PREDICTED: B3 domain-containing transcriptio...    135   8e-33    
ref|XP_010068644.1|  PREDICTED: B3 domain-containing transcriptio...    137   1e-32    
ref|XP_006446963.1|  hypothetical protein CICLE_v10016085mg             138   1e-32    
gb|ADO16345.1|  fusca 3                                                 138   1e-32    
emb|CDY28525.1|  BnaC02g36350D                                          138   1e-32    
emb|CDY34212.1|  BnaA02g28280D                                          138   1e-32    
gb|ADO16344.1|  fusca 3                                                 137   1e-32    
ref|XP_008231041.1|  PREDICTED: B3 domain-containing transcriptio...    138   1e-32    
ref|XP_006468874.1|  PREDICTED: B3 domain-containing transcriptio...    137   1e-32    
ref|XP_009129479.1|  PREDICTED: B3 domain-containing transcriptio...    137   2e-32    
ref|XP_003579476.2|  PREDICTED: putative B3 domain-containing pro...    138   2e-32    
dbj|BAE80317.1|  transcription factor ABI3-like                         141   2e-32    Physcomitrella patens
ref|XP_006395520.1|  hypothetical protein EUTSA_v10005481mg             137   2e-32    
ref|XP_011045793.1|  PREDICTED: B3 domain-containing transcriptio...    137   3e-32    
gb|KDP41838.1|  hypothetical protein JCGZ_26856                         137   3e-32    
gb|AAC35247.1|  FUSCA3                                                  137   3e-32    Arabidopsis thaliana [mouse-ear cress]
gb|AAS79559.1|  transcriptional regulator                               137   3e-32    Arabidopsis thaliana [mouse-ear cress]
gb|AAC35246.1|  FUSCA3                                                  137   3e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293066.1|  hypothetical protein CARUB_v10019353mg             137   3e-32    
ref|NP_566799.1|  B3 domain-containing transcription factor FUS3        137   3e-32    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876992.1|  hypothetical protein ARALYDRAFT_484455             137   4e-32    
ref|XP_007031992.1|  AP2/B3-like transcriptional factor family pr...    134   4e-32    
gb|KHG24234.1|  B3 domain-containing transcription factor FUS3 -l...    134   4e-32    
ref|XP_010068643.1|  PREDICTED: B3 domain-containing transcriptio...    136   4e-32    
ref|XP_007031991.1|  AP2/B3-like transcriptional factor family pr...    135   5e-32    
ref|XP_010502623.1|  PREDICTED: B3 domain-containing transcriptio...    136   5e-32    
ref|XP_002982416.1|  hypothetical protein SELMODRAFT_451623             140   5e-32    
ref|XP_002966578.1|  hypothetical protein SELMODRAFT_451619             140   6e-32    
ref|XP_010683360.1|  PREDICTED: B3 domain-containing transcriptio...    136   8e-32    
emb|CBI35396.3|  unnamed protein product                                135   8e-32    
ref|XP_006373111.1|  hypothetical protein POPTR_0017s08820g             135   1e-31    
ref|XP_008362172.1|  PREDICTED: B3 domain-containing transcriptio...    132   1e-31    
ref|XP_010096045.1|  B3 domain-containing transcription factor FUS3     135   1e-31    
dbj|BAE80314.1|  transcription factor ABI3-like                         140   1e-31    Physcomitrella patens
ref|XP_001752973.1|  predicted protein                                  140   2e-31    
ref|XP_004969734.1|  PREDICTED: B3 domain-containing protein LFL1...    134   2e-31    
ref|XP_004306317.1|  PREDICTED: B3 domain-containing transcriptio...    135   2e-31    
ref|XP_010425402.1|  PREDICTED: B3 domain-containing transcriptio...    134   2e-31    
ref|XP_011013336.1|  PREDICTED: B3 domain-containing transcriptio...    134   2e-31    
ref|XP_002512863.1|  conserved hypothetical protein                     134   3e-31    Ricinus communis
ref|XP_010656027.1|  PREDICTED: uncharacterized protein LOC100256682    136   3e-31    
ref|XP_002275489.2|  PREDICTED: B3 domain-containing transcriptio...    133   3e-31    Vitis vinifera
ref|XP_002298665.2|  hypothetical protein POPTR_0001s32990g             134   4e-31    Populus trichocarpa [western balsam poplar]
ref|XP_010233498.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...    136   4e-31    
gb|KFK33600.1|  hypothetical protein AALP_AA5G035000                    134   5e-31    
ref|XP_008810033.1|  PREDICTED: B3 domain-containing protein LFL1...    133   5e-31    
ref|XP_011045797.1|  PREDICTED: B3 domain-containing transcriptio...    132   5e-31    
ref|XP_010279457.1|  PREDICTED: uncharacterized protein LOC104613...    137   5e-31    
ref|XP_008802959.1|  PREDICTED: putative B3 domain-containing pro...    133   5e-31    
ref|XP_007031993.1|  AP2/B3-like transcriptional factor family pr...    131   5e-31    
ref|XP_010279459.1|  PREDICTED: uncharacterized protein LOC104613...    137   6e-31    
ref|XP_008379742.1|  PREDICTED: B3 domain-containing transcriptio...    133   6e-31    
ref|XP_010279456.1|  PREDICTED: uncharacterized protein LOC104613...    137   6e-31    
ref|XP_007216861.1|  hypothetical protein PRUPE_ppa021307mg             133   7e-31    
ref|XP_010279454.1|  PREDICTED: uncharacterized protein LOC104613...    137   7e-31    
ref|XP_010279455.1|  PREDICTED: uncharacterized protein LOC104613...    137   7e-31    
ref|XP_011080162.1|  PREDICTED: B3 domain-containing transcriptio...    137   7e-31    
gb|AFW83736.1|  putative B3 DNA binding domain family protein           132   7e-31    
ref|XP_008341665.1|  PREDICTED: B3 domain-containing transcriptio...    133   9e-31    
ref|XP_010249171.1|  PREDICTED: B3 domain-containing transcriptio...    132   1e-30    
dbj|BAB01226.1|  FUSCA3                                                 132   1e-30    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553973.1|  PREDICTED: B3 domain-containing transcriptio...    132   2e-30    
ref|XP_008656805.1|  PREDICTED: B3 domain-containing protein LFL1...    134   2e-30    
ref|XP_010249175.1|  PREDICTED: B3 domain-containing transcriptio...    131   2e-30    
ref|XP_003548926.1|  PREDICTED: B3 domain-containing transcriptio...    132   2e-30    
gb|KHM99228.1|  B3 domain-containing transcription factor FUS3          132   2e-30    
ref|XP_009378079.1|  PREDICTED: B3 domain-containing transcriptio...    131   3e-30    
tpg|DAA35358.1|  TPA: putative B3 DNA binding domain family protein     133   3e-30    
ref|XP_004493060.1|  PREDICTED: B3 domain-containing transcriptio...    131   3e-30    
gb|ACF88143.1|  unknown                                                 133   3e-30    Zea mays [maize]
ref|NP_001152398.1|  B3 DNA binding domain containing protein           133   4e-30    Zea mays [maize]
ref|XP_001774197.1|  predicted protein                                  135   5e-30    
tpg|DAA35357.1|  TPA: putative B3 DNA binding domain family protein     133   5e-30    
ref|XP_006415675.1|  hypothetical protein EUTSA_v10009849mg             131   7e-30    
ref|XP_002456243.1|  hypothetical protein SORBIDRAFT_03g032730          130   8e-30    Sorghum bicolor [broomcorn]
ref|XP_004963379.1|  PREDICTED: putative B3 domain-containing pro...    132   8e-30    
ref|XP_006847797.1|  hypothetical protein AMTR_s00029p00026560          134   1e-29    
ref|XP_006304381.1|  hypothetical protein CARUB_v10010882mg             130   1e-29    
ref|XP_010260258.1|  PREDICTED: B3 domain-containing transcriptio...    132   1e-29    
sp|Q7XKC4.2|Y4765_ORYSJ  RecName: Full=Putative B3 domain-contain...    132   1e-29    Oryza sativa Japonica Group [Japonica rice]
gb|AFN25690.1|  ABI3 protein                                            123   1e-29    
emb|CDM83789.1|  unnamed protein product                                129   1e-29    
gb|AGI43901.1|  FUSCA3                                                  130   2e-29    
emb|CAE05756.1|  OSJNBa0064G10.7                                        131   3e-29    Oryza sativa Japonica Group [Japonica rice]
dbj|BAE80315.1|  transcription factor ABI3-like                         132   3e-29    Physcomitrella patens
gb|AHL24863.1|  TcLEC2                                                  130   3e-29    
ref|XP_010460616.1|  PREDICTED: B3 domain-containing transcriptio...    129   3e-29    
ref|XP_006659013.1|  PREDICTED: B3 domain-containing protein IDEF...    129   5e-29    
ref|XP_010499344.1|  PREDICTED: B3 domain-containing transcriptio...    129   5e-29    
gb|AEX88464.1|  iron deficiency-responsive cis-acting element-bin...    128   5e-29    
gb|EMS68809.1|  B3 domain-containing protein IDEF1                      126   5e-29    
ref|XP_009152025.1|  PREDICTED: B3 domain-containing transcriptio...    128   5e-29    
emb|CDY13657.1|  BnaA06g32660D                                          127   6e-29    
ref|XP_010272400.1|  PREDICTED: B3 domain-containing protein IDEF1      130   6e-29    
ref|XP_002448770.1|  hypothetical protein SORBIDRAFT_06g032870          129   7e-29    Sorghum bicolor [broomcorn]
ref|XP_003573243.1|  PREDICTED: B3 domain-containing protein IDEF...    128   7e-29    
dbj|BAK06337.1|  predicted protein                                      127   8e-29    
ref|XP_003624470.1|  B3 domain-containing protein                       127   8e-29    
ref|XP_006653877.1|  PREDICTED: putative B3 domain-containing pro...    129   8e-29    
emb|CAL91173.1|  FUSCA3                                                 126   8e-29    
ref|NP_001044053.1|  Os01g0713600                                       127   8e-29    
ref|XP_002893519.1|  leafy cotyledon 2                                  128   9e-29    
ref|XP_010460617.1|  PREDICTED: B3 domain-containing transcriptio...    128   9e-29    
ref|XP_010499347.1|  PREDICTED: B3 domain-containing transcriptio...    127   9e-29    
ref|XP_007025584.1|  AP2/B3-like transcriptional factor family pr...    130   9e-29    
ref|XP_010323015.1|  PREDICTED: ABI3 protein isoform X2                 129   1e-28    
emb|CDY53003.1|  BnaC07g48930D                                          127   1e-28    
ref|XP_011045794.1|  PREDICTED: B3 domain-containing transcriptio...    126   1e-28    
gb|AGT56425.1|  leafy cotyledon 2                                       128   2e-28    
ref|XP_002509459.1|  hypothetical protein RCOM_1674130                  128   2e-28    
ref|XP_010556322.1|  PREDICTED: B3 domain-containing transcriptio...    126   2e-28    
ref|XP_009102920.1|  PREDICTED: B3 domain-containing transcriptio...    127   2e-28    
gb|ADO16343.1|  leafy cotyledon 2                                       127   2e-28    
tpd|FAA00380.1|  TPA: transcription factor IDEF1                        127   2e-28    
ref|NP_001060757.1|  Os08g0101000                                       127   2e-28    
ref|XP_006644610.1|  PREDICTED: B3 domain-containing protein LFL1...    125   2e-28    
emb|CDX94608.1|  BnaC07g10500D                                          126   2e-28    
gb|AAL12004.1|AF400123_1  LEAFY COTYLEDON 2                             127   3e-28    
ref|NP_564304.1|  B3 domain-containing transcription factor LEC2        127   3e-28    
gb|AAF98425.1|AC021044_4  Hypothetical protein                          127   3e-28    
gb|ABK28418.1|  unknown                                                 127   3e-28    
sp|A4LBC0.1|LFL1_ORYSJ  RecName: Full=B3 domain-containing protei...    127   3e-28    
emb|CAH68208.1|  H0101F08.6                                             127   3e-28    
dbj|BAI47565.1|  iron deficiency-responsive element binding factor 1    126   4e-28    
ref|XP_010478197.1|  PREDICTED: B3 domain-containing transcriptio...    126   4e-28    
gb|EAZ32405.1|  hypothetical protein OsJ_16616                          127   4e-28    
tpd|FAA00381.1|  TPA: transcription factor IDEF1 homolog                127   4e-28    
dbj|BAK05099.1|  predicted protein                                      125   4e-28    
gb|KFK44694.1|  hypothetical protein AALP_AA1G291200                    125   5e-28    
gb|KHG23900.1|  B3 domain-containing transcription factor LEC2 -l...    126   6e-28    
gb|AAL85449.1|  abscisic acid insensitive                               121   6e-28    
ref|XP_010460618.1|  PREDICTED: B3 domain-containing transcriptio...    125   7e-28    
emb|CDP16731.1|  unnamed protein product                                124   9e-28    
ref|XP_010499346.1|  PREDICTED: B3 domain-containing transcriptio...    125   9e-28    
ref|XP_006849410.1|  hypothetical protein AMTR_s00160p00070370          127   1e-27    
ref|XP_010108168.1|  B3 domain-containing transcription factor LEC2     126   1e-27    
gb|EMT27675.1|  B3 domain-containing protein IDEF1                      124   1e-27    
ref|XP_001771859.1|  predicted protein                                  128   2e-27    
ref|XP_011027804.1|  PREDICTED: B3 domain-containing transcriptio...    124   3e-27    
ref|XP_010540453.1|  PREDICTED: B3 domain-containing transcriptio...    123   4e-27    
gb|KDP20985.1|  hypothetical protein JCGZ_21456                         124   4e-27    
gb|EAZ32406.1|  hypothetical protein OsJ_16617                          125   4e-27    
ref|NP_001054257.1|  Os04g0676600                                       124   5e-27    
emb|CDY66878.1|  BnaC05g50460D                                          122   6e-27    
ref|XP_001752589.1|  predicted protein                                  116   7e-27    
ref|XP_004974288.1|  PREDICTED: B3 domain-containing protein IDEF...    123   8e-27    
ref|XP_010540454.1|  PREDICTED: B3 domain-containing transcriptio...    122   1e-26    
ref|NP_001140504.1|  putative B3 DNA binding domain family protein      121   2e-26    
ref|XP_002444849.1|  hypothetical protein SORBIDRAFT_07g000220          121   2e-26    
ref|XP_008225116.1|  PREDICTED: B3 domain-containing transcriptio...    123   2e-26    
ref|XP_003631363.1|  PREDICTED: B3 domain-containing transcriptio...    119   3e-26    
ref|XP_008648336.1|  PREDICTED: B3 domain-containing protein IDEF...    120   3e-26    
ref|XP_006377377.1|  hypothetical protein POPTR_0011s05380g             119   4e-26    
ref|XP_010100050.1|  B3 domain-containing transcription factor FUS3     120   4e-26    
emb|CDY46611.1|  BnaA09g27380D                                          120   4e-26    
ref|XP_009113679.1|  PREDICTED: B3 domain-containing transcriptio...    120   4e-26    
emb|CAJ86208.1|  H0101F08.7                                             122   5e-26    
ref|XP_011098958.1|  PREDICTED: B3 domain-containing transcriptio...    116   7e-26    
gb|EYU31867.1|  hypothetical protein MIMGU_mgv1a018740mg                117   2e-25    
gb|EAZ05270.1|  hypothetical protein OsI_27472                          119   2e-25    
ref|XP_001752267.1|  predicted protein                                  111   3e-25    
ref|XP_011043404.1|  PREDICTED: B3 domain-containing transcriptio...    119   3e-25    
ref|XP_008371388.1|  PREDICTED: B3 domain-containing transcriptio...    119   3e-25    
ref|XP_011098957.1|  PREDICTED: B3 domain-containing transcriptio...    117   4e-25    
ref|XP_010249173.1|  PREDICTED: B3 domain-containing transcriptio...    116   5e-25    
ref|XP_006438851.1|  hypothetical protein CICLE_v10033303mg             115   6e-25    
ref|XP_001780405.1|  predicted protein                                  109   7e-25    
ref|XP_006605565.1|  PREDICTED: B3 domain-containing transcriptio...    117   8e-25    
ref|XP_006605566.1|  PREDICTED: B3 domain-containing transcriptio...    117   8e-25    
ref|XP_009599643.1|  PREDICTED: B3 domain-containing transcriptio...    115   1e-24    
ref|XP_009800270.1|  PREDICTED: B3 domain-containing transcriptio...    115   1e-24    
ref|XP_009341913.1|  PREDICTED: B3 domain-containing transcriptio...    118   1e-24    
ref|XP_011045795.1|  PREDICTED: B3 domain-containing transcriptio...    115   1e-24    
ref|XP_010249174.1|  PREDICTED: B3 domain-containing transcriptio...    114   3e-24    
ref|XP_010657181.1|  PREDICTED: B3 domain-containing transcriptio...    113   3e-24    
ref|XP_001781895.1|  predicted protein                                  108   3e-24    
gb|KDO83162.1|  hypothetical protein CISIN_1g043432mg                   108   4e-24    
ref|XP_010249176.1|  PREDICTED: B3 domain-containing transcriptio...    112   5e-24    
ref|XP_004231748.2|  PREDICTED: B3 domain-containing transcriptio...    112   2e-23    
gb|AGO18166.1|  viviparous-like protein                                 104   3e-23    
ref|XP_001756194.1|  predicted protein                                  105   3e-23    
gb|AGO18169.1|  viviparous-like protein                                 103   5e-23    
gb|AGO18189.1|  viviparous-like protein                                 103   8e-23    
gb|AGO18188.1|  viviparous-like protein                                 103   9e-23    
gb|AGO18204.1|  viviparous-like protein                                 102   1e-22    
ref|XP_007159338.1|  hypothetical protein PHAVU_002G229800g             110   2e-22    
ref|XP_009352892.1|  PREDICTED: B3 domain-containing transcriptio...    110   2e-22    
gb|AGO18167.1|  viviparous-like protein                                 102   2e-22    
gb|AGO18205.1|  viviparous-like protein                                 101   3e-22    
ref|XP_008383719.1|  PREDICTED: B3 domain-containing transcriptio...    110   3e-22    
gb|AGO18187.1|  viviparous-like protein                                 101   4e-22    
ref|XP_007159339.1|  hypothetical protein PHAVU_002G229800g             108   4e-22    
ref|XP_011045796.1|  PREDICTED: B3 domain-containing transcriptio...    107   4e-22    
gb|AGO18172.1|  viviparous-like protein                                 100   5e-22    
gb|AGO18206.1|  viviparous-like protein                                 100   6e-22    
gb|KHN47602.1|  B3 domain-containing transcription factor LEC2          107   1e-21    
ref|XP_004505388.1|  PREDICTED: B3 domain-containing transcriptio...    106   1e-21    
ref|XP_001768576.1|  predicted protein                                  100   2e-21    
gb|KGN49236.1|  hypothetical protein Csa_6G517930                       103   4e-21    
gb|KDO77616.1|  hypothetical protein CISIN_1g039100mg                   105   5e-21    
gb|AFW74189.1|  putative B3 DNA binding domain family protein           101   6e-21    
ref|XP_010918415.1|  PREDICTED: uncharacterized protein LOC105042794    103   1e-20    
gb|AFW74191.1|  putative B3 DNA binding domain family protein           102   2e-20    
gb|AFW74190.1|  putative B3 DNA binding domain family protein           102   2e-20    
ref|XP_007161647.1|  hypothetical protein PHAVU_001G086800g             101   7e-20    
emb|CAN72435.1|  hypothetical protein VITISV_009009                     104   8e-20    
ref|XP_010926608.1|  PREDICTED: regulatory protein viviparous-1 i...  68.2    1e-19    
gb|EPS62827.1|  hypothetical protein M569_11961                       94.7    2e-19    
ref|XP_006606668.1|  PREDICTED: B3 domain-containing transcriptio...  98.6    4e-19    
gb|ABP01773.1|  FUS3-like protein                                     92.8    5e-19    
ref|XP_007227641.1|  hypothetical protein PRUPE_ppa018953mg           95.9    3e-18    
ref|XP_010926609.1|  PREDICTED: regulatory protein viviparous-1 i...  68.2    4e-18    
ref|XP_006449368.1|  hypothetical protein CICLE_v10018117mg           95.1    2e-17    
ref|XP_010657182.1|  PREDICTED: B3 domain-containing protein LFL1...  92.4    2e-17    
gb|ABR21510.1|  abscisic acid insensitive protein 3                   92.0    4e-17    
gb|ABR21503.1|  abscisic acid insensitive protein 3                   91.7    5e-17    
gb|ABR21523.1|  abscisic acid insensitive protein 3                   91.7    5e-17    
gb|KHN47603.1|  B3 domain-containing transcription factor LEC2        90.9    8e-17    
gb|ACN96383.1|  viviparous-1                                          92.8    1e-16    
ref|XP_006384034.1|  hypothetical protein POPTR_0004s04560g           91.3    1e-16    
gb|ABR21522.1|  abscisic acid insensitive protein 3                   90.1    2e-16    
gb|KEH31034.1|  B3 DNA-binding domain protein                         90.1    2e-16    
gb|ACN96403.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96381.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96409.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96405.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96397.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96388.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96386.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96393.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96414.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96426.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96384.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96392.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96416.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96390.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96382.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96411.1|  viviparous-1                                          88.6    5e-16    
gb|ACN96385.1|  viviparous-1                                          90.9    5e-16    
gb|ACN96413.1|  viviparous-1                                          88.6    6e-16    
gb|ACN96423.1|  viviparous-1                                          88.6    6e-16    
gb|ACN96389.1|  viviparous-1                                          90.5    6e-16    
ref|XP_004492630.1|  PREDICTED: B3 domain-containing protein Os07...  87.8    2e-15    
gb|AGO18182.1|  viviparous-like protein                               81.3    4e-15    
emb|CAA04889.1|  viviparous-1                                         88.2    4e-15    
gb|ACN96429.1|  viviparous-1                                          85.5    5e-15    
ref|XP_007212983.1|  hypothetical protein PRUPE_ppa022488mg           85.5    7e-15    
emb|CDX79071.1|  BnaA01g11380D                                        87.8    1e-14    
ref|XP_009134879.1|  PREDICTED: B3 domain-containing transcriptio...  87.8    1e-14    
ref|XP_009134871.1|  PREDICTED: B3 domain-containing transcriptio...  87.8    1e-14    
ref|XP_002966355.1|  hypothetical protein SELMODRAFT_451635           86.3    1e-14    
ref|XP_010527217.1|  PREDICTED: B3 domain-containing transcriptio...  87.4    1e-14    
ref|XP_009771757.1|  PREDICTED: B3 domain-containing protein Os07...  86.7    2e-14    
emb|CDX82834.1|  BnaC01g12840D                                        87.0    2e-14    
ref|XP_010040774.1|  PREDICTED: B3 domain-containing protein Os07...  83.2    2e-14    
gb|EPS64487.1|  hypothetical protein M569_10291                       86.3    3e-14    
gb|EYU36907.1|  hypothetical protein MIMGU_mgv1a001615mg              86.7    3e-14    
ref|XP_009595180.1|  PREDICTED: B3 domain-containing transcriptio...  86.7    4e-14    
ref|XP_004242480.1|  PREDICTED: B3 domain-containing transcriptio...  86.3    4e-14    
ref|XP_009772834.1|  PREDICTED: B3 domain-containing transcriptio...  86.3    4e-14    
ref|XP_009595181.1|  PREDICTED: B3 domain-containing transcriptio...  86.3    4e-14    
ref|XP_006350883.1|  PREDICTED: B3 domain-containing protein Os07...  86.3    4e-14    
ref|XP_009595178.1|  PREDICTED: B3 domain-containing transcriptio...  86.3    4e-14    
ref|XP_009595179.1|  PREDICTED: B3 domain-containing transcriptio...  86.3    4e-14    
ref|XP_001693653.1|  predicted protein                                82.4    5e-14    
ref|XP_006413764.1|  hypothetical protein EUTSA_v10024526mg           85.9    5e-14    
ref|XP_010236989.1|  PREDICTED: B3 domain-containing protein Os07...  85.9    6e-14    
ref|XP_010236982.1|  PREDICTED: B3 domain-containing protein Os07...  85.9    6e-14    
ref|XP_003623621.1|  B3 domain-containing transcription repressor...  83.6    6e-14    
ref|XP_002981754.1|  hypothetical protein SELMODRAFT_451631           85.5    7e-14    
ref|XP_010040771.1|  PREDICTED: B3 domain-containing protein Os07...  81.6    7e-14    
ref|XP_010491642.1|  PREDICTED: B3 domain-containing transcriptio...  85.5    8e-14    
ref|XP_009141065.1|  PREDICTED: B3 domain-containing transcriptio...  85.5    8e-14    
gb|KDP45706.1|  hypothetical protein JCGZ_17313                       85.5    8e-14    
ref|XP_002967591.1|  hypothetical protein SELMODRAFT_451626           85.5    8e-14    
emb|CDY29672.1|  BnaA04g17550D                                        85.1    9e-14    
ref|XP_002325640.1|  hypothetical protein POPTR_0019s15070g           85.1    9e-14    
ref|XP_010542684.1|  PREDICTED: B3 domain-containing transcriptio...  84.7    1e-13    
ref|XP_002319970.2|  hypothetical protein POPTR_0013s15330g           85.1    1e-13    
ref|XP_010522013.1|  PREDICTED: B3 domain-containing transcriptio...  84.7    1e-13    
ref|XP_011041785.1|  PREDICTED: B3 domain-containing transcriptio...  84.7    1e-13    
ref|XP_010522012.1|  PREDICTED: B3 domain-containing transcriptio...  84.7    1e-13    
ref|XP_010522011.1|  PREDICTED: B3 domain-containing transcriptio...  84.7    1e-13    
gb|KCW87581.1|  hypothetical protein EUGRSUZ_B040272                  84.7    1e-13    
ref|XP_010040772.1|  PREDICTED: B3 domain-containing protein Os07...  80.9    1e-13    
ref|XP_010045427.1|  PREDICTED: B3 domain-containing protein Os07...  84.7    1e-13    
ref|XP_007146893.1|  hypothetical protein PHAVU_006G079300g           84.7    1e-13    
ref|XP_010045426.1|  PREDICTED: B3 domain-containing transcriptio...  84.7    1e-13    
ref|XP_002523945.1|  transcription factor, putative                   84.7    1e-13    
emb|CDY23997.1|  BnaC03g16940D                                        84.3    1e-13    
gb|EYU46020.1|  hypothetical protein MIMGU_mgv1a027022mg              84.3    2e-13    
ref|XP_008787723.1|  PREDICTED: regulatory protein viviparous-1 i...  84.3    2e-13    
ref|XP_006347122.1|  PREDICTED: B3 domain-containing protein Os07...  84.0    2e-13    
ref|XP_007142042.1|  hypothetical protein PHAVU_008G247500g           84.0    2e-13    
emb|CDX84832.1|  BnaA03g13980D                                        84.3    2e-13    
ref|XP_007025775.1|  Transcription factor, putative isoform 1         84.3    2e-13    
ref|XP_009132737.1|  PREDICTED: B3 domain-containing transcriptio...  84.0    2e-13    
ref|XP_002947399.1|  hypothetical protein VOLCADRAFT_116438           81.3    2e-13    
emb|CDY10738.1|  BnaA05g11980D                                        84.0    2e-13    
gb|KFM25874.1|  B3 domain-containing transcription repressor VAL2     80.9    2e-13    
emb|CDY02066.1|  BnaC04g14350D                                        84.0    2e-13    
ref|XP_010414264.1|  PREDICTED: B3 domain-containing transcriptio...  84.0    2e-13    
ref|XP_010469852.1|  PREDICTED: B3 domain-containing transcriptio...  84.0    2e-13    
gb|EPS68316.1|  hypothetical protein M569_06459                       79.3    2e-13    
ref|XP_009144302.1|  PREDICTED: B3 domain-containing transcriptio...  84.0    2e-13    
ref|XP_006591264.1|  PREDICTED: B3 domain-containing transcriptio...  84.0    2e-13    
emb|CDP04043.1|  unnamed protein product                              84.0    2e-13    
ref|XP_006283162.1|  hypothetical protein CARUB_v10004192mg           83.6    2e-13    
ref|XP_011080654.1|  PREDICTED: LOW QUALITY PROTEIN: B3 domain-co...  84.0    2e-13    
ref|XP_010558872.1|  PREDICTED: B3 domain-containing transcriptio...  83.6    2e-13    
ref|XP_006347123.1|  PREDICTED: B3 domain-containing protein Os07...  84.0    3e-13    
emb|CDX97828.1|  BnaC04g41110D                                        83.6    3e-13    
ref|XP_011021047.1|  PREDICTED: B3 domain-containing transcriptio...  83.6    3e-13    
ref|XP_006377302.1|  hypothetical protein POPTR_0011s04340g           82.4    3e-13    
ref|XP_008363434.1|  PREDICTED: B3 domain-containing protein Os07...  83.6    3e-13    
ref|XP_007148240.1|  hypothetical protein PHAVU_006G191700g           83.6    3e-13    
ref|XP_004293496.1|  PREDICTED: B3 domain-containing protein Os07...  83.6    3e-13    



>ref|XP_009628582.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Nicotiana tomentosiformis]
Length=713

 Score =   449 bits (1155),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 297/522 (57%), Positives = 340/522 (65%), Gaps = 57/522 (11%)
 Frame = -3

Query  1937  QQNQE--------DDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLK  1782
             QQNQE        DDD        LSF  GNGELA IFF+WLKQNKD ISAEDMR+IKLK
Sbjct  216   QQNQESKPQFEEGDDDPNDG----LSFFTGNGELAVIFFEWLKQNKDYISAEDMRSIKLK  271

Query  1781  RSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGG  1602
             RSTIESASKRLG +KEGKKQLL+LILEWV+QYQLQKK  +EEAAA AA+ S  Q      
Sbjct  272   RSTIESASKRLGGTKEGKKQLLRLILEWVEQYQLQKKRMKEEAAATAASDSQCQYQESQL  331

Query  1601  HFQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQP----PFPVFQ-PHA  1437
             H          D+ P+      +              +  M    P    P P F  P A
Sbjct  332   H----------DSNPNPNPSFQYNNAVASDPSSCFYPSPWMPTPSPYIPGPDPFFSTPMA  381

Query  1436  IGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS  1257
              GY+  GDPY+     SFT M           EY     +++AQSW  S+F A  A+   
Sbjct  382   PGYA--GDPYS--NVPSFTNM-----------EYQ---TMESAQSWPPSQFSAMEASQ--  421

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             +NPYP+N NN     +   PQ  + S+YPYQLYDGNGERL RLGSSATKEARKKRMARQR
Sbjct  422   YNPYPENENN---LATNANPQGSF-SQYPYQLYDGNGERLARLGSSATKEARKKRMARQR  477

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMV  897
             RL SHH+RHH++   H +Q+     ++R+  +       +N GNWVYW  AA      + 
Sbjct  478   RLPSHHYRHHSHQTQHQSQSS--DQSLRLSGENCTMSPANNPGNWVYWPSAAPSPMMMVP  535

Query  896   VLppaeaapqppp--aqqQNHQKQSSS--DRRQGSKPEKNLKFLLQKVLKQSDVGSLGRI  729
                  +  P       Q QN QK +SS   R QG K EKNLKFLLQKVLKQSDVG+LGRI
Sbjct  536   PPEAPQPHPITERPGMQPQNRQKHASSADKRSQGWKSEKNLKFLLQKVLKQSDVGNLGRI  595

Query  728   VLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRAN  549
             VLPKKEAE+ LPEL+SRDGISI MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRAN
Sbjct  596   VLPKKEAESHLPELESRDGISIPMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRAN  655

Query  548   GLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             GLQEGDFIVIYAD KCGKYLIRGVKVRQ G +++GKKPA+KN
Sbjct  656   GLQEGDFIVIYADTKCGKYLIRGVKVRQSGPKAEGKKPAKKN  697



>ref|XP_009792996.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Nicotiana sylvestris]
Length=706

 Score =   448 bits (1153),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 294/518 (57%), Positives = 347/518 (67%), Gaps = 54/518 (10%)
 Frame = -3

Query  1937  QQNQEDDDSKAAETAD-----LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRST  1773
             QQNQE       E  D     LSF  GN ELA IFF+WLKQNKD ISAEDMR+IKLKRST
Sbjct  212   QQNQESKPQLEEEGDDDQNDGLSFFTGNSELAVIFFEWLKQNKDYISAEDMRSIKLKRST  271

Query  1772  IESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQ----STGGG  1605
             IESASKRLG SKEGKKQLL+LILEWV+QYQLQKK +   A+ +     + Q    S    
Sbjct  272   IESASKRLGGSKEGKKQLLRLILEWVEQYQLQKKAAATAASDSPCQYQESQLHDSSPNPN  331

Query  1604  GHFQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPHAIGYS  1425
              +FQ    +  +D     +       P P    PD           P +P   P A GY+
Sbjct  332   SNFQYNNAVA-SDPNACFYPSPWMPTPSPYIPGPD-----------PFYPT--PMAPGYA  377

Query  1424  NIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPY  1245
               GDPY+     SFT M           EY     +++AQSW  S+F A AA+   + P+
Sbjct  378   --GDPYS--NVPSFTNM-----------EYQ---TMESAQSWPPSQFSAMAASQ--YTPF  417

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSS  1065
             P+N +N +A ++   PQ L+ S+YPYQLYDGNGERL RLGSSATKEARKKRMARQRRL S
Sbjct  418   PENESN-LATQAN--PQGLF-SQYPYQLYDGNGERLARLGSSATKEARKKRMARQRRLPS  473

Query  1064  hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMVVLpp  885
             HH+RHH++   H +Q+     ++R+  +       +N GNWVYW P+A+ +P  MV  P 
Sbjct  474   HHYRHHSHQTQHQSQSS--DQSLRIVGENCTMSPANNPGNWVYW-PSAASSPMMMVPPPE  530

Query  884   aeaapqppp---aqqQNHQKQSSSDRR-QGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPK  717
             A            Q QNHQK +S+D+R Q  K EKNLKFLLQKVLKQSDVG+LGRIVLPK
Sbjct  531   APQPHPMTERPGMQPQNHQKHASADKRSQNWKSEKNLKFLLQKVLKQSDVGNLGRIVLPK  590

Query  716   KEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQE  537
             KEAE+ LPEL+SRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVR NGLQE
Sbjct  591   KEAESHLPELESRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRTNGLQE  650

Query  536   GDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             GDFIV+YAD KCGKYLIRGVKVRQ G +++GKKPA+KN
Sbjct  651   GDFIVLYADTKCGKYLIRGVKVRQTGPKAEGKKPAKKN  688



>ref|XP_009609744.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Nicotiana 
tomentosiformis]
 ref|XP_009609745.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Nicotiana 
tomentosiformis]
Length=663

 Score =   444 bits (1143),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 280/497 (56%), Positives = 329/497 (66%), Gaps = 45/497 (9%)
 Frame = -3

Query  1889  LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKL  1710
             LS  QG+ ELA +FF+WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKKQLL+L
Sbjct  184   LSIFQGDSELAVMFFEWLKQNKDYISAEDMRSIKLKRSTIESASKRLGSTKEGKKQLLRL  243

Query  1709  ILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTD-TApscffpspw  1533
             IL+WV+Q++LQK    E    A A   + Q++    +F   T    TD  A     P   
Sbjct  244   ILDWVEQHRLQKNQMSE----AVANQENFQNSAPNSNFHYNTV--GTDPNACFYPSPWMA  297

Query  1532  tppppppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVN---S  1362
             TP       PD+             PV      GY  IGDPY+ G   S    H N   S
Sbjct  298   TPSYNVTNFPDST------------PVMAGQIPGY--IGDPYSNG---SLFASHFNQTMS  340

Query  1361  GHFSHP--TEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL  1188
             G  S P  TEY     +D  QSW  S+F  AAA+   +N +PDN+++        QPQ+L
Sbjct  341   GSASSPASTEYQH---MDFTQSWLPSQFAVAAASQ--YNQFPDNSDSANNVAVVDQPQSL  395

Query  1187  YGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDP  1008
              G++YPYQL DGNGERL RLGS   KEARK RMARQRRL       H+  H    Q    
Sbjct  396   LGTQYPYQLLDGNGERLARLGS---KEARKNRMARQRRLP-----LHHYRHQTQNQRQCN  447

Query  1007  HHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMV--VLppaeaapqpppaqqQNHQK  834
               ++ M  +       ++ GNWVYW P+AS AP  MV     P   + + P  + QNHQK
Sbjct  448   DQSVIMCRENCAIDTGNSPGNWVYW-PSASAAPVMMVPQADSPQSHSTKRPALRSQNHQK  506

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
              SS+D+RQ  K EKNLKFLLQKVLKQSDVG+LGRIVLPK+EAET LP+L+SRDGISIAME
Sbjct  507   HSSADKRQACKTEKNLKFLLQKVLKQSDVGNLGRIVLPKREAETHLPQLESRDGISIAME  566

Query  653   DIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             DIGTS VWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYAD+KCGKYLIRG+K
Sbjct  567   DIGTSCVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADIKCGKYLIRGIK  626

Query  473   VRQHGARSDGKKPARKN  423
             VRQ+G +S+GKKPA+KN
Sbjct  627   VRQNGPKSEGKKPAKKN  643



>ref|XP_009799315.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Nicotiana sylvestris]
Length=650

 Score =   444 bits (1141),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 276/504 (55%), Positives = 325/504 (64%), Gaps = 50/504 (10%)
 Frame = -3

Query  1901  ETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQ  1722
             E   LS  QG+ ELA +FF+WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKKQ
Sbjct  167   ENEQLSIFQGDSELALMFFEWLKQNKDYISAEDMRSIKLKRSTIESASKRLGSTKEGKKQ  226

Query  1721  LLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffp  1542
             LL+LIL+WV+Q++LQKK   E    AAA     Q +    +F   T     +        
Sbjct  227   LLRLILDWVEQHRLQKKQMSE----AAANQESFQISAPNSNFHYNTVAADPNACFYQSPW  282

Query  1541  spwtppppppyiPDannaammaaAQPPFP----VFQPHAIGYSNIGDPYNCGGGASFTP-  1377
                                      P FP    V      GY  IGDPY    G+ F P 
Sbjct  283   MATAAYNI-----------------PNFPDSASVMAGQIPGY--IGDPYT--NGSLFVPP  321

Query  1376  -MHVNSGHFSHP--TEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESG  1206
                  SG  S P  TEY QP  +D  +SW  S+F  AAA+   +N +PD +++       
Sbjct  322   FNQTMSGSASSPASTEY-QP--MDYTRSWSPSQFAVAAASQ--YNKFPDYSDSANNVAVV  376

Query  1205  HQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhH  1026
              QPQ+L+G++YPYQL DGNGERL RLGS   KEARK RMARQRRL  HH+RH   N    
Sbjct  377   DQPQSLFGTQYPYQLLDGNGERLARLGS---KEARKNRMARQRRLPVHHYRHQVQN----  429

Query  1025  AQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpp---pa  855
              Q      ++ +G ++ +    S  GNW+YW P A+ A P ++V P              
Sbjct  430   -QRQINDQSVMIGENSAIDTGNSP-GNWIYWPPTAAAASPMVMVPPADSPQSYSTERPAL  487

Query  854   qqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRD  675
             + QNHQK S +D+RQ  K EKNLKFLLQKVLKQSDVG+LGRIVLPK+EAET LP+L+SRD
Sbjct  488   RSQNHQKHSLADKRQACKTEKNLKFLLQKVLKQSDVGNLGRIVLPKREAETHLPQLESRD  547

Query  674   GISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  495
             GISIA+ED+GTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK
Sbjct  548   GISIAVEDVGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  607

Query  494   YLIRGVKVRQHGARSDGKKPARKN  423
             YLIRGVKVRQ G  S+GKKPA+KN
Sbjct  608   YLIRGVKVRQSGPESEGKKPAKKN  631



>ref|XP_006352828.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Solanum tuberosum]
Length=580

 Score =   410 bits (1055),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 259/497 (52%), Positives = 313/497 (63%), Gaps = 69/497 (14%)
 Frame = -3

Query  1904  AETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             A    +S  QG+ ELA +F +WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKK
Sbjct  131   ANDEQVSIFQGDSELALMFLEWLKQNKDNISAEDMRSIKLKRSTIESASKRLGSTKEGKK  190

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscff  1545
             QLL+LIL+WV+Q++LQKK  R E           QS      F    F  P     +  F
Sbjct  191   QLLRLILDWVEQHRLQKKQMRVE-----------QSIQNSAPF---NFNNPNACLYNASF  236

Query  1544  pspwtppppppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVN  1365
             P                            PV      GY  IGD Y+   G+ F P    
Sbjct  237   PDSS-------------------------PVMTGPIQGY--IGDLYS--NGSLFAP----  263

Query  1364  SGHFSHPTEYHQP-AAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL  1188
                      Y+Q  +   T++SW  S+F  A A+   +NP+PDN++    A      Q L
Sbjct  264   --------PYNQTMSGSATSRSWSPSQFTMATASQ--YNPFPDNDSTDNVAIPD---QPL  310

Query  1187  YGSEY-PYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYD  1011
             + ++Y PYQ++DGN ERL RLG+ ATKEARK RMARQRR+  HH+RH   N    +    
Sbjct  311   FSAQYDPYQVFDGNSERLARLGTCATKEARKNRMARQRRVPLHHYRHQTQNQRQISN---  367

Query  1010  PHHAMRMG--VDTVLPHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQ  837
                ++ MG  ++     + ++LGNWVYW  AA+  P  MV L     A        Q+ Q
Sbjct  368   -EKSVMMGGKINNCAMSRANSLGNWVYWPCAAAAPPIAMVPLADTPQALPMERPAVQS-Q  425

Query  836   KQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAM  657
             K  S+D+RQ  K EKNLKFLLQKVLKQSDVG+LGRIVLPKKEAE+ LP+L++RDGISIAM
Sbjct  426   KHGSTDKRQACKTEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAESHLPQLETRDGISIAM  485

Query  656   EDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGV  477
             EDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFV ANGLQEGDFIVIYAD+KCGKYLIRGV
Sbjct  486   EDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVLANGLQEGDFIVIYADIKCGKYLIRGV  545

Query  476   KVRQHGARSDGKKPARK  426
             KVR +GA+SD  +PA+K
Sbjct  546   KVRPNGAKSDSTQPAKK  562



>gb|EYU46359.1| hypothetical protein MIMGU_mgv1a025237mg [Erythranthe guttata]
Length=693

 Score =   409 bits (1050),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 269/512 (53%), Positives = 312/512 (61%), Gaps = 72/512 (14%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             SFL+GN ELA IFF+WLKQN+D ISAEDMRNIKLKRSTIE+ASKRLGS+KEGKKQLLKLI
Sbjct  209   SFLEGNSELAFIFFEWLKQNRDYISAEDMRNIKLKRSTIENASKRLGSNKEGKKQLLKLI  268

Query  1706  LEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGG--------HFQAETFLQPTDTApsc  1551
             LEWV+ YQLQKK                 + GGGG        +F      Q  +T    
Sbjct  269   LEWVENYQLQKK------------PPPITAEGGGGPQSPNPNPNFNYTPLPQDPNTCFPA  316

Query  1550  ffpspwtppppppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMH  1371
                 P  P P                A PPF     H  GYS  GDPY+        PMH
Sbjct  317   PTWMPPPPQPDQVSSM---------MAAPPFS--GQHMAGYS--GDPYS--NQIPMVPMH  361

Query  1370  ---VNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAP-SFNPYPDNNNNRIAAESGH  1203
                VN   + H  EY        AQSW  S +          F+PYPD+N + +      
Sbjct  362   HQVVNGIAYQHSPEY--------AQSWPISPYPMPPPPPHHQFSPYPDSNGHVMTHHHHQ  413

Query  1202  QPQALYGSEY--PYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhh  1029
                    + Y  PYQ+YD NGERLMRLGSSATKEARKKRMARQ+++ SHH RH +N+  +
Sbjct  414   HHHHHQQTVYGNPYQVYDPNGERLMRLGSSATKEARKKRMARQKKMYSHHHRHSSNSGQN  473

Query  1028  HAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYW----------SPAASEAPPPMVVLppae  879
              +Q  D           V+        NW YW          SP  + APP         
Sbjct  474   QSQLNDA---------DVVGDGGDEGDNW-YWSGGGGGGDASSPTNANAPP---GDDSHT  520

Query  878   aapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQ  699
              +   P  Q Q +QKQ S  R+QG K EKNLKFLLQKVLKQSDVG+LGRIVLPKKEAE+ 
Sbjct  521   PSGDRPSKQPQTNQKQGSDKRQQGWKSEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAESH  580

Query  698   LPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVI  519
             LPEL++RDG++IAMEDIG+SRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVI
Sbjct  581   LPELETRDGMTIAMEDIGSSRVWNMRYRFWPNNKSRMYLLENTGDFVRVNGLQEGDFIVI  640

Query  518   YADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             Y+D KCGKY+IRGVKVRQ GA+ +GKKPAR+N
Sbjct  641   YSDTKCGKYMIRGVKVRQPGAKMEGKKPARRN  672



>emb|CAC84597.2| VP1-ABI3-like protein [Solanum tuberosum]
Length=582

 Score =   404 bits (1039),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 253/499 (51%), Positives = 313/499 (63%), Gaps = 71/499 (14%)
 Frame = -3

Query  1904  AETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             A    +S  QG+ ELA +F +WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKK
Sbjct  131   ANDEQVSIFQGDSELALMFLEWLKQNKDNISAEDMRSIKLKRSTIESASKRLGSTKEGKK  190

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscff  1545
             QLL+LIL+WV+Q++LQKK  R E           QS      F    F  P     +  F
Sbjct  191   QLLRLILDWVEQHRLQKKQMRIE-----------QSIQNSAPF---NFNNPNACFYNASF  236

Query  1544  pspwtppppppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVN  1365
             P                            PV      GY  IGD Y+   G+ F P    
Sbjct  237   PDSS-------------------------PVMTGPIQGY--IGDLYS--NGSLFAP----  263

Query  1364  SGHFSHPTEYHQP-AAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNN-NRIAAESGHQPQA  1191
                      Y+Q  +   T++SW  S+F  + A A  +NP+PDN++ N +A       Q 
Sbjct  264   --------PYNQTMSGSATSRSWSPSQF--SMATASQYNPFPDNDSTNNVAIPD----QP  309

Query  1190  LYGSEY-PYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY  1014
             L+ ++Y PYQ++DGN ERL RLG+ ATKEARK RMARQRR+  HH+R    +    +   
Sbjct  310   LFSAQYDPYQVFDGNSERLARLGTCATKEARKNRMARQRRVPLHHYRDQTQDQRQISN--  367

Query  1013  DPHHAMRMG--VDTVLPHQVSNLGNWVYWSPAASEAPPPMVVL-ppaeaapqpppaqqQN  843
                 ++ MG  ++     + ++LGNWVYW  AA+   PP+ ++         P       
Sbjct  368   --EKSVMMGGKINNCAISRANSLGNWVYWPCAAAAPAPPITMVPLADTPQALPMERPAVQ  425

