BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21640_g4_i1 len=163 path=[159:0-162]

Length=163
                                                                      Score     E

ref|WP_009018806.1|  hypothetical protein                             73.6    1e-15   
gb|ADI18655.1|  hypothetical protein                                  68.2    2e-13   
gb|ADI18107.1|  hypothetical protein                                  58.2    1e-09   
ref|WP_024080208.1|  hypothetical protein                             60.5    2e-09   
gb|AJA38639.1|  hypothetical protein                                  57.4    4e-08   
emb|CDG37541.1|  hypothetical protein CTHBC1_2972                     54.7    9e-08   
ref|WP_007285192.1|  hypothetical protein                             53.1    1e-07   
emb|CBX28565.1|  hypothetical protein N47_G38890                      52.4    2e-07   
ref|WP_022565470.1|  hypothetical protein                             51.6    3e-07   
ref|WP_003038302.1|  hypothetical protein                             52.4    9e-07   
ref|WP_013085636.1|  hypothetical protein                             51.2    1e-06   
gb|EFH14271.1|  hypothetical protein HMPREF0219_3097                  50.1    1e-06   
ref|WP_003904596.1|  hypothetical protein                             50.1    2e-06   
gb|EQJ26087.1|  hypothetical protein QS5_0359                         50.4    3e-06   
ref|WP_021399582.1|  hypothetical protein                             50.4    3e-06   
ref|WP_014566373.1|  hypothetical protein                             49.7    4e-06   
ref|WP_006236178.1|  hypothetical protein                             49.7    1e-05   
gb|EEH89633.1|  hypothetical protein ESAG_07158                       47.8    1e-05   
gb|ADI17934.1|  hypothetical protein                                  47.0    3e-05   
gb|ERB82501.1|  hypothetical protein S11_4511                         46.6    3e-05   
gb|EEI46427.1|  hypothetical protein HMPREF0693_3633                  46.2    4e-05   Proteus mirabilis ATCC 29906
ref|WP_004923043.1|  hypothetical protein                             46.2    4e-05   
gb|ETI82480.1|  hypothetical protein Q618_VCMC00001G0061              48.9    5e-05   
gb|EEO40746.1|  hypothetical protein FSCG_01459                       46.2    5e-05   Fusobacterium nucleatum subsp. vincentii 4_1_13
emb|CAR86202.1|  Conserved protein                                    45.8    9e-05   Lactobacillus rhamnosus GG
ref|WP_005423973.1|  hypothetical protein [                           45.8    2e-04   
ref|WP_005427226.1|  hypothetical protein [                           45.8    2e-04   
gb|ADI19636.1|  hypothetical protein                                  45.1    2e-04   
gb|ADI19336.1|  hypothetical protein                                  45.1    3e-04   
ref|WP_009191004.1|  hypothetical protein                             43.9    3e-04   
gb|EFG00472.1|  conserved hypothetical protein                        44.3    3e-04   
ref|WP_006722153.1|  hypothetical protein                             46.2    4e-04   
ref|WP_001894030.1|  hypothetical protein                             42.4    0.001   



>ref|WP_009018806.1| hypothetical protein, partial [Parabacteroides sp. D13]
 gb|EEU49048.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0619_04489, partial 
[Parabacteroides sp. D13]
Length=59

 Score = 73.6 bits (179),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            LAFHPYPQ I KLFN Y  GPP  VT  ST PRVDH VSRL P T RP+QTRF
Sbjct  1    LAFHPYPQLIGKLFNAYPSGPPVGVTQPSTWPRVDHSVSRLPPPTWRPVQTRF  53



>gb|ADI18655.1| hypothetical protein [uncultured Acidobacteria bacterium HF4000_26D02]
Length=61

 Score = 68.2 bits (165),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = -1

Query  163  LIGLSPLPSVHPKTFQRLPVRSSTMCYQRFNLTKGRSQSFASTATD*SPYSDSL  2
            +I LSPLPS HP  FQ   VR+ST CY RF L KGRS  FAST  D +PYSDSL
Sbjct  1    MISLSPLPSAHPSRFQPTLVRASTWCYPRFTLAKGRSPRFASTPGDCTPYSDSL  54