Query  842   HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
              QK  S+D+RQ  K EKNLKFLLQKVLKQSD+G+LGRIVLPKKEAE+ LP+L++RDGISI
Sbjct  426   SQKHGSTDKRQACKTEKNLKFLLQKVLKQSDIGNLGRIVLPKKEAESHLPQLETRDGISI  485

Query  662   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
             AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFV ANGLQEGDFIVIYAD++CGKYLIR
Sbjct  486   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVLANGLQEGDFIVIYADIQCGKYLIR  545

Query  482   GVKVRQHGARSDGKKPARK  426
             GVKVR +GA+SD  +PA+K
Sbjct  546   GVKVRPNGAKSDSTQPAKK  564



>ref|XP_006443662.1| hypothetical protein CICLE_v10019039mg [Citrus clementina]
 ref|XP_006480255.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Citrus sinensis]
 gb|ESR56902.1| hypothetical protein CICLE_v10019039mg [Citrus clementina]
Length=725

 Score =   404 bits (1037),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 266/525 (51%), Positives = 333/525 (63%), Gaps = 53/525 (10%)
 Frame = -3

Query  1958  RSQFEELQQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKR  1779
             R Q   +Q N  D+ ++    +D        +LA +F +WLK NK+ +SAED+RN+K+K+
Sbjct  210   RDQELMMQSNNGDNSNEDGGASD--------DLAMVFLEWLKSNKETVSAEDLRNVKIKK  261

Query  1778  STIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASD--HQSTGGG  1605
             STIE A+KRLG  KE  KQLLKLILEWVQ   LQK+  RE    A+   ++  HQ     
Sbjct  262   STIECAAKRLGGGKEAMKQLLKLILEWVQTNHLQKRRMREALLPASNNNNNLPHQQ----  317

Query  1604  GHFQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPF---PV-----F  1449
              HFQ +TF  P         P+P     P P  P+   A      QP F   P      F
Sbjct  318   -HFQ-DTFQNPNPNPNPNHIPNPNLNCNPIPPEPNPCFAQSSWIGQPSFIHDPATMVTGF  375

Query  1448  QPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaa  1269
                A+GY  +GD +    G S    H   G+ + P+EYH    ++T +SW +S+F     
Sbjct  376   PTPAVGY--MGDSF--ANGMSNINGH---GYAAPPSEYHM---LETTRSWPNSQF----G  421

Query  1268  aAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEYPYQLYDGNGE-RLMRLGSSATKEARK  1098
              A ++N + DNN       +   PQA   YG++YPY    G+GE RLMR+GSSATKEARK
Sbjct  422   LASNYNSFSDNN----LHPAPLHPQAFTGYGNQYPYPYLPGHGEQRLMRMGSSATKEARK  477

Query  1097  KRMARQRRLSShhfrhhnnnhhhHAQNYDP--HHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             KRMARQRRLS+H    H++N+  +         HA R G D   P   +N GNWV+W PA
Sbjct  478   KRMARQRRLSTHPRHQHHHNNQQNQLQGQNADQHA-RFGSDNCNPAAQANSGNWVFW-PA  535

Query  923   ASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVG  744
             ++  P  +  L P +  P  P     N+Q+Q +SDRRQG KPEKNL+FLLQKVLKQSDVG
Sbjct  536   SAGGPAAVSPLSPVDRQPMQPQ----NYQRQPASDRRQGWKPEKNLRFLLQKVLKQSDVG  591

Query  743   SLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGD  564
             +LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGD
Sbjct  592   NLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGD  651

Query  563   FVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             FV+ANGLQEGDFIVIY+D+KCGKYLIRGVKVRQ G +S+ K+  +
Sbjct  652   FVKANGLQEGDFIVIYSDVKCGKYLIRGVKVRQPGPKSETKRTGK  696



>ref|XP_006443663.1| hypothetical protein CICLE_v10019039mg [Citrus clementina]
 gb|ESR56903.1| hypothetical protein CICLE_v10019039mg [Citrus clementina]
Length=727

 Score =   399 bits (1024),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 266/527 (50%), Positives = 333/527 (63%), Gaps = 55/527 (10%)
 Frame = -3

Query  1958  RSQFEELQQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKR  1779
             R Q   +Q N  D+ ++    +D        +LA +F +WLK NK+ +SAED+RN+K+K+
Sbjct  210   RDQELMMQSNNGDNSNEDGGASD--------DLAMVFLEWLKSNKETVSAEDLRNVKIKK  261

Query  1778  STIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASD--HQSTGGG  1605
             STIE A+KRLG  KE  KQLLKLILEWVQ   LQK+  RE    A+   ++  HQ     
Sbjct  262   STIECAAKRLGGGKEAMKQLLKLILEWVQTNHLQKRRMREALLPASNNNNNLPHQQ----  317

Query  1604  GHFQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPF---PV-----F  1449
              HFQ +TF  P         P+P     P P  P+   A      QP F   P      F
Sbjct  318   -HFQ-DTFQNPNPNPNPNHIPNPNLNCNPIPPEPNPCFAQSSWIGQPSFIHDPATMVTGF  375

Query  1448  QPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaa  1269
                A+GY  +GD +    G S    H   G+ + P+EYH    ++T +SW +S+F     
Sbjct  376   PTPAVGY--MGDSF--ANGMSNINGH---GYAAPPSEYHM---LETTRSWPNSQF----G  421

Query  1268  aAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEYPYQLYDGNGE-RLMRLGSSATKEARK  1098
              A ++N + DNN       +   PQA   YG++YPY    G+GE RLMR+GSSATKEARK
Sbjct  422   LASNYNSFSDNN----LHPAPLHPQAFTGYGNQYPYPYLPGHGEQRLMRMGSSATKEARK  477

Query  1097  KRMARQRRLSShhfrhhnnnhhhHAQNYDP--HHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             KRMARQRRLS+H    H++N+  +         HA R G D   P   +N GNWV+W PA
Sbjct  478   KRMARQRRLSTHPRHQHHHNNQQNQLQGQNADQHA-RFGSDNCNPAAQANSGNWVFW-PA  535

Query  923   ASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVG  744
             ++  P  +  L P +  P  P     N+Q+Q +SDRRQG KPEKNL+FLLQKVLKQSDVG
Sbjct  536   SAGGPAAVSPLSPVDRQPMQPQ----NYQRQPASDRRQGWKPEKNLRFLLQKVLKQSDVG  591

Query  743   SLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY--RFWPNNKSRMYLLENT  570
             +LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+Y  RFWPNNKSRMYLLENT
Sbjct  592   NLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYSFRFWPNNKSRMYLLENT  651

Query  569   GDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             GDFV+ANGLQEGDFIVIY+D+KCGKYLIRGVKVRQ G +S+ K+  +
Sbjct  652   GDFVKANGLQEGDFIVIYSDVKCGKYLIRGVKVRQPGPKSETKRTGK  698



>ref|XP_002521137.1| Abscisic acid-insensitive protein, putative [Ricinus communis]
 gb|EEF41288.1| Abscisic acid-insensitive protein, putative [Ricinus communis]
Length=551

 Score =   392 bits (1008),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 255/503 (51%), Positives = 312/503 (62%), Gaps = 62/503 (12%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A+KRLG  KE  KQLLKLILEWVQ  
Sbjct  62    DLAMVFLEWLKSNKETVSAEDLRKVKIKKATIECAAKRLGGGKEAMKQLLKLILEWVQTN  121

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+  +E             S      +Q +  LQ       C  P+       PP  
Sbjct  122   HLQKRRMKES------------SCTNNLSYQCQDPLQ-NPNPNPCLNPNNSNCNSIPPEQ  168

Query  1505  PDannaammaaAQPPF--------PVFQPHAIGYSNIGDPYNCG----GGASFTPMHVNS  1362
                        A PP+        P F P  +GY  +GD +  G     G S+ P     
Sbjct  169   STPCFTQSPWIAPPPYVSDPSTVMPGFSP-MVGY--VGDQFGNGTSTMAGHSYPP-----  220

Query  1361  GHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGH-QPQALY  1185
                  P EYH    +D+AQSW +S+F  A+     ++PYPDNN   I    GH Q    Y
Sbjct  221   ---PQPAEYHM---LDSAQSWPASQFALASQ----YSPYPDNNLQPIP---GHGQVFTGY  267

Query  1184  GSEYPYQLYDG-NGERLMRLGSSATKEARKKRMARQRR-LSShhfrhhnnnhhhHAQNYD  1011
             G++YP Q   G  G+RLMRLGSSATKEARKKRMARQ+R LS H   +H++N  +  QN  
Sbjct  268   GNQYPCQYLPGQGGDRLMRLGSSATKEARKKRMARQKRFLSHHRNHNHHSNQPNQHQNQG  327

Query  1010  PHHAMRMGVDTVLPH--QVSNLGNWVYWSPA-----ASEAPPPMVVLppaeaapqpppaq  852
                  R+G D  +P   Q ++ GNWVYW  A     A  A P + V      A +P    
Sbjct  328   ADEHARLGNDNGVPATPQANHPGNWVYWPTAPPTHGAVSAAPVLPV----RTADRPAMQT  383

Query  851   qQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
              QN ++Q++SD+RQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDG
Sbjct  384   AQNQRQQAASDKRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDG  443

Query  671   ISIAMEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCG  498
             ISIAMEDIGTSRVWNM+Y  RFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KCG
Sbjct  444   ISIAMEDIGTSRVWNMRYSFRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCG  503

Query  497   KYLIRGVKVRQHGARSDGKKPAR  429
             KYLIRGVKVRQ G +S+ KK  +
Sbjct  504   KYLIRGVKVRQPGPKSESKKAGK  526



>gb|KDO65858.1| hypothetical protein CISIN_1g038867mg [Citrus sinensis]
Length=721

 Score =   396 bits (1017),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 261/519 (50%), Positives = 331/519 (64%), Gaps = 45/519 (9%)
 Frame = -3

Query  1958  RSQFEELQQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKR  1779
             R Q   +Q N  D+ ++    +D        +LA +F +WLK NK+ +SAED+RN+K+K+
Sbjct  210   RDQELMMQSNNGDNSNEDGGASD--------DLAMVFLEWLKSNKETVSAEDLRNVKIKK  261

Query  1778  STIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGH  1599
             STIE A+KRLG  KE  KQLLKLILEWVQ   LQK+  RE   A   A++++ +     H
Sbjct  262   STIECAAKRLGGGKEAMKQLLKLILEWVQTNHLQKRRMRE---ALLPASNNNNNLPYQQH  318

Query  1598  FQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPFPV--FQPHAIGYS  1425
             FQ +TF  P          +P  P P P +   +          P   V  F   A+GY 
Sbjct  319   FQ-DTFQNPNPNPNPNHNCNPIPPEPNPCFAQSSWIGQPSFIHDPATMVTGFPTPAVGY-  376

Query  1424  NIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPY  1245
              +GD +    G S    H   G+ + P+EYH    ++T +SW +S+F      A ++N +
Sbjct  377   -MGDSF--ANGMSNINGH---GYAAPPSEYHM---LETTRSWPNSQF----GLASNYNSF  423

Query  1244  PDNNNNRIAAESGHQPQAL--YGSEYPYQLYDGNGE-RLMRLGSSATKEARKKRMARQRR  1074
              DNN       +   PQA   YG++YPY    G+GE RLMR+GSSATKEARKKRMARQRR
Sbjct  424   SDNN----LHPAPLHPQAFTGYGNQYPYPYLPGHGEQRLMRMGSSATKEARKKRMARQRR  479

Query  1073  LSShhfrhhnnnhhhHAQNYDP--HHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPM  900
             LS+H    H++N+  +         HA R G D   P   +N GNWV+W PA++  P  +
Sbjct  480   LSTHPRHQHHHNNQQNQLQGQNADQHA-RFGSDNCNPAAQANSGNWVFW-PASAGGPAAV  537

Query  899   VVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLP  720
               L P +  P  P     N+Q+Q +SDRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLP
Sbjct  538   SPLSPVDRQPMQPQ----NYQRQPASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLP  593

Query  719   KKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANG  546
             KKEAET LPEL++RDGISIAMEDIGTSRVWNM+Y  RFWPNNKSRMYLLENTGDFV+ANG
Sbjct  594   KKEAETHLPELEARDGISIAMEDIGTSRVWNMRYSFRFWPNNKSRMYLLENTGDFVKANG  653

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             LQEGDFIVIY+D+KCGKYLIRGVKVRQ G +S+ K+  +
Sbjct  654   LQEGDFIVIYSDVKCGKYLIRGVKVRQPGPKSETKRTGK  692



>ref|XP_007140552.1| hypothetical protein PHAVU_008G122100g [Phaseolus vulgaris]
 gb|ESW12546.1| hypothetical protein PHAVU_008G122100g [Phaseolus vulgaris]
Length=734

 Score =   394 bits (1013),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 246/503 (49%), Positives = 302/503 (60%), Gaps = 56/503 (11%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E++ +F +WLK NKD +SA D+RN+KLK++TIESA+KRLG  KE  KQLLKLILEWVQ  
Sbjct  228   EMSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAAKRLGGGKEAMKQLLKLILEWVQTS  287

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQ---AETFLQPTDTApscffpspwtppppp  1515
              LQ K  +E           + S      FQ   A+T      +       +       P
Sbjct  288   HLQNKRRKEN--------GSNNSNALQAQFQDPSAQTKENAHTSGSFAPESNSCFNNQTP  339

Query  1514  pyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHP---  1344
                P            P  P  QP  +GY  +GDPY  G   +   + VN  H ++P   
Sbjct  340   WLNPQTFGTDQAPVMVPSQPYSQP-VVGY--VGDPYTSGSAPN--NITVNHNHNNNPYQP  394

Query  1343  --TEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG----  1182
                +YH    +++A SW  S+F  A+  + S+             E+G      +G    
Sbjct  395   GTDQYHM---LESAHSWPHSQFNVASHYSQSY------------GENGLFTHGGFGGYAN  439

Query  1181  SEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
             ++YPYQ + G G+RLMRLG SATKEARKKRMARQRR  SHH   + N+  +  Q  DPH 
Sbjct  440   NQYPYQFFHGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRNQNGNHLQN--QGSDPH-  496

Query  1001  AMRMGVDT-----VLPHQV-SNLGNWVYW-----SPAASEAPP-PMVVLppaeaapqppp  858
               R+G D      V PHQ  S   NW+YW      PA   AP  P   L       +   
Sbjct  497   -ARLGNDNCTTGLVAPHQPNSAAANWMYWQAMTGGPAGPLAPVVPADPLAGQTVVDRTTM  555

Query  857   aqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSR  678
               Q +HQ +++SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++R
Sbjct  556   HTQNSHQNRAASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEAR  615

Query  677   DGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCG  498
             DGISI MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCG
Sbjct  616   DGISITMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCG  675

Query  497   KYLIRGVKVRQHGARSDGKKPAR  429
             KY+IRGVKVRQ G + + KK  +
Sbjct  676   KYMIRGVKVRQQGVKPETKKAGK  698



>ref|XP_003532309.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X1 [Glycine max]
Length=761

 Score =   392 bits (1007),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 239/498 (48%), Positives = 300/498 (60%), Gaps = 45/498 (9%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++T+ESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  250   MSNVFLEWLKSNKDSVSANDLRNVKLKKATLESAARRLGGGKEAMKQLLKLILEWVQTSH  309

Query  1682  LQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyiP  1503
             LQ K  +E   ++ ++    Q     G    +   Q T +       +       P    
Sbjct  310   LQNKRRKENNGSSISSVLQAQFQDPSG----QNNNQNTQSGSFAPESNTCFNNQTPWLSS  365

Query  1502  DannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPA  1323
                         PP    QP  +GY  +GDPY  G  ++    ++++ H  + +  +QP 
Sbjct  366   QTFATDQAPLMVPPQQFPQP-MVGY--VGDPYTSGAASN----NISATHNHNNSNPYQPG  418

Query  1322  A-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLY  1158
             A     +++A SW  S F  A+  + SF      +NN +    G        ++YPYQ +
Sbjct  419   AEQYHMLESAHSWPHSLFNVASNYSQSFG-----DNNGLNPHGGFGGGGYGNNQYPYQFF  473

Query  1157  DGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDT  978
              G G+RLMRLG SATKEARKKRMARQRR  SHH  H  N+ +   Q  DPH   RMG D 
Sbjct  474   HGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRHHSGNHQN---QGSDPH--ARMGGDN  528

Query  977   V-----LPHQVSNLGNWVYW--------SPAASEAP--PPMVVLppaeaapqpppaqqQN  843
                    PH  +   NW+YW         P A   P  PP+V         +     Q  
Sbjct  529   CNTALAAPHHANPSANWMYWQAMIGGAAGPLAPVIPAEPPVV----QPVVDRSAMQTQNC  584

Query  842   HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
             HQ + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI
Sbjct  585   HQNRVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISI  644

Query  662   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
              MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IR
Sbjct  645   TMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIR  704

Query  482   GVKVRQHGARSDGKKPAR  429
             GVKVRQ G + + KK  +
Sbjct  705   GVKVRQQGVKPETKKAGK  722



>ref|XP_007049857.1| ABI3, putative isoform 4 [Theobroma cacao]
 gb|EOX94014.1| ABI3, putative isoform 4 [Theobroma cacao]
Length=740

 Score =   389 bits (1000),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 247/497 (50%), Positives = 312/497 (63%), Gaps = 50/497 (10%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A++RLG  KE  KQLLKLILEWVQ  
Sbjct  251   DLAMVFLEWLKTNKETVSAEDLRRVKIKKATIECAARRLGGGKEAMKQLLKLILEWVQTN  310

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+  +E A+                 +Q +   Q  +  P+       +    PP  
Sbjct  311   HLQKRRIKESASNNNIDIP----------YQYQDNFQNPNPNPNPNSNPNLSCDSGPPPE  360

Query  1505  PDannaammaaAQPPF---PV-----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFS  1350
             P++  +      QP +   PV     F P  +GY  +GDP+  G        ++NS  + 
Sbjct  361   PNSCFSQPPWIPQPTYVTDPVAVVAGFAP-TVGY--MGDPFLNGAP------NINSHPYQ  411

Query  1349  HPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSE  1176
              PT+Y     +D+AQ+W  S+F  A+     +N +PDNN       + HQP A   YG++
Sbjct  412   PPTDY---PMLDSAQTWPPSQFALAS----QYNSFPDNN----LHPAPHQPSAFPGYGNQ  460

Query  1175  YPYQLYD--GNGERLMRLGSSATKEARKKRMARQRRLS---ShhfrhhnnnhhhHAQNYD  1011
             YPYQ      N ERL+RLGSSATKEARKKRMARQRR +    +H  H+N    H  Q+ D
Sbjct  461   YPYQYIQRHNNEERLVRLGSSATKEARKKRMARQRRFAPHHRNHNYHNNQQSQHQNQSVD  520

Query  1010  PHHAMRMGVDTVLPHQVSNLGNWVYWSPAA---SEAPPPMVVLppaeaapqpppaqqQNH  840
              H  +R+  D       +N GNWVYW   A   +  PP +    P       P  Q Q +
Sbjct  521   QH--VRLIKDNCAAAAQANSGNWVYWPAVACGMASNPPLLPGDVPVVHPVDRPSMQGQTY  578

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             Q+  +SDRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIA
Sbjct  579   QRHVASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIA  638

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KC KYLIRG
Sbjct  639   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCSKYLIRG  698

Query  479   VKVRQHGARSDGKKPAR  429
             VKVRQ G +S+ K+P +
Sbjct  699   VKVRQSGPKSETKRPGK  715



>ref|XP_007049854.1| ABI3, putative isoform 1 [Theobroma cacao]
 gb|EOX94011.1| ABI3, putative isoform 1 [Theobroma cacao]
Length=746

 Score =   389 bits (999),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 247/497 (50%), Positives = 312/497 (63%), Gaps = 50/497 (10%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A++RLG  KE  KQLLKLILEWVQ  
Sbjct  257   DLAMVFLEWLKTNKETVSAEDLRRVKIKKATIECAARRLGGGKEAMKQLLKLILEWVQTN  316

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+  +E A+                 +Q +   Q  +  P+       +    PP  
Sbjct  317   HLQKRRIKESASNNNIDIP----------YQYQDNFQNPNPNPNPNSNPNLSCDSGPPPE  366

Query  1505  PDannaammaaAQPPF---PV-----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFS  1350
             P++  +      QP +   PV     F P  +GY  +GDP+  G        ++NS  + 
Sbjct  367   PNSCFSQPPWIPQPTYVTDPVAVVAGFAP-TVGY--MGDPFLNGAP------NINSHPYQ  417

Query  1349  HPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSE  1176
              PT+Y     +D+AQ+W  S+F  A+     +N +PDNN       + HQP A   YG++
Sbjct  418   PPTDY---PMLDSAQTWPPSQFALAS----QYNSFPDNN----LHPAPHQPSAFPGYGNQ  466

Query  1175  YPYQLYD--GNGERLMRLGSSATKEARKKRMARQRRLS---ShhfrhhnnnhhhHAQNYD  1011
             YPYQ      N ERL+RLGSSATKEARKKRMARQRR +    +H  H+N    H  Q+ D
Sbjct  467   YPYQYIQRHNNEERLVRLGSSATKEARKKRMARQRRFAPHHRNHNYHNNQQSQHQNQSVD  526

Query  1010  PHHAMRMGVDTVLPHQVSNLGNWVYWSPAA---SEAPPPMVVLppaeaapqpppaqqQNH  840
              H  +R+  D       +N GNWVYW   A   +  PP +    P       P  Q Q +
Sbjct  527   QH--VRLIKDNCAAAAQANSGNWVYWPAVACGMASNPPLLPGDVPVVHPVDRPSMQGQTY  584

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             Q+  +SDRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIA
Sbjct  585   QRHVASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIA  644

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KC KYLIRG
Sbjct  645   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCSKYLIRG  704

Query  479   VKVRQHGARSDGKKPAR  429
             VKVRQ G +S+ K+P +
Sbjct  705   VKVRQSGPKSETKRPGK  721



>dbj|BAB96578.1| abscisic acid insensitive 3-like factor [Phaseolus vulgaris]
Length=755

 Score =   387 bits (995),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 243/499 (49%), Positives = 299/499 (60%), Gaps = 48/499 (10%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E++ +F +WLK NKD +SA D+RN+KLK++TIESA+KRLG  KE  KQLLKLILEWVQ  
Sbjct  255   EMSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAAKRLGGGKEAMKQLLKLILEWVQTS  314

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQ---AETFLQPTDTApscffpspwtppppp  1515
              LQ K  +E           + S      FQ   A+T      +       +       P
Sbjct  315   HLQNKRRKEN--------GSNNSNALQAQFQDPSAQTKENAHTSGSFAPESNSCFNNQTP  366

Query  1514  pyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHP---  1344
                P            P  P  QP  +GY  +GDPY  G   +   + VN  H ++P   
Sbjct  367   WLNPQTFGTDQAPVMVPSQPYSQP-VVGY--VGDPYTSGSAPN--NITVNHNHNNNPYQP  421

Query  1343  --TEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYP  1170
                +YH    +++A SW  S+F  A+  + S+        N +    G    A   ++YP
Sbjct  422   GTDQYHM---LESAHSWPHSQFNVASHYSQSYG------ENGLFTHGGFGGYA--NNQYP  470

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRM  990
             YQ + G G+RLMRLG SATKEARKKRMARQRR  SHH  H+ N+  +  Q  DPH   R+
Sbjct  471   YQFFHGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRNHNGNHLQN--QGSDPH--ARL  526

Query  989   GVDT-----VLPHQV-SNLGNWVYW-----SPAASEAPP-PMVVLppaeaapqpppaqqQ  846
             G D      V PHQ  S   NW+YW      P    AP  P   L       +     Q 
Sbjct  527   GNDNCTTGLVAPHQPNSAAANWMYWQAMTGGPGGPLAPVVPADPLAGQTVVDRTTMHTQN  586

Query  845   NHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGIS  666
             +HQ +++SDRRQG KPEKNL+FL+QKVLKQSDVG LG IVLPKKEAET LPEL++RDGIS
Sbjct  587   SHQNRAASDRRQGWKPEKNLRFLVQKVLKQSDVGKLGEIVLPKKEAETHLPELEARDGIS  646

Query  665   IAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             I MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+I
Sbjct  647   ITMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMI  706

Query  485   RGVKVRQHGARSDGKKPAR  429
             RGVKVRQ G + + KK  +
Sbjct  707   RGVKVRQQGVKPETKKAGK  725



>ref|XP_006586272.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X2 [Glycine max]
Length=763

 Score =   387 bits (995),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 239/500 (48%), Positives = 300/500 (60%), Gaps = 47/500 (9%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++T+ESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  250   MSNVFLEWLKSNKDSVSANDLRNVKLKKATLESAARRLGGGKEAMKQLLKLILEWVQTSH  309

Query  1682  LQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyiP  1503
             LQ K  +E   ++ ++    Q     G    +   Q T +       +       P    
Sbjct  310   LQNKRRKENNGSSISSVLQAQFQDPSG----QNNNQNTQSGSFAPESNTCFNNQTPWLSS  365

Query  1502  DannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPA  1323
                         PP    QP  +GY  +GDPY  G  ++    ++++ H  + +  +QP 
Sbjct  366   QTFATDQAPLMVPPQQFPQP-MVGY--VGDPYTSGAASN----NISATHNHNNSNPYQPG  418

Query  1322  A-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLY  1158
             A     +++A SW  S F  A+  + SF      +NN +    G        ++YPYQ +
Sbjct  419   AEQYHMLESAHSWPHSLFNVASNYSQSFG-----DNNGLNPHGGFGGGGYGNNQYPYQFF  473

Query  1157  DGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDT  978
              G G+RLMRLG SATKEARKKRMARQRR  SHH  H  N+ +   Q  DPH   RMG D 
Sbjct  474   HGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRHHSGNHQN---QGSDPH--ARMGGDN  528

Query  977   V-----LPHQVSNLGNWVYW--------SPAASEAP--PPMVVLppaeaapqpppaqqQN  843
                    PH  +   NW+YW         P A   P  PP+V         +     Q  
Sbjct  529   CNTALAAPHHANPSANWMYWQAMIGGAAGPLAPVIPAEPPVV----QPVVDRSAMQTQNC  584

Query  842   HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
             HQ + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI
Sbjct  585   HQNRVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISI  644

Query  662   AMEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYL  489
              MEDIGTSRVWNM+Y  R+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+
Sbjct  645   TMEDIGTSRVWNMRYSIRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYM  704

Query  488   IRGVKVRQHGARSDGKKPAR  429
             IRGVKVRQ G + + KK  +
Sbjct  705   IRGVKVRQQGVKPETKKAGK  724



>ref|XP_007049855.1| ABI3, putative isoform 2 [Theobroma cacao]
 gb|EOX94012.1| ABI3, putative isoform 2 [Theobroma cacao]
Length=742

 Score =   384 bits (986),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 247/499 (49%), Positives = 312/499 (63%), Gaps = 52/499 (10%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A++RLG  KE  KQLLKLILEWVQ  
Sbjct  251   DLAMVFLEWLKTNKETVSAEDLRRVKIKKATIECAARRLGGGKEAMKQLLKLILEWVQTN  310

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+  +E A+                 +Q +   Q  +  P+       +    PP  
Sbjct  311   HLQKRRIKESASNNNIDIP----------YQYQDNFQNPNPNPNPNSNPNLSCDSGPPPE  360

Query  1505  PDannaammaaAQPPF---PV-----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFS  1350
             P++  +      QP +   PV     F P  +GY  +GDP+  G        ++NS  + 
Sbjct  361   PNSCFSQPPWIPQPTYVTDPVAVVAGFAP-TVGY--MGDPFLNGAP------NINSHPYQ  411

Query  1349  HPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSE  1176
              PT+Y     +D+AQ+W  S+F  A+     +N +PDNN       + HQP A   YG++
Sbjct  412   PPTDY---PMLDSAQTWPPSQFALAS----QYNSFPDNN----LHPAPHQPSAFPGYGNQ  460

Query  1175  YPYQLYD--GNGERLMRLGSSATKEARKKRMARQRRLS---ShhfrhhnnnhhhHAQNYD  1011
             YPYQ      N ERL+RLGSSATKEARKKRMARQRR +    +H  H+N    H  Q+ D
Sbjct  461   YPYQYIQRHNNEERLVRLGSSATKEARKKRMARQRRFAPHHRNHNYHNNQQSQHQNQSVD  520

Query  1010  PHHAMRMGVDTVLPHQVSNLGNWVYWSPAA---SEAPPPMVVLppaeaapqpppaqqQNH  840
              H  +R+  D       +N GNWVYW   A   +  PP +    P       P  Q Q +
Sbjct  521   QH--VRLIKDNCAAAAQANSGNWVYWPAVACGMASNPPLLPGDVPVVHPVDRPSMQGQTY  578

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             Q+  +SDRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIA
Sbjct  579   QRHVASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIA  638

Query  659   MEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             MEDIGTSRVWNM+Y  RFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KC KYLI
Sbjct  639   MEDIGTSRVWNMRYRFRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCSKYLI  698

Query  485   RGVKVRQHGARSDGKKPAR  429
             RGVKVRQ G +S+ K+P +
Sbjct  699   RGVKVRQSGPKSETKRPGK  717



>ref|XP_003552154.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X1 [Glycine max]
Length=758

 Score =   384 bits (985),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 235/492 (48%), Positives = 297/492 (60%), Gaps = 46/492 (9%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++TIESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  254   MSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQLLKLILEWVQTSH  313

Query  1682  LQKKNSREEaaaaaaaASDHQ----STGGGGHFQAETFLQPTDTApscffpspwtppppp  1515
             LQ K  +E   ++ ++A   Q    S     + Q+ +F   ++   +   P         
Sbjct  314   LQNKRRKENNGSSISSALQAQFPDPSVQNNQNTQSGSFSPESNACFNNQTPWLSPQTFAT  373

Query  1514  pyiPDannaammaaAQPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSH  1347
                            Q P  V    FQ   +GY  +GDPY  G  ++    ++ + H  +
Sbjct  374   D--------------QAPLMVPPQQFQQPMVGY--VGDPYTSGAASN----NITTSHNHN  413

Query  1346  PTEYHQPAA-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG  1182
                 +QP A     +++A SW  S+F  A   + SF      +NN I    G        
Sbjct  414   SNNPYQPGAEQYHMLESAHSWPHSQFNVACHYSQSFG-----DNNGIFPHGGFG-GGYGN  467

Query  1181  SEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
             ++YPYQ + G G+ LMRLG SATKEARKKRMARQRR  SHH  H+ N  +  +   DPH 
Sbjct  468   NQYPYQFFHGPGDTLMRLGPSATKEARKKRMARQRRFLSHHRHHNGNYQNSGS---DPHA  524

Query  1001  AMRMGVDTVL----PHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQK  834
              +  G +       PH  +   NW+YW      A  P+       A  +     Q  HQ 
Sbjct  525   RLGGGDNCTTGLAAPHHANPTANWMYWQAMTGGAAGPLAPPAEPPAVDRSALQTQNCHQS  584

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
             + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI ME
Sbjct  585   RVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITME  644

Query  653   DIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             DIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRGVK
Sbjct  645   DIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRGVK  704

Query  473   VRQHGARSDGKK  438
             VRQ G + + KK
Sbjct  705   VRQQGVKPETKK  716



>gb|AAA87030.1| PvAlf [Phaseolus vulgaris]
Length=750

 Score =   382 bits (982),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 244/505 (48%), Positives = 298/505 (59%), Gaps = 62/505 (12%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E++ +F +W K NKD +SA D+RN+KLK++TIESA+KRLG  KE  KQLLKLILEWVQ  
Sbjct  256   EMSNVFLEWSKSNKDSVSANDLRNVKLKKATIESAAKRLGGGKEAMKQLLKLILEWVQTS  315

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQ K  +E                G    QA TF  P+         S    P      
Sbjct  316   HLQNKRRKE---------------NGSNALQA-TFQDPSAQTKENAHTSGSFAPESNSCF  359

Query  1505  PDan--------naammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFS  1350
              +                   P  P  QP A GY  +GDPY  G   +   + VN  H +
Sbjct  360   NNQTPWLNPQTFGTDQAPVMVPSQPYSQPVA-GY--VGDPYTSGSAPN--NITVNHNHNN  414

Query  1349  HP-----TEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALY  1185
             +P      +YH    +++A SW  S+F  A+  + S+        N +    G    A+ 
Sbjct  415   NPYQPGTDQYHM---LESAHSWPHSQFNVASHYSQSYG------ENGLFTHGGFGGYAI-  464

Query  1184  GSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH  1005
              + YPYQ + G G+RLMRLG SATKEARKKRMARQR+  SHH   + N+  +  Q  DPH
Sbjct  465   -TRYPYQFFHGPGDRLMRLGPSATKEARKKRMARQRKFLSHHRNQNGNHLQN--QGSDPH  521

Query  1004  HAMRMGVDT-----VLPHQV-SNLGNWVYW-----SPAASEAPP-PMVVLppaeaapqpp  861
                R+G D      V PHQ  S   NW+YW      PA   AP  P   L       +  
Sbjct  522   --ARLGNDNCTTGLVAPHQPNSAAANWMYWQAMTGGPAGPLAPVVPADPLAGQTVVDRTT  579

Query  860   paqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDS  681
                Q +HQ +++SDRRQG KPEKN++FL QKVLKQSDVG LGRIVLPKKEAET LPEL++
Sbjct  580   MHTQNSHQNRAASDRRQGWKPEKNVRFLGQKVLKQSDVGKLGRIVLPKKEAETHLPELEA  639

Query  680   RDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKC  501
             RDGISI MEDIGTSRVWNM+YR+WPNNKSRMY+LENTGDFVRANGLQEGDFIVIY+D+KC
Sbjct  640   RDGISITMEDIGTSRVWNMRYRYWPNNKSRMYMLENTGDFVRANGLQEGDFIVIYSDVKC  699

Query  500   GKYLIRGVKVRQHGARSDGKKPARK  426
             GKY+IRGVKVRQ G + +  KPA K
Sbjct  700   GKYMIRGVKVRQQGVKPE-TKPAGK  723



>gb|KEH22833.1| B3 domain transcription factor [Medicago truncatula]
Length=770

 Score =   381 bits (978),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 245/495 (49%), Positives = 305/495 (62%), Gaps = 45/495 (9%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E++ +F +WLK NKD +SA D+RN+KLK+STIESA++RLG  KEG KQLLKLILEWVQ  
Sbjct  274   EMSMVFLEWLKSNKDSVSANDLRNVKLKKSTIESAARRLGGGKEGMKQLLKLILEWVQTS  333

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              L  K  +E A       S+        HFQ     Q  +TA +    S           
Sbjct  334   HLHNKRLKENANTNTIIPSN--IVPQQHHFQDPC--QNQNTANTFAPESNACFNQTSWLD  389

Query  1505  PDannaammaaAQPPFPVFQPHA-IGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQ  1329
                          PP    QP   +G   + DPY  G  ++    ++N    +   EYH 
Sbjct  390   QTPLIV-------PPQQFSQPMVGVGVGFVADPYTNGSVSN----NINPYQPAVTNEYHM  438

Query  1328  PAAVDTAQSWQSSEFMaaaaaAPSFN-PYPDNNNNRIAAESGHQPQAL----YGSEY-PY  1167
                +++  SW +S+F      AP++N  + +NNNN +      QP  +    YG++Y  Y
Sbjct  439   ---LESNHSWGASQF----NVAPNYNQSFVENNNNVL------QPHGMNFGGYGNQYNSY  485

Query  1166  QLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMG  987
             QL+ G G+RLMRLG SATKEARKKRMARQRR  SHH  H+ N+H +  Q  DP   +  G
Sbjct  486   QLFPGPGDRLMRLGPSATKEARKKRMARQRRFMSHHRHHNINHHQN-IQGSDPLARLGSG  544

Query  986   ---VDTVLPHQVSNLGNWVYW-----SPAASEAPP-PMVVLppaeaapqpppaqqQNHQK  834
                 +       +N  NW+YW       AAS AP  P     P     +P    Q +HQ 
Sbjct  545   DSCTNVAAGGSHANPANWMYWQTMTGGTAASLAPVVPAEPTQPPVDRDRPTMQTQSSHQG  604

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
             +S+SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI ME
Sbjct  605   RSASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITME  664

Query  653   DIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             DIGTSRVWNM+YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIVIY+D+KCGK++IRGVK
Sbjct  665   DIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVIYSDVKCGKFMIRGVK  724

Query  473   VRQHGARSDGKKPAR  429
             VRQ G + + KK  +
Sbjct  725   VRQQGTKPEAKKAGK  739



>dbj|BAD42433.1| ABI-3 homolog [Psophocarpus tetragonolobus]
Length=751

 Score =   380 bits (975),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 242/500 (48%), Positives = 299/500 (60%), Gaps = 64/500 (13%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++TIESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  251   MSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQLLKLILEWVQTSH  310

Query  1682  LQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyiP  1503
             LQ K  +E         S   ST   G FQ  + +Q T T      P+       P   P
Sbjct  311   LQNKRRKEN--------SGSISTVLQGQFQDPS-VQNTHTGSFAPEPNSCFNNQTPWLSP  361

Query  1502  DannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPA  1323
                         P     QP  +GY  +GDPY  G  ++    ++ + H +H    +QP 
Sbjct  362   QPFGTDQNPLMVPSQQFPQP-MVGY--VGDPYTSGAASN----NITATH-NHNNNPYQPG  413

Query  1322  A-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG----SEYP  1170
             A     +++A SW  S+F  A+    SF             E+G  P   +G    ++YP
Sbjct  414   AEQYHMLESAHSWPHSQFNVASHYGQSF------------GENGLFPHGGFGGYGNNQYP  461

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAM--  996
             YQ + G G+RLMRLG SATKEARKKRMARQRR  SHH  H+ N+  +  Q  DPH  +  
Sbjct  462   YQFFHGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRNHNGNHQQN--QGNDPHATLGG  519

Query  995   RMGVDTVLPHQVSNLGNWVYW-----------SPAASEAPP---PMVVLppaeaapqppp  858
                 + V     ++  NW+YW            P     PP   P+V         +   
Sbjct  520   DNCTNVVAAPHANHAANWMYWQAMTAGVAGTLGPVVPAEPPAGQPVV--------DRSTI  571

Query  857   aqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSR  678
               Q  HQ + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++R
Sbjct  572   HTQNCHQSRVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEAR  631

Query  677   DGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCG  498
             DGISI MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCG
Sbjct  632   DGISITMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCG  691

Query  497   KYLIRGVKVRQHGARSDGKK  438
             KY+IRGVKVRQ G + + KK
Sbjct  692   KYMIRGVKVRQQGVKPETKK  711



>ref|XP_006602556.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X3 [Glycine max]
Length=733

 Score =   379 bits (972),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 235/494 (48%), Positives = 297/494 (60%), Gaps = 48/494 (10%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++TIESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  227   MSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQLLKLILEWVQTSH  286

Query  1682  LQKKNSREEaaaaaaaASDHQ----STGGGGHFQAETFLQPTDTApscffpspwtppppp  1515
             LQ K  +E   ++ ++A   Q    S     + Q+ +F   ++   +   P         
Sbjct  287   LQNKRRKENNGSSISSALQAQFPDPSVQNNQNTQSGSFSPESNACFNNQTPWLSPQTFAT  346

Query  1514  pyiPDannaammaaAQPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSH  1347
                            Q P  V    FQ   +GY  +GDPY  G  ++    ++ + H  +
Sbjct  347   D--------------QAPLMVPPQQFQQPMVGY--VGDPYTSGAASN----NITTSHNHN  386

Query  1346  PTEYHQPAA-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG  1182
                 +QP A     +++A SW  S+F  A   + SF      +NN I    G        
Sbjct  387   SNNPYQPGAEQYHMLESAHSWPHSQFNVACHYSQSFG-----DNNGIFPHGGFG-GGYGN  440

Query  1181  SEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
             ++YPYQ + G G+ LMRLG SATKEARKKRMARQRR  SHH  H+ N  +  +   DPH 
Sbjct  441   NQYPYQFFHGPGDTLMRLGPSATKEARKKRMARQRRFLSHHRHHNGNYQNSGS---DPHA  497

Query  1001  AMRMGVDTVL----PHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQK  834
              +  G +       PH  +   NW+YW      A  P+       A  +     Q  HQ 
Sbjct  498   RLGGGDNCTTGLAAPHHANPTANWMYWQAMTGGAAGPLAPPAEPPAVDRSALQTQNCHQS  557

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
             + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI ME
Sbjct  558   RVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITME  617

Query  653   DIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             DIGTSRVWNM+Y  R+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRG
Sbjct  618   DIGTSRVWNMRYSIRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRG  677

Query  479   VKVRQHGARSDGKK  438
             VKVRQ G + + KK
Sbjct  678   VKVRQQGVKPETKK  691



>ref|XP_006602555.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X2 [Glycine max]
Length=760

 Score =   379 bits (972),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 235/494 (48%), Positives = 297/494 (60%), Gaps = 48/494 (10%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++TIESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  254   MSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQLLKLILEWVQTSH  313

Query  1682  LQKKNSREEaaaaaaaASDHQ----STGGGGHFQAETFLQPTDTApscffpspwtppppp  1515
             LQ K  +E   ++ ++A   Q    S     + Q+ +F   ++   +   P         
Sbjct  314   LQNKRRKENNGSSISSALQAQFPDPSVQNNQNTQSGSFSPESNACFNNQTPWLSPQTFAT  373

Query  1514  pyiPDannaammaaAQPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSH  1347
                            Q P  V    FQ   +GY  +GDPY  G  ++    ++ + H  +
Sbjct  374   D--------------QAPLMVPPQQFQQPMVGY--VGDPYTSGAASN----NITTSHNHN  413

Query  1346  PTEYHQPAA-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG  1182
                 +QP A     +++A SW  S+F  A   + SF      +NN I    G        
Sbjct  414   SNNPYQPGAEQYHMLESAHSWPHSQFNVACHYSQSFG-----DNNGIFPHGGFG-GGYGN  467

Query  1181  SEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
             ++YPYQ + G G+ LMRLG SATKEARKKRMARQRR  SHH  H+ N  +  +   DPH 
Sbjct  468   NQYPYQFFHGPGDTLMRLGPSATKEARKKRMARQRRFLSHHRHHNGNYQNSGS---DPHA  524

Query  1001  AMRMGVDTVL----PHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQK  834
              +  G +       PH  +   NW+YW      A  P+       A  +     Q  HQ 
Sbjct  525   RLGGGDNCTTGLAAPHHANPTANWMYWQAMTGGAAGPLAPPAEPPAVDRSALQTQNCHQS  584

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
             + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI ME
Sbjct  585   RVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITME  644

Query  653   DIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             DIGTSRVWNM+Y  R+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRG
Sbjct  645   DIGTSRVWNMRYSIRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRG  704

Query  479   VKVRQHGARSDGKK  438
             VKVRQ G + + KK
Sbjct  705   VKVRQQGVKPETKK  718



>gb|AGM20671.1| ABI3 [Populus tomentosa]
Length=731

 Score =   376 bits (966),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 254/522 (49%), Positives = 320/522 (61%), Gaps = 55/522 (11%)
 Frame = -3

Query  1952  QFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAEDMRNIKLKR  1779
             Q++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D+R +KLK+
Sbjct  223   QYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADDLRRVKLKK  279

Query  1778  STIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGH  1599
             +T+E A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE ++        +Q      +
Sbjct  280   TTVECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRLRESSSNVNLPYPYNQDPLQSQN  339

Query  1598  FQAETFLQ----PTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPHAIG  1431
                 + L     P D +  CF  SPW   PPP    D              P F P  +G
Sbjct  340   PNPNSNLNCNPIPADHSNPCFTQSPWNVAPPPYLAADPATV---------MPGFSP-MVG  389

Query  1430  YSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFN  1251
             Y  +GDP++ G        ++N   +  P + ++   + + Q+W  S+F  A+     FN
Sbjct  390   Y--MGDPFSNGSS------NINGHPYGTPQDCNR--RLQSYQTWPPSQFPPASH----FN  435

Query  1250  PYPDNN----NNRIAAESGHQPQALYGSEYPYQLYDGNGE-RLMRLGSSATKEARKKRMA  1086
              + DNN      +I A +G      YG++YPYQ    NG+ RL RLGSSATKEARKKRMA
Sbjct  436   SFADNNLQSAQPQIPAFTG------YGNQYPYQYVPANGDNRLTRLGSSATKEARKKRMA  489

Query  1085  RQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLPHQVSNLGNWVYWSPAASEA  912
             RQRR  S+H   +++N  H  Q   DPH   R+  D    P   SN G+WVYW  AA   
Sbjct  490   RQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAPTGQSNPGSWVYWPTAAGGG  547

Query  911   PPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGR  732
                  V        +P    Q N+ +Q++++RRQG KPEKNL+FLLQKVLKQSDVGSLGR
Sbjct  548   SASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKNLRFLLQKVLKQSDVGSLGR  604

Query  731   IVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRA  552
             IVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR 
Sbjct  605   IVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRT  664

Query  551   NGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G KP  K
Sbjct  665   NGLQEGDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPENK  702



>ref|XP_002303088.2| ABA insensitive 3 family protein [Populus trichocarpa]
 gb|EEE82361.2| ABA insensitive 3 family protein [Populus trichocarpa]
Length=718

 Score =   374 bits (961),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 313/520 (60%), Gaps = 51/520 (10%)
 Frame = -3

Query  1952  QFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAEDMRNIKLKR  1779
             Q++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D+R +KLK+
Sbjct  210   QYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADDLRRVKLKK  266

Query  1778  STIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGH  1599
             +TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE ++        +Q       
Sbjct  267   TTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRESSSNVNLLYPYNQD------  320

Query  1598  FQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPHAI--GYS  1425
                     P          +    P P  +       +    A PP+    P  +  G+S
Sbjct  321   --------PLQNQNPNPNSNLNCNPIPADHSNPCFTQSPWNVAPPPYLAADPATVMPGFS  372

Query  1424  N----IGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS  1257
                  +GDP++ G        ++N   +  P + +    + + Q+W  S+F +A+     
Sbjct  373   PMVGFMGDPFSNGSS------NINGHPYGTPQDCNH--MLQSYQTWPPSQFHSASH----  420

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-RLMRLGSSATKEARKKRMARQ  1080
             FN + DNN    +A+  +     YG++YPYQ    NG+ RL RLGSSATKEARKKRMARQ
Sbjct  421   FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDNRLTRLGSSATKEARKKRMARQ  478

Query  1079  RRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLPHQVSNLGNWVYWSPAASEAPP  906
             RR  S+H   +++N  H  Q   DPH   R+  D    P   SN G+WVYW  AA     
Sbjct  479   RRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAPTGQSNPGSWVYWPTAAGGGSA  536

Query  905   PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                V        +P    Q N+ +Q++++RRQG KPEKNL+FLLQKVLKQSDVGSLGRIV
Sbjct  537   STTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKNLRFLLQKVLKQSDVGSLGRIV  593

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NG
Sbjct  594   LPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNG  653

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             LQEGDFIVIY+D+KCGKYLIRGVKVRQ      G KP  K
Sbjct  654   LQEGDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPENK  689



>gb|KHN24997.1| B3 domain-containing transcription factor ABI3 [Glycine soja]
Length=726

 Score =   374 bits (961),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 227/488 (47%), Positives = 285/488 (58%), Gaps = 60/488 (12%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++T+ESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  250   MSNVFLEWLKSNKDSVSANDLRNVKLKKATLESAARRLGGGKEAMKQLLKLILEWVQTSH  309

Query  1682  LQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyiP  1503
             LQ K  +E   ++ ++    Q     G    +   Q T +       +       P    
Sbjct  310   LQNKRRKENNGSSISSVLQAQFQDPSG----QNNNQNTQSGSFAPESNTCFNNQTPWLSS  365

Query  1502  DannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPA  1323
                         PP    QP  +GY  +GDPY  G  ++    ++++ H  + +  +QP 
Sbjct  366   QTFATDQAPLMVPPQQFPQP-MVGY--VGDPYTSGAASN----NISATHNHNNSNPYQPG  418

Query  1322  A-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLY  1158
             A     +++A SW  S F  A+  + SF      +NN +    G        ++YPYQ +
Sbjct  419   AEQYHMLESAHSWPHSLFNVASNYSQSFG-----DNNGLNPHGGFGGGGYGNNQYPYQFF  473

Query  1157  DGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDT  978
              G G+RLMRLG SATKEARKKRMARQRR  SHH  H  N+ +   Q  DPH   RMG D 
Sbjct  474   HGPGDRLMRLGPSATKEARKKRMARQRRFLSHHRHHSGNHQN---QGSDPH--ARMGGDN  528

Query  977   V-----LPHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRR  813
                    PH  +   NW+YW      A                             +D  
Sbjct  529   CNTALAAPHHANPSANWMYWQAMIGGA-----------------------------ADTE  559

Query  812   QGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRV  633
              G KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI MEDIGTSRV
Sbjct  560   LGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITMEDIGTSRV  619

Query  632   WNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGAR  453
             WNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRGVKVRQ G +
Sbjct  620   WNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRGVKVRQQGVK  679

Query  452   SDGKKPAR  429
              + KK  +
Sbjct  680   PETKKAGK  687



>emb|CAA05922.1| ABI3 [Populus trichocarpa]
Length=734

 Score =   374 bits (961),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 245/520 (47%), Positives = 313/520 (60%), Gaps = 51/520 (10%)
 Frame = -3

Query  1952  QFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAEDMRNIKLKR  1779
             Q++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D+R +KLK+
Sbjct  226   QYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADDLRRVKLKK  282

Query  1778  STIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGH  1599
             +TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE ++        +Q       
Sbjct  283   TTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRESSSNVNLLYPYNQD------  336

Query  1598  FQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPHAI--GYS  1425
                     P          +    P P  +       +    A PP+    P  +  G+S
Sbjct  337   --------PLQNQNPNPNSNLNCNPIPADHSNPCFTQSPWNVAPPPYLAADPATVMPGFS  388

Query  1424  N----IGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS  1257
                  +GDP++ G        ++N   +  P + +    + + Q+W  S+F +A+     
Sbjct  389   PMVGFMGDPFSNGSS------NINGHPYGTPQDCNH--MLQSYQTWPPSQFHSASH----  436

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-RLMRLGSSATKEARKKRMARQ  1080
             FN + D  NN  +A+  +     YG++YPYQ    NG+ RL RLGSSATKEARKKRMARQ
Sbjct  437   FNSFAD--NNLQSAQPQNPAFTGYGNQYPYQYVPANGDNRLTRLGSSATKEARKKRMARQ  494

Query  1079  RRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLPHQVSNLGNWVYWSPAASEAPP  906
             RR  S+H   +++N  H  Q   DPH   R+  D    P   SN G+WVYW  AA     
Sbjct  495   RRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAPTGQSNPGSWVYWPTAAGGGSA  552

Query  905   PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                V        +P    Q N+ +Q++++RRQG KPEKNL+FLLQKVLKQSDVGSLGRIV
Sbjct  553   STTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKNLRFLLQKVLKQSDVGSLGRIV  609

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NG
Sbjct  610   LPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNG  669

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             LQEGDFIVIY+D+KCGKYLIRGVKVRQ      G KP  K
Sbjct  670   LQEGDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPENK  705



>emb|CAA05921.1| ABI3 [Populus trichocarpa]
Length=735

 Score =   373 bits (957),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 246/528 (47%), Positives = 314/528 (59%), Gaps = 51/528 (10%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  219   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  275

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDH  1623
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE ++        +
Sbjct  276   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRESSSNVNLLYPYN  335

Query  1622  QSTGGGGHFQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQP  1443
             Q               P          +    P P  +       +    A PP+    P
Sbjct  336   QD--------------PLQNQNPNPNSNLNCNPIPADHSNPCFTQSPWNVAPPPYLAADP  381

Query  1442  HAI--GYSN----IGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFM  1281
               +  G+S     +GDP++ G        ++N   +  P + +    + + Q+W  S+F 
Sbjct  382   ATVMPGFSPMVGFMGDPFSNGSS------NINGHPYGTPQDCNH--MLQSYQTWPPSQFH  433

Query  1280  aaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-RLMRLGSSATKEA  1104
             +A+     FN + D  NN  +A+  +     YG++YPYQ    NG+ RL RLGSSATKEA
Sbjct  434   SASH----FNSFAD--NNLQSAQPQNPAFTGYGNQYPYQYVPANGDNRLTRLGSSATKEA  487

Query  1103  RKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLPHQVSNLGNWVYWS  930
             RKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P   SN G+WVYW 
Sbjct  488   RKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAPTGQSNPGSWVYWP  545

Query  929   PAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSD  750
              AA        V        +P    Q N+ +Q++++RRQG KPEKNL+FLLQKVLKQSD
Sbjct  546   TAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKNLRFLLQKVLKQSD  602

Query  749   VGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENT  570
             VGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENT
Sbjct  603   VGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENT  662

Query  569   GDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             GDFVR NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G KP  K
Sbjct  663   GDFVRTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPENK  706



>gb|AEK26581.1| ABA insensitive 3 [Populus tremula]
Length=648

 Score =   367 bits (941),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 229/478 (48%), Positives = 292/478 (61%), Gaps = 46/478 (10%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F DWLK NK+ +SA+D+R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ  
Sbjct  205   DLAMVFLDWLKNNKETVSADDLRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTN  264

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQ++  RE ++        +Q               P          +    P P  + 
Sbjct  265   HLQRRRLRESSSNVNLPYPYNQD--------------PLQNQNPNPNSNLNCNPIPADHS  310

Query  1505  PDannaammaaAQPPFPVFQPHAI--GYS----NIGDPYNCGGGASFTPMHVNSGHFSHP  1344
                 N +    A PP+    P  +  G+S     +GDP++ G        ++N   +  P
Sbjct  311   NPCFNQSPWNVAPPPYLAADPATVMPGFSPMVGYMGDPFSNGSS------NINGHPYGTP  364

Query  1343  TEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNN----NNRIAAESGHQPQALYGSE  1176
              + ++   + + Q+W  S+F +A+     FN + DNN      +I A +G      YG++
Sbjct  365   QDCNR--RLQSYQTWPPSQFHSAS----HFNSFADNNLQSAQPQIPAFTG------YGNQ  412

Query  1175  YPYQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHA  999
             YPYQ    NG+ RL RLGSSATKEARKKRMARQRR  S+H   +++N  +  Q     H 
Sbjct  413   YPYQYVPANGDNRLTRLGSSATKEARKKRMARQRRFLSYHRNQNHHNIQNQNQGAGGPHE  472

Query  998   MRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSD  819
                      P   SN G+WVYW  AA E      V        +P    Q N+ +Q++++
Sbjct  473   RLADDPNGGPTGQSNPGSWVYWPTAAGEGSASTTV---DAPVDRPAMQTQTNNHRQAAAE  529

Query  818   RRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTS  639
             RRQG  PEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTS
Sbjct  530   RRQGWNPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTS  589

Query  638   RVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             RVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KCGKYLIR VKVRQ
Sbjct  590   RVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCGKYLIRRVKVRQ  647



>gb|EPS64119.1| hypothetical protein M569_10660, partial [Genlisea aurea]
Length=414

 Score =   355 bits (910),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 232/504 (46%), Positives = 277/504 (55%), Gaps = 108/504 (21%)
 Frame = -3

Query  1889  LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKL  1710
              SFLQGNGELAAIF +WLKQN+D ISAEDMR+IKLKRSTIESASKRLGS  EGKKQLLKL
Sbjct  2     FSFLQGNGELAAIFLEWLKQNRDSISAEDMRSIKLKRSTIESASKRLGSDTEGKKQLLKL  61

Query  1709  ILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwt  1530
             ILEWV+Q+QLQKK  RE               GG  H     + Q               
Sbjct  62    ILEWVEQHQLQKKRMRE--------------LGGASHHLQCPYQQ---------------  92

Query  1529  ppppppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFT---PMHVNSG  1359
                      +  N    AA  PP PV  P+   + +   P   GGG  +    PM     
Sbjct  93    ---------ENPNFQPYAAPLPP-PVVSPYHHHHHHHQWPPMSGGGCCYVDQIPMLPLGT  142

Query  1358  HFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGS  1179
              F     +HQ        SW +  +     +    + +   +N + +A         Y  
Sbjct  143   EFQTMQPHHQ--------SWPAPPYAMGGCSTGFGHAHKCCSNQQGSA---------YVG  185

Query  1178  EYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHA  999
              +PY  +D +  +    G SATKEARKKRMARQR+                 Q Y+  H+
Sbjct  186   NHPYGGFDAS--KSSNGGCSATKEARKKRMARQRK-----------------QLYNHRHS  226

Query  998   MRMGVDTVLPHQVS----------NLGNWVYWSPAASEAP--PPMVVLppaeaapqpppa  855
                  + ++    S            G+W+YWS  A+  P  PP                
Sbjct  227   AAAATNNIISGNDSVSSSVRDHDDGDGSWMYWSSPANPLPVDPP----------------  270

Query  854   qqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRD  675
                 H ++       G K EKNLKFLLQKVLKQSDVG+LGRIVLPKKEAE+ LPEL+SRD
Sbjct  271   --HKHSEEEIDAAVAGWKSEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAESHLPELESRD  328

Query  674   GISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  495
             GISIAMEDIGTSR+WNM+YRFWPNNKSRMYLLENTG+FVR NGLQEGDFIVIY+D K GK
Sbjct  329   GISIAMEDIGTSRIWNMRYRFWPNNKSRMYLLENTGEFVRVNGLQEGDFIVIYSDAKSGK  388

Query  494   YLIRGVKVRQHGARSDGKKPARKN  423
             Y+IRGVKVRQ G + + KKP RKN
Sbjct  389   YMIRGVKVRQPGNKPEIKKPPRKN  412



>gb|KHN07827.1| B3 domain-containing transcription factor ABI3 [Glycine soja]
Length=752

 Score =   362 bits (930),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 226/495 (46%), Positives = 289/495 (58%), Gaps = 57/495 (12%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++TIESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  254   MSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQLLKLILEWVQTSH  313

Query  1682  LQKKNSREEaaaaaaaASDHQ----STGGGGHFQAETFLQPTDTApscffpspwtppppp  1515
             LQ K  +E   ++ ++A   Q    S     + Q+ +F   ++   +   P         
Sbjct  314   LQNKRRKENNGSSISSALQAQFPDPSVQNNQNTQSGSFSPESNACFNNQTPWLSPQTFAT  373

Query  1514  pyiPDannaammaaAQPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSH  1347
                            Q P  V    FQ   +GY  +GDPY  G  ++    ++ + H  +
Sbjct  374   D--------------QAPLMVPPQQFQQPMVGY--VGDPYTSGAASN----NITTSHNHN  413

Query  1346  PTEYHQPAA-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG  1182
                 +QP A     +++A SW  S+F  A   + SF      +NN I    G        
Sbjct  414   SNNPYQPGAEQYHMLESAHSWPHSQFNVACHYSQSFG-----DNNGIFPHGGFG-GGYGN  467

Query  1181  SEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
             ++YPYQ + G G+ LMRLG SATKEARKKRMARQRR  SHH  H+ N+ +  +   DPH 
Sbjct  468   NQYPYQFFHGPGDTLMRLGPSATKEARKKRMARQRRFLSHHRHHNGNHQNSGS---DPHA  524

Query  1001  AMRMGVDTVL----PHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQK  834
              +  G +       PH  +   NW+YW      A  P+                      
Sbjct  525   RLGGGDNCTTGLAAPHHANPTANWMYWQAMTGGAAGPL-----------GGRCGGSFGSP  573

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
               ++    G KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI ME
Sbjct  574   GRAASCGPGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITME  633

Query  653   DIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             DIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRGVK
Sbjct  634   DIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRGVK  693

Query  473   VRQHGARSDGKKPAR  429
             VRQ G + + KK  +
Sbjct  694   VRQQGVKPETKKVGK  708



>gb|KHG04618.1| B3 domain-containing transcription factor ABI3 -like protein 
[Gossypium arboreum]
Length=763

 Score =   361 bits (926),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 243/523 (46%), Positives = 305/523 (58%), Gaps = 44/523 (8%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A++RLG    GK+ + +L+   ++  
Sbjct  266   DLAMVFLEWLKTNKETVSAEDLRRVKIKKATIECAARRLGG---GKEAMKQLLKLILEWV  322

Query  1685  QLQKKNSREEaaaaaaaASDH-----QSTGGGGHFQAETFLQPTDTApscffpspwtppp  1521
             Q      R    +A+    DH                     P   +      S     P
Sbjct  323   QTNHLQRRRIKESASNNQPDHPYQYSNPNNLNSSSNPNLNCNPILPSEPNSCFSQPAWVP  382

Query  1520  pppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
              P Y  D   A       PP P F P  +GY  +GDP+  G     T  H     +  PT
Sbjct  383   QPAYTTDPEAAP------PPLPGFTP-VVGY--MGDPFANGAPNVTTHHHP----YQPPT  429

Query  1340  EYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEYPY  1167
             +Y     +DTAQ+W  S+F  AA+   SF      +NN   A    QP A   Y ++YPY
Sbjct  430   DYQ---VLDTAQTWPPSQFALAASQYNSFA-----DNNLHPAPLQQQPSAFPGYVNQYPY  481

Query  1166  QLYDG---NGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQN----YDP  1008
                 G   N +RL+RLGSSATKEARKKRMARQRR +SHH  H +++++  +Q      D 
Sbjct  482   HYVPGHNNNDQRLLRLGSSATKEARKKRMARQRRFASHHRNHGHHHNNQQSQLQNQSIDQ  541

Query  1007  HHAMRMGVDTVLPHQVSNLGNWVYWSPAA----SEAPPPMVVLppaeaapqpppaqqQNH  840
             H  +  G + V   Q +N GNWVYW   A    S  PP +            P  Q Q +
Sbjct  542   HERLVKG-NCVAAAQ-ANPGNWVYWPSVAGALASNPPPVLPGDVTMVHPVDQPTMQGQTY  599

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             Q+Q ++DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIA
Sbjct  600   QRQVATDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIA  659

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KCGKYLIRG
Sbjct  660   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCGKYLIRG  719

Query  479   VKVRQHGARSDGKKPARKNprtlppsspatatspAISLIKQTV  351
             VKVRQ G +S+ K+P +        S  A       + I QTV
Sbjct  720   VKVRQSGTKSETKRPGKSQKNHHTNSPSAAVNGSLPTPITQTV  762



>ref|XP_004515628.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Cicer arietinum]
Length=794

 Score =   361 bits (927),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 245/499 (49%), Positives = 300/499 (60%), Gaps = 43/499 (9%)
 Frame = -3

Query  1871  NGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQ  1692
             N E++ +F +WLK NKD +SA D+RN+KLK+STIESA++RLG  KEG KQLLKLILEWVQ
Sbjct  285   NDEMSMVFLEWLKSNKDSVSANDLRNVKLKKSTIESAARRLGGGKEGMKQLLKLILEWVQ  344

Query  1691  QYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtpppppp  1512
                LQ K  ++      +     Q        Q +    P  T                 
Sbjct  345   TSHLQNKRHKQNNTTMLSNVLVPQQQQFQDPCQNQNTFAPEST-------------NTCF  391

Query  1511  yiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGAS--FTPMHVNSGHFSHPTE  1338
                            PP    QP  +GY    DPY  G  ++  +   HV +  F H   
Sbjct  392   NQTQWLIDQTPLIVNPPQFSSQP-MVGYVG-SDPYTNGSVSNNPYNQQHV-TNEFQH---  445

Query  1337  YHQPAAVDTAQSWQSSEFMaaaaa--APSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQ  1164
                   +++  SW  S+F  AAA+    SF     NNNN    + G      YG++YPYQ
Sbjct  446   -----MLESNNSWGGSQFTIAAASHYNQSFGENNSNNNNNNMLQHGVSFGG-YGNQYPYQ  499

Query  1163  LYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAM-RMG  987
              + G G+RLMRLG SATKEARKKRMARQRR  SHH  H+NNN+ H   N+     + R+G
Sbjct  500   FFHGPGDRLMRLGPSATKEARKKRMARQRRFMSHHRNHNNNNNQHLLNNHQGSDPLGRLG  559

Query  986   VD--TVLPHQVSNLGN---WVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQ---  831
              D  T L     + GN   W+YW   A+     +  + PAE  P   P ++   Q Q   
Sbjct  560   GDNCTNLVAAAGSHGNPPNWMYWQTMAAGGGASLAPVVPAEPPPPQVPVERSTMQAQNCH  619

Query  830   ----SSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
                 +SSDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI
Sbjct  620   QGRNASSDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISI  679

Query  662   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
              MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIVIY+D+KCGK++IR
Sbjct  680   TMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVIYSDVKCGKFMIR  739

Query  482   GVKVR-QHGARSDGKKPAR  429
             GVKVR Q GA+ + KK  +
Sbjct  740   GVKVRQQQGAKPEAKKAGK  758



>ref|XP_007049858.1| ABI3, putative isoform 5 [Theobroma cacao]
 gb|EOX94015.1| ABI3, putative isoform 5 [Theobroma cacao]
Length=727

 Score =   358 bits (918),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 236/497 (47%), Positives = 300/497 (60%), Gaps = 63/497 (13%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A++RLG  KE  KQLLKLILEWVQ  
Sbjct  251   DLAMVFLEWLKTNKETVSAEDLRRVKIKKATIECAARRLGGGKEAMKQLLKLILEWVQTN  310

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+  +E A+                 +Q +   Q  +  P+       +    PP  
Sbjct  311   HLQKRRIKESASNNNIDIP----------YQYQDNFQNPNPNPNPNSNPNLSCDSGPPPE  360

Query  1505  PDannaammaaAQPPF---PV-----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFS  1350
             P++  +      QP +   PV     F P  +GY  +GDP+  G        ++NS  + 
Sbjct  361   PNSCFSQPPWIPQPTYVTDPVAVVAGFAP-TVGY--MGDPFLNGAP------NINSHPYQ  411

Query  1349  HPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSE  1176
              PT+Y     +D+AQ+W  S+F  A+     +N +PDNN       + HQP A   YG++
Sbjct  412   PPTDY---PMLDSAQTWPPSQFALAS----QYNSFPDNN----LHPAPHQPSAFPGYGNQ  460

Query  1175  YPYQLYD--GNGERLMRLGSSATKEARKKRMARQRRLS---ShhfrhhnnnhhhHAQNYD  1011
             YPYQ      N ERL+RLGSSATKEARKKRMARQRR +    +H  H+N    H  Q+ D
Sbjct  461   YPYQYIQRHNNEERLVRLGSSATKEARKKRMARQRRFAPHHRNHNYHNNQQSQHQNQSVD  520

Query  1010  PHHAMRMGVDTVLPHQVSNLGNWVYWSPAA---SEAPPPMVVLppaeaapqpppaqqQNH  840
              H  +R+  D       +N GNWVYW   A   +  PP +    P       P  Q Q +
Sbjct  521   QH--VRLIKDNCAAAAQANSGNWVYWPAVACGMASNPPLLPGDVPVVHPVDRPSMQGQTY  578

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             Q+  +SDRRQ             KVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIA
Sbjct  579   QRHVASDRRQ-------------KVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIA  625

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KC KYLIRG
Sbjct  626   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCSKYLIRG  685

Query  479   VKVRQHGARSDGKKPAR  429
             VKVRQ G +S+ K+P +
Sbjct  686   VKVRQSGPKSETKRPGK  702



>ref|XP_007049856.1| ABI3, putative isoform 3 [Theobroma cacao]
 gb|EOX94013.1| ABI3, putative isoform 3 [Theobroma cacao]
Length=733

 Score =   357 bits (917),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 236/497 (47%), Positives = 300/497 (60%), Gaps = 63/497 (13%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F +WLK NK+ +SAED+R +K+K++TIE A++RLG  KE  KQLLKLILEWVQ  
Sbjct  257   DLAMVFLEWLKTNKETVSAEDLRRVKIKKATIECAARRLGGGKEAMKQLLKLILEWVQTN  316

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+  +E A+                 +Q +   Q  +  P+       +    PP  
Sbjct  317   HLQKRRIKESASNNNIDIP----------YQYQDNFQNPNPNPNPNSNPNLSCDSGPPPE  366

Query  1505  PDannaammaaAQPPF---PV-----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFS  1350
             P++  +      QP +   PV     F P  +GY  +GDP+  G        ++NS  + 
Sbjct  367   PNSCFSQPPWIPQPTYVTDPVAVVAGFAP-TVGY--MGDPFLNGAP------NINSHPYQ  417

Query  1349  HPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSE  1176
              PT+Y     +D+AQ+W  S+F  A+     +N +PDNN       + HQP A   YG++
Sbjct  418   PPTDY---PMLDSAQTWPPSQFALAS----QYNSFPDNN----LHPAPHQPSAFPGYGNQ  466

Query  1175  YPYQLYD--GNGERLMRLGSSATKEARKKRMARQRRLS---ShhfrhhnnnhhhHAQNYD  1011
             YPYQ      N ERL+RLGSSATKEARKKRMARQRR +    +H  H+N    H  Q+ D
Sbjct  467   YPYQYIQRHNNEERLVRLGSSATKEARKKRMARQRRFAPHHRNHNYHNNQQSQHQNQSVD  526

Query  1010  PHHAMRMGVDTVLPHQVSNLGNWVYWSPAA---SEAPPPMVVLppaeaapqpppaqqQNH  840
              H  +R+  D       +N GNWVYW   A   +  PP +    P       P  Q Q +
Sbjct  527   QH--VRLIKDNCAAAAQANSGNWVYWPAVACGMASNPPLLPGDVPVVHPVDRPSMQGQTY  584

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             Q+  +SDRRQ             KVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIA
Sbjct  585   QRHVASDRRQ-------------KVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIA  631

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KC KYLIRG
Sbjct  632   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCSKYLIRG  691

Query  479   VKVRQHGARSDGKKPAR  429
             VKVRQ G +S+ K+P +
Sbjct  692   VKVRQSGPKSETKRPGK  708



>dbj|BAA28779.1| transcription factor Vp1 [Mesembryanthemum crystallinum]
Length=790

 Score =   348 bits (893),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 235/501 (47%), Positives = 294/501 (59%), Gaps = 37/501 (7%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             L  + +LA +FF+WLK NK+ ISAED+RNIK+K+STIE+A+KRLG  KEG KQLLKLIL+
Sbjct  270   LVSSDDLAMVFFEWLKTNKEAISAEDLRNIKIKKSTIEAAAKRLGGGKEGMKQLLKLILQ  329

Query  1700  WVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppp  1521
             WVQ + L   N RE +  +        +     H  +       + +          P P
Sbjct  330   WVQNHHLH--NKRESSTVSNNTCGAPVALVDQDHTNSTNNNNDNNNSIIADPNPNPNPNP  387

Query  1520  pppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
              PP +    +        PP   + P       +GDP            ++ S  +S   
Sbjct  388   TPPPLEQQASTTSSCFTTPPPATWLPAPQPQPFVGDPAAMVPAPPPMVGYMGSDPYSAGM  447

Query  1340  EYHQPA----AVDTA-QSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSE  1176
               + PA     +DTA  SW  +  M      P +  +PD ++   AA+ G  P    G  
Sbjct  448   AAYPPADYHQMMDTAPHSWAQTPSM-QFGMGPQYGSFPDPSH---AAQFGGYPAPYPGFY  503

Query  1175  YPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQN-------  1017
             Y    + G GE LMRLGSSATKEARKKRMARQRR  +HH R+HN++ + +  N       
Sbjct  504   Y----HPGPGEGLMRLGSSATKEARKKRMARQRRFFTHHHRNHNHHQNQNQNNQMNNNLM  559

Query  1016  YDPHHAMRMGVDTVLPHQVSNLGNWVYWS------PAASE---APPPMVVLppaeaapqp  864
              + H  +  G   V PH  S  GNWVYWS      P  S     PPPMV         + 
Sbjct  560   VEQHGGVGNGNCGVAPHP-SPAGNWVYWSHPPPLPPQVSHPVGGPPPMV---GQMQGLER  615

Query  863   ppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELD  684
                     Q+Q   +++QG K EKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL+
Sbjct  616   AAPSGNGFQRQGGVEKKQGWKSEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELE  675

Query  683   SRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMK  504
             +RDGI IAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+NGLQEGDFIVIY+D+K
Sbjct  676   ARDGIPIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNGLQEGDFIVIYSDVK  735

Query  503   CGKYLIRGVKVR--QHGARSD  447
             CGKY+IRGVKVR  Q GA+++
Sbjct  736   CGKYMIRGVKVRPQQQGAKAE  756



>dbj|BAA82596.1| C-ABI3 protein [Daucus carota]
Length=663

 Score =   343 bits (879),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 234/499 (47%), Positives = 287/499 (58%), Gaps = 62/499 (12%)
 Frame = -3

Query  1874  GNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWV  1695
             G  EL  +FF+WLK NK+ ISAEDM+NI+ K+STIE A KR+GSSKEGKKQLLKLILEWV
Sbjct  154   GLDELGVMFFEWLKTNKEHISAEDMKNIRFKKSTIECAYKRMGSSKEGKKQLLKLILEWV  213

Query  1694  QQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppp  1515
             +QYQLQKK SRE A AAA AA+ HQ          E    P   +    F          
Sbjct  214   EQYQLQKKRSREAAEAAAEAATSHQVPC----LYQEPNPNPNPNSNFVNFMPTPGANACM  269

Query  1514  pyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEY  1335
                   +++    A  P  P   P A+ Y     PY   GGA+  P++        P   
Sbjct  270   WIPTPQSSSIDPLAVVPSGPA--PPAVAYYQ---PYPFVGGANVGPVNCQPYPPQMPQPE  324

Query  1334  HQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYD  1155
             +Q   +++ Q W  S+F+ A    P +N  PD N N +   + H    +YG +YP Q+Y+
Sbjct  325   YQ--MLESPQLWPRSQFVLA----PQYNSLPDQNGNFVPI-APHPVAPVYGGQYPSQVYN  377

Query  1154  G-NGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDT  978
             G N +R++RL  SATKEAR+KRMAR+R  S                   PH       D+
Sbjct  378   GSNSDRVVRLAPSATKEARQKRMARKRWGS--------------FHRNQPHQNQIQKTDS  423

Query  977   VLPHQVS--NLG---------------NWVYWSPAASE---APPPMVVLppaeaa-----  873
               P Q+S   LG               NW+YW PA      A PPM              
Sbjct  424   --PEQISEKKLGAENFTNSINGQSSPVNWLYW-PAVGPPKLAQPPMAAQSQQPDQYQQGY  480

Query  872   -pqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQL  696
                 P   Q N +      ++QG K EKNLKFLLQKVLKQSDVG LGRIVLPK+EAETQL
Sbjct  481   PTFLPVKAQSNRRPAQQQQKKQGFKGEKNLKFLLQKVLKQSDVGCLGRIVLPKREAETQL  540

Query  695   PELDSRDGISIAMEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRANGLQEGDFIV  522
             P+L+ RDGI I MEDIGTS+VWN++Y  R+WPNNKSRMY+LENTG+FV+ NGLQEGDFIV
Sbjct  541   PQLEDRDGIQIVMEDIGTSKVWNLRYSLRYWPNNKSRMYVLENTGEFVKENGLQEGDFIV  600

Query  521   IYADMKCGKYLIRGVKVRQ  465
             IY+D+KCGKYLIRGVKVRQ
Sbjct  601   IYSDIKCGKYLIRGVKVRQ  619



>ref|XP_011080160.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Sesamum indicum]
Length=741

 Score =   337 bits (865),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 207/341 (61%), Positives = 237/341 (70%), Gaps = 27/341 (8%)
 Frame = -3

Query  1418  GDPYNCGGGASFTPMH---VNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNP  1248
             GDPY+        PM+   VN   + H  EY     ++ AQSW  S F         F+ 
Sbjct  398   GDPYS--NPIPVAPMNHQVVNGIPYPHAAEY---PVMEHAQSWVISPFPMQQPHQ--FSH  450

Query  1247  YPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +PDN N        HQ QALYG  +PYQ++D NGERLMRLGSSATKEARKKRMARQRRL 
Sbjct  451   FPDNGNMIT-----HQ-QALYG--HPYQIFDPNGERLMRLGSSATKEARKKRMARQRRLY  502

Query  1067  ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA-ASEAPPPMV--  897
             SHH RH +N++ H  Q  D H       D     Q  + GNWVYWSP+ A  +P P    
Sbjct  503   SHHHRHSSNSNQHQNQMNDAHVVGEASEDG---DQAGSPGNWVYWSPSGAGSSPTPGSGP  559

Query  896   -VLppaeaapqpppaqqQNHQKQSSSDRRQ--GSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                     +    P QQQN+Q+QSSSDRRQ  G K EKNLKFLLQKVLKQSD+G+LGRIV
Sbjct  560   PADASQAHSGDRAPVQQQNYQRQSSSDRRQQQGWKTEKNLKFLLQKVLKQSDIGNLGRIV  619

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAE+ LPEL+SRDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NG
Sbjct  620   LPKKEAESHLPELESRDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRVNG  679

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             LQEGDFI+IY+D KCGKY+IRGVKVRQ G + +GKKPAR+N
Sbjct  680   LQEGDFIIIYSDTKCGKYMIRGVKVRQPGGKLEGKKPARRN  720


 Score =   137 bits (345),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  1901  ETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQ  1722
             E    SFLQGN ELA IFF+WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKKQ
Sbjct  240   ENDGFSFLQGNSELAMIFFEWLKQNKDYISAEDMRSIKLKRSTIESASKRLGSTKEGKKQ  299

Query  1721  LLKLILEWVQQYQLQKKNSRE  1659
             LLKLILEWV+QYQLQKK  RE
Sbjct  300   LLKLILEWVEQYQLQKKRMRE  320



>ref|XP_006352829.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Solanum tuberosum]
Length=620

 Score =   332 bits (852),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 203/352 (58%), Positives = 242/352 (69%), Gaps = 27/352 (8%)
 Frame = -3

Query  1457  PVFQPHAIGYSNIGDPYNCGGGASFTPMH--VNSGHFSHPTEY-HQPAAVDTAQSWQSSE  1287
             PV      GY  IGDPY+ GG   F P +    SG  + PT   +QP  +DT+QSW  S+
Sbjct  269   PVMTGPIQGY--IGDPYSNGG--LFPPPYSQTMSGGATSPTSAEYQP--MDTSQSWSPSQ  322

Query  1286  FMaaaaaAPSFNPYPDNNN-NRIAAESGHQPQALYGSEY-PYQLYDGNGERLMRLGSSAT  1113
             F  A A+   +NP+P+N++ N +A       Q+L+G++Y PYQL+DGNGE L RLGS AT
Sbjct  323   FTMATAS--QYNPFPENDSTNNVAMPD----QSLFGAQYDPYQLFDGNGEILPRLGSCAT  376

Query  1112  KEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYW  933
             KEARK RMARQRRL  HH+RH                   +  + V+  Q +N GNWV W
Sbjct  377   KEARKNRMARQRRLRPHHYRHQTRIPRQITNEQSVMMGGEINNNYVM-TQANNPGNWVCW  435

Query  932   SPAASEAPPPMVVLppaeaapqpppaqqQNHQKQ--SSSDRRQGSKPEKNLKFLLQKVLK  759
                    P P + +      P+ P  Q QN QKQ  +S+D++Q  K EKNLKFLLQKVLK
Sbjct  436   -------PSPPMAMVSQSLPPERPAMQSQNQQKQVSASADKKQAFKSEKNLKFLLQKVLK  488

Query  758   QSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLL  579
             QSDV +LGRIVLPKKEAE  LP L++RDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLL
Sbjct  489   QSDVNNLGRIVLPKKEAERHLPHLETRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLL  548

Query  578   ENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             ENTGDFV+ANGLQEGDFIVIYADMKCGKYLIRGVKVRQ+G +S+GKK  +KN
Sbjct  549   ENTGDFVKANGLQEGDFIVIYADMKCGKYLIRGVKVRQNGPKSEGKKQTKKN  600


 Score =   127 bits (319),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 71/77 (92%), Gaps = 0/77 (0%)
 Frame = -3

Query  1889  LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKL  1710
             LSF QG+ ELA +FF+WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKKQLL+L
Sbjct  153   LSFFQGDSELALMFFEWLKQNKDYISAEDMRSIKLKRSTIESASKRLGSTKEGKKQLLRL  212

Query  1709  ILEWVQQYQLQKKNSRE  1659
             IL+WV+Q++LQKK  RE
Sbjct  213   ILDWVEQHRLQKKQMRE  229



>ref|XP_004242390.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Solanum 
lycopersicum]
Length=620

 Score =   329 bits (844),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 244/353 (69%), Gaps = 30/353 (8%)
 Frame = -3

Query  1457  PVFQPHAIGYSNIGDPYNCGGGASFTPMH---VNSGHFSHPTEYHQPAAVDTAQSWQSSE  1287
             P+      GY+   DPY+ GG   F P +   ++ G  S  +  +QP  +DT+QSW  S+
Sbjct  270   PIMTGPIQGYT--SDPYSNGG--LFPPPYSQTMSGGATSPASAEYQP--MDTSQSWSPSQ  323

Query  1286  FMaaaaaAPSFNPYPDNNN-NRIAAESGHQPQALYGSEY-PYQLYDGNGERLMRLGSSAT  1113
             F  A  +   +NP+P+N++ N +A       Q+L+G++Y PYQL+DGNGE + RLGS AT
Sbjct  324   FTMATTS--QYNPFPENDSTNNVAMPD----QSLFGAQYDPYQLFDGNGEIVPRLGSCAT  377

Query  1112  KEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMG-VDTVLPHQVSNLGNWVY  936
             KEARK RMARQRRL  HH+RH   N     Q  +    M  G ++  +  Q +N GNWV 
Sbjct  378   KEARKNRMARQRRLRPHHYRHQARNPR---QITNEQSVMMAGEINNCVMTQANNPGNWVC  434

Query  935   WSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQ--SSSDRRQGSKPEKNLKFLLQKVL  762
             W       P P + +      P+ P  Q QN QKQ  +S+D++Q  K EKNLKFLLQKVL
Sbjct  435   W-------PSPPMAMVSQSLPPERPAMQSQNQQKQVSTSADKKQAFKSEKNLKFLLQKVL  487

Query  761   KQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYL  582
             KQSDV +LGRIVLPKKEAE  LP L++RDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYL
Sbjct  488   KQSDVNNLGRIVLPKKEAERHLPHLETRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYL  547

Query  581   LENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             LENTGDFV+ANGLQEGDFIVIYADMKCGKYLIRGVKVRQ+G +S+GKK  +KN
Sbjct  548   LENTGDFVKANGLQEGDFIVIYADMKCGKYLIRGVKVRQNGPKSEGKKQMKKN  600


 Score =   124 bits (310),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 69/77 (90%), Gaps = 0/77 (0%)
 Frame = -3

Query  1889  LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKL  1710
              SF QG+ ELA +FF+WLKQN+D I AEDMR+IKLKRSTIESASKRLGS+KEGKKQLL+L
Sbjct  154   FSFFQGDSELALMFFEWLKQNRDYICAEDMRSIKLKRSTIESASKRLGSTKEGKKQLLRL  213

Query  1709  ILEWVQQYQLQKKNSRE  1659
             IL+WV+Q++LQKK  RE
Sbjct  214   ILDWVEQHRLQKKQMRE  230



>emb|CDP03838.1| unnamed protein product [Coffea canephora]
Length=995

 Score =   333 bits (855),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 227/326 (70%), Gaps = 27/326 (8%)
 Frame = -3

Query  1367  NSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL  1188
             N+  +  P EYHQP   D+ QSW     M  A     +NP+PDN    +   SG Q QAL
Sbjct  661   NANLYLVPAEYHQP--TDSPQSWSGPYSMPQA----QYNPFPDNTKLPV---SGSQAQAL  711

Query  1187  YGSEYPYQLYDGN-GERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYD  1011
             Y + YPYQ++DG+ GERL+R GSSATKEARKKRMARQRR+S H +RHH+ + +      +
Sbjct  712   YANPYPYQVFDGSSGERLVRYGSSATKEARKKRMARQRRISLHQYRHHHTHQNQPQSLVN  771

Query  1010  PHHAMRMGV--DTVLPHQVSNLGNWVYWSPAASEAP--------PPMVVLppaeaapqpp  861
               HA R+    D    +  +N GNW+YWSPA             PP+V       +   P
Sbjct  772   EQHATRIPAVGDDCTSNSRANPGNWIYWSPAVPPPAPAPMASTMPPLV-------SSDKP  824

Query  860   paqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDS  681
               +Q   Q   SSDR+Q  K EKNLKFLLQKVLKQSDVG+LGRIVLPKKEAET LPEL+S
Sbjct  825   SHRQAPTQPVPSSDRKQSWKTEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELES  884

Query  680   RDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKC  501
             RDGI IA+EDIGTS VWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D KC
Sbjct  885   RDGIPIALEDIGTSNVWNMRYRFWPNNKSRMYLLENTGDFVRVNGLQEGDFIVIYSDTKC  944

Query  500   GKYLIRGVKVRQHGARSDGKKPARKN  423
             GKYLIRGVKVRQ G++S+ KKPAR+N
Sbjct  945   GKYLIRGVKVRQPGSKSEAKKPARRN  970


 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  1889  LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKL  1710
             L FLQ N EL  IF +WLKQNKD ISAEDMR+IKLKRSTI+ ASKRLGS+KEGKKQLLKL
Sbjct  154   LYFLQANSELGVIFLEWLKQNKDHISAEDMRSIKLKRSTIDCASKRLGSTKEGKKQLLKL  213

Query  1709  ILEWVQQYQLQKKNSRE  1659
             ILEWV+QYQL K+ + E
Sbjct  214   ILEWVEQYQLHKRRATE  230


 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/77 (77%), Positives = 66/77 (86%), Gaps = 0/77 (0%)
 Frame = -3

Query  1889  LSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKL  1710
             L FLQ N EL  IF +WLKQNKD ISAEDMR+IKLKRSTI+ ASKRLGS+KEGKKQLLKL
Sbjct  519   LYFLQANSELGVIFLEWLKQNKDHISAEDMRSIKLKRSTIDCASKRLGSTKEGKKQLLKL  578

Query  1709  ILEWVQQYQLQKKNSRE  1659
             ILEWV+QYQL K+ + E
Sbjct  579   ILEWVEQYQLHKRRATE  595



>gb|KDP26424.1| hypothetical protein JCGZ_17582 [Jatropha curcas]
Length=577

 Score =   321 bits (823),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 221/320 (69%), Gaps = 38/320 (12%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEYPYQ-LYDGN  1149
             +D+AQSW +S+F  A+     ++P+PDNN   +       P     YG++YP Q L    
Sbjct  249   LDSAQSWSASQFALASH----YSPFPDNNLQPVPT----HPNVFSGYGNQYPCQYLPTQV  300

Query  1148  GERLMRLGSSATKEARKKRMARQRRLSS-----hhfrhhnnnhhhHAQNYDPHHAMRMGV  984
             G+ L+RLGSSATKEARKKRMARQRR  S     +H  ++  N + +      HH  R+G 
Sbjct  301   GDTLVRLGSSATKEARKKRMARQRRFMSHHRNHNHQNNNQQNQNQNQNTVIDHHG-RLGS  359

Query  983   DTVLPH-QVSNLGNWVYWSPAAS------------EAPPPMVVLppaeaapqpppaqqQN  843
             D + P  Q  N GNWVYW  A              +APP   V        +P     QN
Sbjct  360   DNITPAAQPPNPGNWVYWPAAVGGVAVSTTPVLPMDAPPVHTV-------DRPAMQSHQN  412

Query  842   HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
             HQ+Q +SDRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISI
Sbjct  413   HQRQVASDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISI  472

Query  662   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
             AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDFIVIY+D+KCGKYLIR
Sbjct  473   AMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRTNGLQEGDFIVIYSDVKCGKYLIR  532

Query  482   GVKVRQHGARSDGKKPARKN  423
             GVKVRQ GA+ + KK ARK+
Sbjct  533   GVKVRQPGAKPENKK-ARKS  551


 Score = 94.7 bits (234),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 68/101 (67%), Gaps = 5/101 (5%)
 Frame = -3

Query  1946  EELQQNQEDDDSKAAETADLSFLQGNGE-----LAAIFFDWLKQNKDCISAEDMRNIKLK  1782
             +ELQ  Q +++      ++++  Q +GE     LA +F +WLK NK+ +SAED+R +K+K
Sbjct  58    QELQVQQRNEELAMETKSEVTQKQESGEGASDDLAMVFLEWLKSNKETVSAEDLRKVKIK  117

Query  1781  RSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             ++TIE A+KRLG  K   KQLLKLILEWVQ   LQK+  +E
Sbjct  118   KATIECAAKRLGGGKAAMKQLLKLILEWVQTNHLQKRRMKE  158



>emb|CAC84596.1| VP1/ABI3-like protein [Solanum tuberosum]
Length=363

 Score =   305 bits (782),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 210/429 (49%), Positives = 255/429 (59%), Gaps = 74/429 (17%)
 Frame = -3

Query  1790  KLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTG  1611
             KLKRSTIESASKRLGS+KEGKKQLL+LIL+WV+Q++LQKK  R E           QS  
Sbjct  1     KLKRSTIESASKRLGSTKEGKKQLLRLILDWVEQHRLQKKQMRVE-----------QSIQ  49

Query  1610  GGGHFQAETFLQPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPHAIG  1431
                 F    F  P     +  FP                            PV      G
Sbjct  50    NSAPF---NFNNPNACLFNASFPDSS-------------------------PVMTGPIQG  81

Query  1430  YSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQP-AAVDTAQSWQSSEFMaaaaaAPSF  1254
             Y  IGD Y+   G+ F P             Y+Q  +   T++SW  S+F  A A+   +
Sbjct  82    Y--IGDLYS--NGSLFAP------------PYNQTMSGSTTSRSWSPSQFTMATASQ--Y  123

Query  1253  NPYPDNN--NNRIAAESGHQPQALYGSEY-PYQLYDGNGERLMRLGSSATKEARKKRMAR  1083
             N +P+N+  NN    +     + L+ ++Y PYQ++DGN ERL RLG+ ATKEARK RMAR
Sbjct  124   NQFPENDSTNNVTIPD-----RPLFSAQYVPYQVFDGNSERLARLGTCATKEARKNRMAR  178

Query  1082  QRRLSShhfrhhnnnhhhHAQNYDPHHAMRMG--VDTVLPHQVSNLGNWVYWSPAASEAP  909
             QRR+S HH+RH   N    +       ++ MG  ++     + ++LGNWVYW  AA+  P
Sbjct  179   QRRVSLHHYRHQTQNQRQISN----EKSVMMGGKINNCAMSRANSLGNWVYWPCAAAAPP  234

Query  908   PPMVVLppaeaa--pqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLG  735
               MV L     A   + P  Q Q HQK  S+DRRQ  K EKNLKFLLQKVLKQSDVG+LG
Sbjct  235   ITMVPLADTPQALPMERPAVQSQKHQKHGSTDRRQACKTEKNLKFLLQKVLKQSDVGNLG  294

Query  734   RIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVR  555
             RIVLPKKEAE+ LP+L++RDGISIAMEDIGTSRVWNM   FWPNNKSRMYLLENTGDFV 
Sbjct  295   RIVLPKKEAESHLPQLETRDGISIAMEDIGTSRVWNMNIGFWPNNKSRMYLLENTGDFVL  354

Query  554   ANGLQEGDF  528
             ANGLQEGDF
Sbjct  355   ANGLQEGDF  363



>ref|NP_001234669.1| ABI3 protein [Solanum lycopersicum]
 gb|AAW84252.1| ABI3 [Solanum lycopersicum]
Length=569

 Score =   309 bits (792),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 173/282 (61%), Positives = 206/282 (73%), Gaps = 12/282 (4%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYP-YQLYDGNGERLMRLGSSATKEARKKRMARQ  1080
             +N +P+NN   I        Q L+ ++Y  YQ++DG+GERL RLG+ ATKEARK RMARQ
Sbjct  277   YNRFPENN---ITNNVAIPDQPLFSAQYDQYQIFDGSGERLARLGTCATKEARKIRMARQ  333

Query  1079  RRLSShhfrhhnnnhhhHAQNYDPHHAMRMG--VDTVLPHQVSNLGNWVYWSPAASEAPP  906
             RR+  HH+RH   N    +       ++ MG  ++     Q +N GNWVYW  AA+  P 
Sbjct  334   RRVPLHHYRHQTQNQRQISN----EKSVMMGRKINNCAISQANNPGNWVYWPCAAAAPPI  389

Query  905   PMVVLppaeaa--pqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGR  732
              MV L     +   +  P Q Q HQK  S+D+RQ  K EKNLKFL+QKVLKQSDVG LGR
Sbjct  390   AMVPLADTPQSLPMERSPVQSQKHQKNGSTDKRQACKTEKNLKFLMQKVLKQSDVGHLGR  449

Query  731   IVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRA  552
             IVLPKKEAE+ LP+L++RDGISIAMEDIGT RVWNMKYRFWPNNKSRMYLLENTGDFV A
Sbjct  450   IVLPKKEAESHLPQLETRDGISIAMEDIGTCRVWNMKYRFWPNNKSRMYLLENTGDFVVA  509

Query  551   NGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             NGLQEGDFIVIYAD+KCGKYLIRGVKVR +GA+SDG +PA+K
Sbjct  510   NGLQEGDFIVIYADIKCGKYLIRGVKVRPNGAKSDGMQPAKK  551


 Score =   125 bits (313),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  1904  AETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             A    +S  QG+ ELA +F DWLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKK
Sbjct  127   ANEEQVSIFQGDSELALMFLDWLKQNKDNISAEDMRSIKLKRSTIESASKRLGSTKEGKK  186

Query  1724  QLLKLILEWVQQYQLQKKNSREE  1656
             QLL+LIL+WV+Q++LQKK  REE
Sbjct  187   QLLRLILDWVEQHRLQKKQMREE  209