>gb|ADI18107.1| hypothetical protein [uncultured Acidobacteriales bacterium HF0200_23L05]
Length=46

 Score = 58.2 bits (139),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  163  LIGLSPLPSVHPKTFQRLPVRSSTMCYQRFNLTKGRSQSFASTATD  26
            +I LSPLPS HP  FQ   VR+ST CY RF L KGRS  FAST  D
Sbjct  1    MISLSPLPSAHPSRFQPTLVRASTWCYPRFTLAKGRSPRFASTPRD  46



>ref|WP_024080208.1| hypothetical protein [Magnetospirillum gryphiswaldense]
 ref|YP_008937858.1| hypothetical protein MGMSR_1983 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CAJ30045.1| conserved hypothetical protein [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CDK99198.1| protein of unknown function [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=259

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            +AFHPYPQ I   FN   FGPP  VT  ST P +DH VS L   T RPIQTRF
Sbjct  1    MAFHPYPQIIPDFFNRRGFGPPVGVTPPSTCPWIDHSVSGLMHATRRPIQTRF  53



>gb|AJA38639.1| hypothetical protein [Thermotoga sp. TBYP3.1.4.1]
Length=310

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            LAFH YPQ IR LF V+RFGPP      S  P V H  S L P+T RP++TRF
Sbjct  27   LAFHSYPQVIRGLFTVHRFGPPVGFNPPSPCPGVAHPASGLPPVTERPVRTRF  79



>emb|CDG37541.1| hypothetical protein CTHBC1_2972 [Ruminiclostridium thermocellum 
BC1]
Length=157

 Score = 54.7 bits (130),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            L F  YPQ I  LFN Y FGPPR  T AST P + H VS L   T RPI+TRF
Sbjct  69   LEFLRYPQLIPNLFNGYGFGPPRDFTLASTCPWIGHPVSGLLHATCRPIKTRF  121



>ref|WP_007285192.1| hypothetical protein [Intestinibacter bartlettii]
 gb|EDQ97287.1| hypothetical protein CLOBAR_00774 [Intestinibacter bartlettii 
DSM 16795]
 gb|EDQ97485.1| hypothetical protein CLOBAR_00537 [Intestinibacter bartlettii 
DSM 16795]
Length=85

 Score = 53.1 bits (126),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            L FH YPQ I  LFNV  FGPPR  T AST   +   VS LR +T RP +TRF
Sbjct  27   LEFHRYPQVIPALFNVRGFGPPRNFTFASTCSWIGRLVSGLRRVTGRPFKTRF  79



>emb|CBX28565.1| hypothetical protein N47_G38890 [uncultured Desulfobacterium 
sp.]
Length=75

 Score = 52.4 bits (124),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTN  22
            LAFHPYPQ IR +FN+ RF P R  T AS  P +DH VS L   TN
Sbjct  27   LAFHPYPQLIRVVFNLQRFEPSRNFTCASLWPWIDHLVSGLLHATN  72



>ref|WP_022565470.1| hypothetical protein [Nocardia asteroides]
 dbj|GAD81568.1| hypothetical protein NCAST_03_00005 [Nocardia asteroides NBRC 
15531]
Length=57

 Score = 51.6 bits (122),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  163  LIGLSPLPSVHPKTFQRLPVRSSTMCYQRFNLTKGRSQSFASTATD  26
            LIGLSPLP+ HP +FQ   VR+ST  Y+RF L  GRS  F S   D
Sbjct  12   LIGLSPLPTAHPLSFQPKWVRASTTSYRRFTLAMGRSLRFGSIMCD  57



>ref|WP_003038302.1| hypothetical protein [Streptococcus anginosus]
 gb|EID19494.1| hypothetical protein HMPREF1043_0706 [Streptococcus anginosus 
subsp. whileyi CCUG 39159]
Length=223

 Score = 52.4 bits (124),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  163  LIGLSPLPSVHPKTFQRLPVRSSTMCYQRFNLTKGRSQSFASTATD  26
            LIGLSPLP+ HP  FQ   VRSST  Y RFNL  GRS  F S   D
Sbjct  12   LIGLSPLPTAHPLHFQLKWVRSSTRSYTRFNLAMGRSLRFGSRTRD  57