>ref|XP_010323010.1| PREDICTED: ABI3 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010323011.1| PREDICTED: ABI3 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010323012.1| PREDICTED: ABI3 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010323013.1| PREDICTED: ABI3 protein isoform X1 [Solanum lycopersicum]
 ref|XP_010323014.1| PREDICTED: ABI3 protein isoform X1 [Solanum lycopersicum]
Length=579

 Score =   310 bits (793),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/283 (61%), Positives = 208/283 (73%), Gaps = 14/283 (5%)
 Frame = -3

Query  1256  FNPYPDNN-NNRIAAESGHQPQALYGSEYP-YQLYDGNGERLMRLGSSATKEARKKRMAR  1083
             +N +P+NN  N +A       Q L+ ++Y  YQ++DG+GERL RLG+ ATKEARK RMAR
Sbjct  287   YNRFPENNITNNVAIPD----QPLFSAQYDQYQIFDGSGERLARLGTCATKEARKIRMAR  342

Query  1082  QRRLSShhfrhhnnnhhhHAQNYDPHHAMRMG--VDTVLPHQVSNLGNWVYWSPAASEAP  909
             QRR+  HH+RH   N    +       ++ MG  ++     Q +N GNWVYW  AA+  P
Sbjct  343   QRRVPLHHYRHQTQNQRQISN----EKSVMMGRKINNCAISQANNPGNWVYWPCAAAAPP  398

Query  908   PPMVVLppaeaa--pqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLG  735
               MV L     +   +  P Q Q HQK  S+D+RQ  K EKNLKFL+QKVLKQSDVG LG
Sbjct  399   IAMVPLADTPQSLPMERSPVQSQKHQKHGSTDKRQACKTEKNLKFLMQKVLKQSDVGHLG  458

Query  734   RIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVR  555
             RIVLPKKEAE+ LP+L++RDGISIAMEDIGT RVWNMKYRFWPNNKSRMYLLENTGDFV 
Sbjct  459   RIVLPKKEAESHLPQLETRDGISIAMEDIGTCRVWNMKYRFWPNNKSRMYLLENTGDFVV  518

Query  554   ANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             ANGLQEGDFIVIYAD+KCGKYLIRGVKVR +GA+SDG +PA+K
Sbjct  519   ANGLQEGDFIVIYADIKCGKYLIRGVKVRPNGAKSDGMQPAKK  561


 Score =   125 bits (313),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  1904  AETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             A    +S  QG+ ELA +F DWLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKK
Sbjct  127   ANEEQVSIFQGDSELALMFLDWLKQNKDNISAEDMRSIKLKRSTIESASKRLGSTKEGKK  186

Query  1724  QLLKLILEWVQQYQLQKKNSREE  1656
             QLL+LIL+WV+Q++LQKK  REE
Sbjct  187   QLLRLILDWVEQHRLQKKQMREE  209



>ref|XP_010109682.1| B3 domain-containing transcription factor ABI3 [Morus notabilis]
 gb|EXC24152.1| B3 domain-containing transcription factor ABI3 [Morus notabilis]
Length=769

 Score =   315 bits (806),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 196/361 (54%), Positives = 237/361 (66%), Gaps = 53/361 (15%)
 Frame = -3

Query  1436  IGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS  1257
             +G+  +GDP+  G      P          PT+ +    +D+AQ+W S   +A+      
Sbjct  410   VGF--MGDPFANGSAYPTVP---------PPTDNYN--MLDSAQTWHSQFGLAS-----P  451

Query  1256  FNPYPDNNNNRIAAESGHQPQALYG-----SEYPYQLY------DGNGERLMRLGSSATK  1110
             + P+ DNNNN     +    QA  G     S+YPY  Y       G+G+RL+RLGSSATK
Sbjct  452   YAPFHDNNNNLQPTLASQHAQAFAGYGSSHSQYPYNQYYQEGNNSGHGDRLVRLGSSATK  511

Query  1109  EARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQV--SNLGNWVY  936
             EARKKRMARQRRL +HH  HH+ +     QN    H  R+ V  +   Q   +NLGNWVY
Sbjct  512   EARKKRMARQRRLLTHHRHHHHTH----HQNQGVDHHARLAVAEICTTQAQQANLGNWVY  567

Query  935   WSPAA------------SEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             W PA             +EAPP   V        Q  PA QQN+Q + SS+RRQG KPEK
Sbjct  568   WPPAVPCPTPPLIPGIPAEAPPLHAV------DHQSAPAAQQNYQGRISSERRQGWKPEK  621

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL++RDGISI MEDIGTS VWNM+YR+
Sbjct  622   NLRFLLQKVLKQSDVGSLGRIVLPKKEAEIHLPELEARDGISIPMEDIGTSHVWNMRYRY  681

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPA  432
             WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRGVKVRQ G++S+ K+P 
Sbjct  682   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDIKCGKYMIRGVKVRQQGSKSENKRPG  741

Query  431   R  429
             +
Sbjct  742   K  742


 Score = 88.6 bits (218),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SAED+R++K+K++TIE A++RLG  +E  KQLLKL+LEWVQ  
Sbjct  269   DMATVFLEWLRSNRETVSAEDLRSVKIKKATIECAARRLGGGEEAMKQLLKLVLEWVQMN  328

Query  1685  QLQKKNSREE  1656
              LQK+  R++
Sbjct  329   HLQKRRIRDQ  338



>ref|XP_003632397.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X2 [Vitis vinifera]
Length=733

 Score =   313 bits (802),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 231/340 (68%), Gaps = 23/340 (7%)
 Frame = -3

Query  1421  IGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS-FNPY  1245
             +GDP+  G      P ++NS  +   +EYH    +D+  +WQ S+F     + PS +  +
Sbjct  383   MGDPFANG------PSNINSHPYQSTSEYH---ILDSTNTWQPSQF-----SLPSPYTSF  428

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSS  1065
             P++N     A    Q  A YG+++ YQ + GNGERL RLGSSATKEARKKRMARQRR+ S
Sbjct  429   PESNLPLAPAPQPPQAFAGYGNQFTYQYFPGNGERLTRLGSSATKEARKKRMARQRRVFS  488

Query  1064  hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYW--------SPAASEAP  909
             HH RHHN+++           A   G +       +N  NWV+W        SPA +   
Sbjct  489   HHHRHHNHHNQQQQNPSPDQQARPAGNEGCNSAAQANQANWVFWPSAGAASNSPAGAPDA  548

Query  908   PPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRI  729
             P     PP   A      Q QN+ +Q +++RRQG KPEKNLKFLLQKVLKQSDVG+LGRI
Sbjct  549   PQPQPPPPPPPAVDRQAGQAQNNPRQLAAERRQGWKPEKNLKFLLQKVLKQSDVGNLGRI  608

Query  728   VLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRAN  549
             VLPKKEAET LPEL++RDGI+I MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+N
Sbjct  609   VLPKKEAETHLPELEARDGITIPMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSN  668

Query  548   GLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             GLQEGDFIV+Y+D+KCGKY+IRGVKVRQ G +S+ K+  +
Sbjct  669   GLQEGDFIVLYSDVKCGKYMIRGVKVRQSGPKSESKRSGK  708


 Score =   104 bits (259),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +FF+WLK NK+ IS ED+RNIKLKR+TIE A+KRLG  KEG KQLLKLILEWVQ +
Sbjct  242   DLAMVFFEWLKSNKESISPEDLRNIKLKRATIECAAKRLGGGKEGMKQLLKLILEWVQNH  301

Query  1685  QLQKKNSRE  1659
             QLQKK   E
Sbjct  302   QLQKKRISE  310



>ref|XP_010245692.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Nelumbo 
nucifera]
Length=727

 Score =   311 bits (797),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 188/343 (55%), Positives = 228/343 (66%), Gaps = 28/343 (8%)
 Frame = -3

Query  1412  PYNCGGGASFTPM--HVNSGHFSH-------PTEYHQPAAVDTAQSWQSSEFMaaaaaAP  1260
             P     GA F PM    N G FS        PT+Y     +D + +W SS F      +P
Sbjct  373   PEPTATGAGFPPMVGFANGGPFSQGINGYSPPTDYRM---LDPSVTWPSSNF----TLSP  425

Query  1259  SFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQ  1080
              +N + D++     A   HQ  A + ++YP Q + G+ +RL+R+GSSATKEARKKRMARQ
Sbjct  426   RYNSFTDHH--LPTAPPTHQVFAPFANQYPCQPFQGSSDRLLRMGSSATKEARKKRMARQ  483

Query  1079  RRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAAS--EAPP  906
             RR  SHH   ++   H  + N D H  +    +     Q +N  NW++WS +AS     P
Sbjct  484   RRFLSHHRSLNHQQQHP-SPNTDLHAKLPSEGNCANTAQ-TNPENWMFWSSSASVPTVSP  541

Query  905   PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
               ++      +   PP Q QN+Q+Q +SDRRQG KPEKNL+FLLQKVLKQSDVG+LGRIV
Sbjct  542   AHLLPEAPPQSADRPPMQPQNYQRQITSDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIV  601

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+NG
Sbjct  602   LPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNG  661

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHG------ARSDGKKP  435
             LQEGDFIVIY+D KCGKYLIRGVKVRQ G      A+  GK P
Sbjct  662   LQEGDFIVIYSDTKCGKYLIRGVKVRQPGTGSKLEAKKTGKIP  704


 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 58/70 (83%), Gaps = 0/70 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +FF+WLK NK+ ISAED+RNIKLKRSTI+ A++RLG  KEG K+LLKLILEWVQ +
Sbjct  251   DLAKLFFEWLKSNKESISAEDLRNIKLKRSTIDCAAQRLGGGKEGMKRLLKLILEWVQNH  310

Query  1685  QLQKKNSREE  1656
              LQ++  R E
Sbjct  311   HLQRRRMRGE  320



>ref|XP_010652462.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Vitis vinifera]
 ref|XP_010652463.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Vitis vinifera]
Length=735

 Score =   309 bits (791),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 231/342 (68%), Gaps = 25/342 (7%)
 Frame = -3

Query  1421  IGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS-FNPY  1245
             +GDP+  G      P ++NS  +   +EYH    +D+  +WQ S+F     + PS +  +
Sbjct  383   MGDPFANG------PSNINSHPYQSTSEYH---ILDSTNTWQPSQF-----SLPSPYTSF  428

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSS  1065
             P++N     A    Q  A YG+++ YQ + GNGERL RLGSSATKEARKKRMARQRR+ S
Sbjct  429   PESNLPLAPAPQPPQAFAGYGNQFTYQYFPGNGERLTRLGSSATKEARKKRMARQRRVFS  488

Query  1064  hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYW--------SPAASEAP  909
             HH RHHN+++           A   G +       +N  NWV+W        SPA +   
Sbjct  489   HHHRHHNHHNQQQQNPSPDQQARPAGNEGCNSAAQANQANWVFWPSAGAASNSPAGAPDA  548

Query  908   PPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRI  729
             P     PP   A      Q QN+ +Q +++RRQG KPEKNLKFLLQKVLKQSDVG+LGRI
Sbjct  549   PQPQPPPPPPPAVDRQAGQAQNNPRQLAAERRQGWKPEKNLKFLLQKVLKQSDVGNLGRI  608

Query  728   VLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVR  555
             VLPKKEAET LPEL++RDGI+I MEDIGTSRVWNM+Y  RFWPNNKSRMYLLENTGDFVR
Sbjct  609   VLPKKEAETHLPELEARDGITIPMEDIGTSRVWNMRYSFRFWPNNKSRMYLLENTGDFVR  668

Query  554   ANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             +NGLQEGDFIV+Y+D+KCGKY+IRGVKVRQ G +S+ K+  +
Sbjct  669   SNGLQEGDFIVLYSDVKCGKYMIRGVKVRQSGPKSESKRSGK  710


 Score =   104 bits (259),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +FF+WLK NK+ IS ED+RNIKLKR+TIE A+KRLG  KEG KQLLKLILEWVQ +
Sbjct  242   DLAMVFFEWLKSNKESISPEDLRNIKLKRATIECAAKRLGGGKEGMKQLLKLILEWVQNH  301

Query  1685  QLQKKNSRE  1659
             QLQKK   E
Sbjct  302   QLQKKRISE  310



>gb|AAQ04076.1|AF426832_1 ABI3-like transcription factor [Prunus avium]
Length=802

 Score =   309 bits (791),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 191/339 (56%), Positives = 220/339 (65%), Gaps = 38/339 (11%)
 Frame = -3

Query  1361  GHFSHPTEYHQPAAVDTAQ-SWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL-  1188
             G +    EYH    +D+ Q +W SS F    A   SF   PDNN + +A    H+PQA  
Sbjct  437   GPYQPSPEYHH--MIDSGQPTWPSSPFGMGTAHYGSF---PDNNIH-LAPPPQHRPQAFA  490

Query  1187  -YGSEY-PYQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQN  1017
              YGS+Y PYQ + GNGE +LMRLGSSATKEARKKRMARQRRL SHH   H++   H    
Sbjct  491   GYGSQYQPYQYFPGNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHGHHHQQQHLNAQ  550

Query  1016  YDPH-----------HAMRMGVDTVLPHQVSNLGNWVYWSPAASE---------------  915
                H           +A  +     +P Q +N GNW YW+ A +                
Sbjct  551   MPDHLLHQQHTRLVGNAANLNCANSVPLQ-ANPGNWFYWATATAAPSPSPAMMPSITPEA  609

Query  914   APPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLG  735
             APPP V      A+ Q     Q     Q   +RRQG K EKNLKFLLQKVLKQSDVGSLG
Sbjct  610   APPPPVQQMDRPASTQAQNYNQGRSAAQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLG  669

Query  734   RIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVR  555
             RIVLPKKEAET LPEL++RDGISI MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVR
Sbjct  670   RIVLPKKEAETHLPELEARDGISIPMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVR  729

Query  554   ANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
             ANGLQEGDFIVIY+D+KC KY+IRGVKVRQ G +S+G K
Sbjct  730   ANGLQEGDFIVIYSDVKCNKYMIRGVKVRQAGPKSEGNK  768


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 63/91 (69%), Gaps = 9/91 (10%)
 Frame = -3

Query  1937  QQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESAS  1758
             + N++DD ++  E  D+         A +F +WL+ N++ +SAED+R++K+K+STIE A+
Sbjct  264   ENNKKDDQNENKEPDDM---------AMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAA  314

Query  1757  KRLGSSKEGKKQLLKLILEWVQQYQLQKKNS  1665
             +RLG  KE  KQLLKL+LEWVQ   LQK+ S
Sbjct  315   RRLGGGKEAMKQLLKLVLEWVQTNHLQKRRS  345



>gb|AAQ03210.1|AF411073_1 viviparous protein [Prunus avium]
Length=804

 Score =   309 bits (792),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 190/332 (57%), Positives = 218/332 (66%), Gaps = 38/332 (11%)
 Frame = -3

Query  1340  EYHQPAAVDTAQ-SWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEY-  1173
             EYH    +D+ Q +W SS F    A   SF   PDNN + +A    H+PQA   YGS+Y 
Sbjct  446   EYHH--MIDSGQPTWPSSPFGMGTAHYGSF---PDNNIH-LAPPPQHRPQAFAGYGSQYQ  499

Query  1172  PYQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH---  1005
             PYQ + GNGE +LMRLGSSATKEARKKRMARQRRL SHH   H++   H       H   
Sbjct  500   PYQYFPGNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHGHHHQQQHLNAQMPDHLLH  559

Query  1004  --------HAMRMGVDTVLPHQVSNLGNWVYWSPAASE---------------APPPMVV  894
                     +A  +     +P Q +N GNW YW+ A +                APPP V 
Sbjct  560   QQHTRLVGNAANLNCANSVPLQ-ANPGNWFYWATATAAPSPSPAMMPSITPEAAPPPPVQ  618

Query  893   LppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKK  714
                  A+ Q     Q     Q   +RRQG K EKNLKFLLQKVLKQSDVGSLGRIVLPKK
Sbjct  619   QMDRPASTQAQNYNQGRSAAQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIVLPKK  678

Query  713   EAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEG  534
             EAET LPEL++RDGISI MEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEG
Sbjct  679   EAETHLPELEARDGISIPMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEG  738

Query  533   DFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
             DFIVIY+D+KC KY+IRGVKVRQ G +S+G K
Sbjct  739   DFIVIYSDVKCNKYMIRGVKVRQAGPKSEGNK  770


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 63/91 (69%), Gaps = 9/91 (10%)
 Frame = -3

Query  1937  QQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESAS  1758
             + N++DD ++  E  D+         A +F +WL+ N++ +SAED+R++K+K+STIE A+
Sbjct  266   ENNKKDDQNENKEPDDM---------AMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAA  316

Query  1757  KRLGSSKEGKKQLLKLILEWVQQYQLQKKNS  1665
             +RLG  KE  KQLLKL+LEWVQ   LQK+ S
Sbjct  317   RRLGGGKEAMKQLLKLVLEWVQTNHLQKRRS  347



>ref|XP_011024550.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Populus 
euphratica]
Length=718

 Score =   305 bits (780),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 188/348 (54%), Positives = 229/348 (66%), Gaps = 29/348 (8%)
 Frame = -3

Query  1460  FPVFQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFM  1281
              P F P  +GY  +GDP++ G        ++N   +  P + +    + + Q+W  S+F 
Sbjct  368   MPGFSP-MVGY--MGDPFSNGSS------NINGHPYGTPQDCNH--MLQSYQTWPPSQFP  416

Query  1280  aaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-RLMRLGSSATKEA  1104
             +A+     FN + D N    +A+  +     YG++YPYQ    NG+ RL RLGSSATKEA
Sbjct  417   SASR----FNSFADTNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDNRLTRLGSSATKEA  470

Query  1103  RKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLPHQVSNLGNWVYWS  930
             RKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P   S  G+WVYW 
Sbjct  471   RKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLADDPNGAPTGQSTPGSWVYWP  528

Query  929   PAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSD  750
              AA        V        +P    Q N+ +Q++++RRQG KPEKNL+FLLQKVLKQSD
Sbjct  529   TAAGGGSASTTV---DAPVDRPAMQTQTNNHRQAAAERRQGWKPEKNLRFLLQKVLKQSD  585

Query  749   VGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENT  570
             VGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENT
Sbjct  586   VGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENT  645

Query  569   GDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             GDFVR NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G KP  K
Sbjct  646   GDFVRTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPENK  689


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/69 (58%), Positives = 54/69 (78%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F DWLK NK+ +SA+D+R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ  
Sbjct  238   DLAMVFLDWLKSNKETVSADDLRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTN  297

Query  1685  QLQKKNSRE  1659
              L ++  RE
Sbjct  298   HLHRRRMRE  306



>ref|XP_007200956.1| hypothetical protein PRUPE_ppa001608mg [Prunus persica]
 gb|EMJ02155.1| hypothetical protein PRUPE_ppa001608mg [Prunus persica]
Length=793

 Score =   306 bits (784),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 219/333 (66%), Gaps = 40/333 (12%)
 Frame = -3

Query  1340  EYHQPAAVDTAQ-SWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEY-  1173
             EYH    +D+ Q +W SS F    A   SF   PDNN + +A    H PQA   YGS+Y 
Sbjct  435   EYHH--MIDSGQPTWPSSPFGMGTAHYGSF---PDNNIH-LAPPPQHHPQAFAGYGSQYQ  488

Query  1172  PYQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH---  1005
             PYQ +  NGE +LMRLGSSATKEARKKRMARQRRL SHH   H    H +AQ  D H   
Sbjct  489   PYQYFPLNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHGHQQQQHLNAQMPD-HLLH  547

Query  1004  --------HAMRMGVDTVLPHQVSNLGNWVYW-----SPAASEA-----------PPPMV  897
                     +A  +     +P Q +N GNW YW     +P+ S A           PPP+ 
Sbjct  548   QQHTRLVGNAADLNCTNTVPLQ-ANPGNWFYWPTATAAPSQSPAMMPSITQEAAPPPPLQ  606

Query  896   VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPK  717
              +    +       Q ++   Q   +RRQG K EKNLKFLLQKVLKQSDVGSLGRIVLPK
Sbjct  607   QMDRPASTQAQNYNQGRSSAAQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIVLPK  666

Query  716   KEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQE  537
             KEAET LPEL++RDGISI MEDIGTS VWNM+YR+WPNNKSRMYLLENTGDFVRANGLQE
Sbjct  667   KEAETHLPELEARDGISIPMEDIGTSHVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQE  726

Query  536   GDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
             GDFIVIY+D+KC KY+IRGVKVR  GA+S+G K
Sbjct  727   GDFIVIYSDVKCNKYMIRGVKVRHAGAKSEGNK  759


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 63/91 (69%), Gaps = 9/91 (10%)
 Frame = -3

Query  1937  QQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESAS  1758
             + N+EDD ++  E  D+         A +F +WL+ N++ +SAED+R++K+K+STIE A+
Sbjct  264   ENNKEDDQNENKEPDDM---------AMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAA  314

Query  1757  KRLGSSKEGKKQLLKLILEWVQQYQLQKKNS  1665
             +RLG  KE  KQLLKL+LEWVQ   LQK+ S
Sbjct  315   RRLGGGKEAMKQLLKLVLEWVQTNHLQKRRS  345



>ref|XP_006602557.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X4 [Glycine max]
Length=686

 Score =   303 bits (777),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 201/454 (44%), Positives = 260/454 (57%), Gaps = 48/454 (11%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             ++ +F +WLK NKD +SA D+RN+KLK++TIESA++RLG  KE  KQLLKLILEWVQ   
Sbjct  254   MSNVFLEWLKSNKDSVSANDLRNVKLKKATIESAARRLGGGKEAMKQLLKLILEWVQTSH  313

Query  1682  LQKKNSREEaaaaaaaASDHQ----STGGGGHFQAETFLQPTDTApscffpspwtppppp  1515
             LQ K  +E   ++ ++A   Q    S     + Q+ +F   ++   +   P         
Sbjct  314   LQNKRRKENNGSSISSALQAQFPDPSVQNNQNTQSGSFSPESNACFNNQTPWLSPQTFAT  373

Query  1514  pyiPDannaammaaAQPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSH  1347
                            Q P  V    FQ   +GY  +GDPY  G  ++    ++ + H  +
Sbjct  374   D--------------QAPLMVPPQQFQQPMVGY--VGDPYTSGAASN----NITTSHNHN  413

Query  1346  PTEYHQPAA-----VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYG  1182
                 +QP A     +++A SW  S+F  A   + SF      +NN I    G        
Sbjct  414   SNNPYQPGAEQYHMLESAHSWPHSQFNVACHYSQSFG-----DNNGIFPHGGFG-GGYGN  467

Query  1181  SEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
             ++YPYQ + G G+ LMRLG SATKEARKKRMARQRR  SHH  H+ N  +  +   DPH 
Sbjct  468   NQYPYQFFHGPGDTLMRLGPSATKEARKKRMARQRRFLSHHRHHNGNYQNSGS---DPHA  524

Query  1001  AMRMGVDTVL----PHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQK  834
              +  G +       PH  +   NW+YW      A  P+       A  +     Q  HQ 
Sbjct  525   RLGGGDNCTTGLAAPHHANPTANWMYWQAMTGGAAGPLAPPAEPPAVDRSALQTQNCHQS  584

Query  833   QSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
             + +SDRRQG KPEKNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI ME
Sbjct  585   RVASDRRQGWKPEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITME  644

Query  653   DIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFV  558
             DIGTSRVWNM+Y  R+WPNNKSRMYLLENTG+ +
Sbjct  645   DIGTSRVWNMRYSIRYWPNNKSRMYLLENTGELL  678



>ref|XP_008235529.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X2 [Prunus mume]
Length=776

 Score =   305 bits (782),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 216/335 (64%), Gaps = 36/335 (11%)
 Frame = -3

Query  1361  GHFSHPTEYHQPAAVDTAQS-WQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL-  1188
             G +    EYH    +D+ QS W SS F    A   SF   PDNN + +A    H PQA  
Sbjct  415   GPYQPSPEYHH--MIDSGQSTWPSSPFGMGTAHYGSF---PDNNIH-LAPPPQHHPQAFG  468

Query  1187  YGSEY-PYQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY  1014
             YGS+Y PYQ +  NGE +LMRLGSSATKEARKKRMARQRRL SHH   H    H + Q  
Sbjct  469   YGSQYQPYQYFPLNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHGHQQQQHLNVQM-  527

Query  1013  DPHHAMR------------MGVDTVLPHQVSNLGNWVYWSPAASE-----------APPP  903
              P H +             +     +P Q +N GNW YW  A +            APPP
Sbjct  528   -PDHLLHQQHTRLVGNAGDLNCANSVPLQ-ANPGNWFYWPTATAAPAMMPSITQEAAPPP  585

Query  902   MVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVL  723
              V      A+ Q     Q     Q   +RRQG K EKNLKFLLQKVLKQSDVGSLGRIVL
Sbjct  586   PVQQMDRPASTQAQNYSQGRSAAQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIVL  645

Query  722   PKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGL  543
             PKKEAET LPEL++RDGISI MEDIGTS VWNM+YR+WPNNKSRMYLLENTGDFVRANGL
Sbjct  646   PKKEAETHLPELEARDGISIPMEDIGTSHVWNMRYRYWPNNKSRMYLLENTGDFVRANGL  705

Query  542   QEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
             QEGDFIVIY+D+KC KY+IRGVKVRQ G +S+G K
Sbjct  706   QEGDFIVIYSDVKCNKYMIRGVKVRQAGPKSEGNK  740


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 8/88 (9%)
 Frame = -3

Query  1934  QNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASK  1755
             +N + DD K  +  D        ++A +F +WL+ N++ +SAED+R++K+K+STIE A++
Sbjct  243   ENNKKDDQKENKEPD--------DMAMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAAR  294

Query  1754  RLGSSKEGKKQLLKLILEWVQQYQLQKK  1671
             RLG  KE  KQLLKL+LEWVQ   LQK+
Sbjct  295   RLGGGKEAMKQLLKLVLEWVQTNHLQKR  322



>ref|XP_008235526.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Prunus mume]
 ref|XP_008235527.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Prunus mume]
 ref|XP_008235528.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Prunus mume]
Length=799

 Score =   305 bits (782),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 190/328 (58%), Positives = 214/328 (65%), Gaps = 36/328 (11%)
 Frame = -3

Query  1340  EYHQPAAVDTAQS-WQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL-YGSEY-P  1170
             EYH    +D+ QS W SS F    A   SF   PDNN + +A    H PQA  YGS+Y P
Sbjct  445   EYHH--MIDSGQSTWPSSPFGMGTAHYGSF---PDNNIH-LAPPPQHHPQAFGYGSQYQP  498

Query  1169  YQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMR  993
             YQ +  NGE +LMRLGSSATKEARKKRMARQRRL SHH   H    H + Q   P H + 
Sbjct  499   YQYFPLNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHGHQQQQHLNVQM--PDHLLH  556

Query  992   ------------MGVDTVLPHQVSNLGNWVYWSPAASE-----------APPPMVVLppa  882
                         +     +P Q +N GNW YW  A +            APPP V     
Sbjct  557   QQHTRLVGNAGDLNCANSVPLQ-ANPGNWFYWPTATAAPAMMPSITQEAAPPPPVQQMDR  615

Query  881   eaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET  702
              A+ Q     Q     Q   +RRQG K EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET
Sbjct  616   PASTQAQNYSQGRSAAQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET  675

Query  701   QLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIV  522
              LPEL++RDGISI MEDIGTS VWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIV
Sbjct  676   HLPELEARDGISIPMEDIGTSHVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIV  735

Query  521   IYADMKCGKYLIRGVKVRQHGARSDGKK  438
             IY+D+KC KY+IRGVKVRQ G +S+G K
Sbjct  736   IYSDVKCNKYMIRGVKVRQAGPKSEGNK  763


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 61/88 (69%), Gaps = 8/88 (9%)
 Frame = -3

Query  1934  QNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASK  1755
             +N + DD K  +  D        ++A +F +WL+ N++ +SAED+R++K+K+STIE A++
Sbjct  266   ENNKKDDQKENKEPD--------DMAMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAAR  317

Query  1754  RLGSSKEGKKQLLKLILEWVQQYQLQKK  1671
             RLG  KE  KQLLKL+LEWVQ   LQK+
Sbjct  318   RLGGGKEAMKQLLKLVLEWVQTNHLQKR  345



>ref|XP_010026024.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Eucalyptus 
grandis]
Length=752

 Score =   303 bits (775),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 196/353 (56%), Positives = 233/353 (66%), Gaps = 44/353 (12%)
 Frame = -3

Query  1433  GYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSF  1254
             GY  +GDP    G     P H++   F  P EY     +++AQSW  S+F  AA      
Sbjct  402   GY--MGDPAYSHGA---PPDHLSGNPF--PPEYQM---INSAQSWPMSQFSMAAQPYD--  449

Query  1253  NPYPDNNNNRIAAESGHQPQALYG---SEYPYQLYDGNGERLMRLGSSATKEARKKRMAR  1083
               YP+N +         Q Q L G    +YP+Q Y+G+G+RL+RLGSSATKEARKKRMAR
Sbjct  450   --YPENFH------PPPQAQGLRGYQHHQYPFQYYNGHGQRLIRLGSSATKEARKKRMAR  501

Query  1082  QRR-LSShhfrhhnnnhhhHAQNYDP------HHAMRMGVDTVLP---HQVSNL-GNWVY  936
             QRR LS H   HH++   +   N+         HA   G +  +P   HQ  N  G+WVY
Sbjct  502   QRRFLSHHRSSHHHHQQSNQQGNHQSMAVAAEQHARLGGENCAIPEAAHQAHNHPGSWVY  561

Query  935   W-SPAAS---EAPP--PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLL  774
             W SPA +     PP  P +           P  QQQN+Q+Q + +RRQG KPE NLKFLL
Sbjct  562   WPSPAHAGQVAVPPSLPAMDPVQVAHPADQPAMQQQNYQRQVAPERRQGWKPENNLKFLL  621

Query  773   QKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKS  594
             QKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIAMEDIGTS+VWNM+YRFWPNNKS
Sbjct  622   QKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSKVWNMRYRFWPNNKS  681

Query  593   RMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             RMYLLENTGDFVRANGL+EGDFIVIY+D+KCGKYLIRGVKVRQ     +G KP
Sbjct  682   RMYLLENTGDFVRANGLEEGDFIVIYSDVKCGKYLIRGVKVRQ----PEGTKP  730


 Score = 85.9 bits (211),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E+ A+  +WL +NKD IS +D+R IK+K++T+E+A+KRLG  +E  KQLLKLIL+WVQ  
Sbjct  254   EMGAVLLEWLTENKDDISPDDLRRIKIKKATVETAAKRLGGGREAMKQLLKLILQWVQTN  313

Query  1685  QLQKKNSRE  1659
              L KK  +E
Sbjct  314   HLHKKRLKE  322



>emb|CBI37258.3| unnamed protein product [Vitis vinifera]
Length=564

 Score =   296 bits (758),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 162/273 (59%), Positives = 195/273 (71%), Gaps = 17/273 (6%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             +  +P++N     A    Q  A YG+++ YQ + GNGERL RLGSSATKEARKKRMARQR
Sbjct  281   YTSFPESNLPLAPAPQPPQAFAGYGNQFTYQYFPGNGERLTRLGSSATKEARKKRMARQR  340

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMV  897
             R+ SHH RHHN+++           A   G +       +N  NWV+W  A         
Sbjct  341   RVFSHHHRHHNHHNQQQQNPSPDQQARPAGNEGCNSAAQANQANWVFWPSAVDR------  394

Query  896   VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPK  717
                           Q QN+ +Q +++RRQG KPEKNLKFLLQKVLKQSDVG+LGRIVLPK
Sbjct  395   -----------QAGQAQNNPRQLAAERRQGWKPEKNLKFLLQKVLKQSDVGNLGRIVLPK  443

Query  716   KEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQE  537
             KEAET LPEL++RDGI+I MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+NGLQE
Sbjct  444   KEAETHLPELEARDGITIPMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNGLQE  503

Query  536   GDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
             GDFIV+Y+D+KCGKY+IRGVKVRQ G +S+ K+
Sbjct  504   GDFIVLYSDVKCGKYMIRGVKVRQSGPKSESKR  536


 Score =   103 bits (258),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 57/69 (83%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +FF+WLK NK+ IS ED+RNIKLKR+TIE A+KRLG  KEG KQLLKLILEWVQ +
Sbjct  144   DLAMVFFEWLKSNKESISPEDLRNIKLKRATIECAAKRLGGGKEGMKQLLKLILEWVQNH  203

Query  1685  QLQKKNSRE  1659
             QLQKK   E
Sbjct  204   QLQKKRISE  212



>gb|AFN22068.1| ABI3 [Rosa canina]
Length=718

 Score =   300 bits (767),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 215/515 (42%), Positives = 285/515 (55%), Gaps = 82/515 (16%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A++F +WL+ N++ +SAED+R++K+K+STIESA++RLG  KE  KQLLKL+LEWVQ  
Sbjct  229   DMASVFLEWLRSNRETVSAEDLRSVKIKKSTIESAARRLGGGKEAMKQLLKLVLEWVQTN  288

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQAETFLQPTDTApscffpspwtppppppyi  1506
              LQK+   +++     A    Q+     +        P  T+P    P            
Sbjct  289   HLQKRRGTKDSGIQQYAVDPFQNAIPNPNPSLNPTQNPPITSPWMASPQYDAAA------  342

Query  1505  PDannaammaaAQPPFPVFQPHAIGYSNIG-------DPYNCGGGASFTPMHVNSGHFSH  1347
                           P  V  P  +GY +         DP+  G G            +  
Sbjct  343   --------------PILVPTPSQVGYPSTPMMGFMGQDPFGNGPG------------YQQ  376

Query  1346  P-TEYHQPAAVDTAQSWQ-SSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQP--QALYGS  1179
             P ++ +Q   ++TA +W  SS FM       ++  +PD+N  ++A     QP        
Sbjct  377   PISDQYQHQMLETAPTWPPSSPFMGN-----NYGSFPDSNI-QLAPPQHQQPLSGYGGQY  430

Query  1178  EYPYQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
                      +GE +L+RLGSSATKEARKKRM RQRR  SHH   H+ +  +   N  P  
Sbjct  431   GQYQYFQGQSGEPQLVRLGSSATKEARKKRMQRQRRTLSHHHGRHHGHQQNQHPNQMPDQ  490

Query  1001  AMRMGVD---TVLPHQVSNLGNWVYW--------------------SPAASEAPPPMVVL  891
              +    D   T          NW YW                    +P A+    P+V+ 
Sbjct  491   RLVGNADHNCTTAAMGNPAASNWFYWPTTAAGGPAPAASPAMMQTMAPGAA----PLVL-  545

Query  890   ppaeaapqpppaqqQNHQKQSSSDRRQGSKPE-KNLKFLLQKVLKQSDVGSLGRIVLPKK  714
                         Q  N  + ++ +RRQG +PE KNL+FLLQKVLKQSDVG+LGRIVLPKK
Sbjct  546   ---PVDRPASQGQNYNPGRINTQERRQGWRPENKNLRFLLQKVLKQSDVGNLGRIVLPKK  602

Query  713   EAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEG  534
             EAET LPEL++RDGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRA+GLQEG
Sbjct  603   EAETHLPELEARDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRADGLQEG  662

Query  533   DFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             DFIVIY+D+KC KY+IRGVKVRQ G +S+ K+P +
Sbjct  663   DFIVIYSDVKCNKYMIRGVKVRQAGTKSETKRPGK  697



>ref|XP_009372412.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Pyrus 
x bretschneideri]
Length=795

 Score =   300 bits (768),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 186/333 (56%), Positives = 210/333 (63%), Gaps = 42/333 (13%)
 Frame = -3

Query  1340  EYHQPAAVDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEY-P  1170
             EYH         SW SS F    A   SF   PDNN +   A   H PQA   YGS+Y P
Sbjct  424   EYHHHMIESGQPSWPSSPFGMGTAPYGSF---PDNNIH--LAPPLHHPQAFAGYGSQYQP  478

Query  1169  YQLYDGNGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDP-HHAM  996
             YQ + GNGE +LMRLGSSATKEARKKRMARQRRL SHH  H +  +     N  P HH +
Sbjct  479   YQYFPGNGEHQLMRLGSSATKEARKKRMARQRRLVSHHRHHGHQQNSQQLNNQMPDHHHL  538

Query  995   R----------MGVDTVLPHQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQ  846
             +          +     +P Q +N GNW YW P A+ AP P  +        +  P    
Sbjct  539   QQTRLVGNTTDLNCTGAVPLQ-ANPGNWFYW-PTATAAPSPSALAMMPSIMQEAAPLPPV  596

Query  845   NHQKQSSSDRRQ--------------------GSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                 Q +S + Q                    G K EKNLKFLLQKVLKQSDVGSLGRIV
Sbjct  597   QQMDQPASTQAQNYNHGRSAVQERQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIV  656

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAET LPELD+RDGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANG
Sbjct  657   LPKKEAETHLPELDARDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANG  716

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
             LQEGDFIVIY+D+KC KY+IRGVKVRQ G +S+
Sbjct  717   LQEGDFIVIYSDVKCNKYMIRGVKVRQAGPKSE  749


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SAED+R++K+K+STIE A++RLG  KE  KQLLKL+LEWVQ  
Sbjct  257   DMAMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAARRLGGGKEAMKQLLKLVLEWVQTN  316

Query  1685  QLQKKNS  1665
              LQK+ S
Sbjct  317   HLQKRRS  323



>gb|ABW03095.1| ABI3-like factor [Pisum sativum]
Length=515

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 221/372 (59%), Gaps = 63/372 (17%)
 Frame = -3

Query  1469  QPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQS  1302
             Q P  V    F    +G   +GD +   G  S +     S       EYHQ   V     
Sbjct  146   QTPLVVPPQQFSQGMVGVGYVGDIHYTNGSVSNSLYQQGS-----TNEYHQFNVV-----  195

Query  1301  WQSSEFMaaaaaAPSFN--PYPDNNNNRIAAESGHQPQAL----YGSEY-PYQLY-DGNG  1146
                          P++N   + D+NNN +      QP  L    YG++Y  YQ +  G G
Sbjct  196   -------------PNYNQPSFVDSNNNVV------QPHGLSFGGYGNQYGSYQFFHGGGG  236

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +RLMRLG SATKEARKKRMARQRR  SHH  HH  +                    V  H
Sbjct  237   DRLMRLGPSATKEARKKRMARQRRFVSHHRNHHQGSESVARLGGGGGGDNCTNGVGVGSH  296

Query  965   QVSNLGNWVYW-----SPAASEAP--------PPMVVLppaeaapqpppaqqQNHQKQSS  825
               +N  NW+YW       AAS AP        PP+          +     Q +HQ +++
Sbjct  297   --ANQANWMYWQSMAGGKAASLAPVVRDEQTQPPV-------ERDRTNNQTQNSHQGRNA  347

Query  824   SDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
             SD++QG KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI MEDIG
Sbjct  348   SDKKQGWKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITMEDIG  407

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             TSRVWNM+YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIV+Y+D+KCGK++IRGVKVRQ
Sbjct  408   TSRVWNMRYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVLYSDVKCGKFMIRGVKVRQ  467

Query  464   HGARSDGKKPAR  429
              GA+ + KK  +
Sbjct  468   QGAKPEAKKTGK  479


 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  1799  RNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             RN+KLK+STIESA++RLG  KEG KQLLKLILEWVQ   LQ K  +E
Sbjct  57    RNVKLKKSTIESAARRLGGGKEGMKQLLKLILEWVQTSHLQNKRLKE  103



>ref|XP_008372613.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Malus domestica]
Length=796

 Score =   296 bits (757),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 193/365 (53%), Positives = 221/365 (61%), Gaps = 54/365 (15%)
 Frame = -3

Query  1436  IGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPS  1257
             IGY    DP+  G G S  P   +  +  H  E  QP       SW SS F    A   S
Sbjct  405   IGYM-AADPF--GNGPS--PYQTSPEYHHHMIESGQP-------SWPSSPFGMGTAPYGS  452

Query  1256  FNPYPDNNNNRIAAESGHQPQAL--YGSEY-PYQLYDGNGE-RLMRLGSSATKEARKKRM  1089
             F   PDNN +   A   H PQA   YGS+Y PYQ + GNGE +LMRLGSSATKEARKKRM
Sbjct  453   F---PDNNIH--LAPPQHHPQAFAGYGSQYQPYQYFPGNGEHQLMRLGSSATKEARKKRM  507

Query  1088  ARQRRLSShhfrhhnnnhhhHAQNYDP-HHAMR----------MGVDTVLPHQVSNLGNW  942
             ARQ RL SHH  H +  +     N  P HH ++          +     +P Q +N GNW
Sbjct  508   ARQXRLVSHHRHHGHQQNSQQLNNQMPDHHHLQQTRLVGNTTDLNCTGAVPLQ-ANPGNW  566

Query  941   VYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQ----------------  810
              YW P A+ AP P  +        +  P        + +S + Q                
Sbjct  567   FYW-PTATAAPSPSAIAMMPSIMQEAAPLPPVQQMDRPASTQAQNYNHGRSAVQERQERQ  625

Query  809   ----GSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGT  642
                 G K EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET LPELD+RDGISIAMEDIGT
Sbjct  626   ERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELDARDGISIAMEDIGT  685

Query  641   SRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQH  462
             SRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KC KY+IRGVKVR  
Sbjct  686   SRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCNKYMIRGVKVRXA  745

Query  461   GARSD  447
             G +S+
Sbjct  746   GPKSE  750


 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SAED+R++K+K+STIE A++RLG  KE  KQLLKL+LEWVQ  
Sbjct  258   DMAMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAARRLGGGKEAMKQLLKLVLEWVQTN  317

Query  1685  QLQKKNS  1665
              LQK+ S
Sbjct  318   HLQKRRS  324



>gb|ABW03096.1| ABI3-like factor [Pisum sativum]
Length=683

 Score =   293 bits (749),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 221/372 (59%), Gaps = 63/372 (17%)
 Frame = -3

Query  1469  QPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQS  1302
             Q P  V    F    +G   +GD +   G  S +     S       EYHQ   V     
Sbjct  314   QTPLVVPPQQFSQGMVGVGYVGDIHYTNGSVSNSLYQQGS-----TNEYHQFNVV-----  363

Query  1301  WQSSEFMaaaaaAPSFN--PYPDNNNNRIAAESGHQPQAL----YGSEY-PYQLYDGNG-  1146
                          P++N   + D+NNN +      QP  L    YG++Y  YQ + G G 
Sbjct  364   -------------PNYNQPSFVDSNNNVV------QPHGLSFGGYGNQYGSYQFFHGGGG  404

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +RLMRLG SATKEARKKRMARQRR  SHH  HH  +                    V  H
Sbjct  405   DRLMRLGPSATKEARKKRMARQRRFVSHHRNHHQGSESVARLGGGGGGDNCTNGVGVGSH  464

Query  965   QVSNLGNWVYW-----SPAASEAP--------PPMVVLppaeaapqpppaqqQNHQKQSS  825
               +N  NW+YW       AAS AP        PP+          +     Q +HQ +++
Sbjct  465   --ANQANWMYWQSMAGGKAASLAPVVRDEQTQPPV-------ERDRTNNQTQNSHQGRNA  515

Query  824   SDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
             SD++QG KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI MEDIG
Sbjct  516   SDKKQGWKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITMEDIG  575

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             TSRVWNM+YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIV+Y+D+KCGK++IRGVKVRQ
Sbjct  576   TSRVWNMRYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVLYSDVKCGKFMIRGVKVRQ  635

Query  464   HGARSDGKKPAR  429
              GA+ + KK  +
Sbjct  636   QGAKPEAKKTGK  647


 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  1871  NGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQ  1692
             N E++ +F +WLK NKD +SA D+RN+KLK+STIESA++RLG  KEG KQLLKLILEWVQ
Sbjct  201   NDEMSNVFLEWLKSNKDSVSANDLRNVKLKKSTIESAARRLGGGKEGMKQLLKLILEWVQ  260

Query  1691  QYQLQKKNSRE  1659
                LQ K  +E
Sbjct  261   TSHLQNKRLKE  271



>ref|XP_008382790.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Malus domestica]
Length=780

 Score =   293 bits (750),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 212/336 (63%), Gaps = 42/336 (13%)
 Frame = -3

Query  1340  EYHQPAAVDTAQ-SWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQAL--YGSEY-  1173
             EYH    +D+ Q SWQSS F         +  +PDNN +   A   H PQA   Y S+Y 
Sbjct  417   EYHH-HMIDSGQPSWQSSPF--GMVGTAPYGSFPDNNIH--LAPPQHHPQAFAGYSSQYQ  471

Query  1172  PYQLYDGNGER-LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH--  1002
             PYQ + GNGER LMRLG SATKEARKKRMARQRRL SHH  H +  +     N  P H  
Sbjct  472   PYQYFPGNGERQLMRLGPSATKEARKKRMARQRRLVSHHRHHGHQQNSQQLNNEMPDHNY  531

Query  1001  ---------AMRMGVDTVLPHQVSNLGNWVYWSPAASE------APPPMVVLppaeaapq  867
                         +     +P Q  N GNW YW  A +       A  P ++   A   P 
Sbjct  532   LQQTRFVGNTTDLNCTGAVPLQ-PNPGNWFYWPTATAALSSSAVAMMPSIMPEAAPLPPV  590

Query  866   pppaqqQNHQKQSSSDRR-------------QGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                 +  ++Q Q+ +  R             QG K EKNLKFLLQKVLKQSDVGSLGRIV
Sbjct  591   QQMDRPASNQAQNYNQGRSAAQERQERQERRQGWKSEKNLKFLLQKVLKQSDVGSLGRIV  650

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKK AET LPELD+RDGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANG
Sbjct  651   LPKK-AETHLPELDARDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANG  709

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
             LQEGDFIVIY+D+KC KY+IRGVKVRQ G +S+G K
Sbjct  710   LQEGDFIVIYSDVKCNKYMIRGVKVRQEGPKSEGNK  745


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SAED+R++K+K+STIE A++RLG  KE  KQLLKL+LEWVQ  
Sbjct  250   DMAMVFLEWLRSNRETVSAEDLRSVKIKKSTIECAARRLGGGKEAMKQLLKLVLEWVQTN  309

Query  1685  QLQKKNS  1665
              LQK+ S
Sbjct  310   HLQKRRS  316



>gb|ABW03094.1| ABI3-like factor [Pisum sativum]
Length=753

 Score =   291 bits (746),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 184/372 (49%), Positives = 221/372 (59%), Gaps = 63/372 (17%)
 Frame = -3

Query  1469  QPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQS  1302
             Q P  V    F    +G   +GD +   G  S +     S       EYHQ   V     
Sbjct  384   QTPLVVPPQQFSQGMVGVGYVGDIHYTNGSVSNSLYQQGS-----TNEYHQFNVV-----  433

Query  1301  WQSSEFMaaaaaAPSFN--PYPDNNNNRIAAESGHQPQAL----YGSEY-PYQLYDGNG-  1146
                          P++N   + D+NNN +      QP  L    YG++Y  YQ + G G 
Sbjct  434   -------------PNYNQPSFVDSNNNVV------QPHGLSFGGYGNQYGSYQFFHGGGG  474

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +RLMRLG SATKEARKKRMARQRR  SHH  HH  +                    V  H
Sbjct  475   DRLMRLGPSATKEARKKRMARQRRFVSHHRNHHQGSESVARLGGGGGGDNCTNGVGVGSH  534

Query  965   QVSNLGNWVYW-----SPAASEAP--------PPMVVLppaeaapqpppaqqQNHQKQSS  825
               +N  NW+YW       AAS AP        PP+          +     Q +HQ +++
Sbjct  535   --ANQANWMYWQSMAGGKAASLAPVVRDEQTQPPV-------ERDRTNNQTQNSHQGRNA  585

Query  824   SDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
             SD++QG KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI MEDIG
Sbjct  586   SDKKQGWKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITMEDIG  645

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             TSRVWNM+YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIV+Y+D+KCGK++IRGVKVRQ
Sbjct  646   TSRVWNMRYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVLYSDVKCGKFMIRGVKVRQ  705

Query  464   HGARSDGKKPAR  429
              GA+ + KK  +
Sbjct  706   QGAKPEAKKTGK  717


 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  1871  NGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQ  1692
             N E++ +F +WLK NKD +SA D+RN+KLK+STIESA++RLG  KEG KQLLKLILEWVQ
Sbjct  271   NDEMSNVFLEWLKSNKDSVSANDLRNVKLKKSTIESAARRLGGGKEGMKQLLKLILEWVQ  330

Query  1691  QYQLQKKNSRE  1659
                LQ K  +E
Sbjct  331   TSHLQNKRLKE  341



>dbj|BAC10553.1| ABA insensitive 3 [Pisum sativum]
Length=730

 Score =   291 bits (744),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 219/365 (60%), Gaps = 48/365 (13%)
 Frame = -3

Query  1469  QPPFPV----FQPHAIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQS  1302
             Q P  V    F    +G   +GD +   G  S +     S       EYHQ   V     
Sbjct  360   QTPLVVPPQQFSQAMVGVGYVGDIHYTNGSVSNSLYQQGS-----TNEYHQFNVV-----  409

Query  1301  WQSSEFMaaaaaAPSFN--PYPDNNNNRIAAESGHQPQAL----YGSEY-PYQLYDGNG-  1146
                          P++N   + D+NNN +      QP  L    YG++Y  YQ + G G 
Sbjct  410   -------------PNYNQPSFVDSNNNVV------QPHGLSFGGYGNQYGSYQFFHGGGG  450

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +RLMRLG SATKEARKKRMARQRR  SHH  HH  +    A+            + V   
Sbjct  451   DRLMRLGPSATKEARKKRMARQRRFVSHHRNHHQGSDSV-ARLGGGGGGGDNCTNGVGVG  509

Query  965   QVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQN------HQKQSSSDRRQGS  804
               +N  NW+YW   A      +  +   E    P    + N      HQ +++SD++QG 
Sbjct  510   SHANQANWMYWQSMAGGKEASLAPVVRDEQTQPPVERDRTNNQTPNSHQGRNASDKKQGW  569

Query  803   KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNM  624
             KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI MEDIGTSRVWNM
Sbjct  570   KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITMEDIGTSRVWNM  629

Query  623   KYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDG  444
             +YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIV+Y+D+KCGK++IRGVKVRQ GA+ + 
Sbjct  630   RYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVMYSDVKCGKFMIRGVKVRQQGAKPEA  689

Query  443   KKPAR  429
             KK  +
Sbjct  690   KKTGK  694


 Score = 99.0 bits (245),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -3

Query  1871  NGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQ  1692
             N E++ +F +WLK NKD +SA D+RN+KLK+STIESA++RLG  KEG KQLLKLILEWVQ
Sbjct  247   NDEMSNVFLEWLKSNKDSVSANDLRNVKLKKSTIESAARRLGGGKEGMKQLLKLILEWVQ  306

Query  1691  QYQLQKKNSRE  1659
                LQ K  +E
Sbjct  307   TSHLQNKRLKE  317



>dbj|BAC78904.1| transcription factor VP-1 homologue [Fagopyrum esculentum]
Length=776

 Score =   279 bits (714),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 164/280 (59%), Positives = 202/280 (72%), Gaps = 27/280 (10%)
 Frame = -3

Query  1193  ALYGSEY-PYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQN  1017
             A +G+ Y PYQ + G G+ L R+GSSATKEARKKRMARQR++ +HH   +N+N  +H   
Sbjct  475   AGHGNGYNPYQFFPGPGDGLARMGSSATKEARKKRMARQRKMFTHHHHRNNHNTINHGNG  534

Query  1016  ----------YDPHHAMRMGVDTVLPHQVSNLGNWVYW-----SPAASEAPPPMVVLppa  882
                        DP+  + +G D      +S+ G WVYW     S  A  A PPM+    +
Sbjct  535   TQQQMIQGGCIDPNTRIMIG-DHDSTGSISH-GGWVYWPQTAGSSGAGMAGPPMMGSMQS  592

Query  881   eaapqpppaqqQN------HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLP  720
                 QP  A++         QKQ+++D++QG KPEKNLKFLLQKVLKQSDVG+LGRIVLP
Sbjct  593   HQQLQPALAERPGVALPQASQKQAAADKKQGFKPEKNLKFLLQKVLKQSDVGNLGRIVLP  652

Query  719   KKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQ  540
             KKEAET LPEL++RDGI IAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+NGLQ
Sbjct  653   KKEAETHLPELEARDGIPIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNGLQ  712

Query  539   EGDFIVIYADMKCGKYLIRGVKVRQH--GARSD-GKKPAR  429
             EGDFIVIY+D+KCGKY+IRGVKVR H  G++ +  KKP++
Sbjct  713   EGDFIVIYSDVKCGKYMIRGVKVRPHQQGSKPEVAKKPSK  752


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 67/90 (74%), Gaps = 1/90 (1%)
 Frame = -3

Query  1922  DDDSKAAETADLSFLQGNGE-LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             DD +   E   +  + G  E LA +FF+WLK NK+ I+AE++R+IK+K+STIESA+KRLG
Sbjct  236   DDQADNKELDKMEPVSGLSEDLAVVFFEWLKSNKESITAEELRSIKIKKSTIESAAKRLG  295

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSREE  1656
               KEG KQLLKLIL+WVQ ++L  K S++E
Sbjct  296   GGKEGMKQLLKLILQWVQNHRLHTKRSQDE  325



>gb|AEK05624.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   276 bits (705),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 200/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RLMRLGSS TKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLMRLGSSVTKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>gb|AEK05612.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05626.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   275 bits (703),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 200/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSSATKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSATKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>gb|AEK05613.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   275 bits (703),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 168/301 (56%), Positives = 200/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSSATKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSATKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 94.7 bits (234),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +LA +F DWLK NK+ +SA+D+R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ  
Sbjct  208   DLAMVFLDWLKSNKETVSADDLRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTN  267

Query  1685  QLQKKNSRE  1659
              LQ++  RE
Sbjct  268   HLQRRRMRE  276



>gb|KGN44572.1| hypothetical protein Csa_7G336510 [Cucumis sativus]
Length=735

 Score =   275 bits (704),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 156/248 (63%), Positives = 180/248 (73%), Gaps = 14/248 (6%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLS----ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVL  972
             L+RL SSATKEARKKRMARQRR S     H   H N + + H    +P+ +    + T  
Sbjct  465   LVRLDSSATKEARKKRMARQRRFSVHHRHHGGHHGNGHQNQHPTQMNPNASDHCNMATT-  523

Query  971   PHQVSNLGNWVYW-SPAASEAPP------PMVVLppaeaapqpppaqqQNHQKQSSSDRR  813
                  N GNWVYW SP  + A        P+   P   A       Q QN+  +  SDRR
Sbjct  524   --AQPNAGNWVYWPSPTGAGASSTTSSGFPVDSSPLHAADRSNSSLQNQNYPPRIPSDRR  581

Query  812   QGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRV  633
             QG KPEKNLKFLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRV
Sbjct  582   QGWKPEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRV  641

Query  632   WNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGAR  453
             WNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRGVKVRQ G++
Sbjct  642   WNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDIKCGKYMIRGVKVRQPGSK  701

Query  452   SDGKKPAR  429
              + K+P +
Sbjct  702   PESKRPGK  709


 Score = 89.4 bits (220),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SA+D+RN+++K++TIESA++RLG  KEG KQLLKL+L+WVQ  
Sbjct  237   DMAKVFLEWLRSNRETVSADDLRNVRIKKATIESAARRLGGGKEGMKQLLKLVLQWVQTN  296

Query  1685  QLQKKNSRE  1659
              L K+  R+
Sbjct  297   HLHKRKFRD  305



>gb|AEK05615.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   274 bits (700),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 199/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSS TKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSVTKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGXSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>gb|AEK05611.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05616.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05617.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05618.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05619.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05620.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05622.1| abscisic acid insensitivity 3 [Populus balsamifera]
 gb|AEK05623.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   273 bits (699),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 199/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSS TKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSXTKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>ref|XP_010532867.1| PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing transcription 
factor ABI3-like [Tarenaya hassleriana]
Length=758

 Score =   275 bits (703),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 166/287 (58%), Positives = 192/287 (67%), Gaps = 31/287 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-RLMRLGSSATKEARKKRMARQ  1080
             FNPYPD+        +G+ P       YPY      G+ RL+RL SSATKEARKKRMARQ
Sbjct  463   FNPYPDH------GFAGYVPNPY---SYPYMHGQVVGDQRLLRLCSSATKEARKKRMARQ  513

Query  1079  RRLSShhfrhhnnnhhhHAQNYDPH----HAMRMG-----VDTVLPHQVSNLGNWVYWSP  927
             RR  SHH RH NN ++   QN + +    HA R G     V    P   +  G W+YW  
Sbjct  514   RRFLSHHHRHGNNANNGSQQNMNQNQFGEHA-RAGETCTMVGAAPPLNAATAGGWMYW--  570

Query  926   AASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDV  747
                    P +    ++A+          HQ    SDRRQG KPEKNL+FLLQKVLKQSDV
Sbjct  571   -------PNIPAVESQASAAERGGSAXRHQ--VVSDRRQGWKPEKNLRFLLQKVLKQSDV  621

Query  746   GSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTG  567
             G+LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTG
Sbjct  622   GNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTG  681

Query  566   DFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             DFV+ NGL+EGDFIVIY+D+KCGKYLIRGVKVRQ  A      P+ +
Sbjct  682   DFVKTNGLREGDFIVIYSDIKCGKYLIRGVKVRQPPAPKPETTPSAR  728


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 57/70 (81%), Gaps = 0/70 (0%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             L+ + +LA++F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLILE
Sbjct  255   LEQDEDLASVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLILE  314

Query  1700  WVQQYQLQKK  1671
             WVQ   LQK+
Sbjct  315   WVQTNHLQKR  324



>ref|XP_004139719.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Cucumis sativus]
Length=868

 Score =   277 bits (708),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 161/265 (61%), Positives = 187/265 (71%), Gaps = 16/265 (6%)
 Frame = -3

Query  1184  GSEYPYQLYDGNGER--LMRLGSSATKEARKKRMARQRRLS----ShhfrhhnnnhhhHA  1023
             G ++PY    G G    L+RL SSATKEARKKRMARQRR S     H   H N + + H 
Sbjct  581   GRQFPYMGGSGGGGENGLVRLDSSATKEARKKRMARQRRFSVHHRHHGGHHGNGHQNQHP  640

Query  1022  QNYDPHHAMRMGVDTVLPHQVSNLGNWVYW-SPAASEAPP------PMVVLppaeaapqp  864
                +P+ +    + T       N GNWVYW SP  + A        P+   P   A    
Sbjct  641   TQMNPNASDHCNMATT---AQPNAGNWVYWPSPTGAGASSTTSSGFPVDSSPLHAADRSN  697

Query  863   ppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELD  684
                Q QN+  +  SDRRQG KPEKNLKFLLQKVLKQSDVG+LGRIVLPKKEAET LPEL+
Sbjct  698   SSLQNQNYPPRIPSDRRQGWKPEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELE  757

Query  683   SRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMK  504
             +RDGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+K
Sbjct  758   ARDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDIK  817

Query  503   CGKYLIRGVKVRQHGARSDGKKPAR  429
             CGKY+IRGVKVRQ G++ + K+P +
Sbjct  818   CGKYMIRGVKVRQPGSKPESKRPGK  842


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SA+D+RN+++K++TIESA++RLG  KEG KQLLKL+L+WVQ  
Sbjct  389   DMAKVFLEWLRSNRETVSADDLRNVRIKKATIESAARRLGGGKEGMKQLLKLVLQWVQTN  448

Query  1685  QLQKKNSRE  1659
              L K+  R+
Sbjct  449   HLHKRKFRD  457



>gb|AEK05625.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   273 bits (698),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 199/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSS TKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSXTKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>gb|AEK05621.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   273 bits (698),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 199/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSS TKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSXTKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>gb|AEK05614.1| abscisic acid insensitivity 3 [Populus balsamifera]
Length=688

 Score =   273 bits (698),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 167/301 (55%), Positives = 199/301 (66%), Gaps = 18/301 (6%)
 Frame = -3

Query  1319  VDTAQSWQSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGE-  1143
             + + Q+W  S+F +A+     FN + DNN    +A+  +     YG++YPYQ    NG+ 
Sbjct  374   LQSYQTWPPSQFHSASH----FNSFADNNLQ--SAQPQNPAFTGYGNQYPYQYVPANGDN  427

Query  1142  RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY-DPHHAMRMGVD-TVLP  969
             RL RLGSS TKEARKKRMARQRR  S+H   +++N  H  Q   DPH   R+  D    P
Sbjct  428   RLTRLGSSXTKEARKKRMARQRRFLSYHRNQNHHNIQHQNQGAGDPHE--RLSDDPNGAP  485

Query  968   HQVSNLGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKN  789
                SN G+WVYW  AA        V        +P    Q N+ +Q++++RRQG KPEKN
Sbjct  486   TGQSNPGSWVYWPTAAGGGSASTTV---DAPVDRPAMQAQTNNHRQAAAERRQGWKPEKN  542

Query  788   LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
             L+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFW
Sbjct  543   LRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFW  602

Query  608   PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             PNNKSRMYLLENT            DFIVIY+D+KCGKYLIRGVKVRQ      G KP  
Sbjct  603   PNNKSRMYLLENTXXXXXXXXXXXXDFIVIYSDVKCGKYLIRGVKVRQPA----GPKPEN  658

Query  428   K  426
             K
Sbjct  659   K  659


 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 5/108 (5%)
 Frame = -3

Query  1976  PQAAAARSQFEELQQNQEDDDSKAAETADLSFLQG--NGELAAIFFDWLKQNKDCISAED  1803
             PQ       ++E   N+E    K  + AD    QG  + +LA +F DWLK NK+ +SA+D
Sbjct  172   PQDQLQLQYYDEQAGNEEITKGKNDQEADH---QGGRSDDLAMVFLDWLKSNKETVSADD  228

Query  1802  MRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSRE  1659
             +R +KLK++TIE A++RLG  KEG KQLLKLIL+WVQ   LQ++  RE
Sbjct  229   LRRVKLKKTTIECAARRLGGGKEGMKQLLKLILQWVQTNHLQRRRMRE  276



>emb|CAA04184.1| VP1 protein homologue [Craterostigma plantagineum]
Length=688

 Score =   272 bits (695),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 193/275 (70%), Gaps = 22/275 (8%)
 Frame = -3

Query  1208  GHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhh  1029
             G  P+  + +  PYQ+ D +GER ++LG+SATKEARKKRMARQRRL S H RH +++H H
Sbjct  400   GAFPEPNFYACNPYQMCDLSGERFVKLGASATKEARKKRMARQRRLYSSHHRHGHHHHGH  459

Query  1028  HAQNYDPH---HAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPPMVVLppaeaap----  870
                  D +   +    G D   P   S    W+Y +  AS      VV+   ++      
Sbjct  460   QIAPADANSMENHQNGGGDRSSPGNSS----WMYNNVGASSN----VVIQNVDSTQPSSG  511

Query  869   -qpppaqqQNHQKQSSSDRR-----QGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEA  708
              +     Q ++Q+  S+DRR     QG K EKNLKFLLQKVLKQSDVGSLGRIVLPKKEA
Sbjct  512   DKMAAQAQSSNQRLGSNDRRQQQQQQGLKTEKNLKFLLQKVLKQSDVGSLGRIVLPKKEA  571

Query  707   ETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDF  528
             E  LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR NGLQEGDF
Sbjct  572   EIHLPELETRDGISVAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRLNGLQEGDF  631

Query  527   IVIYADMKCGKYLIRGVKVRQHGARSDGKKPARKN  423
             IVIY+D KCGKY+IRGVKVR  G + + KKPA+KN
Sbjct  632   IVIYSDTKCGKYMIRGVKVR-PGTKLESKKPAKKN  665


 Score =   117 bits (292),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = -3

Query  1979  PPQAAAARSQFEELQQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDM  1800
             PP     R      QQ+QE+D          + LQ N ELA IFF+WLKQNKD ISAEDM
Sbjct  180   PPPQENQRVITMAAQQSQEND-------GLTTLLQENSELAVIFFEWLKQNKDNISAEDM  232

Query  1799  RNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNS  1665
             R+IKL+RSTI++ASKRLGSSKEGK +LLKLIL WV+Q QLQKK +
Sbjct  233   RSIKLRRSTIDNASKRLGSSKEGKIKLLKLILGWVEQCQLQKKKT  277



>ref|XP_008458109.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Cucumis 
melo]
Length=705

 Score =   271 bits (693),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 179/246 (73%), Gaps = 9/246 (4%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVD--TVLPH  966
             L+RL SSATKEARKKRMARQRR S HH  HH  +H +  QN  P        D   +   
Sbjct  434   LVRLDSSATKEARKKRMARQRRFSVHHRHHHGGHHGNGHQNQHPTQMNPNASDHCNMATT  493

Query  965   QVSNLGNWVYW-SPAASEAPP------PMVVLppaeaapqpppaqqQNHQKQSSSDRRQG  807
                N GNWV W SP  + A        P+   P   A       Q QN+  +  ++RRQG
Sbjct  494   TQPNAGNWVSWPSPTGAGASSTTSSGFPVDSSPVHTADRSNSSLQNQNYPPRIPTERRQG  553

Query  806   SKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
              KPEKNLKFLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWN
Sbjct  554   WKPEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWN  613

Query  626   MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
             M+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFIVIY+D+KCGKY+IRGVKVRQ G++ +
Sbjct  614   MRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYSDVKCGKYMIRGVKVRQPGSKPE  673

Query  446   GKKPAR  429
              K+P +
Sbjct  674   SKRPGK  679


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SA+D+RN+++K++TIESA++RLG  KEG KQLLKL+L+WVQ  
Sbjct  212   DMAKVFLEWLRSNRETVSADDLRNVRIKKATIESAARRLGGGKEGMKQLLKLVLQWVQTN  271

Query  1685  QLQKKNSRE  1659
              L K+  R+
Sbjct  272   HLHKRKFRD  280



>ref|XP_006418703.1| hypothetical protein EUTSA_v10003110mg [Eutrema salsugineum]
 gb|ESQ37139.1| hypothetical protein EUTSA_v10003110mg [Eutrema salsugineum]
Length=728

 Score =   271 bits (692),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 155/257 (60%), Positives = 183/257 (71%), Gaps = 19/257 (7%)
 Frame = -3

Query  1178  EYPY----QLYDGNGERLMRLGSSATKEARKKRMARQRR-LSShhfrhhnnnhhhHAQNY  1014
             +YPY    Q+ D   +RL+RL SSATKEARKKRMARQRR LS HH   +NNN+ + AQ  
Sbjct  442   QYPYLPSGQIRD---QRLLRLCSSATKEARKKRMARQRRFLSHHHRHTNNNNNPNQAQLG  498

Query  1013  DPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPP----MVVLppaeaapqpppaqqQ  846
             +    +   ++ V     +  G W+YW P     PPP    +  +           +   
Sbjct  499   ETCPVVAPQLNPV--AATATGGTWMYW-PNVPAVPPPGAAQLPAMETQLPPMDRAGSVSA  555

Query  845   NHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGIS  666
               ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGIS
Sbjct  556   MPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGIS  615

Query  665   IAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             +AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFV+ NGLQEGDFIVIY+D+KCGKYLI
Sbjct  616   LAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLI  675

Query  485   RGVKVRQHGARSDGKKP  435
             RGVKVRQ      G+KP
Sbjct  676   RGVKVRQPA----GQKP  688


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 59/74 (80%), Gaps = 0/74 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LA++F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  245   SSLEQDDDLASVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  304

Query  1706  LEWVQQYQLQKKNS  1665
             LEWVQ   LQ++ +
Sbjct  305   LEWVQTNHLQRRRT  318



>gb|KFK39784.1| hypothetical protein AALP_AA3G287300 [Arabis alpina]
Length=736

 Score =   270 bits (691),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 155/254 (61%), Positives = 180/254 (71%), Gaps = 13/254 (5%)
 Frame = -3

Query  1178  EYPYQLYDGN--GERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH  1005
             +YP  L  G    +RL+RL SSATKEARKKRMARQRR  SHH RH+NN+  +  Q  +  
Sbjct  454   QYPPYLPSGQMRDQRLIRLCSSATKEARKKRMARQRRFLSHHHRHNNNSTQNQTQMGESC  513

Query  1004  HAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPP----MVVLppaeaapqpppaqqQNHQ  837
              A+   ++ V        G W+YW P  S  PPP    +  +                 +
Sbjct  514   AAVASQLNPV--TTTPTGGTWMYW-PNVSAVPPPVSAQLPAMETQLPTMDRAGTASAMPR  570

Query  836   KQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAM  657
             +Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGIS+AM
Sbjct  571   QQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISLAM  630

Query  656   EDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGV  477
             EDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFV+ NGLQEGDFIVIY+D+KCGKYLIRGV
Sbjct  631   EDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIRGV  690

Query  476   KVRQHGARSDGKKP  435
             KVRQ      G+KP
Sbjct  691   KVRQPA----GQKP  700


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LAA+F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  254   SSLEQDEDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  313

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  314   LEWVQTNHLQ  323



>emb|CDY15121.1| BnaC03g44820D [Brassica napus]
Length=672

 Score =   266 bits (680),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 177/256 (69%), Gaps = 18/256 (7%)
 Frame = -3

Query  1178  EYPYQLYDGN--GERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH  1005
             +YPY    G    + L+RL SSATKEARKKRMARQRR  SHH RH+NN  +         
Sbjct  389   QYPYLPSSGQMRDQGLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNQQNQTQIG----  444

Query  1004  HAMRMGVDTVLPH--QVSNLGNWVYWSPAASEAPPP----MVVLppaeaapqpppaqqQN  843
               +   VD  L H    +  G W+YW P     PPP    +  +           +    
Sbjct  445   -EVCGAVDPQLNHVPTTATGGTWMYW-PNVPAMPPPVSSQLPAMETQLPTMDRAGSSSVM  502

Query  842   HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
              ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGIS+
Sbjct  503   PRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISL  562

Query  662   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
             AMEDIGTSRVWN++YRFWPNNKSRMYLLENTGDFV+ NGLQEGDFIVIY+D+KCGKYLIR
Sbjct  563   AMEDIGTSRVWNLRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIR  622

Query  482   GVKVRQHGARSDGKKP  435
             GVKVRQ      G+KP
Sbjct  623   GVKVRQPA----GQKP  634


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             L+   +LAA+F +WLK NK+ +SA+D+R +K+K++TIESA+KRLG  KE  KQLLKLILE
Sbjct  204   LEQEDDLAAVFLEWLKNNKETVSADDLRKVKIKKATIESAAKRLGGGKEAMKQLLKLILE  263

Query  1700  WVQQYQLQKKNS  1665
             WVQ   LQ++ +
Sbjct  264   WVQTNHLQRRRT  275



>dbj|BAD93896.1| abscisic acid-insensitive protein 3 [Arabidopsis thaliana]
Length=720

 Score =   267 bits (682),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 189/282 (67%), Gaps = 23/282 (8%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P +  N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  411   PTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRD---QRLLRLCSSATKEARKKRMARQR  467

Query  1076  RLSS------hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWS--PAA  921
             R  S      ++  ++NNN  +  Q  +   A+   ++ V     +  G W+YW   PA 
Sbjct  468   RFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVA--TTATGGTWMYWPNVPAV  525

Query  920   SEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGS  741
                 PP  V+           +     ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+
Sbjct  526   PPQLPP--VMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGN  583

Query  740   LGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDF  561
             LGRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDF
Sbjct  584   LGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDF  643

Query  560   VRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             V+ NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G+KP
Sbjct  644   VKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ----PSGQKP  681


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LAA+F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  298   LEWVQTNHLQ  307



>ref|NP_189108.1| B3 domain-containing transcription factor ABI3 [Arabidopsis thaliana]
 sp|Q01593.1|ABI3_ARATH RecName: Full=B3 domain-containing transcription factor ABI3; 
AltName: Full=Protein ABSCISIC ACID-INSENSITIVE 3 [Arabidopsis 
thaliana]
 emb|CAA48241.1| ABI3 protein [Arabidopsis thaliana]
 dbj|BAB01214.1| abscisic acid-insensitive protein 3 [Arabidopsis thaliana]
 gb|AEE76933.1| B3 domain-containing transcription factor ABI3 [Arabidopsis thaliana]
Length=720

 Score =   267 bits (682),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 189/282 (67%), Gaps = 23/282 (8%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P +  N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  411   PTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRD---QRLLRLCSSATKEARKKRMARQR  467

Query  1076  RLSS------hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWS--PAA  921
             R  S      ++  ++NNN  +  Q  +   A+   ++ V     +  G W+YW   PA 
Sbjct  468   RFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVA--TTATGGTWMYWPNVPAV  525

Query  920   SEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGS  741
                 PP  V+           +     ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+
Sbjct  526   PPQLPP--VMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGN  583

Query  740   LGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDF  561
             LGRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDF
Sbjct  584   LGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDF  643

Query  560   VRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             V+ NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G+KP
Sbjct  644   VKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ----PSGQKP  681


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LAA+F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  298   LEWVQTNHLQ  307



>dbj|BAD94272.1| abscisic acid-insensitive protein 3 [Arabidopsis thaliana]
Length=720

 Score =   267 bits (682),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 189/282 (67%), Gaps = 23/282 (8%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P +  N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  411   PTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRD---QRLLRLCSSATKEARKKRMARQR  467

Query  1076  RLSS------hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWS--PAA  921
             R  S      ++  ++NNN  +  Q  +   A+   ++ V     +  G W+YW   PA 
Sbjct  468   RFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVA--TTATGGTWMYWPNVPAV  525

Query  920   SEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGS  741
                 PP  V+           +     ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+
Sbjct  526   PPQLPP--VMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGN  583

Query  740   LGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDF  561
             LGRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDF
Sbjct  584   LGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDF  643

Query  560   VRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             V+ NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G+KP
Sbjct  644   VKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ----PSGQKP  681


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LAA+F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  298   LEWVQTNHLQ  307



>ref|XP_009136082.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Brassica 
rapa]
Length=717

 Score =   267 bits (682),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 154/257 (60%), Positives = 179/257 (70%), Gaps = 17/257 (7%)
 Frame = -3

Query  1178  EYPYQLYDGN--GERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH  1005
             +YPY    G    + L+RL SSATKEARKKRMARQRR  SHH RH+NNN+  +       
Sbjct  430   QYPYLPSSGQMRDQGLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNNNQQNQTQI---  486

Query  1004  HAMRMGVDTVLPH--QVSNLGNWVYWSPAASEAPPP-----MVVLppaeaapqpppaqqQ  846
               +   VD  L H    +  G W+YW P     PPP     +  +           +   
Sbjct  487   GEVCGAVDPQLNHVPTTATGGTWMYW-PNVPAMPPPVSSSQLPAMETQLPTMDRAGSSSV  545

Query  845   NHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGIS  666
               ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGIS
Sbjct  546   MPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGIS  605

Query  665   IAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             +AMEDIGTSRVWN++YRFWPNNKSRMYLLENTGDFV+ NGLQEGDFIVIY+D+KCGKYLI
Sbjct  606   LAMEDIGTSRVWNLRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLI  665

Query  485   RGVKVRQHGARSDGKKP  435
             RGVKVRQ      G+KP
Sbjct  666   RGVKVRQPA----GQKP  678


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             L+   +LAA+F +WLK NK+ +SA+D+R +K+K++TIESA+KRLG  KE  KQLLKLILE
Sbjct  243   LEQEDDLAAVFLEWLKNNKETVSADDLRKVKIKKATIESAAKRLGGGKEAMKQLLKLILE  302

Query  1700  WVQQYQLQ  1677
             WVQ   LQ
Sbjct  303   WVQTNHLQ  310



>gb|AHC02486.1| abscisic acid insensitive 3 [Brassica napus]
Length=711

 Score =   266 bits (680),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 153/256 (60%), Positives = 177/256 (69%), Gaps = 18/256 (7%)
 Frame = -3

Query  1178  EYPYQLYDGN--GERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH  1005
             +YPY    G    + L+RL SSATKEARKKRMARQRR  SHH RH+NN  +         
Sbjct  428   QYPYLPSSGQMRDQGLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNQQNQTQIG----  483

Query  1004  HAMRMGVDTVLPH--QVSNLGNWVYWSPAASEAPPP----MVVLppaeaapqpppaqqQN  843
               +   VD  L H    +  G W+YW P     PPP    +  +           +    
Sbjct  484   -EVCGAVDPQLNHVPTTATGGTWMYW-PNVPAMPPPVSSQLPAMETQLPTMDRAGSSSVM  541

Query  842   HQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
              ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGIS+
Sbjct  542   PRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISL  601

Query  662   AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
             AMEDIGTSRVWN++YRFWPNNKSRMYLLENTGDFV+ NGLQEGDFIVIY+D+KCGKYLIR
Sbjct  602   AMEDIGTSRVWNLRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLIR  661

Query  482   GVKVRQHGARSDGKKP  435
             GVKVRQ      G+KP
Sbjct  662   GVKVRQPA----GQKP  673


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             L+   +LAA+F +WLK NK+ +SA+D+R +K+K++TIESA+KRLG  KE  KQLLKLILE
Sbjct  243   LEQEDDLAAVFLEWLKNNKETVSADDLRKVKIKKATIESAAKRLGGGKEAMKQLLKLILE  302

Query  1700  WVQQYQLQKKNS  1665
             WVQ   LQ++ +
Sbjct  303   WVQTNHLQRRRT  314



>dbj|BAE96106.1| abscisic acid insensitive 3 [Arabidopsis thaliana]
Length=718

 Score =   266 bits (680),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 189/282 (67%), Gaps = 23/282 (8%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P +  N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  410   PTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRD---QRLLRLCSSATKEARKKRMARQR  466

Query  1076  RLSS------hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWS--PAA  921
             R  S      ++  ++NNN  +  Q  +   A+   ++ V     +  G W+YW   PA 
Sbjct  467   RFLSHHHRHNNNNNNNNNNQQNQTQIGETCAAVAPQLNPVA--TTATGGTWMYWPNVPAV  524

Query  920   SEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGS  741
                 PP  V+           +     ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+
Sbjct  525   PPQLPP--VMETQLPTMDRAGSASAMPRQQVVLDRRQGWKPEKNLRFLLQKVLKQSDVGN  582

Query  740   LGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDF  561
             LGRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDF
Sbjct  583   LGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDF  642

Query  560   VRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             V+ NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ      G+KP
Sbjct  643   VKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ----PSGQKP  680


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LAA+F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  237   SSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  296

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  297   LEWVQTNHLQ  306



>emb|CDX93029.1| BnaA03g37510D [Brassica napus]
Length=718

 Score =   266 bits (680),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 175/247 (71%), Gaps = 13/247 (5%)
 Frame = -3

Query  1178  EYPYQLYDGN--GERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPH  1005
             +YPY    G    + L+RL SSATKEARKKRMARQRR  SHH RH+NNN+  +       
Sbjct  431   QYPYLPSSGQMRDQGLLRLCSSATKEARKKRMARQRRFLSHHHRHNNNNNQQNQTQI---  487

Query  1004  HAMRMGVDTVLPH--QVSNLGNWVYWSPAASEAPPP-----MVVLppaeaapqpppaqqQ  846
               +   VD  L H    +  G W+YW P     PPP     +  +           +   
Sbjct  488   GEVCGAVDPQLNHVPTTATGGTWMYW-PNVPAMPPPVSSSQLPAMETQLPTMDRAGSSSV  546

Query  845   NHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGIS  666
               ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RDGIS
Sbjct  547   MPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEARDGIS  606

Query  665   IAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             +AMEDIGTSRVWN++YRFWPNNKSRMYLLENTGDFV+ NGLQEGDFIVIY+D+KCGKYLI
Sbjct  607   LAMEDIGTSRVWNLRYRFWPNNKSRMYLLENTGDFVKTNGLQEGDFIVIYSDVKCGKYLI  666

Query  485   RGVKVRQ  465
             RGVKVRQ
Sbjct  667   RGVKVRQ  673


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             L+   +LAA+F +WLK NK+ +SA+D+R +K+K++TIESA+KRLG  KE  KQLLKLILE
Sbjct  244   LEQEDDLAAVFLEWLKNNKETVSADDLRKVKIKKATIESAAKRLGGGKEAMKQLLKLILE  303

Query  1700  WVQQYQLQ  1677
             WVQ   LQ
Sbjct  304   WVQTNHLQ  311



>ref|XP_002883542.1| hypothetical protein ARALYDRAFT_342636 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59801.1| hypothetical protein ARALYDRAFT_342636 [Arabidopsis lyrata subsp. 
lyrata]
Length=725

 Score =   261 bits (666),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 155/276 (56%), Positives = 187/276 (68%), Gaps = 13/276 (5%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P+   N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  417   PNTQYNQFGEPTGFTGYNMNPYQYPYVPAGQVRD---QRLLRLCSSATKEARKKRMARQR  473

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLG-NWVYW-SPAASEAPPP  903
             R  SHH RH+NNN+++                 + P   +  G  W+YW +  A+  P  
Sbjct  474   RFLSHHHRHNNNNNNNQQNQTQIGETCAAVAPQLNPVATTATGGTWMYWPNVPAAPPPQL  533

Query  902   MVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVL  723
                +           +     ++Q+  DRRQG KPEKNL+FLLQKVLKQSDVG+LGRIVL
Sbjct  534   PPAMETQLPTMDRAGSLAAMPRQQAVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRIVL  593

Query  722   PKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGL  543
             PKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFV+ NGL
Sbjct  594   PKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTNGL  653

Query  542   QEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             QEGDFIVIY+D+KCGKYLIRGVKVRQ      G+KP
Sbjct  654   QEGDFIVIYSDVKCGKYLIRGVKVRQ----PTGQKP  685


 Score = 91.7 bits (226),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LA +F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  240   SSLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  299

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  300   LEWVQTNHLQ  309



>gb|ABW03098.1| ABI3-like factor [Pisum sativum]
Length=313

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 147/190 (77%), Gaps = 20/190 (11%)
 Frame = -3

Query  959  SNLGNWVYWSP-----AASEAP--------PPMVVLppaeaapqpppaqqQNHQKQSSSD  819
            +N  NW+YW       AAS AP        PP+          +     Q +HQ +++SD
Sbjct  95   ANQANWMYWQSMAGGKAASLAPVVRDEQTQPPV-------ERDRTNNQTQNSHQGRNASD  147

Query  818  RRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTS  639
            ++QG KPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAET LPEL++RDGISI MEDIGTS
Sbjct  148  KKQGWKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELEARDGISITMEDIGTS  207

Query  638  RVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHG  459
            RVWNM+YR+WPNNKSRMYLLENTGDFV+ANGLQEGDFIV+Y+D+KCGK++IRGVKVRQ G
Sbjct  208  RVWNMRYRYWPNNKSRMYLLENTGDFVKANGLQEGDFIVLYSDVKCGKFMIRGVKVRQQG  267

Query  458  ARSDGKKPAR  429
            A+ + KK  +
Sbjct  268  AKPEAKKTGK  277



>ref|XP_006299887.1| hypothetical protein CARUB_v10016094mg [Capsella rubella]
 gb|EOA32785.1| hypothetical protein CARUB_v10016094mg [Capsella rubella]
Length=722

 Score =   258 bits (659),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 182/268 (68%), Gaps = 11/268 (4%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P++  N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  412   PNSQYNQFGEPTGFTGYNMNPYQYPYIPPGQMRD---QRLLRLCSSATKEARKKRMARQR  468

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVL--PHQVSNLGNWVYWSPAASEAPPP  903
             R  SHH RH+NNN  +              V   L      +  G W+YW    S  PP 
Sbjct  469   RFLSHHHRHNNNNSTNQQNQNQVGETCTAAVAPQLNPVTTTTTGGTWMYWPNVPSVPPPQ  528

Query  902   MVVLppaeaapqpppaqqQNH--QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRI  729
             +      +       +   +   ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+LGRI
Sbjct  529   LPPPMETQLQTMDRASSAASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLGRI  588

Query  728   VLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRAN  549
             VLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFV+ N
Sbjct  589   VLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVKTN  648

Query  548   GLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             GLQEGDFIVIY+D+KCGKYLIRGVKVRQ
Sbjct  649   GLQEGDFIVIYSDVKCGKYLIRGVKVRQ  676


 Score = 90.9 bits (224),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LA +F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  235   SSLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  294

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  295   LEWVQTNHLQ  304



>ref|XP_009411203.1| PREDICTED: B3 domain-containing protein VP1-like [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   256 bits (655),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 162/223 (73%), Gaps = 17/223 (8%)
 Frame = -3

Query  1124  SSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLG-  948
             +SATKEARKKRMARQRRL+S               ++  +H  +  +    PH  S  G 
Sbjct  406   ASATKEARKKRMARQRRLASL--------------HHHRNHHNQSHLQHAHPHLGSTEGA  451

Query  947   --NWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLL  774
               NW +W+ ++S +     +       P   P ++  H   S+S++RQG K EKNLKFLL
Sbjct  452   ARNWAFWTNSSSSSHKRNHLAETQTPPPAAQPQRRSPHGAASTSEKRQGWKGEKNLKFLL  511

Query  773   QKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKS  594
             QKVLKQSDVGSLGRIVLPKKEAET LPEL +RDGISI MEDIGTS+VWNM+YRFWPNNKS
Sbjct  512   QKVLKQSDVGSLGRIVLPKKEAETHLPELGARDGISIPMEDIGTSQVWNMRYRFWPNNKS  571

Query  593   RMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             RMYLLENTGDFVR+NGLQEGDFIVIY+D+KCGKY+IRGVKVRQ
Sbjct  572   RMYLLENTGDFVRSNGLQEGDFIVIYSDVKCGKYMIRGVKVRQ  614


 Score = 98.2 bits (243),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 67/104 (64%), Gaps = 12/104 (12%)
 Frame = -3

Query  1973  QAAAARSQFEELQQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRN  1794
             + A++    E +QQ Q+ +D+ +             ELA +F DWL+ NKD ISAED+R+
Sbjct  179   EEASSEGHGEGVQQRQQLEDTSS------------DELARVFLDWLRSNKDSISAEDLRS  226

Query  1793  IKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNSR  1662
             IKLKR+TIE A +RLG +K G+ QLLKLIL WVQ   LQ+K  R
Sbjct  227   IKLKRATIECADRRLGRTKHGRMQLLKLILTWVQNSHLQRKRHR  270



>ref|XP_010488574.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Camelina sativa]
Length=730

 Score =   258 bits (658),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 154/275 (56%), Positives = 182/275 (66%), Gaps = 20/275 (7%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P+   N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  415   PNPQYNQFGEPTGFTGYNMNPYQYPYIPPGQMRD---QRLLRLCSSATKEARKKRMARQR  471

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH-----QVSNLGNWVYWSPAASEA  912
             R  SHH RH+NNN++   Q     + +      V P        +  G W+YW    S  
Sbjct  472   RFLSHHHRHNNNNNNSTNQQN--QNQVGETCTAVAPQLNPVATTATGGTWMYWPNVPSVP  529

Query  911   PPPMVVLppaeaapqpppaqqQNHQKQSSS------DRRQGSKPEKNLKFLLQKVLKQSD  750
             P     +           +     ++Q         DRRQG KPEKNL+FLLQKVLKQSD
Sbjct  530   PQLPPPMETQLPTMDRAGSASAMPRQQVVPVPVPVPDRRQGWKPEKNLRFLLQKVLKQSD  589

Query  749   VGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENT  570
             VG+LGRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENT
Sbjct  590   VGNLGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENT  649

Query  569   GDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             GDFV+ NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ
Sbjct  650   GDFVKTNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ  684


 Score = 91.3 bits (225),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/70 (59%), Positives = 55/70 (79%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LA +F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  298   LEWVQTNHLQ  307



>ref|XP_010466887.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Camelina sativa]
Length=726

 Score =   258 bits (658),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 157/270 (58%), Positives = 183/270 (68%), Gaps = 13/270 (5%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P+   N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  414   PNPQYNQFGEPTGFTGYNMNPYQYPYIPPGQMRD---QRLLRLCSSATKEARKKRMARQR  470

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNL--GNWVYWSPAASEAPPP  903
             R  SHH RH+NNN+  + QN +        V   L    +N   G W+YW    S  P  
Sbjct  471   RFLSHHHRHNNNNNSTNQQNQNQVGETCAAVAPQLNPVATNATGGTWMYWPNVPSVPPQL  530

Query  902   MVVLppaeaapqpppaqqQNHQKQ----SSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLG  735
                L           +     ++Q       DRRQG KPEKNL+FLLQKVLKQSDVG+LG
Sbjct  531   PPPLETQLPTMDRAGSASAMPRQQVVPVPVPDRRQGWKPEKNLRFLLQKVLKQSDVGNLG  590

Query  734   RIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVR  555
             RIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFV+
Sbjct  591   RIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVK  650

Query  554   ANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
              NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ
Sbjct  651   TNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ  680


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LA +F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLATVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQKKNS  1665
             LEWVQ   LQ++ +
Sbjct  298   LEWVQTNHLQRRRT  311



>ref|XP_010684987.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=801

 Score =   258 bits (659),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 148/266 (56%), Positives = 169/266 (64%), Gaps = 45/266 (17%)
 Frame = -3

Query  1175  YP-YQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhh-----------  1032
             YP +  + G  E L+RLGSSATKEARKKRMARQRR  SH+ R  + N             
Sbjct  511   YPGFYYHPGPAEGLVRLGSSATKEARKKRMARQRRFFSHNHRSSHTNSQNNNNSNGVVNQ  570

Query  1031  hHAQNYDPHHAMRMGVDT--VLPHQVSNLGNWVYW----------------SPAASEAPP  906
                      HA  +G     V PH     GNWVYW                 P   +  P
Sbjct  571   QMINQMAEQHAAGIGNGNCGVAPH-----GNWVYWPPPPPSHVPPPQVNRSGPMVGQMMP  625

Query  905   PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
             P   +  +               KQ   +++QG K EKNL+FLLQKVLKQSDVG+LGRIV
Sbjct  626   PQPAIERSGN----------GFSKQVGIEKKQGWKTEKNLRFLLQKVLKQSDVGNLGRIV  675

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAET LPEL++RDGI IAMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+NG
Sbjct  676   LPKKEAETHLPELEARDGIPIAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNG  735

Query  545   LQEGDFIVIYADMKCGKYLIRGVKVR  468
             LQEGDFIVIY+D+KCGKY+IRGVKVR
Sbjct  736   LQEGDFIVIYSDVKCGKYMIRGVKVR  761


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = -3

Query  1913  SKAAETADLSFLQGNG--ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSS  1740
             S   E   ++F  G+   +LA +FF+WLK NK+ ISA D+RNIK+K+STIE+A+KRLG  
Sbjct  272   SGGGEDGGVNFGSGSSPDDLAMVFFEWLKSNKEMISAADLRNIKIKKSTIENAAKRLGGG  331

Query  1739  KEGKKQLLKLILEWVQQYQLQKK  1671
             KEG KQLLKLIL+WVQ + LQ K
Sbjct  332   KEGMKQLLKLILQWVQNHHLQNK  354



>ref|XP_010513655.1| PREDICTED: B3 domain-containing transcription factor ABI3 [Camelina 
sativa]
Length=734

 Score =   255 bits (651),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 184/272 (68%), Gaps = 15/272 (6%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P+   N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  420   PNPQYNQFGEPTGFTGYNMNPYQYPYIPPGQMRD---QRLLRLCSSATKEARKKRMARQR  476

Query  1076  RLSShhfrhhnnnhhhHAQNYDPHHA--MRMGVDTVLPHQVSNL--GNWVYWSPAASEAP  909
             R  SHH RH+NNN+++     + +        V   L    +N   G W+YW    S  P
Sbjct  477   RFLSHHHRHNNNNNNNSTNQQNQNQVGETCAAVAPQLNPVATNATGGTWMYWPNVPSVPP  536

Query  908   PPMVVLppaeaapqpppaqqQNHQKQSSS----DRRQGSKPEKNLKFLLQKVLKQSDVGS  741
                  +           +     ++Q       DRRQG KPEKNL+FLLQKVLKQSDVG+
Sbjct  537   QLPPPMETQLPMMDRAGSASAMPRQQVVPVPVPDRRQGWKPEKNLRFLLQKVLKQSDVGN  596

Query  740   LGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDF  561
             LGRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDF
Sbjct  597   LGRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDF  656

Query  560   VRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             V++NGLQEGDFIVIY+D+KCGKYLIRGVKVRQ
Sbjct  657   VKSNGLQEGDFIVIYSDVKCGKYLIRGVKVRQ  688


 Score = 94.7 bits (234),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LA +F +WLK NKD +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLATVFLEWLKNNKDTVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQKK  1671
             LEWVQ   LQ++
Sbjct  298   LEWVQTNHLQRR  309



>ref|XP_010684986.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=803

 Score =   253 bits (646),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/268 (55%), Positives = 169/268 (63%), Gaps = 47/268 (18%)
 Frame = -3

Query  1175  YP-YQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhh-----------  1032
             YP +  + G  E L+RLGSSATKEARKKRMARQRR  SH+ R  + N             
Sbjct  511   YPGFYYHPGPAEGLVRLGSSATKEARKKRMARQRRFFSHNHRSSHTNSQNNNNSNGVVNQ  570

Query  1031  hHAQNYDPHHAMRMGVDT--VLPHQVSNLGNWVYW----------------SPAASEAPP  906
                      HA  +G     V PH     GNWVYW                 P   +  P
Sbjct  571   QMINQMAEQHAAGIGNGNCGVAPH-----GNWVYWPPPPPSHVPPPQVNRSGPMVGQMMP  625

Query  905   PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
             P   +  +               KQ   +++QG K EKNL+FLLQKVLKQSDVG+LGRIV
Sbjct  626   PQPAIERSGN----------GFSKQVGIEKKQGWKTEKNLRFLLQKVLKQSDVGNLGRIV  675