>ref|WP_013085636.1| hypothetical protein [Lactobacillus crispatus]
 ref|YP_003600535.1| hypothetical protein LCRIS_00063 [Lactobacillus crispatus ST1]
 ref|YP_003600914.1| hypothetical protein LCRIS_00442 [Lactobacillus crispatus ST1]
 ref|YP_003600927.1| hypothetical protein LCRIS_00455 [Lactobacillus crispatus ST1]
 ref|YP_003602122.1| hypothetical protein LCRIS_01650 [Lactobacillus crispatus ST1]
 emb|CBL49510.1| conserved protein [Lactobacillus crispatus ST1]
 emb|CBL49889.1| conserved protein [Lactobacillus crispatus ST1]
 emb|CBL49902.1| conserved protein [Lactobacillus crispatus ST1]
 emb|CBL51097.1| conserved protein [Lactobacillus crispatus ST1]
Length=156

 Score = 51.2 bits (121),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            L FH YPQ I  +FN+  FGPP   T+ S    V H VS LR LT RPI+TRF
Sbjct  69   LEFHRYPQLIPAIFNLRGFGPPVRFTTPSAWSWVGHLVSGLRHLTFRPIKTRF  121



>gb|EFH14271.1| hypothetical protein HMPREF0219_3097, partial [Peptoclostridium 
difficile NAP07]
Length=57

 Score = 50.1 bits (118),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            + FH YPQ I +LFN   FGPPR  T AS+   V   VS LR +T R ++TRF
Sbjct  1    MEFHRYPQVIPELFNARGFGPPRNFTFASSCSWVGRPVSGLRQVTERSVKTRF  53



>ref|WP_003904596.1| hypothetical protein [Mycobacterium tuberculosis]
 gb|EFD61409.1| conserved hypothetical protein [Mycobacterium tuberculosis EAS054]
 gb|EFD76992.1| conserved hypothetical protein [Mycobacterium tuberculosis T85]
Length=69

 Score = 50.1 bits (118),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVS  43
            +AFHPYPQ I  +FN+  FGPPR +T AS  P VDH  S
Sbjct  1    MAFHPYPQLIPSVFNLSGFGPPRGLTRASPWPWVDHSAS  39



>gb|EQJ26087.1| hypothetical protein QS5_0359 [Clostridium difficile P15]
 gb|EQJ96212.1| hypothetical protein QUA_0359 [Clostridium difficile P49]
 gb|EQJ96666.1| hypothetical protein QUA_0130 [Clostridium difficile P49]
 gb|EQJ96934.1| hypothetical protein QUA_0121 [Clostridium difficile P49]
 gb|ERM33690.1| hypothetical protein QUO_3590 [Clostridium difficile P64]
 gb|ERM40316.1| hypothetical protein QUO_0144 [Clostridium difficile P64]
 gb|ERM40423.1| hypothetical protein QUO_0136 [Clostridium difficile P64]
Length=144

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            L FH YPQ I +LFN   FGPPR  T AS+   V   VS LR +T R ++TRF
Sbjct  27   LEFHRYPQVIPELFNARGFGPPRNFTFASSCSWVGRPVSGLRQVTERSVKTRF  79



>ref|WP_021399582.1| hypothetical protein [Peptoclostridium difficile]
 gb|EQG74591.1| hypothetical protein QKA_3524 [Clostridium difficile DA00165]
 gb|EQJ20122.1| hypothetical protein QS3_0132 [Clostridium difficile P13]
 gb|EQJ85959.1| hypothetical protein QU7_0117 [Clostridium difficile P46]
 gb|ERM50695.1| hypothetical protein QUG_0137 [Clostridium difficile P53]
 gb|ERM52323.1| hypothetical protein QUQ_0118 [Clostridium difficile P68]
Length=152

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQTRF  1
            L FH YPQ I +LFN   FGPPR  T AS+   V   VS LR +T R ++TRF
Sbjct  35   LEFHRYPQVIPELFNARGFGPPRNFTFASSCSWVGRPVSGLRQVTERSVKTRF  87