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY--RFWPNNKSRMYLLENTGDFVRA  552
             LPKKEAET LPEL++RDGI IAMEDIGTSRVWNM+Y  RFWPNNKSRMYLLENTGDFVR+
Sbjct  676   LPKKEAETHLPELEARDGIPIAMEDIGTSRVWNMRYSVRFWPNNKSRMYLLENTGDFVRS  735

Query  551   NGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             NGLQEGDFIVIY+D+KCGKY+IRGVKVR
Sbjct  736   NGLQEGDFIVIYSDVKCGKYMIRGVKVR  763


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 62/83 (75%), Gaps = 2/83 (2%)
 Frame = -3

Query  1913  SKAAETADLSFLQGNG--ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSS  1740
             S   E   ++F  G+   +LA +FF+WLK NK+ ISA D+RNIK+K+STIE+A+KRLG  
Sbjct  272   SGGGEDGGVNFGSGSSPDDLAMVFFEWLKSNKEMISAADLRNIKIKKSTIENAAKRLGGG  331

Query  1739  KEGKKQLLKLILEWVQQYQLQKK  1671
             KEG KQLLKLIL+WVQ + LQ K
Sbjct  332   KEGMKQLLKLILQWVQNHHLQNK  354



>emb|CAA05484.1| ABI3 protein [Arabidopsis thaliana]
Length=715

 Score =   250 bits (639),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 152/281 (54%), Positives = 185/281 (66%), Gaps = 26/281 (9%)
 Frame = -3

Query  1244  PDNNNNRIAAESGHQPQALYGSEYPY----QLYDGNGERLMRLGSSATKEARKKRMARQR  1077
             P +  N+    +G     +   +YPY    Q+ D   +RL+RL SSATKEARKKRMARQR
Sbjct  411   PTSQYNQFGDPTGFNGYNMNPYQYPYVPAGQMRD---QRLLRLCSSATKEARKKRMARQR  467

Query  1076  RLSS-----hhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWS--PAAS  918
             R  S     ++  ++NNN  +  Q  +   A+   ++ V     +  G W+YW   PA  
Sbjct  468   RFLSHHHRHNNNNNNNNNQQNQTQIGETCAAVAPQLNPVA--TTATGGTWMYWPNVPAVP  525

Query  917   EAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSL  738
                PP  V+           +     ++Q   DRRQG KPEKNL+FLLQKVLKQSDVG+L
Sbjct  526   PQLPP--VMETQLPTMDRAGSASAMPRQQVVPDRRQGWKPEKNLRFLLQKVLKQSDVGNL  583

Query  737   GRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFV  558
             GRIVLPKKEAET LPEL++RDGIS+AMEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFV
Sbjct  584   GRIVLPKKEAETHLPELEARDGISLAMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFV  643

Query  557   RANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             + NGLQEGDFIVIY+D+K    LIRGVKVRQ      G+KP
Sbjct  644   KTNGLQEGDFIVIYSDVK----LIRGVKVRQ----PSGQKP  676


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -3

Query  1886  SFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLI  1707
             S L+ + +LAA+F +WLK NK+ +SAED+R +K+K++TIESA++RLG  KE  KQLLKLI
Sbjct  238   SSLEQDDDLAAVFLEWLKNNKETVSAEDLRKVKIKKATIESAARRLGGGKEAMKQLLKLI  297

Query  1706  LEWVQQYQLQ  1677
             LEWVQ   LQ
Sbjct  298   LEWVQTNHLQ  307



>tpg|DAA56193.1| TPA: viviparous1 [Zea mays]
Length=691

 Score =   248 bits (634),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 166/244 (68%), Gaps = 20/244 (8%)
 Frame = -3

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +R+  + +SATKEARKKRMARQRRLS    +          Q     H       +    
Sbjct  378   QRMAGVEASATKEARKKRMARQRRLSCLQQQRSQQLSLGQIQAS--VHLQEPSPRSTHSG  435

Query  965   QVS-NLGNWVYWSPAA-------------SEAPPPMV----VLppaeaapqpppaqqQNH  840
              V+ + G W +WSP++             S APPP +    V P  + AP        +H
Sbjct  436   PVTPSAGGWGFWSPSSQQQVQNPLSKSNSSRAPPPSLEAAAVAPQTKPAPAGARQDDIHH  495

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             +  ++SD+RQG+K +KNL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RDGISI 
Sbjct  496   RLAAASDKRQGAKADKNLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGISIP  555

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTG+FVR+N LQEGDFIVIY+D+K GKYLIRG
Sbjct  556   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGDFIVIYSDVKSGKYLIRG  615

Query  479   VKVR  468
             VKVR
Sbjct  616   VKVR  619


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             EL   F +WL  N++ ISAED+R I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  167   ELPRFFMEWLTSNRENISAEDLRGIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  226

Query  1685  QLQKKNSRE  1659
              LQ+K  R+
Sbjct  227   HLQRKRPRD  235



>ref|XP_009387503.1| PREDICTED: regulatory protein viviparous-1-like [Musa acuminata 
subsp. malaccensis]
Length=829

 Score =   249 bits (637),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 152/303 (50%), Positives = 185/303 (61%), Gaps = 37/303 (12%)
 Frame = -3

Query  1262  PSFNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMAR  1083
             P F PYP  + +   + +  Q      +++        G+RL    +SATKEARKKRMAR
Sbjct  500   PQFAPYPGTSASHPLSMAPPQYSGGMTNQFLGHPMYHQGQRLPGT-TSATKEARKKRMAR  558

Query  1082  QRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPPP  903
             QRR SS H   ++N   H    + P  +      +      SN  NW +W+  +S +   
Sbjct  559   QRRFSSLHQHRNHNQPLHLQHAHHPVGSTEGANGS----SHSNTRNWGFWTSMSSSS---  611

Query  902   MVVLppaeaapqpppaqqQNHQKQ-----------------SSSDRRQGSKPEKNLKFLL  774
                    +           N Q+                  S+S++RQG K EKNLKFLL
Sbjct  612   ------HQMNHMAEAQNASNMQQTPPPPAAQLPQRPQLTTASTSEKRQGWKGEKNLKFLL  665

Query  773   QKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKS  594
             QKVLKQSDVGSLGRIVLPKKEAET LPELD+RDGISI MEDIGTS+VWNM+YRFWPNNKS
Sbjct  666   QKVLKQSDVGSLGRIVLPKKEAETHLPELDARDGISIPMEDIGTSQVWNMRYRFWPNNKS  725

Query  593   RMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ------HGARSDGKKPA  432
             RMYLLENTGDFVR+NGLQEGDFIVIY+D+KCGKY+IRGVKVRQ        +R+ GK   
Sbjct  726   RMYLLENTGDFVRSNGLQEGDFIVIYSDVKCGKYMIRGVKVRQPVEARAPSSRNTGKAHQ  785

Query  431   RKN  423
             R+N
Sbjct  786   RRN  788


 Score = 94.0 bits (232),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             LA IF +WL+ NKD IS ED+R+IKLKR+TIE A++RLG +K+G+ QLLKLIL WVQ   
Sbjct  327   LARIFLEWLRSNKDSISPEDLRSIKLKRATIECAARRLGRTKQGRTQLLKLILTWVQNNH  386

Query  1682  LQKKNSR  1662
             LQ+K  R
Sbjct  387   LQRKRHR  393



>ref|NP_001105540.1| regulatory protein viviparous-1 [Zea mays]
 sp|P26307.1|VIV1_MAIZE RecName: Full=Regulatory protein viviparous-1 [Zea mays]
 gb|AAA33506.1| viviparous-1 [Zea mays]
Length=691

 Score =   244 bits (622),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 166/244 (68%), Gaps = 20/244 (8%)
 Frame = -3

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +R+  + +SATKEARKKRMARQRRLS    +          Q     H       +    
Sbjct  378   QRMAGVEASATKEARKKRMARQRRLSCLQQQRSQQLSLGQIQTS--VHLQEPSPRSTHSG  435

Query  965   QVS-NLGNWVYWSPAA-------------SEAPPPMVVLppaeaapqpppaqqQ----NH  840
              V+ + G W +WSP++             S APP  +    A    +P PA  +    +H
Sbjct  436   PVTPSAGGWGFWSPSSQQQVQNPLSKSNSSRAPPSSLEAAAAAPQTKPAPAGARQDDIHH  495

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             +  ++SD+RQG+K +KNL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RDGISI 
Sbjct  496   RLAAASDKRQGAKADKNLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGISIP  555

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTG+FVR+N LQEGDFIVIY+D+K GKYLIRG
Sbjct  556   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGDFIVIYSDVKSGKYLIRG  615

Query  479   VKVR  468
             VKVR
Sbjct  616   VKVR  619


 Score = 88.2 bits (217),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             EL   F +WL  N++ ISAED+R I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  167   ELPRFFMEWLTSNRENISAEDLRGIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  226

Query  1685  QLQKKNSRE  1659
              LQ+K  R+
Sbjct  227   HLQRKRPRD  235



>ref|XP_004971015.1| PREDICTED: regulatory protein viviparous-1-like [Setaria italica]
Length=704

 Score =   244 bits (623),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 178/277 (64%), Gaps = 24/277 (9%)
 Frame = -3

Query  1187  YGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDP  1008
             +G +Y    +    +R+    +SATKEARKKRMARQRRLS    +   +   + AQ   P
Sbjct  376   FGGQYGGAAHPMGPQRMAGGEASATKEARKKRMARQRRLSC--LQQQRSQQLNLAQIQVP  433

Query  1007  HHAMRMGVDTVLPHQVS-NLGNWVYWSPA-------------ASEAP-------PPMVVL  891
              H       +V    V+ + G W +WSP              +S AP       P     
Sbjct  434   VHPQEPSPRSVHSAPVTPSGGGWGFWSPGSQQQVQNPLSKSNSSRAPMQQVPRSPEAPAE  493

Query  890   ppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKE  711
                   P P   Q+++ Q+ ++SD+RQG+K +KNL++LLQKVLKQSDVGSLGRIVLPKKE
Sbjct  494   GAPPVNPAPGARQEESPQRSTASDKRQGAKSDKNLRYLLQKVLKQSDVGSLGRIVLPKKE  553

Query  710   AETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGD  531
             AE  LPEL +RDGISI MEDIGTSRVWNM+YRFWPNNKSRMYLLENTG+FVR+N LQEGD
Sbjct  554   AEVHLPELKTRDGISIPMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGD  613

Query  530   FIVIYADMKCGKYLIRGVKVR-QHGARSDGKKPARKN  423
             FIVIY+D+K GKYLIRGVKVR  H  + +G     KN
Sbjct  614   FIVIYSDVKSGKYLIRGVKVRPAHQDQGNGSSAVGKN  650


 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WL  N++ ISAED+R+I+L+RSTIE+A+ RLG  + G  QLLKLIL WVQ +
Sbjct  176   DLPRFFMEWLTSNRENISAEDLRSIRLRRSTIEAAAARLGGGRHGTMQLLKLILTWVQNH  235

Query  1685  QLQKKNSRE  1659
              LQ+K  R+
Sbjct  236   HLQRKRPRD  244



>ref|XP_006852120.1| hypothetical protein AMTR_s00049p00034730 [Amborella trichopoda]
 gb|ERN13587.1| hypothetical protein AMTR_s00049p00034730 [Amborella trichopoda]
Length=661

 Score =   242 bits (618),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 165/233 (71%), Gaps = 16/233 (7%)
 Frame = -3

Query  1124  SSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGN  945
             +SATKEARKKRMARQRR  SHH   H ++  H+ ++      M++  + ++ +     G 
Sbjct  413   ASATKEARKKRMARQRRFLSHHHHSHGHHGRHNGEHG---RGMQVNEEGLVSNGGEKRGV  469

Query  944   WVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKV  765
             W   S         ++V               Q   +  +S+RRQG KPEKNLKFLLQKV
Sbjct  470   WSSSSVMEGGVSDHVLV-------------HGQGFNRHVASERRQGWKPEKNLKFLLQKV  516

Query  764   LKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMY  585
             LKQSDVG+LGRIVLPKKEAET LPEL++RDGI+I MEDIGTSRVWNM+YRFWPNNKSRMY
Sbjct  517   LKQSDVGNLGRIVLPKKEAETHLPELEARDGITIVMEDIGTSRVWNMRYRFWPNNKSRMY  576

Query  584   LLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKPARK  426
             LLENTGDFVR+NGLQEGDFIVIY+D KCGKY+IRGVKV +  ++++ K P  K
Sbjct  577   LLENTGDFVRSNGLQEGDFIVIYSDTKCGKYMIRGVKVPRQESKAETKMPMIK  629


 Score = 94.0 bits (232),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/69 (61%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ELA +FF+WLK NK+ IS E++R+IKL+RSTIESA++RLG  +EG  QLLKLIL WVQ +
Sbjct  187   ELAKVFFEWLKSNKESISPEELRSIKLRRSTIESAARRLGGGREGMMQLLKLILAWVQNH  246

Query  1685  QLQKKNSRE  1659
              LQ++ + E
Sbjct  247   HLQRRRNAE  255



>ref|XP_010527216.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
isoform X1 [Tarenaya hassleriana]
Length=701

 Score =   243 bits (619),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 139/253 (55%), Positives = 160/253 (63%), Gaps = 40/253 (16%)
 Frame = -3

Query  1175  YPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLSS------hhfrhhnnnhhhHAQNY  1014
             YPY       +R  RL SSATKEARKKRMARQR+  S      +     + +  +  QN 
Sbjct  437   YPYMPGRMGDQRFPRLCSSATKEARKKRMARQRKFLSHHNRHRNATNADSLSQQNMNQNQ  496

Query  1013  DPHHAMRMGVDTVLPHQVS-------NLGNWVYWSPAASEAPPPMVVLppaeaapqpppa  855
                HA+    DT    Q +         G W+YW P   E     ++             
Sbjct  497   IGEHAI--ARDTFTAVQAAGAVAPPDTAGGWMYW-PNVWETVESQLM-------------  540

Query  854   qqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRD  675
                          RQG K EK+L+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++RD
Sbjct  541   -----------QPRQGWKQEKSLRFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELETRD  589

Query  674   GISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  495
             GIS+AMEDIGTSRVWNM+YRFWPNN SRMYLLENTGDFV+ANGL EGDFIVIY+D+KCGK
Sbjct  590   GISLAMEDIGTSRVWNMRYRFWPNNNSRMYLLENTGDFVKANGLGEGDFIVIYSDIKCGK  649

Query  494   YLIRGVKVRQHGA  456
             YLIRGVKVRQ  A
Sbjct  650   YLIRGVKVRQRAA  662


 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = -3

Query  1946  EELQQNQEDDDSKAAETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIE  1767
             +E  QN+E D          +  Q   +LA +F  WLK NK+ +SA+D+R +K+K++TIE
Sbjct  206   QEALQNRESDVPFHRLEDQHTIEQDKEDLATVFLKWLKSNKETVSADDLRKVKIKKATIE  265

Query  1766  SASKRLGSSKEGKKQLLKLILEWVQQYQLQKKNS  1665
             SA++RLG  K+  KQLLKLILEWVQ   L K+++
Sbjct  266   SAARRLGGGKKAMKQLLKLILEWVQTNHLHKRHN  299



>ref|XP_008673439.1| PREDICTED: regulatory protein viviparous-1 isoform X1 [Zea mays]
 gb|ACN25691.1| unknown [Zea mays]
 gb|AFU81654.1| ABI3VP1-type transcription factor, partial [Zea mays subsp. mays]
 tpg|DAA56194.1| TPA: viviparous1 [Zea mays]
Length=690

 Score =   242 bits (617),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 165/244 (68%), Gaps = 21/244 (9%)
 Frame = -3

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH  966
             +R+  + +SATKEARKKRMARQRRLS    +          Q     H       +    
Sbjct  378   QRMAGVEASATKEARKKRMARQRRLSCLQQQRSQQLSLGQIQAS--VHLQEPSPRSTHSG  435

Query  965   QVS-NLGNWVYWSPAA-------------SEAPPPMV----VLppaeaapqpppaqqQNH  840
              V+ + G W +WSP++             S APPP +    V P  + AP        +H
Sbjct  436   PVTPSAGGWGFWSPSSQQQVQNPLSKSNSSRAPPPSLEAAAVAPQTKPAPAGARQDDIHH  495

Query  839   QKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIA  660
             +  ++SD+RQG+K +KNL+FLLQKVLKQSDVGSLGRIVLPK EAE  LPEL +RDGISI 
Sbjct  496   RLAAASDKRQGAKADKNLRFLLQKVLKQSDVGSLGRIVLPK-EAEVHLPELKTRDGISIP  554

Query  659   MEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRG  480
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTG+FVR+N LQEGDFIVIY+D+K GKYLIRG
Sbjct  555   MEDIGTSRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGDFIVIYSDVKSGKYLIRG  614

Query  479   VKVR  468
             VKVR
Sbjct  615   VKVR  618


 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/69 (55%), Positives = 51/69 (74%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             EL   F +WL  N++ ISAED+R I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  167   ELPRFFMEWLTSNRENISAEDLRGIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  226

Query  1685  QLQKKNSRE  1659
              LQ+K  R+
Sbjct  227   HLQRKRPRD  235



>gb|ABE73191.1| viviparous 1 [Avena fatua]
Length=428

 Score =   235 bits (599),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQV  960
             L  +  SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V
Sbjct  130   LAGVKPSASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSV  189

Query  959   S----NLGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSD  819
                  + G W   W P + +         P P+   P + +  +          +  SS 
Sbjct  190   PVSPPSPGGWCGLWPPPSVQVQGQGQLMVPDPLSTKPSSSSRQKAQKPSPVAGARPPSSG  249

Query  818   RRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
              +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIG
Sbjct  250   AQQGAKPGADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIG  309

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             TSRVW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  310   TSRVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  368



>gb|ABE73186.1| viviparous 1 [Avena fatua]
Length=427

 Score =   235 bits (599),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQV  960
             L  +  SA+KEARKKRMARQRRLS    R     +    QN   H    +       H V
Sbjct  130   LAGVKPSASKEARKKRMARQRRLSCLQHRRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSV  189

Query  959   S----NLGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSD  819
                  + G W   W P + +         P P+   P + +  +          +  SS 
Sbjct  190   PVSPPSPGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPSSSSRQKAQKPSPDAGARPPSSG  249

Query  818   RRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
              +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIG
Sbjct  250   AQQGAKPGADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIG  309

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             TSRVW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  310   TSRVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  368



>gb|ABE73187.1| viviparous 1 [Avena fatua]
Length=426

 Score =   234 bits (598),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 156/239 (65%), Gaps = 15/239 (6%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQV  960
             L  +  SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V
Sbjct  130   LAGVKPSASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSV  189

Query  959   S----NLGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSD  819
                  + G W   W P + +         P P+   P + +  +          +  SS 
Sbjct  190   PVSPPSPGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPSSSSRQKAQKPSPDAGARPPSSG  249

Query  818   RRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
              +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIG
Sbjct  250   AQQGAKPGADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIG  309

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             TSRVW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  310   TSRVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  368



>gb|ABE73193.1| viviparous 1 [Avena fatua]
Length=428

 Score =   234 bits (598),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 154/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  1121  SATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVS----N  954
             SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V     +
Sbjct  136   SASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSVPVSPPS  195

Query  953   LGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSK  801
              G W   W P + +         P P+   P + +  +          +  SS  +QG+K
Sbjct  196   PGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPNSSSRQKAQKPSPDAGARPPSSGAQQGAK  255

Query  800   P--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
             P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIGTSRVW+
Sbjct  256   PAADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIGTSRVWS  315

Query  626   MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  316   MRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  368



>ref|XP_002458965.1| hypothetical protein SORBIDRAFT_03g043480 [Sorghum bicolor]
 gb|EES04085.1| hypothetical protein SORBIDRAFT_03g043480 [Sorghum bicolor]
Length=701

 Score =   241 bits (614),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 164/249 (66%), Gaps = 30/249 (12%)
 Frame = -3

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNY------DPHHAMRMGV  984
             +R+  + +SATKEARKKRMARQRRLS    + +   +    Q         P  A    V
Sbjct  392   QRMAGVEASATKEARKKRMARQRRLSCLQQQRNQQLNLGQIQGSVHPQEPSPRSAHSTPV  451

Query  983   DTVLPHQVSNLGNWVYWSPAA--------------SEAPPPMVVLppaeaapqpppaqqQ  846
                      + G W +WSP++              S  P P+ +        +P P  + 
Sbjct  452   -------TPSAGGWGFWSPSSQQQVQNPLSIKSNSSGEPVPLSLEAVTAPPAKPAPGARL  504

Query  845   NHQKQ---SSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRD  675
             +   Q   ++SD+RQG+K +KNL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RD
Sbjct  505   DDSPQRLAAASDKRQGAKADKNLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRD  564

Query  674   GISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  495
             GISI MEDIGTSRVWNM+YRFWPNNKSRMYLLENTG+FVR+N LQEGDFIVIY+D+K GK
Sbjct  565   GISIPMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGDFIVIYSDVKSGK  624

Query  494   YLIRGVKVR  468
             +LIRGVKVR
Sbjct  625   FLIRGVKVR  633


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/78 (53%), Positives = 54/78 (69%), Gaps = 0/78 (0%)
 Frame = -3

Query  1892  DLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLK  1713
             D S +    EL   F +WL  N++ ISAED+R I+L+RSTIE+A+ RLG  ++G  QLLK
Sbjct  168   DASSVAAGEELPRFFMEWLTSNRENISAEDLRGIRLRRSTIEAAAARLGGGRQGNMQLLK  227

Query  1712  LILEWVQQYQLQKKNSRE  1659
             LIL WVQ + LQKK  R+
Sbjct  228   LILTWVQNHHLQKKRPRD  245



>gb|ABE73195.1| viviparous 1 [Avena fatua]
Length=436

 Score =   234 bits (596),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 154/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  1121  SATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVS----N  954
             SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V     +
Sbjct  143   SASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSVPVSPPS  202

Query  953   LGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSK  801
              G W   W P + +         P P+   P + +  +          +  SS  +QG+K
Sbjct  203   PGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPNSSSRQEAQKPSPDAGARPPSSGAQQGAK  262

Query  800   P--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
             P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIGTSRVW+
Sbjct  263   PAADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIGTSRVWS  322

Query  626   MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  323   MRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  375



>gb|ABE73197.1| viviparous 1 [Avena fatua]
Length=397

 Score =   233 bits (593),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 157/246 (64%), Gaps = 15/246 (6%)
 Frame = -3

Query  1160  YDGNGERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVD  981
             +    + L  +  SA+KEARKKRMARQRRLS    +     +    QN   H    +   
Sbjct  130   FGACSQPLAGVEPSASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFS  189

Query  980   TVLPHQVS----NLGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNH  840
                 H V     + G W   W P + +         P P+   P + +  +         
Sbjct  190   PRSAHSVPVSPPSPGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPNSSSRQKAQKPSPDAG  249

Query  839   QKQSSSDRRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGIS  666
              +  SS  +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGIS
Sbjct  250   ARPPSSGAQQGAKPAADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGIS  309

Query  665   IAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             I MEDIGTSRVW+M+YRFWPNNKSRMYLLENTGDF R+N LQEGDFIVIY+D+K GKYLI
Sbjct  310   IPMEDIGTSRVWSMRYRFWPNNKSRMYLLENTGDFARSNELQEGDFIVIYSDVKSGKYLI  369

Query  485   RGVKVR  468
             RGVKVR
Sbjct  370   RGVKVR  375



>gb|ABE73189.1| viviparous 1 [Avena fatua]
Length=428

 Score =   233 bits (595),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 154/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  1121  SATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVS----N  954
             SA++EARKKRMARQRRLS    +     +    QN   H    +       H V     +
Sbjct  136   SASREARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSVPVSPPS  195

Query  953   LGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSK  801
              G W   W P + +         P P+   P + +  +          +  SS  +QG+K
Sbjct  196   PGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPNSSSRQKAQKPSPDAGARPPSSGAQQGAK  255

Query  800   P--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
             P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIGTSRVW+
Sbjct  256   PAADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIGTSRVWS  315

Query  626   MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  316   MRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  368



>gb|ABE73196.1| viviparous 1 [Avena fatua]
Length=435

 Score =   233 bits (593),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 153/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  1121  SATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVS----N  954
             SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V     +
Sbjct  143   SASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSVPGSPPS  202

Query  953   LGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSK  801
              G W   W P + +         P P+   P + +  +          +  SS  +QG+K
Sbjct  203   PGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPSSSSRQKAQKPSPDAGARPPSSGAQQGAK  262

Query  800   P--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
             P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIGTSRVW+
Sbjct  263   PGADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIGTSRVWS  322

Query  626   MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             M+YRFWPNNK RMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  323   MRYRFWPNNKRRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  375



>ref|XP_004290234.1| PREDICTED: B3 domain-containing transcription factor ABI3-like 
[Fragaria vesca subsp. vesca]
Length=727

 Score =   238 bits (607),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 169/332 (51%), Positives = 208/332 (63%), Gaps = 38/332 (11%)
 Frame = -3

Query  1343  TEYHQPAAVDTAQSWQ-SSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPY  1167
             +E +Q   ++TA +W  SS FM       ++  + D N  ++A  S HQ Q   G    Y
Sbjct  386   SEQYQNQMLETAPTWPPSSPFMGN-----NYGSFQDTNV-QLAPTSQHQQQQFSGYGGQY  439

Query  1166  QLYDG----NGE-RLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHH  1002
               Y      +GE +L+RL SSATKEARKKRM RQRR  SHH RHH +      QN  P+ 
Sbjct  440   GQYQYFGGHSGEPQLVRLASSATKEARKKRMQRQRRTLSHHGRHHGH-----QQNQHPNQ  494

Query  1001  AM-RMGVDTVLPHQVS------NLGNWVYW------------SPAASEAPPPMVVLppae  879
              + +  V  + P+  +      +  NW YW            SP   +   P        
Sbjct  495   MLDQRLVGNIDPNCTTAAMGNPSAANWFYWPTAAAGGPAPAASPTMVQNMTPEAAPSVLP  554

Query  878   aapqpppaqqQNHQKQSSSDRRQGSKPE--KNLKFLLQKVLKQSDVGSLGRIVLPKKEAE  705
                     Q  N  + +  +RRQG KP+  KNL+FLLQKVLKQSDVG+LGRIVLPKKEAE
Sbjct  555   VDRPASQGQNYNPGRINVQERRQGWKPDQNKNLRFLLQKVLKQSDVGNLGRIVLPKKEAE  614

Query  704   TQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFI  525
             T LPEL++RDGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLENTGDFVRANGLQEGDFI
Sbjct  615   THLPELEARDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENTGDFVRANGLQEGDFI  674

Query  524   VIYADMKCGKYLIRGVKVRQHGARSDGKKPAR  429
             VIY+D+KC KY+IRGVKVRQ G +S+ K+P +
Sbjct  675   VIYSDIKCNKYMIRGVKVRQAGTKSETKRPGK  706


 Score = 90.1 bits (222),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A++F +WL+ N++ +SAED+R++K+K+STIE A++RLG  KE  KQLLKL+LEWVQ  
Sbjct  240   DMASVFLEWLRSNRETVSAEDLRSVKIKKSTIECAARRLGGGKEAMKQLLKLVLEWVQTN  299

Query  1685  QLQKK  1671
              LQK+
Sbjct  300   HLQKR  304



>gb|ABE73194.1| viviparous 1 [Avena fatua]
Length=436

 Score =   230 bits (586),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 153/233 (66%), Gaps = 15/233 (6%)
 Frame = -3

Query  1121  SATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVS----N  954
             SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V     +
Sbjct  143   SASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSVPVSPPS  202

Query  953   LGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSK  801
              G W   W P + +         P P+   P + +  +          +  SS  +QG+K
Sbjct  203   PGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPNSSSRQKAQKPSPDAGARPLSSGAQQGAK  262

Query  800   P--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
             P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL +RDGISI MEDIGTSRVW+
Sbjct  263   PAADKNLRFLLQKVLKQSDVGALGRIVLPKKEAETHLPELKTRDGISIPMEDIGTSRVWS  322

Query  626   MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GK LIRGVKVR
Sbjct  323   MRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKNLIRGVKVR  375



>dbj|BAA04066.1| VP1 protein [Oryza sativa Japonica Group]
Length=728

 Score =   236 bits (601),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 173/289 (60%), Gaps = 32/289 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNG---ERLMRLGSSATKEARKKRMA  1086
             F P+P ++ +     S   P    G  +P Q   G+     RL  +  S+TKEARKKRMA
Sbjct  359   FAPFPVSSTSSYTMPSVVPPPFTAG--FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMA  416

Query  1085  RQRRLS------ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             RQRRLS      S        +   H Q   P  A    V        +   +W  W PA
Sbjct  417   RQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTP----SSAGCRSWGIWPPA  472

Query  923   A---------SEAPPPMV-------VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             A            PPP            P         A  ++ Q+ ++S++RQ +K +K
Sbjct  473   AQIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQ-AKTDK  531

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RDG+SI MEDIGTS+VWNM+YRF
Sbjct  532   NLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRF  591

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             WPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR+
Sbjct  592   WPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRR  640


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  184   DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  243

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  244   HLQKKRPR  251



>pir||S43768 transcription activator VP1 - rice
Length=728

 Score =   235 bits (600),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 173/289 (60%), Gaps = 32/289 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNG---ERLMRLGSSATKEARKKRMA  1086
             F P+P ++ +     S   P    G  +P Q   G+     RL  +  S+TKEARKKRMA
Sbjct  359   FAPFPVSSTSSYTMPSVVPPPFTAG--FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMA  416

Query  1085  RQRRLS------ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             RQRRLS      S        +   H Q   P  A    V        +   +W  W PA
Sbjct  417   RQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTP----SSAGCRSWGIWPPA  472

Query  923   A---------SEAPPPMV-------VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             A            PPP            P         A  ++ Q+ ++S++RQ +K +K
Sbjct  473   AQIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQ-AKTDK  531

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RDG+SI MEDIGTS+VWNM+YRF
Sbjct  532   NLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRF  591

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             WPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR+
Sbjct  592   WPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRR  640


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  184   DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  243

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  244   HLQKKRPR  251



>gb|ABE73188.1| viviparous 1 [Avena fatua]
Length=427

 Score =   228 bits (582),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 155/239 (65%), Gaps = 16/239 (7%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQV  960
             L  +  SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V
Sbjct  130   LAGVKPSASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSV  189

Query  959   S----NLGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSD  819
                  + G W   W P + +         P P+   P + +  +          +  SS 
Sbjct  190   PVSPPSPGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPNSSSRQKAQKPSPDAGARPPSSG  249

Query  818   RRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
              +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPK EAET LPEL +RDGISI MEDIG
Sbjct  250   AQQGAKPAADKNLRFLLQKVLKQSDVGALGRIVLPK-EAETHLPELKTRDGISIPMEDIG  308

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             TSRVW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  309   TSRVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  367



>gb|EAY76922.1| hypothetical protein OsI_04880 [Oryza sativa Indica Group]
Length=727

 Score =   235 bits (600),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 173/289 (60%), Gaps = 32/289 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNG---ERLMRLGSSATKEARKKRMA  1086
             F P+P ++ +     S   P    G  +P Q   G+     RL  +  S+TKEARKKRMA
Sbjct  358   FAPFPVSSTSSYTMPSVVPPPFTAG--FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMA  415

Query  1085  RQRRLS------ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             RQRRLS      S        +   H Q   P  A    V        +   +W  W PA
Sbjct  416   RQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTP----SSAGCRSWGIWPPA  471

Query  923   A---------SEAPPPMV-------VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             A            PPP            P         A  ++ Q+ ++S++RQ +K +K
Sbjct  472   AQIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQ-AKTDK  530

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RDG+SI MEDIGTS+VWNM+YRF
Sbjct  531   NLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRF  590

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             WPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR+
Sbjct  591   WPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRR  639


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  183   DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  242

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  243   HLQKKRPR  250



>gb|EEE55867.1| hypothetical protein OsJ_04504 [Oryza sativa Japonica Group]
Length=705

 Score =   235 bits (599),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 144/289 (50%), Positives = 173/289 (60%), Gaps = 32/289 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNG---ERLMRLGSSATKEARKKRMA  1086
             F P+P ++ +     S   P    G  +P Q   G+     RL  +  S+TKEARKKRMA
Sbjct  336   FAPFPVSSTSSYTMPSVVPPPFTAG--FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMA  393

Query  1085  RQRRLS------ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             RQRRLS      S        +   H Q   P  A    V        +   +W  W PA
Sbjct  394   RQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTP----SSAGCRSWGIWPPA  449

Query  923   A---------SEAPPPMV-------VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             A            PPP            P         A  ++ Q+ ++S++RQ +K +K
Sbjct  450   AQIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQ-AKTDK  508

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RDG+SI MEDIGTS+VWNM+YRF
Sbjct  509   NLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRF  568

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             WPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR+
Sbjct  569   WPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRR  617


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  161   DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  220

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  221   HLQKKRPR  228



>gb|KCW58090.1| hypothetical protein EUGRSUZ_H00815 [Eucalyptus grandis]
Length=695

 Score =   232 bits (592),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 168/353 (48%), Positives = 204/353 (58%), Gaps = 75/353 (21%)
 Frame = -3

Query  1433  GYSNIGDPYNCGGGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSF  1254
             GY  +GDP    G     P H++   F  P EY     +++AQSW  S+F  AA      
Sbjct  376   GY--MGDPAYSHGA---PPDHLSGNPF--PPEYQM---INSAQSWPMSQFSMAAQPYD--  423

Query  1253  NPYPDNNNNRIAAESGHQPQALYG---SEYPYQLYDGNGERLMRLGSSATKEARKKRMAR  1083
               YP+N +         Q Q L G    +YP+Q Y+G+G+RL+RLGSSATKEARKKRMAR
Sbjct  424   --YPENFH------PPPQAQGLRGYQHHQYPFQYYNGHGQRLIRLGSSATKEARKKRMAR  475

Query  1082  QRR-LSShhfrhhnnnhhhHAQNYDP------HHAMRMGVDTVLP---HQVSNL-GNWVY  936
             QRR LS H   HH++   +   N+         HA   G +  +P   HQ  N  G+WVY
Sbjct  476   QRRFLSHHRSSHHHHQQSNQQGNHQSMAVAAEQHARLGGENCAIPEAAHQAHNHPGSWVY  535

Query  935   W-SPAAS---EAPP--PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLL  774
             W SPA +     PP  P +           P  QQQN+Q+Q + +RRQ            
Sbjct  536   WPSPAHAGQVAVPPSLPAMDPVQVAHPADQPAMQQQNYQRQVAPERRQ------------  583

Query  773   QKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKS  594
                                KEAET LPEL++RDGISIAMEDIGTS+VWNM+YRFWPNNKS
Sbjct  584   -------------------KEAETHLPELEARDGISIAMEDIGTSKVWNMRYRFWPNNKS  624

Query  593   RMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
             RMYLLENTGDFVRANGL+EGDFIVIY+D+KCGKYLIRGVKVRQ     +G KP
Sbjct  625   RMYLLENTGDFVRANGLEEGDFIVIYSDVKCGKYLIRGVKVRQ----PEGTKP  673


 Score = 85.9 bits (211),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 52/69 (75%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E+ A+  +WL +NKD IS +D+R IK+K++T+E+A+KRLG  +E  KQLLKLIL+WVQ  
Sbjct  228   EMGAVLLEWLTENKDDISPDDLRRIKIKKATVETAAKRLGGGREAMKQLLKLILQWVQTN  287

Query  1685  QLQKKNSRE  1659
              L KK  +E
Sbjct  288   HLHKKRLKE  296



>dbj|BAM75181.1| B3-type transcription factor [Ricinus communis]
Length=767

 Score =   232 bits (592),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 192/298 (64%), Gaps = 39/298 (13%)
 Frame = -3

Query  1433  GYS-NIGDPYNCG----GGASFTPMHVNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaa  1269
             GYS  +GD +  G     G S+ P          P EYH    +D+AQSW +S+F  A+ 
Sbjct  472   GYSLPLGDQFGNGTSTMAGHSYPP--------PQPAEYHM---LDSAQSWPASQFALAS-  519

Query  1268  aAPSFNPYPDNNNNRIAAESGH-QPQALYGSEYPYQLYDG-NGERLMRLGSSATKEARKK  1095
                 ++PYPDNN   I    GH Q    YG++YP Q   G  G+RLMRLGSSATKEARKK
Sbjct  520   ---QYSPYPDNNLQPI---PGHGQVFTGYGNQYPCQYLPGQGGDRLMRLGSSATKEARKK  573

Query  1094  RMARQRR-LSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPH--QVSNLGNWVYWSPA  924
             RMARQ+R LS H   +H++N  +  QN       R+G D  +P   Q ++ GNWVYW  A
Sbjct  574   RMARQKRFLSHHRNHNHHSNQPNQHQNQGADEHARLGNDNGVPATPQANHPGNWVYWPTA  633

Query  923   -----ASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLK  759
                  A  A P + V      A +P     QN ++Q++SD+RQG KPEKNL+FLLQKVLK
Sbjct  634   PPTHGAVSAAPVLPV----RTADRPAMQTAQNQRQQAASDKRQGWKPEKNLRFLLQKVLK  689

Query  758   QSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY--RFWPNNKSR  591
             QSDVG+LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+Y  RFWPNNKSR
Sbjct  690   QSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYSFRFWPNNKSR  747



>ref|XP_006645206.1| PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein 
VP1-like [Oryza brachyantha]
Length=721

 Score =   229 bits (585),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 134/250 (54%), Positives = 159/250 (64%), Gaps = 23/250 (9%)
 Frame = -3

Query  1145  ERLMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQ--NYDPHHAMRMGVDTVL  972
             +RL  +  SATKEARKKRMARQRRLS    +     +    Q   +    + R      +
Sbjct  381   QRLAGVEPSATKEARKKRMARQRRLSCLQQQRSQQINLSQIQISGHPQEPSPRAAHSAPV  440

Query  971   PHQVSNLGNWV-YWSPAAS-------------------EAPPPMVVLppaeaapqpppaq  852
                     +W   W PA                     + P P    P          AQ
Sbjct  441   TPSSGGCRSWPGIWPPAGQVIQNPLSNKPNNNPSTSKQQKPSPEKPKPAVSQPAAAVGAQ  500

Query  851   qQNHQKQSSSDRRQG-SKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRD  675
             Q++ Q+ ++S++RQ  +K +KNL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPEL +RD
Sbjct  501   QESPQRSAASEKRQAATKTDKNLRFLLQKVLKQSDVGSLGRIVLPKKEAEVHLPELKTRD  560

Query  674   GISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  495
             GISI MEDIGTS+VWNM+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+DMK GK
Sbjct  561   GISIPMEDIGTSQVWNMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDMKSGK  620

Query  494   YLIRGVKVRQ  465
             YLIRGVKVR+
Sbjct  621   YLIRGVKVRR  630


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -3

Query  1880  LQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILE  1701
             ++   +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL 
Sbjct  163   IEAADDLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILT  222

Query  1700  WVQQYQLQKKNSR  1662
             WVQ + LQKK  R
Sbjct  223   WVQNHHLQKKRPR  235



>emb|CAA04553.1| VP 1 [Avena fatua]
Length=665

 Score =   228 bits (582),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 131/239 (55%), Positives = 155/239 (65%), Gaps = 16/239 (7%)
 Frame = -3

Query  1139  LMRLGSSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQV  960
             L  +  SA+KEARKKRMARQRRLS    +     +    QN   H    +       H V
Sbjct  368   LAGVKPSASKEARKKRMARQRRLSCLQHQRSQQLNLGQIQNAMIHPQQEVPFSPRSAHSV  427

Query  959   S----NLGNWV-YWSPAASEA--------PPPMVVLppaeaapqpppaqqQNHQKQSSSD  819
                  + G W   W P + +         P P+   P + +  +          +  SS 
Sbjct  428   PVSPPSPGGWCGLWPPPSVQVQGQGQLMVPNPLSTKPSSSSRQKAQKPSPDAGARPPSSG  487

Query  818   RRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIG  645
              +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPK EAET LPEL +RDGISI MEDIG
Sbjct  488   AQQGAKPGADKNLRFLLQKVLKQSDVGALGRIVLPK-EAETHLPELKTRDGISIPMEDIG  546

Query  644   TSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
             TSRVW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR
Sbjct  547   TSRVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVR  605


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WL  N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  184   DLPRFFMEWLTNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  243

Query  1685  QLQKKNSR  1662
              LQKK +R
Sbjct  244   HLQKKRAR  251



>sp|P37398.3|VIV_ORYSJ RecName: Full=B3 domain-containing protein VP1; Short=OsVP1; 
AltName: Full=Protein viviparous homolog [Oryza sativa Japonica 
Group]
 dbj|BAD82433.1| VP1 protein, OSVP1 [Oryza sativa Japonica Group]
Length=727

 Score =   229 bits (584),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 172/289 (60%), Gaps = 33/289 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNG---ERLMRLGSSATKEARKKRMA  1086
             F P+P ++ +     S   P    G  +P Q   G+     RL  +  S+TKEARKKRMA
Sbjct  359   FAPFPVSSTSSYTMPSVVPPPFTAG--FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMA  416

Query  1085  RQRRLS------ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             RQRRLS      S        +   H Q   P  A    V        +   +W  W PA
Sbjct  417   RQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTP----SSAGCRSWGIWPPA  472

Query  923   A---------SEAPPPMV-------VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             A            PPP            P         A  ++ Q+ ++S++RQ +K +K
Sbjct  473   AQIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQ-AKTDK  531

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPK EAE  LPEL +RDG+SI MEDIGTS+VWNM+YRF
Sbjct  532   NLRFLLQKVLKQSDVGSLGRIVLPK-EAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRF  590

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             WPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR+
Sbjct  591   WPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRR  639


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  184   DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  243

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  244   HLQKKRPR  251



>ref|NP_001045162.2| Os01g0911700 [Oryza sativa Japonica Group]
 dbj|BAD82432.1| putative VP1 protein, OSVP1 [Oryza sativa Japonica Group]
 dbj|BAG93647.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07076.2| Os01g0911700 [Oryza sativa Japonica Group]
Length=704

 Score =   229 bits (583),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 143/289 (49%), Positives = 172/289 (60%), Gaps = 33/289 (11%)
 Frame = -3

Query  1256  FNPYPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNG---ERLMRLGSSATKEARKKRMA  1086
             F P+P ++ +     S   P    G  +P Q   G+     RL  +  S+TKEARKKRMA
Sbjct  336   FAPFPVSSTSSYTMPSVVPPPFTAG--FPGQYSGGHAMCSPRLAGVEPSSTKEARKKRMA  393

Query  1085  RQRRLS------ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA  924
             RQRRLS      S        +   H Q   P  A    V        +   +W  W PA
Sbjct  394   RQRRLSCLQQQRSQQLNLSQIHISGHPQEPSPRAAHSAPVTP----SSAGCRSWGIWPPA  449

Query  923   A---------SEAPPPMV-------VLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEK  792
             A            PPP            P         A  ++ Q+ ++S++RQ +K +K
Sbjct  450   AQIIQNPLSNKPNPPPATSKQPKPSPEKPKPKPQAAATAGAESLQRSTASEKRQ-AKTDK  508

Query  791   NLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRF  612
             NL+FLLQKVLKQSDVGSLGRIVLPK EAE  LPEL +RDG+SI MEDIGTS+VWNM+YRF
Sbjct  509   NLRFLLQKVLKQSDVGSLGRIVLPK-EAEVHLPELKTRDGVSIPMEDIGTSQVWNMRYRF  567

Query  611   WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
             WPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVKVR+
Sbjct  568   WPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDIKSGKYLIRGVKVRR  616


 Score = 87.8 bits (216),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L A F +WL  N++ ISA+D+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  161   DLPAFFMEWLTSNREYISADDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  220

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  221   HLQKKRPR  228



>ref|XP_008787720.1| PREDICTED: regulatory protein viviparous-1 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008787721.1| PREDICTED: regulatory protein viviparous-1 isoform X1 [Phoenix 
dactylifera]
Length=801

 Score =   229 bits (585),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = -3

Query  830  SSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMED  651
            S++DRRQG K EKNL+FLLQKVLKQSDVGSLGRIVLPKKEAE  LPELD+RDGISI MED
Sbjct  619  STADRRQGLKGEKNLRFLLQKVLKQSDVGSLGRIVLPKKEAEIHLPELDTRDGISIPMED  678

Query  650  IGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKV  471
            IGTS++WNM+YRFWPNNKSRMYLLENTG+FVR+NGLQEGDFIVIY+D+KCGKY+IRGVKV
Sbjct  679  IGTSQIWNMRYRFWPNNKSRMYLLENTGEFVRSNGLQEGDFIVIYSDIKCGKYMIRGVKV  738

Query  470  RQHGARSDGKK  438
            R    R    +
Sbjct  739  RPQTERGQASR  749


 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E+A +FF+W++ N+D IS +D+R I++KR+TI+ A + LG +++ K QLLKL+L WVQ  
Sbjct  234   EMARVFFEWMRINRDAISPQDLRQIRMKRATIDCAVRHLGGNRQAKVQLLKLVLTWVQAN  293

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  294   HLQKKKRR  301



>ref|XP_010926605.1| PREDICTED: regulatory protein viviparous-1 isoform X1 [Elaeis 
guineensis]
Length=808

 Score =   227 bits (578),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 132/161 (82%), Gaps = 1/161 (1%)
 Frame = -3

Query  932  SPAASEAPPPMVVLppaeaapqpppaqqQNHQ-KQSSSDRRQGSKPEKNLKFLLQKVLKQ  756
            +P     PPP   +   + +P  PP QQ +H+   SS+DRRQG K EKNL+FL QKVLKQ
Sbjct  591  NPMVETPPPPKSSMQQPQLSPSMPPQQQNSHRDAASSTDRRQGLKGEKNLRFLFQKVLKQ  650

Query  755  SDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLE  576
            SDVGSLGRIVLPKKEAE  LPEL++RDGISI +EDIGTS+VWNM+YRFWPNNKSRMYLLE
Sbjct  651  SDVGSLGRIVLPKKEAEIHLPELEARDGISIPVEDIGTSQVWNMRYRFWPNNKSRMYLLE  710

Query  575  NTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGAR  453
            NTG+FVR+NGLQEGDFI+IY+DMKCGKY+IRG+KVR    R
Sbjct  711  NTGEFVRSNGLQEGDFIIIYSDMKCGKYMIRGIKVRPQPER  751


 Score = 82.4 bits (202),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E+A +FF+W++ N+D IS +D+R I++KR+TI+ A + LG +++ + QLLKL+L WVQ  
Sbjct  238   EMARVFFEWMRINRDAISPQDLREIRMKRATIDCAVRHLGGNRQAQVQLLKLVLTWVQAN  297

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  298   HLQKKKRR  305



>gb|AAG22585.1|AF175576_1 transcription factor viviparous 1 [Picea abies]
Length=828

 Score =   225 bits (573),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/220 (57%), Positives = 145/220 (66%), Gaps = 46/220 (21%)
 Frame = -3

Query  1124  SSATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGN  945
             +++TKEARK RMARQRR  SHH            QN                        
Sbjct  508   AASTKEARKNRMARQRRSMSHHHH---------HQNRQ----------------------  536

Query  944   WVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQS--SSDRRQGSKPEKNLKFLLQ  771
                WS + +  P P   +                +Q+Q+   +DRRQG KPEK+LKFLLQ
Sbjct  537   ---WSSSTAMPPQPADTVNLTLM----------QYQRQTFMQTDRRQGWKPEKHLKFLLQ  583

Query  770   KVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSR  591
             KVLKQSDVG+LGRIVLPKKEAE  LPEL++RDGISIAMEDI TSRVWN++YRFWPNNKSR
Sbjct  584   KVLKQSDVGNLGRIVLPKKEAEIHLPELEARDGISIAMEDIVTSRVWNLRYRFWPNNKSR  643

Query  590   MYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKV  471
             MYLLENTGDFVR+NGLQEGDFIVIY+D K GKY+IRGVKV
Sbjct  644   MYLLENTGDFVRSNGLQEGDFIVIYSDTKTGKYMIRGVKV  683


 Score = 90.1 bits (222),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 51/65 (78%), Gaps = 0/65 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             EL  +FF+WLK N+D IS ED+R+IKLKRSTIE+A+K LG  K+G   LLKLIL WVQ +
Sbjct  254   ELPMVFFEWLKSNRDSISPEDLRSIKLKRSTIENAAKHLGGGKKGMLHLLKLILAWVQNH  313

Query  1685  QLQKK  1671
              LQ+K
Sbjct  314   HLQRK  318



>emb|CAC19186.1| VP1/ABI3-like protein [Callitropsis nootkatensis]
Length=794

 Score =   223 bits (567),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 147/220 (67%), Gaps = 43/220 (20%)
 Frame = -3

Query  1118  ATKEARKKRMARQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWV  939
             +TKEARK RMARQRR          ++HHHH QN                          
Sbjct  471   STKEARKNRMARQRR-------SMAHHHHHHHQNR-------------------------  498

Query  938   YWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQS--SSDRRQ--GSKPEKNLKFLLQ  771
             +W P+ S        L    +        Q   Q+Q+   +DRRQ  G KPEKNLKFLLQ
Sbjct  499   HWPPSTSP-------LSRQSSEQVNINIMQYQQQRQTYLQTDRRQVNGWKPEKNLKFLLQ  551

Query  770   KVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSR  591
             KVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIAMEDI TSRVWNM+YRFWPNNKSR
Sbjct  552   KVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIVTSRVWNMRYRFWPNNKSR  611

Query  590   MYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKV  471
             MYLLENTGDFVR+NGLQEGDFIV+Y+D K GKY+IRGVKV
Sbjct  612   MYLLENTGDFVRSNGLQEGDFIVLYSDTKTGKYMIRGVKV  651


 Score = 85.9 bits (211),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             EL  +FF+WLK N+D IS ED+R+IKLKRSTIE A+K+LG  K+    LLKLIL WVQ  
Sbjct  262   ELPMVFFEWLKSNRDSISPEDLRSIKLKRSTIELAAKQLGGGKKAMLHLLKLILAWVQNN  321

Query  1685  QLQKK  1671
              LQ+K
Sbjct  322   HLQRK  326



>ref|XP_010926606.1| PREDICTED: regulatory protein viviparous-1 isoform X2 [Elaeis 
guineensis]
Length=806

 Score =   218 bits (556),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 130/161 (81%), Gaps = 3/161 (2%)
 Frame = -3

Query  932  SPAASEAPPPMVVLppaeaapqpppaqqQNHQ-KQSSSDRRQGSKPEKNLKFLLQKVLKQ  756
            +P     PPP   +   + +P  PP QQ +H+   SS+DRRQG K EKNL+FL QKVLKQ
Sbjct  591  NPMVETPPPPKSSMQQPQLSPSMPPQQQNSHRDAASSTDRRQGLKGEKNLRFLFQKVLKQ  650

Query  755  SDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLE  576
            SDVGSLGRIVLPKKEAE  LPEL++RDGISI +EDIGTS+VWNM  RFWPNNKSRMYLLE
Sbjct  651  SDVGSLGRIVLPKKEAEIHLPELEARDGISIPVEDIGTSQVWNM--RFWPNNKSRMYLLE  708

Query  575  NTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGAR  453
            NTG+FVR+NGLQEGDFI+IY+DMKCGKY+IRG+KVR    R
Sbjct  709  NTGEFVRSNGLQEGDFIIIYSDMKCGKYMIRGIKVRPQPER  749


 Score = 82.4 bits (202),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E+A +FF+W++ N+D IS +D+R I++KR+TI+ A + LG +++ + QLLKL+L WVQ  
Sbjct  238   EMARVFFEWMRINRDAISPQDLREIRMKRATIDCAVRHLGGNRQAQVQLLKLVLTWVQAN  297

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  298   HLQKKKRR  305



>gb|EMT07173.1| hypothetical protein F775_43744 [Aegilops tauschii]
Length=230

 Score =   204 bits (519),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 122/170 (72%), Gaps = 18/170 (11%)
 Frame = -3

Query  953  LGNWVYWSPAASEAPPPMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKP--------  798
            LG  V   PA +  PPP                Q+      S   R+QG++         
Sbjct  17   LGPGVVVGPAGTAGPPP----------GAAATQQRPGRAAASDKQRQQGARTPAAAPAAG  66

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  67   DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  126

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  127  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  176



>gb|ABE73192.1| viviparous 1 [Avena fatua]
Length=427

 Score =   210 bits (534),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 112/122 (92%), Gaps = 3/122 (2%)
 Frame = -3

Query  827  SSDRRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAME  654
            SS  +QG+KP  +KNL+FLLQKVLKQSDVG+LGRIVLPK EAET LPEL +RDGISI ME
Sbjct  247  SSGAQQGAKPAADKNLRFLLQKVLKQSDVGALGRIVLPK-EAETHLPELKTRDGISIPME  305

Query  653  DIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            DIGTSRVW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K GKYLIRGVK
Sbjct  306  DIGTSRVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVKSGKYLIRGVK  365

Query  473  VR  468
            VR
Sbjct  366  VR  367



>ref|XP_010232723.1| PREDICTED: B3 domain-containing protein VP1 isoform X2 [Brachypodium 
distachyon]
Length=698

 Score =   212 bits (539),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 5/125 (4%)
 Frame = -3

Query  830  SSSDRRQGS--KP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
            ++S++RQG+  KP  +KNL+FLLQKVLKQSDVGSLGRIVLPKKEAET LPEL +RDGISI
Sbjct  518  AASEKRQGANNKPAADKNLRFLLQKVLKQSDVGSLGRIVLPKKEAETHLPELKTRDGISI  577

Query  662  AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K G+YLIR
Sbjct  578  PMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVK-GRYLIR  636

Query  482  GVKVR  468
            GVKVR
Sbjct  637  GVKVR  641


 Score = 94.7 bits (234),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WL  N+DCISAED+R+I+LKRSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  176   DLPRFFMEWLTNNRDCISAEDLRSIRLKRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  235

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  236   HLQKKRLR  243



>dbj|BAF36505.1| B3 type transcription factor [Triticum monococcum subsp. aegilopoides]
Length=234

 Score =   197 bits (502),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 102/108 (94%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  127  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  186

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVK
Sbjct  187  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVK  234



>dbj|BAK06992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=682

 Score =   206 bits (524),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 112/128 (88%), Gaps = 2/128 (2%)
 Frame = -3

Query  845  NHQKQSSSDRRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            + Q+Q  + R   + P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DG
Sbjct  502  DKQRQQGASRTAAAPPAGDKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDG  561

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKY  492
            ISI +EDIGTS+VW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKY
Sbjct  562  ISIPIEDIGTSQVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKY  621

Query  491  LIRGVKVR  468
            LIRGVKVR
Sbjct  622  LIRGVKVR  629


 Score = 93.2 bits (230),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             L   F +WL  N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ + 
Sbjct  184   LPRFFMEWLTNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNHH  243

Query  1682  LQKKNSR  1662
             LQKK  R
Sbjct  244   LQKKRPR  250



>ref|XP_010232722.1| PREDICTED: B3 domain-containing protein VP1 isoform X1 [Brachypodium 
distachyon]
Length=697

 Score =   205 bits (522),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/125 (82%), Positives = 115/125 (92%), Gaps = 6/125 (5%)
 Frame = -3

Query  830  SSSDRRQGS--KP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISI  663
            ++S++RQG+  KP  +KNL+FLLQKVLKQSDVGSLGRIVLPK EAET LPEL +RDGISI
Sbjct  518  AASEKRQGANNKPAADKNLRFLLQKVLKQSDVGSLGRIVLPK-EAETHLPELKTRDGISI  576

Query  662  AMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
             MEDIGTSRVWNM+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIVIY+D+K G+YLIR
Sbjct  577  PMEDIGTSRVWNMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVIYSDVK-GRYLIR  635

Query  482  GVKVR  468
            GVKVR
Sbjct  636  GVKVR  640


 Score = 94.7 bits (234),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WL  N+DCISAED+R+I+LKRSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  176   DLPRFFMEWLTNNRDCISAEDLRSIRLKRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  235

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  236   HLQKKRLR  243



>gb|AEZ00784.1| VIVIPAROUS1 protein [Aegilops tauschii]
Length=690

 Score =   204 bits (518),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  526  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  585

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  586  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  635


 Score =   105 bits (261),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 125/274 (46%), Gaps = 62/274 (23%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  185   DLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  244

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTApscffpspwtpppp  1518
              LQKK  R         A D ++   GG   +      +  P +T  +            
Sbjct  245   HLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGAAAATSWM------  291

Query  1517  ppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
                               P+  F P  + G   I   Y    G S + + V+S  FS   
Sbjct  292   ------------------PYQAFSPTGSYGGEAI---YPFQQGCSTSSVAVSSQPFS---  327

Query  1340  EYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYP  1170
                 PAA D  A +W  Q + F+ A A +     YP           G  PQ       P
Sbjct  328   ---PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPGAVPQ-------P  370

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  371   FAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00780.1| VIVIPAROUS1 protein [Triticum monococcum]
Length=692

 Score =   203 bits (517),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   106 bits (264),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 126/274 (46%), Gaps = 62/274 (23%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  185   DLPRFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGRRQGTMQLLKLILTWVQNH  244

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTApscffpspwtpppp  1518
              LQKK  R         A D ++   GG   +      +  PT+T  +            
Sbjct  245   HLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPTETGAAAATSWM------  291

Query  1517  ppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
                               P+  F P  + G   I   Y    G S + + V+S  FS   
Sbjct  292   ------------------PYQAFSPTGSYGGEAI---YPFQQGCSTSSVGVSSQPFS---  327

Query  1340  EYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYP  1170
                 PAA D  A +W  Q + F+ A A +     YP           G  PQ       P
Sbjct  328   ---PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPGAVPQ-------P  370

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  371   FAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00781.1| VIVIPAROUS1 protein [Triticum turgidum subsp. durum]
 gb|AEZ00782.1| VIVIPAROUS1 protein [Triticum turgidum subsp. durum]
 gb|AHE74489.1| viviparous 1 protein [Triticum spelta]
Length=688

 Score =   203 bits (517),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  583

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  584  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  633


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 133/294 (45%), Gaps = 68/294 (23%)
 Frame = -3

Query  1907  AAETADLSFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             AA   + +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG
Sbjct  165   AAGGGEDAFMGGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLG  224

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFL  1578
               ++G  QLLKLIL WVQ + LQKK  R         A D ++   GG   +      + 
Sbjct  225   GGRQGTMQLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYE  277

Query  1577  QPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNC  1401
              P +T  +                              P+  F P  + G   I   Y  
Sbjct  278   FPAETGAAAATSWM------------------------PYQAFSPTGSYGGEAI---YPF  310

Query  1400  GGGASFTPMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNN  1230
               G S + + V+S  FS       PAA D  A +W  Q + F+ A A +     YP    
Sbjct  311   QQGCSTSSVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP----  360

Query  1229  NRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
                    G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  361   ---MPPPGAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00777.1| VIVIPAROUS1 protein [Triticum monococcum subsp. aegilopoides]
Length=692

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 94/274 (34%), Positives = 126/274 (46%), Gaps = 62/274 (23%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  185   DLPRFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  244

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTApscffpspwtpppp  1518
              LQKK  R         A D ++   GG   +      +  PT+T  +            
Sbjct  245   HLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPTETGAAAATSWM------  291

Query  1517  ppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
                               P+  F P  + G   I   Y    G S + + V+S  FS   
Sbjct  292   ------------------PYQAFSPTGSYGGEAI---YPFQQGCSTSSVGVSSQPFS---  327

Query  1340  EYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYP  1170
                 PAA D  A +W  Q + F+ A A +     YP           G  PQ       P
Sbjct  328   ---PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPGAVPQ-------P  370

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  371   FAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|ABF48530.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ACM90521.1| VIVIPAROUS1 protein [Triticum aestivum]
 emb|CDM85587.1| unnamed protein product [Triticum aestivum]
Length=688

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  583

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  584  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  633


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 130/287 (45%), Gaps = 68/287 (24%)
 Frame = -3

Query  1886  SFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  
Sbjct  172   AFMGGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTM  231

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTAp  1557
             QLLKLIL WVQ + LQKK  R         A D ++   GG   +      +  P +T  
Sbjct  232   QLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGA  284

Query  1556  scffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFT  1380
             +                              P+  F P  + G   I   Y    G S +
Sbjct  285   AAATSWM------------------------PYQAFSPTGSYGGEAI---YPFQQGCSTS  317

Query  1379  PMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAES  1209
              + V+S  FS       PAA D  A +W  Q + F+ A A +     YP           
Sbjct  318   SVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPP  364

Query  1208  GHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  365   GAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00785.1| VIVIPAROUS1 protein [Aegilops tauschii]
Length=692

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 125/274 (46%), Gaps = 62/274 (23%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  185   DLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  244

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTApscffpspwtpppp  1518
              LQKK  R         A D ++   GG   +      +  P +T  +            
Sbjct  245   HLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGAAAATSWM------  291

Query  1517  ppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
                               P+  F P  + G   I   Y    G S + + V+S  FS   
Sbjct  292   ------------------PYQAFSPTGSYGGEAI---YPFQQGCSTSSVAVSSQPFS---  327

Query  1340  EYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYP  1170
                 PAA D  A +W  Q + F+ A A +     YP           G  PQ       P
Sbjct  328   ---PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPGAVPQ-------P  370

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  371   FAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00783.1| VIVIPAROUS1 protein [Aegilops tauschii]
Length=692

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   104 bits (260),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 93/274 (34%), Positives = 125/274 (46%), Gaps = 62/274 (23%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  185   DLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  244

Query  1685  QLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTApscffpspwtpppp  1518
              LQKK  R         A D ++   GG   +      +  P +T  +            
Sbjct  245   HLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGAAAATSWM------  291

Query  1517  ppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPT  1341
                               P+  F P  + G   I   Y    G S + + V+S  FS   
Sbjct  292   ------------------PYQAFSPTGSYGGEAI---YPFQQGCSTSSVAVSSQPFS---  327

Query  1340  EYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYP  1170
                 PAA D  A +W  Q + F+ A A +     YP           G  PQ       P
Sbjct  328   ---PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPGAVPQ-------P  370

Query  1169  YQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  371   FAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AHE74491.1| viviparous 1 protein [Triticum spelta]
Length=688

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  583

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  584  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  633


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 130/287 (45%), Gaps = 68/287 (24%)
 Frame = -3

Query  1886  SFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  
Sbjct  172   AFMGGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTM  231

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTAp  1557
             QLLKLIL WVQ + LQKK  R         A D ++   GG   +      +  P +T  
Sbjct  232   QLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGA  284

Query  1556  scffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFT  1380
             +                              P+  F P  + G   I   Y    G S +
Sbjct  285   AAATSWM------------------------PYQAFSPTGSYGGEAI---YPFQQGCSTS  317

Query  1379  PMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAES  1209
              + V+S  FS       PAA D  A +W  Q + F+ A A +     YP           
Sbjct  318   SVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPP  364

Query  1208  GHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  365   GAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AHE74490.1| viviparous 1 protein [Triticum spelta]
Length=688

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  583

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  584  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  633


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 133/294 (45%), Gaps = 68/294 (23%)
 Frame = -3

Query  1907  AAETADLSFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             AA   + +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG
Sbjct  165   AAGGGEDAFMCGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLG  224

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFL  1578
               ++G  QLLKLIL WVQ + LQKK  R         A D ++   GG   +      + 
Sbjct  225   GGRQGTMQLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYE  277

Query  1577  QPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNC  1401
              P +T  +                              P+  F P  + G   I   Y  
Sbjct  278   FPAETGAAAATSWM------------------------PYQAFSPTGSYGGEAI---YPF  310

Query  1400  GGGASFTPMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNN  1230
               G S + + V+S  FS       PAA D  A +W  Q + F+ A A +     YP    
Sbjct  311   QQGCSTSSVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP----  360

Query  1229  NRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
                    G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  361   ---MPPPGAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00778.1| VIVIPAROUS1 protein [Triticum monococcum subsp. aegilopoides]
Length=692

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 99/294 (34%), Positives = 134/294 (46%), Gaps = 68/294 (23%)
 Frame = -3

Query  1907  AAETADLSFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             AA   + +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG
Sbjct  165   AAGGGEDAFMGGGGTGSAADDLPRFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLG  224

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFL  1578
               ++G  QLLKLIL WVQ + LQKK  R         A D ++   GG   +      + 
Sbjct  225   GGRQGTMQLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYE  277

Query  1577  QPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNC  1401
              PT+T  +                              P+  F P  + G   I   Y  
Sbjct  278   FPTETGAAAATSWM------------------------PYQAFSPTGSYGGEAI---YPF  310

Query  1400  GGGASFTPMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNN  1230
               G S + + V+S  FS       PAA D  A +W  Q + F+ A A +     YP    
Sbjct  311   QQGCSTSSVGVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP----  360

Query  1229  NRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
                    G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  361   ---MPPPGSVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AEZ00779.1| VIVIPAROUS1 protein [Triticum monococcum subsp. aegilopoides]
Length=692

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 99/294 (34%), Positives = 133/294 (45%), Gaps = 68/294 (23%)
 Frame = -3

Query  1907  AAETADLSFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             AA   + +F  G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG
Sbjct  165   AAGGGEDAFTGGGGTGSVADDLPRFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLG  224

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFL  1578
               ++G  QLLKLIL WVQ + LQKK  R         A D ++   GG   +      + 
Sbjct  225   GGRQGTMQLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYE  277

Query  1577  QPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNC  1401
              PT+T  +                              P+  F P  + G   I   Y  
Sbjct  278   FPTETGAAAATSWM------------------------PYQAFSPTGSYGGEAI---YPF  310

Query  1400  GGGASFTPMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNN  1230
               G S + + V+S  FS       PAA D  A +W  Q + F+ A A +     YP    
Sbjct  311   QQGCSTSSVGVSSQPFS------PPAAPDMHAGAWPLQYAVFVPAGATSAGTQTYP----  360

Query  1229  NRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
                    G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  361   ---MPPPGAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>emb|CAB91108.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ABF48529.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ADC92022.1| VIVIPAROUS1 protein [Triticum aestivum]
Length=688

 Score =   203 bits (517),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  583

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  584  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  633


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 130/287 (45%), Gaps = 68/287 (24%)
 Frame = -3

Query  1886  SFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  
Sbjct  172   AFMGGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTM  231

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTAp  1557
             QLLKLIL WVQ + LQKK  R         A D ++   GG   +      +  P +T  
Sbjct  232   QLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGA  284

Query  1556  scffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFT  1380
             +                              P+  F P  + G   I   Y    G S +
Sbjct  285   AAATSWM------------------------PYQAFSPTGSYGGEAI---YPFQQGCSTS  317

Query  1379  PMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAES  1209
              + V+S  FS       PAA D  A +W  Q + F+ A A +     YP           
Sbjct  318   SVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPP  364

Query  1208  GHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  365   GAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>emb|CAB91109.1| VIVIPAROUS1 protein [Triticum aestivum]
Length=692

 Score =   203 bits (516),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 124/273 (45%), Gaps = 62/273 (23%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ + 
Sbjct  186   LPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNHH  245

Query  1682  LQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTApscffpspwtppppp  1515
             LQKK  R         A D ++   GG   +      +  P +T  +             
Sbjct  246   LQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGAAANTSWM-------  291

Query  1514  pyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFTPMHVNSGHFSHPTE  1338
                              P+  F P  + G   I   Y    G S + + V+S  FS    
Sbjct  292   -----------------PYQAFSPTGSYGGEAI---YPFQQGCSTSSVAVSSQPFS----  327

Query  1337  YHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESGHQPQALYGSEYPY  1167
                PAA D  A +W  Q + F+ A A +     YP           G  PQ       P+
Sbjct  328   --PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPGAVPQ-------PF  371

Query  1166  QLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
                   G+   R+  +AT+EARKKRMARQRRLS
Sbjct  372   AAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>emb|CAB91107.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ADC92017.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ADC92018.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ADC92019.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ADC92020.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ADC92021.1| VIVIPAROUS1 protein [Triticum aestivum]
Length=692

 Score =   200 bits (509),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KN +FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  528  DKNPRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRY  587

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  588  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  637


 Score = 98.2 bits (243),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 46/88 (52%), Positives = 61/88 (69%), Gaps = 6/88 (7%)
 Frame = -3

Query  1907  AAETADLSFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             AA   + +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG
Sbjct  165   AAGGGEDAFMGGGGTGSAADDLPRFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLG  224

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSR  1662
               ++G  QLLKLIL WVQ + LQKK  R
Sbjct  225   GGRQGTMQLLKLILTWVQNHHLQKKRPR  252



>ref|XP_004173839.1| PREDICTED: B3 domain-containing transcription factor ABI3-like, 
partial [Cucumis sativus]
Length=545

 Score =   197 bits (501),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 124/214 (58%), Positives = 142/214 (66%), Gaps = 14/214 (7%)
 Frame = -3

Query  1184  GSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS----ShhfrhhnnnhhhHAQN  1017
             G ++PY    G    L+RL SSATKEARKKRMARQRR S     H   H N + + H   
Sbjct  333   GRQFPYMGGGGGENGLVRLDSSATKEARKKRMARQRRFSVHHRHHGGHHGNGHQNQHPTQ  392

Query  1016  YDPHHAMRMGVDTVLPHQVSNLGNWVYW-SPAASEAPP------PMVVLppaeaapqppp  858
              +P+ +    + T       N GNWVYW SPA + A        P+   P   A      
Sbjct  393   MNPNASDHCNMATT---AQPNAGNWVYWPSPAGAGASSTTSSGFPVDSSPLHAADRSNSS  449

Query  857   aqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSR  678
              Q QN+  +  SDRRQG KPEKNLKFLLQKVLKQSDVG+LGRIVLPKKEAET LPEL++R
Sbjct  450   LQNQNYPPRIPSDRRQGWKPEKNLKFLLQKVLKQSDVGNLGRIVLPKKEAETHLPELEAR  509

Query  677   DGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLE  576
             DGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLE
Sbjct  510   DGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLE  543


 Score = 89.0 bits (219),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             ++A +F +WL+ N++ +SA+D+RN+++K++TIESA++RLG  KEG KQLLKL+L+WVQ  
Sbjct  141   DMAKVFLEWLRSNRETVSADDLRNVRIKKATIESAARRLGGGKEGMKQLLKLVLQWVQTN  200

Query  1685  QLQKKNSRE  1659
              L K+  R+
Sbjct  201   HLHKRKFRD  209



>gb|ACM90520.1| VIVIPAROUS1 protein [Triticum aestivum]
 gb|ACN21976.1| VIVIPAROUS1 [Triticum aestivum]
 gb|ACN21977.1| VIVIPAROUS1 [Triticum aestivum]
 emb|CBH32542.1| viviparous protein, putative, expressed [Triticum aestivum]
Length=687

 Score =   197 bits (500),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPK EAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPK-EAETHLPELKTGDGISIPIEDIGTSQVWSMRY  582

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  583  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  632


 Score =   105 bits (263),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 130/287 (45%), Gaps = 68/287 (24%)
 Frame = -3

Query  1886  SFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  
Sbjct  172   AFMGGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTM  231

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTAp  1557
             QLLKLIL WVQ + LQKK  R         A D ++   GG   +      +  P +T  
Sbjct  232   QLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGA  284

Query  1556  scffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNCGGGASFT  1380
             +                              P+  F P  + G   I   Y    G S +
Sbjct  285   AAATSWM------------------------PYQAFSPTGSYGGEAI---YPFQQGCSTS  317

Query  1379  PMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAES  1209
              + V+S  FS       PAA D  A +W  Q + F+ A A +     YP           
Sbjct  318   SVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPP  364

Query  1208  GHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  365   GAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>dbj|BAB40614.1| transcription factor VP-1 homologue [Triticum aestivum]
Length=687

 Score =   197 bits (500),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPK EAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPK-EAETHLPELKTGDGISIPIEDIGTSQVWSMRY  582

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  583  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYLIRGVKVR  632


 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 96/286 (34%), Positives = 129/286 (45%), Gaps = 66/286 (23%)
 Frame = -3

Query  1886  SFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKK  1725
             +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  
Sbjct  172   AFMGGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTM  231

Query  1724  QLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFLQPTDTAp  1557
             QLLKLIL WVQ + LQKK  R         A D ++   GG   +      +  P +T  
Sbjct  232   QLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYEFPAETGA  284

Query  1556  scffpspwtppppppyiPDannaammaaAQPPFPVFQPHAIGYSNIGDPYNCGGGASFTP  1377
             +                              P+  F P   G    G  Y    G S + 
Sbjct  285   AAATSWM------------------------PYQAFSP--TGSYGGGAIYPFQQGCSTSS  318

Query  1376  MHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNNNRIAAESG  1206
             + V+S  FS       PAA D  A +W  Q + F+ A A +     YP           G
Sbjct  319   VAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP-------MPPPG  365

Query  1205  HQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
               PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  366   AVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|ACL37467.1| viviparous 1 protein [Triticum aestivum]
Length=687

 Score =   196 bits (497),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +KNL+FLLQKVLKQSDVG+LGRIVLPK EAET LPEL + DGISI +EDIGTS+VW+M+Y
Sbjct  524  DKNLRFLLQKVLKQSDVGTLGRIVLPK-EAETHLPELKTGDGISIPIEDIGTSQVWSMRY  582

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVR  468
            RFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GKY+IRGVKVR
Sbjct  583  RFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGKYVIRGVKVR  632


 Score =   107 bits (266),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 98/294 (33%), Positives = 133/294 (45%), Gaps = 68/294 (23%)
 Frame = -3

Query  1907  AAETADLSFLQGNG------ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLG  1746
             AA   + +F+ G G      +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG
Sbjct  165   AAGGGEDAFMDGGGTGSAADDLPLFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLG  224

Query  1745  SSKEGKKQLLKLILEWVQQYQLQKKNSREEaaaaaaaASDHQSTGGGGHFQA----ETFL  1578
               ++G  QLLKLIL WVQ + LQKK  R         A D ++   GG   +      + 
Sbjct  225   GGRQGTMQLLKLILTWVQNHHLQKKRPR-------VGAMDQEAPPAGGQLPSPGANPGYE  277

Query  1577  QPTDTApscffpspwtppppppyiPDannaammaaAQPPFPVFQPH-AIGYSNIGDPYNC  1401
              P +T  +                              P+  F P  + G   I   Y  
Sbjct  278   FPAETGAAAATSWM------------------------PYQAFSPTGSYGGEAI---YPF  310

Query  1400  GGGASFTPMHVNSGHFSHPTEYHQPAAVDT-AQSW--QSSEFMaaaaaAPSFNPYPDNNN  1230
               G S + + V+S  FS       PAA D  A +W  Q + F+ A A +     YP    
Sbjct  311   QQGCSTSSVAVSSQPFS------PPAAPDMHAGAWPLQYAAFVPAGATSAGTQTYP----  360

Query  1229  NRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
                    G  PQ       P+      G+   R+  +AT+EARKKRMARQRRLS
Sbjct  361   ---MPPPGAVPQ-------PFAAPGFAGQFPQRMEPAATREARKKRMARQRRLS  404



>gb|AAO06117.1| VP1 [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   184 bits (467),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 101/116 (87%), Gaps = 2/116 (2%)
 Frame = -3

Query  845  NHQKQSSSDRRQGSKP--EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            + Q+Q  + R   + P  +KNL+FLLQKVLKQSDVG+LGRIVLPKKEAET LPEL + DG
Sbjct  278  DKQRQQGASRTAAAPPAGDKNLRFLLQKVLKQSDVGTLGRIVLPKKEAETHLPELKTGDG  337

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMK  504
            ISI +EDIGTS+VW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K
Sbjct  338  ISIPIEDIGTSQVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVK  393



>emb|CBJ94490.1| putative ABI3 homolog [Mangifera indica]
Length=83

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/83 (94%), Positives = 82/83 (99%), Gaps = 0/83 (0%)
 Frame = -3

Query  770  KVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSR  591
            KVLKQSDVG+LGRIVLPKKEAET LPEL++RDGISIAMEDIGTSRVWNM+YRFWPNNKSR
Sbjct  1    KVLKQSDVGNLGRIVLPKKEAETHLPELEARDGISIAMEDIGTSRVWNMRYRFWPNNKSR  60

Query  590  MYLLENTGDFVRANGLQEGDFIV  522
            MYLLENTGDFVRANGLQEGDFIV
Sbjct  61   MYLLENTGDFVRANGLQEGDFIV  83



>emb|CAC80983.1| transcription factor [Eragrostis tef]
Length=91

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/91 (86%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = -3

Query  770  KVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSR  591
            +VLKQSDVGSLGRIVLPKKEAE  LPEL +RDGISI MEDIG+SRVWNM+YRFWPNNKSR
Sbjct  1    QVLKQSDVGSLGRIVLPKKEAEIHLPELKTRDGISIPMEDIGSSRVWNMRYRFWPNNKSR  60

Query  590  MYLLENTGDFVRANGLQEGDFIVIYADMKCG  498
            MYLLENTGDFVR N LQEGDFIVIY+D+K G
Sbjct  61   MYLLENTGDFVRYNELQEGDFIVIYSDVKSG  91



>emb|CAA71070.1| viviparous-1 [Hordeum vulgare subsp. vulgare]
Length=88

 Score =   157 bits (398),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 73/88 (83%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = -3

Query  767  VLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRM  588
            VLKQSDVG+LGRIVLPKKEAET LPEL + DGISI +EDIGTS+VW+M+YRFWPNNKSRM
Sbjct  1    VLKQSDVGTLGRIVLPKKEAETHLPELKTGDGISIPIEDIGTSQVWSMRYRFWPNNKSRM  60

Query  587  YLLENTGDFVRANGLQEGDFIVIYADMK  504
            YLLENTGDFVR+N LQEGDFIV+Y+D+K
Sbjct  61   YLLENTGDFVRSNELQEGDFIVLYSDVK  88



>gb|AEQ94109.1| putative ABA insensitive 3 transcription factor [Elaeis guineensis]
 gb|AEQ94170.1| ABA insensitive-3-transcription factor [Elaeis guineensis]
Length=83

 Score =   157 bits (397),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/83 (88%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = -3

Query  770  KVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSR  591
            KVLKQSDVGSLGRIVLPKKEAE  LPEL++RDGISI +EDIGTS+VWNM+YRFWPNNKSR
Sbjct  1    KVLKQSDVGSLGRIVLPKKEAEIHLPELEARDGISIPVEDIGTSQVWNMRYRFWPNNKSR  60

Query  590  MYLLENTGDFVRANGLQEGDFIV  522
            MYLLENTG+FVR+NGLQEGDFIV
Sbjct  61   MYLLENTGEFVRSNGLQEGDFIV  83



>ref|XP_008787722.1| PREDICTED: regulatory protein viviparous-1 isoform X2 [Phoenix 
dactylifera]
Length=770

 Score =   166 bits (421),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 83/94 (88%), Gaps = 0/94 (0%)
 Frame = -3

Query  719  KKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQ  540
            +KEAE  LPELD+RDGISI MEDIGTS++WNM+YRFWPNNKSRMYLLENTG+FVR+NGLQ
Sbjct  625  QKEAEIHLPELDTRDGISIPMEDIGTSQIWNMRYRFWPNNKSRMYLLENTGEFVRSNGLQ  684

Query  539  EGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
            EGDFIVIY+D+KCGKY+IRGVKVR    R    +
Sbjct  685  EGDFIVIYSDIKCGKYMIRGVKVRPQTERGQASR  718


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             E+A +FF+W++ N+D IS +D+R I++KR+TI+ A + LG +++ K QLLKL+L WVQ  
Sbjct  234   EMARVFFEWMRINRDAISPQDLRQIRMKRATIDCAVRHLGGNRQAKVQLLKLVLTWVQAN  293

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  294   HLQKKKRR  301



>ref|XP_002980951.1| hypothetical protein SELMODRAFT_451614 [Selaginella moellendorffii]
 gb|EFJ18136.1| hypothetical protein SELMODRAFT_451614 [Selaginella moellendorffii]
Length=442

 Score =   160 bits (404),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = -3

Query  821  DRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGT  642
            D  QG +  KNLKFLLQK LK SDVG+LGRIVLPKKEAE++LP L +R+G+++AMED+ +
Sbjct  221  DHTQGLQ-NKNLKFLLQKQLKPSDVGNLGRIVLPKKEAESRLPYLSAREGMTLAMEDMTS  279

Query  641  SRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             R WN++YRFWPNNKSRMYLLENTG+F+R++ L EGD++++Y D + GKY+I G K
Sbjct  280  KRTWNLRYRFWPNNKSRMYLLENTGEFIRSHKLCEGDYLLLYKDSRNGKYVIYGKK  335



>ref|XP_002989308.1| hypothetical protein SELMODRAFT_427934 [Selaginella moellendorffii]
 gb|EFJ09582.1| hypothetical protein SELMODRAFT_427934 [Selaginella moellendorffii]
Length=445

 Score =   160 bits (404),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 97/116 (84%), Gaps = 1/116 (1%)
 Frame = -3

Query  821  DRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGT  642
            D  QG +  KNLKFLLQK LK SDVG+LGRIVLPKKEAE++LP L +R+G+++AMED+ +
Sbjct  224  DHTQGLQ-NKNLKFLLQKQLKPSDVGNLGRIVLPKKEAESRLPYLSAREGMTLAMEDMTS  282

Query  641  SRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             R WN++YRFWPNNKSRMYLLENTG+F+R++ L EGD++++Y D + GKY+I G K
Sbjct  283  KRTWNLRYRFWPNNKSRMYLLENTGEFIRSHKLCEGDYLLLYKDSRNGKYVIYGKK  338



>gb|EMS47815.1| B3 domain-containing protein VP1 [Triticum urartu]
Length=316

 Score =   151 bits (382),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 95/129 (74%), Gaps = 8/129 (6%)
 Frame = -3

Query  830  SSSDRRQGSKPEKNLKFLLQK-----VLKQSDVGSLGRIVLP---KKEAETQLPELDSRD  675
            + ++RR+  +P +  +  L       +L    V +  R+      +KEAET LPEL + D
Sbjct  133  AQAERRRNPRPHRAPQMYLSMDVPVFLLADRSVATKTRLFFHGWFQKEAETHLPELKTGD  192

Query  674  GISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGK  495
            GISI +EDIGTS+VW+M+YRFWPNNKSRMYLLENTGDFVR+N LQEGDFIV+Y+D+K GK
Sbjct  193  GISIPIEDIGTSQVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQEGDFIVLYSDVKSGK  252

Query  494  YLIRGVKVR  468
            YLIRGVKVR
Sbjct  253  YLIRGVKVR  261


 Score = 94.0 bits (232),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = -3

Query  1865  ELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQY  1686
             +L   F +WLK N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ +
Sbjct  12    DLPRFFMEWLKNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNH  71

Query  1685  QLQKKNSR  1662
              LQKK  R
Sbjct  72    HLQKKRPR  79



>emb|CDW92174.1| putative abscissic acid insensitive 3, partial [Xylia xylocarpa 
var. kerrii]
Length=72

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/72 (92%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = -3

Query  749  VGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENT  570
            VG+LGRIVLPKKEAET LPEL+ RDGISIAMEDIGTSRVWNM+YR+WPNNKSRMYLLENT
Sbjct  1    VGNLGRIVLPKKEAETHLPELEERDGISIAMEDIGTSRVWNMRYRYWPNNKSRMYLLENT  60

Query  569  GDFVRANGLQEG  534
            GDFVRANGLQEG
Sbjct  61   GDFVRANGLQEG  72



>ref|XP_011080161.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X2 [Sesamum indicum]
Length=625

 Score =   155 bits (391),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 124/244 (51%), Positives = 146/244 (60%), Gaps = 27/244 (11%)
 Frame = -3

Query  1418  GDPYNCGGGASFTPMH---VNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNP  1248
             GDPY+        PM+   VN   + H  EY     ++ AQSW  S F         F+ 
Sbjct  398   GDPYS--NPIPVAPMNHQVVNGIPYPHAAEY---PVMEHAQSWVISPFPMQQPH--QFSH  450

Query  1247  YPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +PDN N        HQ QALYG  +PYQ++D NGERLMRLGSSATKEARKKRMARQRRL 
Sbjct  451   FPDNGNMIT-----HQ-QALYG--HPYQIFDPNGERLMRLGSSATKEARKKRMARQRRLY  502

Query  1067  ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA-ASEAPPPMV--  897
             SHH RH +N++ H  Q  D H       D     Q  + GNWVYWSP+ A  +P P    
Sbjct  503   SHHHRHSSNSNQHQNQMNDAHVVGEASEDG---DQAGSPGNWVYWSPSGAGSSPTPGSGP  559

Query  896   -VLppaeaapqpppaqqQNHQKQSSSDRR--QGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                     +    P QQQN+Q+QSSSDRR  QG K EKNLKFLLQKVLKQSD+G+LGRIV
Sbjct  560   PADASQAHSGDRAPVQQQNYQRQSSSDRRQQQGWKTEKNLKFLLQKVLKQSDIGNLGRIV  619

Query  725   LPKK  714
             LPK+
Sbjct  620   LPKE  623


 Score =   137 bits (346),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  1901  ETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQ  1722
             E    SFLQGN ELA IFF+WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKKQ
Sbjct  240   ENDGFSFLQGNSELAMIFFEWLKQNKDYISAEDMRSIKLKRSTIESASKRLGSTKEGKKQ  299

Query  1721  LLKLILEWVQQYQLQKKNSRE  1659
             LLKLILEWV+QYQLQKK  RE
Sbjct  300   LLKLILEWVEQYQLQKKRMRE  320



>emb|CAD24413.1| viviparous-1 protein [Hordeum vulgare subsp. vulgare]
Length=683

 Score =   154 bits (389),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 78/84 (93%), Gaps = 0/84 (0%)
 Frame = -3

Query  719  KKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQ  540
            +KEAET LPEL + DGISI +EDIGTS+VW+M+YRFWPNNKSRMYLLENTGDFVR+N LQ
Sbjct  547  RKEAETHLPELKTGDGISIPIEDIGTSQVWSMRYRFWPNNKSRMYLLENTGDFVRSNELQ  606

Query  539  EGDFIVIYADMKCGKYLIRGVKVR  468
            EGDFIV+Y+D+K GKYLIRGVKVR
Sbjct  607  EGDFIVLYSDVKSGKYLIRGVKVR  630


 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = -3

Query  1862  LAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQLLKLILEWVQQYQ  1683
             L   F +WL  N+DCISAED+R+I+L+RSTIE+A+ RLG  ++G  QLLKLIL WVQ + 
Sbjct  184   LPRFFMEWLTNNRDCISAEDLRSIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNHH  243

Query  1682  LQKKNSR  1662
             LQKK  R
Sbjct  244   LQKKRPR  250



>ref|XP_004150741.1| PREDICTED: B3 domain-containing transcription factor FUS3-like, 
partial [Cucumis sativus]
 ref|XP_004172616.1| PREDICTED: B3 domain-containing transcription factor FUS3-like, 
partial [Cucumis sativus]
Length=206

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + LKFL QK LK SDV SL R++LPKK AET LP L+S++G+ I M+D+    VWN KYR
Sbjct  5    RKLKFLFQKELKNSDVSSLRRMILPKKAAETHLPALESKEGMMITMDDLDGVHVWNFKYR  64

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            FWPNN SRMY+LENTGDFV A+GL  GDFI+IY D +   Y+I+  K  +    +D
Sbjct  65   FWPNNNSRMYVLENTGDFVNAHGLHLGDFIMIYQDCEEHNYVIQAKKASEQEVYTD  120



>ref|XP_009394588.1| PREDICTED: B3 domain-containing protein LFL1-like [Musa acuminata 
subsp. malaccensis]
Length=231

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FLLQK L+ SDV  LGRIVLPKKEAE+ LP L SRDGI+I M+D+   +VW  KYRFW
Sbjct  59   LRFLLQKELRNSDVSQLGRIVLPKKEAESHLPNLTSRDGIAINMDDLENLQVWTFKYRFW  118

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN+SRMY+LENTGD+V+ + L+ GDFI+IY D    +Y+IR  K
Sbjct  119  PNNRSRMYILENTGDYVKEHHLELGDFIMIYKDDSKDRYVIRAKK  163



>ref|XP_002973460.1| hypothetical protein SELMODRAFT_173356 [Selaginella moellendorffii]
 gb|EFJ25834.1| hypothetical protein SELMODRAFT_173356 [Selaginella moellendorffii]
Length=585

 Score =   149 bits (376),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +K++KFLLQK LK SDVG+LGRIVLPKKEAE  LP L  R+GI +AMED+ T++ W+ +Y
Sbjct  355  DKSVKFLLQKELKPSDVGNLGRIVLPKKEAEIHLPYLSLREGIMLAMEDVLTAQTWHFRY  414

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            RFWPNNKSRMYLLE TGD+V+++ L+EGD I IY D K GK++I   K
Sbjct  415  RFWPNNKSRMYLLEGTGDYVKSHLLKEGDLIQIYRDAKTGKHIICAKK  462



>ref|XP_002993595.1| hypothetical protein SELMODRAFT_431656 [Selaginella moellendorffii]
 gb|EFJ05287.1| hypothetical protein SELMODRAFT_431656 [Selaginella moellendorffii]
Length=653

 Score =   149 bits (376),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            +K++KFLLQK LK SDVG+LGRIVLPKKEAE  LP L  R+GI +AMED+ T++ W+ +Y
Sbjct  420  DKSVKFLLQKELKPSDVGNLGRIVLPKKEAEIHLPYLSLREGIMLAMEDVLTAQTWHFRY  479

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            RFWPNNKSRMYLLE TGD+V+++ L+EGD I IY D K GK++I   K
Sbjct  480  RFWPNNKSRMYLLEGTGDYVKSHLLKEGDLIQIYRDAKTGKHIICAKK  527



>gb|KGN50882.1| hypothetical protein Csa_5G312320 [Cucumis sativus]
Length=280

 Score =   142 bits (359),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + LKFL QK LK SDV SL R++LPKK AET LP L+S++G+ I M+D+    VWN KYR
Sbjct  79   RKLKFLFQKELKNSDVSSLRRMILPKKAAETHLPALESKEGMMITMDDLDGVHVWNFKYR  138

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            FWPNN SRMY+LENTGDFV A+GL  GDFI+IY D +   Y+I+  K  +    +D
Sbjct  139  FWPNNNSRMYVLENTGDFVNAHGLHLGDFIMIYQDCEEHNYVIQAKKASEQEVYTD  194



>ref|XP_008466870.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Cucumis melo]
Length=278

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/116 (57%), Positives = 82/116 (71%), Gaps = 0/116 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + LKFL QK LK SDV SL R++LPKK AET LP L+S++G+ I M+D+    VWN KYR
Sbjct  78   RKLKFLFQKELKNSDVSSLRRMILPKKAAETHLPALESKEGMMITMDDLDGVHVWNFKYR  137

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            FWPNN SRMY+LENTGDFV A+ L  GDFI+IY D +   Y+I+  K  +    SD
Sbjct  138  FWPNNNSRMYVLENTGDFVNAHALHLGDFIMIYQDCEEHNYVIQAKKASEQEIYSD  193



>ref|XP_010939475.1| PREDICTED: B3 domain-containing protein LFL1-like [Elaeis guineensis]
Length=270

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FLLQK L  SD  SLGRIVLPK+EAE  LP L +RDGI I M+D+ T +VW  KYR+W
Sbjct  88   LRFLLQKELSHSDASSLGRIVLPKREAEAYLPVLTARDGIEINMDDLETFQVWTFKYRYW  147

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNNKSRMY+L+NTGDFV  +GLQ GDFI+IY D    + +IR  K
Sbjct  148  PNNKSRMYILDNTGDFVHTHGLQIGDFIMIYKDDHKDRLVIRAKK  192



>ref|XP_008775431.1| PREDICTED: B3 domain-containing protein LFL1-like [Phoenix dactylifera]
Length=270

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FLLQK L  SD  SLGRIVLPK+EAE  LP L +RDG+ I M+D  T +VW  KYR+W
Sbjct  88   LRFLLQKELSHSDASSLGRIVLPKREAEAYLPVLTARDGVEINMDDWETFQVWTFKYRYW  147

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK-VRQHGA  456
            PNNKSRMY+L+NTGDFV  +GLQ GD I+IY D +  + +IR  K V++H A
Sbjct  148  PNNKSRMYILDNTGDFVSTHGLQIGDLIMIYKDDQKDRLVIRAKKAVKEHPA  199



>ref|XP_010249172.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
isoform X2 [Nelumbo nucifera]
Length=300

 Score =   140 bits (352),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FLLQK L+ SDV SLGR+VLPK+ AE  LP LD+++G+ I M+D+   RVWN KYRFW
Sbjct  102  LRFLLQKELRNSDVSSLGRMVLPKRAAEAHLPILDTKEGMFIDMDDMDGLRVWNFKYRFW  161

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
            PNN SRMY+LEN G+FV+ +GLQ GDFI++Y D +  KY+IR  K       S+  +
Sbjct  162  PNNNSRMYILENIGEFVKMHGLQLGDFIMLYRDDQNQKYVIRARKASDQDIFSESTR  218



>ref|XP_009413626.1| PREDICTED: B3 domain-containing protein LFL1-like [Musa acuminata 
subsp. malaccensis]
Length=234

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FLLQK L+ SDV  LGRIVLPKKEAE  LP L SR+GI I M+D    + W  KYRFW
Sbjct  51   LRFLLQKELRNSDVSQLGRIVLPKKEAEAHLPCLTSREGIMINMDDPDNLQAWTFKYRFW  110

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN+SRMY+LENTGD+V+ N LQ GDFI+IY D    +Y+IR  K
Sbjct  111  PNNRSRMYVLENTGDYVKKNCLQLGDFILIYKDDSKDRYVIRAKK  155



>gb|KDO47367.1| hypothetical protein CISIN_1g041864mg [Citrus sinensis]
Length=300

 Score =   139 bits (349),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+MED+    VW  KYRFW
Sbjct  107  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFW  166

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV A+GLQ GDFI++Y D +   Y+I+  K
Sbjct  167  PNNNSRMYVLENTGDFVNAHGLQLGDFIIVYKDDQNQNYVIQAKK  211



>ref|XP_010925032.1| PREDICTED: B3 domain-containing protein LFL1-like [Elaeis guineensis]
Length=292

 Score =   138 bits (347),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K L+FLLQK L  SD  SLGRIVLPK+EAE  LP L +R GI I M+D+ T +VW  KYR
Sbjct  93   KGLRFLLQKELSHSDASSLGRIVLPKREAEAHLPVLTARHGIEINMDDLETFQVWTFKYR  152

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            +WPNNKSRMY+L+NT +++ A+GLQ GDFI++Y D K  + +IR  K
Sbjct  153  YWPNNKSRMYILDNTANYINAHGLQIGDFIIVYKDDKKDRLVIRAKK  199



>ref|XP_010528138.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Tarenaya hassleriana]
Length=208

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP LDS++GI I+MED+    VW+ KYR+W
Sbjct  6    LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALDSKEGIFISMEDLDGLHVWSFKYRYW  65

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV  +GLQ GDFI++Y D     Y+I+  K
Sbjct  66   PNNNSRMYVLENTGDFVNVHGLQLGDFIMVYQDHLSHNYVIQARK  110



>ref|XP_010068644.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Eucalyptus grandis]
Length=281

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R+VLPKK AET LP L+S++GI + M D+     WN KYR
Sbjct  84   RRLRFLFQKELKNSDVSSLRRMVLPKKAAETHLPMLESKEGIFVNMYDLDGQHTWNFKYR  143

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            FWPNN SRMY+LENTG+FV  +GLQ GDFI++Y D +   Y+I+  K  +    +D
Sbjct  144  FWPNNNSRMYVLENTGNFVTTHGLQLGDFIMVYEDCQNHNYVIQAKKASEEDVYTD  199



>ref|XP_006446963.1| hypothetical protein CICLE_v10016085mg [Citrus clementina]
 gb|ESR60203.1| hypothetical protein CICLE_v10016085mg [Citrus clementina]
Length=301

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+MED+    VW  KYRFW
Sbjct  108  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFW  167

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV A+GLQ GDFI++Y D     Y+I+  K
Sbjct  168  PNNNSRMYVLENTGDFVNAHGLQLGDFIIVYQDDHNQNYVIQAKK  212



>gb|ADO16345.1| fusca 3 [Brassica napus]
Length=307

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I MED+    VW  KYR
Sbjct  88   RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIKMEDLDGLHVWTFKYR  147

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ+GDFI++Y ++    Y+I+  K  +
Sbjct  148  YWPNNNSRMYVLENTGDFVNAHGLQQGDFIMVYQNLYPNNYVIQARKASE  197



>emb|CDY28525.1| BnaC02g36350D [Brassica napus]
Length=309

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I MED+    VW  KYR
Sbjct  90   RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIKMEDLDGLHVWTFKYR  149

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ+GDFI++Y ++    Y+I+  K  +
Sbjct  150  YWPNNNSRMYVLENTGDFVNAHGLQQGDFIMVYQNLYPNNYVIQARKASE  199



>emb|CDY34212.1| BnaA02g28280D [Brassica napus]
Length=308

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I MED+    VW  KYR
Sbjct  89   RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIKMEDLDGLHVWTFKYR  148

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ+GDFI++Y ++    Y+I+  K  +
Sbjct  149  YWPNNNSRMYVLENTGDFVNAHGLQQGDFIMVYQNLYPNNYVIQARKASE  198



>gb|ADO16344.1| fusca 3 [Brassica napus]
Length=308

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I MED+    VW  KYR
Sbjct  89   RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIKMEDLDGLHVWTFKYR  148

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ+GDFI++Y ++    Y+I+  K  +
Sbjct  149  YWPNNNSRMYVLENTGDFVNAHGLQQGDFIMVYQNLYPNNYVIQARKASE  198



>ref|XP_008231041.1| PREDICTED: B3 domain-containing transcription factor FUS3 [Prunus 
mume]
Length=321

 Score =   138 bits (347),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+M+DI    VW+ KYRFW
Sbjct  122  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPISMDDIDGLHVWSFKYRFW  181

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTG+FV A+GLQ GDFI++Y D +   Y+I+  K
Sbjct  182  PNNNSRMYVLENTGEFVNAHGLQLGDFIMVYQDTQNQNYVIQAKK  226



>ref|XP_006468874.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Citrus sinensis]
Length=301

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 78/105 (74%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+MED+    VW  KYRFW
Sbjct  108  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGIFISMEDLDGLHVWTFKYRFW  167

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV A+GLQ GDFI++Y D     Y+I+  K
Sbjct  168  PNNNSRMYVLENTGDFVNAHGLQLGDFIIVYQDDHNQNYVIQAKK  212



>ref|XP_009129479.1| PREDICTED: B3 domain-containing transcription factor FUS3 [Brassica 
rapa]
Length=308

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 81/110 (74%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I MED+    VW  KYR
Sbjct  89   RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIKMEDLDGLHVWTFKYR  148

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ+GDFI++Y ++    Y+I+  K  +
Sbjct  149  YWPNNNSRMYVLENTGDFVNAHGLQQGDFIMVYQNLYPNNYVIQARKASE  198



>ref|XP_003579476.2| PREDICTED: putative B3 domain-containing protein Os04g0676650 
[Brachypodium distachyon]
Length=340

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K    +L+K L  SDVG++GRIVLPK++AE  LP L  RDG+ + M+D      WN KYR
Sbjct  200  KEYHIVLRKDLTNSDVGNIGRIVLPKRDAEANLPALLERDGLILQMDDFNLVATWNFKYR  259

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGA  456
            FWPNNKSRMY+LE+TG+FV+++GL+ GD ++IY + + GK+L+RG K  Q  A
Sbjct  260  FWPNNKSRMYILESTGEFVKSHGLEAGDTLIIYKNPESGKFLVRGEKASQQSA  312



>dbj|BAE80317.1| transcription factor ABI3-like [Physcomitrella patens]
Length=539

 Score =   141 bits (356),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/264 (37%), Positives = 134/264 (51%), Gaps = 40/264 (15%)
 Frame = -3

Query  1262  PSFNPYPDNNNNRIAAESG-HQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMA  1086
             P+ +PY      R+  +SG  QP     S  P      + + + +  + ATK AR+ RMA
Sbjct  206   PAVSPY----MPRLNYDSGMQQPVCNMQSMIPSTTSQNSMQPIEQTPAMATKAARRNRMA  261

Query  1085  RQRRLSShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPAASEAPP  906
             RQR                  Q+    HA     +   P  V   G WV+     + APP
Sbjct  262   RQR------------------QSMMKQHAR--ATNQANPVSV---GFWVW-----NGAPP  293

Query  905   PMVVLppaeaapqpppaqqQNHQKQSSSDRRQGSKPEKNLKFLLQKVLKQSDVGSLGRIV  726
                                    + ++ +  Q  +   +L FLLQK L+ SDVGSLGRI+
Sbjct  294   ------AGGTKKTEISHSGAQPAQGTAVNAEQKGRNMDSLTFLLQKELRPSDVGSLGRII  347

Query  725   LPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANG  546
             LPKKEAE  +P L  R G+ I +ED  +  +WN++YRFWPNNKSRMYLLENTGDFV+++ 
Sbjct  348   LPKKEAEQHMPFLSMRGGVCIQVEDFDSGHIWNLRYRFWPNNKSRMYLLENTGDFVKSHR  407

Query  545   LQEGDFIVIYADMKCGKYLIRGVK  474
             L EGD ++IY   + G Y++RG K
Sbjct  408   LVEGDLLIIYRSQQ-GDYVMRGKK  430



>ref|XP_006395520.1| hypothetical protein EUTSA_v10005481mg [Eutrema salsugineum]
 gb|ESQ32806.1| hypothetical protein EUTSA_v10005481mg [Eutrema salsugineum]
Length=320

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I MED+    VW  KYR
Sbjct  97   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPIRMEDLDGLHVWTFKYR  156

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            FWPNN SRMY+LENTGDFV A+GLQ GDFI++Y +     Y+I+  K  +
Sbjct  157  FWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQNFHSNTYVIQARKASE  206



>ref|XP_011045793.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
isoform X1 [Populus euphratica]
Length=312

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I M+D+    VW+ KYR
Sbjct  117  RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPFLESKEGIFINMDDLDGLHVWSFKYR  176

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D +   Y+I+  K       +D  + 
Sbjct  177  YWPNNNSRMYVLENTGDFVHAHGLQLGDFIMVYQDSQSQNYVIQAKKASDQNVYTDIARN  236

Query  434  A  432
            A
Sbjct  237  A  237



>gb|KDP41838.1| hypothetical protein JCGZ_26856 [Jatropha curcas]
Length=329

 Score =   137 bits (345),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            ++ L FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+M+D+    VW+ KY
Sbjct  132  QRRLSFLFQKELKNSDVSSLKRMILPKKAAEAHLPVLESKEGIFISMDDLDGLHVWSFKY  191

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            R+WPNN SRMY+LENTGDFV  +GLQ GDFI++Y DM+   Y+I+  K
Sbjct  192  RYWPNNNSRMYVLENTGDFVNTHGLQLGDFIMVYKDMQNQNYVIQARK  239



>gb|AAC35247.1| FUSCA3 [Arabidopsis thaliana]
Length=312

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR
Sbjct  85   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR  144

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D+    Y+I+  K  +
Sbjct  145  YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASE  194



>gb|AAS79559.1| transcriptional regulator [Arabidopsis thaliana]
 emb|CAG25870.1| hypothetical protein [Arabidopsis thaliana]
Length=310

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR
Sbjct  86   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR  145

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D+    Y+I+  K  +
Sbjct  146  YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASE  195



>gb|AAC35246.1| FUSCA3 [Arabidopsis thaliana]
Length=310

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR
Sbjct  85   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR  144

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D+    Y+I+  K  +
Sbjct  145  YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASE  194



>ref|XP_006293066.1| hypothetical protein CARUB_v10019353mg [Capsella rubella]
 gb|EOA25964.1| hypothetical protein CARUB_v10019353mg [Capsella rubella]
Length=321

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR
Sbjct  88   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGLHVWTFKYR  147

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D+    Y+I+  K
Sbjct  148  YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYLDLDSNNYVIQARK  194



>ref|NP_566799.1| B3 domain-containing transcription factor FUS3 [Arabidopsis thaliana]
 sp|Q9LW31.2|FUS3_ARATH RecName: Full=B3 domain-containing transcription factor FUS3; 
AltName: Full=Protein FUSCA3 [Arabidopsis thaliana]
 gb|AEE77216.1| B3 domain-containing transcription factor FUS3 [Arabidopsis thaliana]
Length=313

 Score =   137 bits (344),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR
Sbjct  86   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR  145

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D+    Y+I+  K  +
Sbjct  146  YWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASE  195



>ref|XP_002876992.1| hypothetical protein ARALYDRAFT_484455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53251.1| hypothetical protein ARALYDRAFT_484455 [Arabidopsis lyrata subsp. 
lyrata]
Length=314

 Score =   137 bits (344),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 0/108 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR+W
Sbjct  91   LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLNGLHVWTFKYRYW  150

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            PNN SRMY+LENTGDFV A+GLQ GDFI++Y D+    Y+I+  K  +
Sbjct  151  PNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASE  198



>ref|XP_007031992.1| AP2/B3-like transcriptional factor family protein isoform 2 [Theobroma 
cacao]
 gb|EOY02918.1| AP2/B3-like transcriptional factor family protein isoform 2 [Theobroma 
cacao]
Length=237

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K L+FL QK LK SDV SL R++LPK+ AE  LP L+S++GI I+M+D+    VW+ KYR
Sbjct  97   KKLRFLFQKELKNSDVSSLRRMILPKRAAEAHLPVLESKEGILISMDDLDGLHVWSFKYR  156

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
            FWPNN SRMY+LENTG+FV  +GLQ GDFI++Y D +   Y+I+  K       +D  + 
Sbjct  157  FWPNNNSRMYVLENTGEFVNTHGLQLGDFIMVYQDSQNQNYVIQAKKASDQDVYADIARN  216

Query  434  A  432
            A
Sbjct  217  A  217



>gb|KHG24234.1| B3 domain-containing transcription factor FUS3 -like protein 
[Gossypium arboreum]
Length=226

 Score =   134 bits (338),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 0/116 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K L+FL QK LK SDV SL R++LPK+ AE  LP L+S++GI I+M+D+    VW+ KYR
Sbjct  30   KRLRFLFQKELKNSDVSSLRRMILPKRAAEAHLPVLESKEGILISMDDLDGLHVWSFKYR  89

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            FWPNN SRMY+LENTG+FV  +GLQ GDFI++Y D     Y+I+  K       SD
Sbjct  90   FWPNNNSRMYVLENTGEFVSTHGLQLGDFIMVYQDSLNQNYVIQAKKASDEDVYSD  145



>ref|XP_010068643.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Eucalyptus grandis]
Length=282

 Score =   136 bits (342),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 81/119 (68%), Gaps = 0/119 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            ++L FL QK LK SDV SL R++LPKK AE  LP L+S++GI I M D+     W+ KYR
Sbjct  85   RSLSFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIFINMYDLDGQHTWSFKYR  144

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
            FWPNN SRMY+LENTGDFV  +GLQ GDFI++Y D +   Y+I+  K  +    +D  K
Sbjct  145  FWPNNNSRMYVLENTGDFVTTHGLQVGDFIMVYQDCQNHNYVIQAKKASEEDVYTDIAK  203



>ref|XP_007031991.1| AP2/B3-like transcriptional factor family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02917.1| AP2/B3-like transcriptional factor family protein isoform 1 [Theobroma 
cacao]
Length=291

 Score =   135 bits (341),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K L+FL QK LK SDV SL R++LPK+ AE  LP L+S++GI I+M+D+    VW+ KYR
Sbjct  97   KKLRFLFQKELKNSDVSSLRRMILPKRAAEAHLPVLESKEGILISMDDLDGLHVWSFKYR  156

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
            FWPNN SRMY+LENTG+FV  +GLQ GDFI++Y D +   Y+I+  K       +D  + 
Sbjct  157  FWPNNNSRMYVLENTGEFVNTHGLQLGDFIMVYQDSQNQNYVIQAKKASDQDVYADIARN  216

Query  434  A  432
            A
Sbjct  217  A  217



>ref|XP_010502623.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Camelina sativa]
Length=311

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI + MED+    VW  KYR+W
Sbjct  91   LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPLRMEDLDGRHVWTFKYRYW  150

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            PNN SRMY+LENTGDFV A+GLQ GDFI++Y ++    Y+I+  K  +     D
Sbjct  151  PNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQNLDSNNYVIQARKASEEEGEED  204



>ref|XP_002982416.1| hypothetical protein SELMODRAFT_451623 [Selaginella moellendorffii]
 gb|EFJ16661.1| hypothetical protein SELMODRAFT_451623 [Selaginella moellendorffii]
Length=533

 Score =   140 bits (352),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 13/121 (11%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            EKNL+FLLQK LK SDVG+LGRIVLPKKEAE+ LP L  R+G++I MED+ T+  W+M+Y
Sbjct  312  EKNLEFLLQKQLKPSDVGNLGRIVLPKKEAESCLPYLTVREGMTIVMEDLTTAYKWHMRY  371

Query  617  -----------RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVI--YADMKCGKYLIRGV  477
                       RFWPNNKSRMYLLENTG+F+R++ L+EGD + +  Y +   GKY+I G 
Sbjct  372  RWKFLQSRARHRFWPNNKSRMYLLENTGEFIRSHCLKEGDLLRLYKYKNSAAGKYVILGK  431

Query  476  K  474
            K
Sbjct  432  K  432



>ref|XP_002966578.1| hypothetical protein SELMODRAFT_451619 [Selaginella moellendorffii]
 gb|EFJ32605.1| hypothetical protein SELMODRAFT_451619 [Selaginella moellendorffii]
Length=530

 Score =   140 bits (352),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 89/121 (74%), Gaps = 13/121 (11%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            EKNL+FLLQK LK SDVG+LGRIVLPKKEAE+ LP L  R+G++I MED+ T+  W+M+Y
Sbjct  309  EKNLEFLLQKQLKPSDVGNLGRIVLPKKEAESCLPYLTVREGMTIVMEDLTTAYKWHMRY  368

Query  617  -----------RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVI--YADMKCGKYLIRGV  477
                       RFWPNNKSRMYLLENTG+F+R++ L+EGD + +  Y +   GKY+I G 
Sbjct  369  RWKFLQSRARHRFWPNNKSRMYLLENTGEFIRSHCLKEGDLLRLYKYKNSAAGKYVILGK  428

Query  476  K  474
            K
Sbjct  429  K  429



>ref|XP_010683360.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Beta vulgaris subsp. vulgaris]
Length=334

 Score =   136 bits (342),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 84/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK L+ SDV SL R+VLPKK AE+ LP L++++GI I+M+D+    +WN KYR
Sbjct  130  RRLRFLFQKQLQNSDVSSLRRMVLPKKAAESHLPTLETKEGIYISMDDMDGVHLWNFKYR  189

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            FWPNN SRMY+LENTGDFV A+ LQ GDFI++Y D+    Y+I+  K  Q    +D
Sbjct  190  FWPNNNSRMYVLENTGDFVSAHRLQLGDFIMVYQDIINLNYVIQAKKTSQQEIYND  245



>emb|CBI35396.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   135 bits (341),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 92/143 (64%), Gaps = 14/143 (10%)
 Frame = -3

Query  830  SSSDRRQGSKPEKNLK------------FLLQKVLKQSDVGSLGRIVLPKKEAETQLPEL  687
            +SS+ R GS P  N+              L+QK L+ +DVG+LGRIVLPKK+AE  LP L
Sbjct  132  NSSETRPGSSPPANIHEDDEEIKGKGWLMLVQKELRNTDVGNLGRIVLPKKDAEANLPPL  191

Query  686  DSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADM  507
             ++DG+ + MED+  S  W  KYR+WPNN+SRMY++ENTG+FV+ + LQ GD  V+Y D 
Sbjct  192  VAKDGLVLQMEDMKYSVNWKFKYRYWPNNRSRMYVMENTGNFVKMHDLQPGDLFVVYKDE  251

Query  506  KCGKYLIRGVKVRQ--HGARSDG  444
              GKY++RG K  +  H    DG
Sbjct  252  SSGKYIVRGKKAVKPAHAEDKDG  274



>ref|XP_006373111.1| hypothetical protein POPTR_0017s08820g, partial [Populus trichocarpa]
 gb|ERP50908.1| hypothetical protein POPTR_0017s08820g, partial [Populus trichocarpa]
Length=287

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/121 (52%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL RI+LPKK AE  LP L+S++GI I M+D+     W+ KYR
Sbjct  92   RRLRFLFQKELKNSDVSSLRRIILPKKAAEAHLPALESKEGIFIRMDDLDGLHAWSFKYR  151

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
            +WPNN SRMY+LENTGDFV A+GL+ GDFI++Y D +   Y+I+  K       +D  + 
Sbjct  152  YWPNNNSRMYVLENTGDFVSAHGLELGDFIMVYQDNQSQNYVIQAKKASDQNVYTDIARN  211

Query  434  A  432
            A
Sbjct  212  A  212



>ref|XP_008362172.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Malus domestica]
Length=215

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV  L R++LPKK AE  LP L+S++GI+I M+DI    VW+ KYRFW
Sbjct  14   LRFLFQKELKNSDVSPLRRMILPKKAAEAHLPTLESKEGIAINMDDIDGLHVWSFKYRFW  73

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV  +GLQ GD+I++Y D     Y+I+  K
Sbjct  74   PNNNSRMYVLENTGDFVNVHGLQFGDYIMVYQDNHNQNYVIQARK  118



>ref|XP_010096045.1| B3 domain-containing transcription factor FUS3 [Morus notabilis]
 gb|EXB62851.1| B3 domain-containing transcription factor FUS3 [Morus notabilis]
Length=336

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++G+ I+M+D+   RVW+ KYRFW
Sbjct  85   LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPVLESKEGMLISMDDLDGLRVWSFKYRFW  144

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV  +GLQ GD+I++Y D +   Y+I+  K
Sbjct  145  PNNNSRMYVLENTGDFVNTHGLQLGDYIMVYRDNENQNYVIQASK  189



>dbj|BAE80314.1| transcription factor ABI3-like [Physcomitrella patens]
Length=658

 Score =   140 bits (353),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L FLLQK L+ SDVG+LGRI+LPKKEAE  LP L  R+G+S+ MED  +   WN++YRFW
Sbjct  419  LTFLLQKELRPSDVGNLGRIILPKKEAEVHLPILALREGVSLLMEDFDSGYCWNIRYRFW  478

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNNKSRMYLLENTG+FV+++ L+EGD +++Y + + G Y++RG K
Sbjct  479  PNNKSRMYLLENTGEFVKSHHLKEGDLLILYRNEQ-GNYVLRGKK  522



>ref|XP_001752973.1| predicted protein [Physcomitrella patens]
 gb|EDQ82014.1| predicted protein [Physcomitrella patens]
Length=741

 Score =   140 bits (353),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L FLLQK L+ SDVG+LGRI+LPKKEAE  LP L  R+G+S+ MED  +   WN++YRFW
Sbjct  446  LTFLLQKELRPSDVGNLGRIILPKKEAEVHLPILALREGVSLLMEDFDSGYCWNIRYRFW  505

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNNKSRMYLLENTG+FV+++ L+EGD +++Y + + G Y++RG K
Sbjct  506  PNNKSRMYLLENTGEFVKSHHLKEGDLLILYRNEQ-GNYVLRGKK  549



>ref|XP_004969734.1| PREDICTED: B3 domain-containing protein LFL1-like [Setaria italica]
Length=290

 Score =   134 bits (337),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+ LLQK L+ SDV  LGRIVLPKKEAE+ LP L S+DG S+ M D+  +++W  KYR+W
Sbjct  69   LRVLLQKELRNSDVSQLGRIVLPKKEAESYLPTLISKDGRSLCMYDLLNAQLWTFKYRYW  128

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
            PNNKSRMY+LENTGD+V+A+ L++GDFIVIY D    +++I
Sbjct  129  PNNKSRMYVLENTGDYVKAHDLRQGDFIVIYKDDGNDRFVI  169



>ref|XP_004306317.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Fragaria vesca subsp. vesca]
Length=327

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 1/111 (1%)
 Frame = -3

Query  806  SKPEKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWN  627
            + P K L+FL QK LK SDV SL R+VLPKK AE  LP LD ++GI I+M+D+    VW+
Sbjct  107  TDPAK-LRFLFQKELKNSDVSSLRRVVLPKKAAEAHLPPLDFKEGIPISMDDMDGLHVWS  165

Query  626  MKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
             KYRFWPNN SRMY+LENTG+FV  +GLQ GDFI++Y D     Y+I+  K
Sbjct  166  FKYRFWPNNNSRMYVLENTGEFVSTHGLQLGDFIMVYQDSANQNYVIQAKK  216



>ref|XP_010425402.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Camelina sativa]
Length=311

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/114 (53%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI + M+D+    VW  KYR+W
Sbjct  91   LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPLRMKDLDGRHVWTFKYRYW  150

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSD  447
            PNN SRMY+LENTGDFV A+GLQ GDFI++Y ++    Y+I+  K  +     D
Sbjct  151  PNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQNLDSNNYVIQARKASEEEGEED  204



>ref|XP_011013336.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Populus euphratica]
Length=310

 Score =   134 bits (338),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I M+D+     W+ KYR
Sbjct  115  RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIFIRMDDLDGLHAWSFKYR  174

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKKP  435
            +WPNN SRMY+LENTGDFV A+GL+ GDFI++Y D +   Y+I+  K       +D  + 
Sbjct  175  YWPNNNSRMYVLENTGDFVSAHGLELGDFIMVYQDNQSQNYIIQAKKASDQNVYTDIARN  234

Query  434  A  432
            A
Sbjct  235  A  235



>ref|XP_002512863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49366.1| conserved hypothetical protein [Ricinus communis]
Length=321

 Score =   134 bits (338),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            ++ L FL QK LK SDV SL R+VLPKK AE  LP L+S++GI I+M+D+    VW+ KY
Sbjct  125  QRRLSFLFQKELKNSDVSSLKRMVLPKKAAEAHLPVLESKEGIFISMDDLDGLHVWSFKY  184

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
            R+WPNN SRMY+LENTGDFV  +GLQ GDFI++Y D +   Y+I+  K       ++  +
Sbjct  185  RYWPNNNSRMYVLENTGDFVNTHGLQLGDFIMVYKDDQNQNYVIQAKKASDEDVYANIAR  244

Query  437  PA  432
             A
Sbjct  245  TA  246



>ref|XP_010656027.1| PREDICTED: uncharacterized protein LOC100256682 [Vitis vinifera]
Length=434

 Score =   136 bits (343),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 92/143 (64%), Gaps = 14/143 (10%)
 Frame = -3

Query  830  SSSDRRQGSKPEKNLK------------FLLQKVLKQSDVGSLGRIVLPKKEAETQLPEL  687
            +SS+ R GS P  N+              L+QK L+ +DVG+LGRIVLPKK+AE  LP L
Sbjct  261  NSSETRPGSSPPANIHEDDEEIKGKGWLMLVQKELRNTDVGNLGRIVLPKKDAEANLPPL  320

Query  686  DSRDGISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADM  507
             ++DG+ + MED+  S  W  KYR+WPNN+SRMY++ENTG+FV+ + LQ GD  V+Y D 
Sbjct  321  VAKDGLVLQMEDMKYSVNWKFKYRYWPNNRSRMYVMENTGNFVKMHDLQPGDLFVVYKDE  380

Query  506  KCGKYLIRGVKVRQ--HGARSDG  444
              GKY++RG K  +  H    DG
Sbjct  381  SSGKYIVRGKKAVKPAHAEDKDG  403



>ref|XP_002275489.2| PREDICTED: B3 domain-containing transcription factor FUS3 [Vitis 
vinifera]
 emb|CBI21292.3| unnamed protein product [Vitis vinifera]
Length=287

 Score =   133 bits (335),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K L+FL +K LK SDVGSL R+VLPKK AET LP L++++GI I M D+    VWN KYR
Sbjct  89   KWLRFLFEKELKNSDVGSLRRMVLPKKSAETHLPLLEAKEGILITMYDLDGQHVWNFKYR  148

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
            FWPNN SRMY+LENTG+FV  +GLQ GD+I++Y D +    +I   K  +    +D  K
Sbjct  149  FWPNNNSRMYVLENTGEFVNVHGLQLGDYIMLYHDGQTQSLVIEARKASEKNLHADLSK  207



>ref|XP_002298665.2| hypothetical protein POPTR_0001s32990g [Populus trichocarpa]
 gb|EEE83470.2| hypothetical protein POPTR_0001s32990g [Populus trichocarpa]
Length=297

 Score =   134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 85/122 (70%), Gaps = 1/122 (1%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY-  618
            + L+FL QK L+ SDV SL R++LPKK AE  LP L+S++GI I+M+D+    VW+ KY 
Sbjct  101  RRLRFLFQKELQNSDVSSLRRMILPKKAAEVHLPFLESKEGIFISMDDLDGLHVWSFKYS  160

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGARSDGKK  438
            R+WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D +   Y+I+  K       SD  +
Sbjct  161  RYWPNNNSRMYVLENTGDFVNAHGLQLGDFIMVYQDSQSQNYVIQAKKASDQNVYSDIAR  220

Query  437  PA  432
             A
Sbjct  221  NA  222



>ref|XP_010233498.1| PREDICTED: LOW QUALITY PROTEIN: B3 domain-containing protein 
LFL1-like [Brachypodium distachyon]
Length=422

 Score =   136 bits (342),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L  +LQK L+ SD+  LGRI+LPKKEAE  LP L S+DG S+ M D+  +++W  KYR+W
Sbjct  200  LHVILQKELRNSDISQLGRIILPKKEAEAYLPILTSKDGKSLCMHDLLNAQLWTFKYRYW  259

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNNKSRMY+LENTGD+VRA+ LQ GDFI+IY D    +++IR  K
Sbjct  260  PNNKSRMYVLENTGDYVRAHNLQVGDFIMIYKDDNNNRFVIRAKK  304



>gb|KFK33600.1| hypothetical protein AALP_AA5G035000 [Arabis alpina]
Length=322

 Score =   134 bits (336),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI + MED+    VW  KYR
Sbjct  97   RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPMTMEDMDGLHVWIFKYR  156

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENTGDFV A+GL  GDFI++Y D+    ++I+  K  +
Sbjct  157  YWPNNNSRMYVLENTGDFVNAHGLHLGDFIMVYKDLNSNNFVIQARKASE  206



>ref|XP_008810033.1| PREDICTED: B3 domain-containing protein LFL1-like [Phoenix dactylifera]
Length=294

 Score =   133 bits (334),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 78/102 (76%), Gaps = 0/102 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FLLQK L  SD  SLGRIVLPK+EAE  LP L +R+GI I M+D+ T +VW  KYR+W
Sbjct  97   LRFLLQKELSHSDASSLGRIVLPKREAEVHLPVLTARNGIEINMDDLETFQVWTFKYRYW  156

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIR  483
            PNNKSRMY+L+NT +F+ A+GLQ GD I+IY D +  + +IR
Sbjct  157  PNNKSRMYILDNTANFIAAHGLQIGDLIMIYKDDERDRLVIR  198



>ref|XP_011045797.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
isoform X5 [Populus euphratica]
Length=243

 Score =   132 bits (331),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I M+D+    VW+ KYR
Sbjct  117  RRLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPFLESKEGIFINMDDLDGLHVWSFKYR  176

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
            +WPNN SRMY+LENTGDFV A+GLQ GDFI++Y D +   Y+ 
Sbjct  177  YWPNNNSRMYVLENTGDFVHAHGLQLGDFIMVYQDSQSQNYVC  219



>ref|XP_010279457.1| PREDICTED: uncharacterized protein LOC104613375 isoform X4 [Nelumbo 
nucifera]
Length=525

 Score =   137 bits (344),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = -3

Query  830  SSSDRRQGSKPE-------KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            SS+D +   +PE       + L+ L+QK L+ +DVGSLGRIVLPKK+AE  LP L  +DG
Sbjct  317  SSTDPQPMHEPEDGKEIEGRGLRVLVQKELRNTDVGSLGRIVLPKKDAEANLPPLAVKDG  376

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKY  492
            + + MED+  S  W+ KYRFWPNN+SRMY++ENTG+FV+ + LQ GD  +IY +   GKY
Sbjct  377  LILQMEDMIYSVKWHFKYRFWPNNRSRMYVMENTGEFVKMHRLQAGDLFIIYKEESSGKY  436

Query  491  LIRG  480
            ++RG
Sbjct  437  VVRG  440



>ref|XP_008802959.1| PREDICTED: putative B3 domain-containing protein Os04g0676650 
[Phoenix dactylifera]
Length=302

 Score =   133 bits (335),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            LK +LQK L  SDVG +GRIVLPKKEAE+ LP L  RDG+ + M+D+     W  KYRFW
Sbjct  110  LKMVLQKELTNSDVGRIGRIVLPKKEAESNLPPLSERDGMMLQMDDLILPTTWKFKYRFW  169

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN+SRMY++E TGDFVR +GL+ GDF +IY     G Y +   K
Sbjct  170  PNNRSRMYIMETTGDFVRTHGLEAGDFFIIYKSSASGNYAVASKK  214



>ref|XP_007031993.1| AP2/B3-like transcriptional factor family protein isoform 3 [Theobroma 
cacao]
 gb|EOY02919.1| AP2/B3-like transcriptional factor family protein isoform 3 [Theobroma 
cacao]
Length=220

 Score =   131 bits (329),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            K L+FL QK LK SDV SL R++LPK+ AE  LP L+S++GI I+M+D+    VW+ KYR
Sbjct  97   KKLRFLFQKELKNSDVSSLRRMILPKRAAEAHLPVLESKEGILISMDDLDGLHVWSFKYR  156

Query  614  FWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYL  489
            FWPNN SRMY+LENTG+FV  +GLQ GDFI++Y D +   Y+
Sbjct  157  FWPNNNSRMYVLENTGEFVNTHGLQLGDFIMVYQDSQNQNYV  198



>ref|XP_010279459.1| PREDICTED: uncharacterized protein LOC104613375 isoform X5 [Nelumbo 
nucifera]
Length=520

 Score =   137 bits (344),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = -3

Query  830  SSSDRRQGSKPE-------KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            SS+D +   +PE       + L+ L+QK L+ +DVGSLGRIVLPKK+AE  LP L  +DG
Sbjct  312  SSTDPQPMHEPEDGKEIEGRGLRVLVQKELRNTDVGSLGRIVLPKKDAEANLPPLAVKDG  371

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKY  492
            + + MED+  S  W+ KYRFWPNN+SRMY++ENTG+FV+ + LQ GD  +IY +   GKY
Sbjct  372  LILQMEDMIYSVKWHFKYRFWPNNRSRMYVMENTGEFVKMHRLQAGDLFIIYKEESSGKY  431

Query  491  LIRG  480
            ++RG
Sbjct  432  VVRG  435



>ref|XP_008379742.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Malus domestica]
Length=317

 Score =   133 bits (335),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++G++I M+DI    VW+ KYRFW
Sbjct  123  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPTLESKEGMAINMDDIDGLHVWSFKYRFW  182

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTG+FV A+GLQ GD+I++Y D     Y+I+  K
Sbjct  183  PNNNSRMYVLENTGEFVNAHGLQFGDYIMVYQDNHNQNYVIQARK  227



>ref|XP_010279456.1| PREDICTED: uncharacterized protein LOC104613375 isoform X3 [Nelumbo 
nucifera]
Length=538

 Score =   137 bits (344),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = -3

Query  830  SSSDRRQGSKPE-------KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            SS+D +   +PE       + L+ L+QK L+ +DVGSLGRIVLPKK+AE  LP L  +DG
Sbjct  330  SSTDPQPMHEPEDGKEIEGRGLRVLVQKELRNTDVGSLGRIVLPKKDAEANLPPLAVKDG  389

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKY  492
            + + MED+  S  W+ KYRFWPNN+SRMY++ENTG+FV+ + LQ GD  +IY +   GKY
Sbjct  390  LILQMEDMIYSVKWHFKYRFWPNNRSRMYVMENTGEFVKMHRLQAGDLFIIYKEESSGKY  449

Query  491  LIRG  480
            ++RG
Sbjct  450  VVRG  453



>ref|XP_007216861.1| hypothetical protein PRUPE_ppa021307mg [Prunus persica]
 gb|EMJ18060.1| hypothetical protein PRUPE_ppa021307mg [Prunus persica]
Length=316

 Score =   133 bits (335),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY-RF  612
            L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+M+DI    VW+ KY RF
Sbjct  115  LRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALESKEGIPISMDDIDGLHVWSFKYSRF  174

Query  611  WPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            WPNN SRMY+LENTG+FV A+GLQ GDFI++Y D +   Y+I+  K
Sbjct  175  WPNNNSRMYVLENTGEFVNAHGLQLGDFIMVYQDNQNQNYVIQAKK  220



>ref|XP_010279454.1| PREDICTED: uncharacterized protein LOC104613375 isoform X1 [Nelumbo 
nucifera]
Length=550

 Score =   137 bits (344),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = -3

Query  830  SSSDRRQGSKPE-------KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            SS+D +   +PE       + L+ L+QK L+ +DVGSLGRIVLPKK+AE  LP L  +DG
Sbjct  342  SSTDPQPMHEPEDGKEIEGRGLRVLVQKELRNTDVGSLGRIVLPKKDAEANLPPLAVKDG  401

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKY  492
            + + MED+  S  W+ KYRFWPNN+SRMY++ENTG+FV+ + LQ GD  +IY +   GKY
Sbjct  402  LILQMEDMIYSVKWHFKYRFWPNNRSRMYVMENTGEFVKMHRLQAGDLFIIYKEESSGKY  461

Query  491  LIRG  480
            ++RG
Sbjct  462  VVRG  465



>ref|XP_010279455.1| PREDICTED: uncharacterized protein LOC104613375 isoform X2 [Nelumbo 
nucifera]
Length=545

 Score =   137 bits (344),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 88/124 (71%), Gaps = 7/124 (6%)
 Frame = -3

Query  830  SSSDRRQGSKPE-------KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDG  672
            SS+D +   +PE       + L+ L+QK L+ +DVGSLGRIVLPKK+AE  LP L  +DG
Sbjct  337  SSTDPQPMHEPEDGKEIEGRGLRVLVQKELRNTDVGSLGRIVLPKKDAEANLPPLAVKDG  396

Query  671  ISIAMEDIGTSRVWNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKY  492
            + + MED+  S  W+ KYRFWPNN+SRMY++ENTG+FV+ + LQ GD  +IY +   GKY
Sbjct  397  LILQMEDMIYSVKWHFKYRFWPNNRSRMYVMENTGEFVKMHRLQAGDLFIIYKEESSGKY  456

Query  491  LIRG  480
            ++RG
Sbjct  457  VVRG  460



>ref|XP_011080162.1| PREDICTED: B3 domain-containing transcription factor ABI3 isoform 
X3 [Sesamum indicum]
Length=615

 Score =   137 bits (346),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/81 (84%), Positives = 72/81 (89%), Gaps = 0/81 (0%)
 Frame = -3

Query  1901  ETADLSFLQGNGELAAIFFDWLKQNKDCISAEDMRNIKLKRSTIESASKRLGSSKEGKKQ  1722
             E    SFLQGN ELA IFF+WLKQNKD ISAEDMR+IKLKRSTIESASKRLGS+KEGKKQ
Sbjct  240   ENDGFSFLQGNSELAMIFFEWLKQNKDYISAEDMRSIKLKRSTIESASKRLGSTKEGKKQ  299

Query  1721  LLKLILEWVQQYQLQKKNSRE  1659
             LLKLILEWV+QYQLQKK  RE
Sbjct  300   LLKLILEWVEQYQLQKKRMRE  320


 Score =   135 bits (341),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 135/233 (58%), Gaps = 27/233 (12%)
 Frame = -3

Query  1418  GDPYNCGGGASFTPMH---VNSGHFSHPTEYHQPAAVDTAQSWQSSEFMaaaaaAPSFNP  1248
             GDPY+        PM+   VN   + H  EY     ++ AQSW  S F         F+ 
Sbjct  398   GDPYS--NPIPVAPMNHQVVNGIPYPHAAEY---PVMEHAQSWVISPFPMQQPHQ--FSH  450

Query  1247  YPDNNNNRIAAESGHQPQALYGSEYPYQLYDGNGERLMRLGSSATKEARKKRMARQRRLS  1068
             +PDN N        HQ QALYG  +PYQ++D NGERLMRLGSSATKEARKKRMARQRRL 
Sbjct  451   FPDNGNMIT-----HQ-QALYG--HPYQIFDPNGERLMRLGSSATKEARKKRMARQRRLY  502

Query  1067  ShhfrhhnnnhhhHAQNYDPHHAMRMGVDTVLPHQVSNLGNWVYWSPA-ASEAPPPMV--  897
             SHH RH +N++ H  Q  D H       D     Q  + GNWVYWSP+ A  +P P    
Sbjct  503   SHHHRHSSNSNQHQNQMNDAHVVGEASEDG---DQAGSPGNWVYWSPSGAGSSPTPGSGP  559

Query  896   -VLppaeaapqpppaqqQNHQKQSSSDRR--QGSKPEKNLKFLLQKVLKQSDV  747
                     +    P QQQN+Q+QSSSDRR  QG K EKNLKFLLQKVLKQSD+
Sbjct  560   PADASQAHSGDRAPVQQQNYQRQSSSDRRQQQGWKTEKNLKFLLQKVLKQSDI  612



>gb|AFW83736.1| putative B3 DNA binding domain family protein [Zea mays]
 gb|AIB05461.1| ABI3VP1 transcription factor, partial [Zea mays]
Length=292

 Score =   132 bits (333),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+ LLQK L+ SDV  LGRIVLPKKEAE+ LP L ++DG S+ M D+  S++W  KYR+W
Sbjct  69   LRVLLQKELRNSDVSQLGRIVLPKKEAESYLPILMAKDGKSLCMHDLLNSQLWTFKYRYW  128

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLI  486
             NNKSRMY+LENTGD+V+A+ LQ+GDFIVIY D +  +++I
Sbjct  129  FNNKSRMYVLENTGDYVKAHDLQQGDFIVIYKDDENNRFVI  169



>ref|XP_008341665.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Malus domestica]
Length=325

 Score =   133 bits (334),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV  L R++LPKK AE  LP L+S++GI+I M+DI    VW+ KYRFW
Sbjct  124  LRFLFQKELKNSDVSPLRRMILPKKAAEAHLPTLESKEGIAINMDDIDGLHVWSFKYRFW  183

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV  +GLQ GD+I++Y D     Y+I+  K
Sbjct  184  PNNNSRMYVLENTGDFVNVHGLQFGDYIMVYQDNHNQNYVIQARK  228



>ref|XP_010249171.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
isoform X1 [Nelumbo nucifera]
Length=308

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 8/125 (6%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPK--------KEAETQLPELDSRDGISIAMEDIGTSRV  633
            L+FLLQK L+ SDV SLGR+VLPK        + AE  LP LD+++G+ I M+D+   RV
Sbjct  102  LRFLLQKELRNSDVSSLGRMVLPKVSWEIGLQRAAEAHLPILDTKEGMFIDMDDMDGLRV  161

Query  632  WNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGAR  453
            WN KYRFWPNN SRMY+LEN G+FV+ +GLQ GDFI++Y D +  KY+IR  K       
Sbjct  162  WNFKYRFWPNNNSRMYILENIGEFVKMHGLQLGDFIMLYRDDQNQKYVIRARKASDQDIF  221

Query  452  SDGKK  438
            S+  +
Sbjct  222  SESTR  226



>dbj|BAB01226.1| FUSCA3 [Arabidopsis thaliana]
Length=313

 Score =   132 bits (332),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 79/111 (71%), Gaps = 1/111 (1%)
 Frame = -3

Query  794  KNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYR  615
            + L+FL QK LK SDV SL R++LPKK AE  LP L+ ++GI I MED+    VW  KYR
Sbjct  85   RKLRFLFQKELKNSDVSSLRRMILPKKAAEAHLPALECKEGIPIRMEDLDGFHVWTFKYR  144

Query  614  FWPNNKSRMYLLENT-GDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQ  465
            +WPNN SRMY+LENT GDFV A+GLQ GDFI++Y D+    Y+I+  K  +
Sbjct  145  YWPNNNSRMYVLENTAGDFVNAHGLQLGDFIMVYQDLYSNNYVIQARKASE  195



>ref|XP_003553973.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Glycine max]
 gb|KHN28566.1| B3 domain-containing transcription factor FUS3 [Glycine soja]
Length=332

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            ++ L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+M+DI    VW+ KY
Sbjct  137  QRRLRFLFQKELKNSDVSSLRRMILPKKAAEAFLPALESKEGIVISMDDIDGLHVWSFKY  196

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            RFWPNN SRMY+LENTGDFV  +GL+ GD I++Y D +   Y+I+  K
Sbjct  197  RFWPNNNSRMYVLENTGDFVNTHGLRFGDSIMVYQDSENNNYVIQAKK  244



>ref|XP_008656805.1| PREDICTED: B3 domain-containing protein LFL1-like [Zea mays]
Length=392

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 0/106 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+ LLQK L+ SDV  LGRIVLPKKEAE+ LP L ++DG S+ M D+  S++W  KYR+W
Sbjct  169  LRVLLQKELRNSDVSQLGRIVLPKKEAESYLPILMAKDGKSLCMHDLLNSQLWTFKYRYW  228

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKV  471
             NNKSRMY+LENTGD+V+A+ LQ+GDFIVIY D +  +++I   K 
Sbjct  229  FNNKSRMYVLENTGDYVKAHDLQQGDFIVIYKDDENNRFVIGAKKA  274



>ref|XP_010249175.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
isoform X5 [Nelumbo nucifera]
Length=279

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 85/125 (68%), Gaps = 8/125 (6%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPK--------KEAETQLPELDSRDGISIAMEDIGTSRV  633
            L+FLLQK L+ SDV SLGR+VLPK        + AE  LP LD+++G+ I M+D+   RV
Sbjct  73   LRFLLQKELRNSDVSSLGRMVLPKVSWEIGLQRAAEAHLPILDTKEGMFIDMDDMDGLRV  132

Query  632  WNMKYRFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVKVRQHGAR  453
            WN KYRFWPNN SRMY+LEN G+FV+ +GLQ GDFI++Y D +  KY+IR  K       
Sbjct  133  WNFKYRFWPNNNSRMYILENIGEFVKMHGLQLGDFIMLYRDDQNQKYVIRARKASDQDIF  192

Query  452  SDGKK  438
            S+  +
Sbjct  193  SESTR  197



>ref|XP_003548926.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Glycine max]
Length=338

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            ++ L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+M+DI    VW+ KY
Sbjct  143  QRRLRFLFQKELKNSDVSSLRRMILPKKAAEAFLPALESKEGIVISMDDIDGLHVWSFKY  202

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            RFWPNN SRMY+LENTGDFV  +GL+ GD I++Y D +   Y+I+  K
Sbjct  203  RFWPNNNSRMYVLENTGDFVNTHGLRFGDSILVYQDSENNNYVIQAKK  250



>gb|KHM99228.1| B3 domain-containing transcription factor FUS3 [Glycine soja]
Length=338

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 80/108 (74%), Gaps = 0/108 (0%)
 Frame = -3

Query  797  EKNLKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKY  618
            ++ L+FL QK LK SDV SL R++LPKK AE  LP L+S++GI I+M+DI    VW+ KY
Sbjct  143  QRRLRFLFQKELKNSDVSSLRRMILPKKAAEAFLPALESKEGIVISMDDIDGLHVWSFKY  202

Query  617  RFWPNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            RFWPNN SRMY+LENTGDFV  +GL+ GD I++Y D +   Y+I+  K
Sbjct  203  RFWPNNNSRMYVLENTGDFVNTHGLRFGDSILVYQDSENNNYVIQAKK  250



>ref|XP_009378079.1| PREDICTED: B3 domain-containing transcription factor FUS3-like 
[Pyrus x bretschneideri]
Length=323

 Score =   131 bits (330),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  788  LKFLLQKVLKQSDVGSLGRIVLPKKEAETQLPELDSRDGISIAMEDIGTSRVWNMKYRFW  609
            L+FL QK LK SDV  L R++LPKK AE  LP L+S++G++I M+DI    VW+ KYRFW
Sbjct  122  LRFLFQKELKNSDVSPLRRMILPKKAAEAHLPTLESKEGMAINMDDIDGLHVWSFKYRFW  181

Query  608  PNNKSRMYLLENTGDFVRANGLQEGDFIVIYADMKCGKYLIRGVK  474
            PNN SRMY+LENTGDFV  +GLQ GD+I++Y D     Y+I+  K
Sbjct  182  PNNNSRMYVLENTGDFVNVHGLQFGDYIMVYQDNHNQNYVIQARK  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5904482816736