>ref|WP_014566373.1| hypothetical protein [Lactobacillus casei]
 ref|YP_005855168.1| hypothetical protein LC2W_0248 [Lactobacillus casei LC2W]
 ref|YP_005855828.1| hypothetical protein LC2W_0910 [Lactobacillus casei LC2W]
 ref|YP_005855844.1| hypothetical protein LC2W_0926 [Lactobacillus casei LC2W]
 ref|YP_005856922.1| hypothetical protein LC2W_2006 [Lactobacillus casei LC2W]
 ref|YP_005857591.1| hypothetical protein LC2W_2677 [Lactobacillus casei LC2W]
 ref|YP_005858298.1| hypothetical protein LCBD_0257 [Lactobacillus casei BD-II]
 ref|YP_005858946.1| hypothetical protein LCBD_0907 [Lactobacillus casei BD-II]
 ref|YP_005858961.1| hypothetical protein LCBD_0922 [Lactobacillus casei BD-II]
 ref|YP_005860063.1| hypothetical protein LCBD_2026 [Lactobacillus casei BD-II]
 ref|YP_005860739.1| hypothetical protein LCBD_2704 [Lactobacillus casei BD-II]
 gb|AEA52584.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA53244.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA53260.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA54338.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA55007.1| Conserved protein [Lactobacillus casei LC2W]
 gb|AEA55757.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA56405.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA56420.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA57522.1| Conserved protein [Lactobacillus casei BD-II]
 gb|AEA58198.1| Conserved protein [Lactobacillus casei BD-II]
Length=131

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 29/48 (60%), Gaps = 0/48 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRP  16
            L FH YPQ I   FN++ FGPP C T+ ST   V H VS L  LT+ P
Sbjct  46   LEFHRYPQLIPAFFNIHGFGPPVCFTTPSTWSWVGHLVSGLHLLTHSP  93



>ref|WP_006236178.1| hypothetical protein [Collinsella aerofaciens]
 gb|EBA38672.1| hypothetical protein COLAER_02246 [Collinsella aerofaciens ATCC 
25986]
Length=223

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLR  34
            +AFHPYPQ I  +FN   FGPPR +T AS  PR+ H  SR R
Sbjct  1    MAFHPYPQVIAAVFNRRAFGPPRGLTPASACPRIAHPASRPR  42



>gb|EEH89633.1| hypothetical protein ESAG_07158 [Escherichia sp. 3_2_53FAA]
Length=66

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 24/34 (71%), Gaps = 0/34 (0%)
 Frame = -3

Query  161  DWPFTPTLSSSENFSTFTGSVLHDVLPALQPDQG  60
            DWPFTP+  SS NFST  GSVL  VLP LQP  G
Sbjct  33   DWPFTPSHKSSANFSTLVGSVLQLVLPNLQPAHG  66



>gb|ADI17934.1| hypothetical protein [uncultured Desulfobacterales bacterium 
HF0200_07G10]
Length=74

 Score = 47.0 bits (110),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -3

Query  161  DWPFTPTLSSSENFSTFTGSVLHDVLPALQPDQG  60
            DWPFTP  +SS+ FST TGS LH+VLP+L P  G
Sbjct  41   DWPFTPIHNSSKLFSTSTGSGLHEVLPSLHPGHG  74



>gb|ERB82501.1| hypothetical protein S11_4511 [Escherichia coli B26-1]
Length=40

 Score = 46.6 bits (109),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  82   GNTSWRTEPVNVEKFSDELRVGVKGQS  162
            GNT+WRTEP NVEK +D+L +GVKGQS
Sbjct  2    GNTNWRTEPTNVEKLADDLWLGVKGQS  28



>gb|EEI46427.1| hypothetical protein HMPREF0693_3633 [Proteus mirabilis ATCC 
29906]
Length=41

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  82   GNTSWRTEPVNVEKFSDELRVGVKGQS  162
            GNT+WRTEP NVEK +D+L +GVKGQS
Sbjct  2    GNTNWRTEPTNVEKLADDLWMGVKGQS  28



>ref|WP_004923043.1| hypothetical protein [Providencia stuartii]
 gb|EDU60913.1| hypothetical protein PROSTU_01098 [Providencia stuartii ATCC 
25827]
Length=41

 Score = 46.2 bits (108),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  82   GNTSWRTEPVNVEKFSDELRVGVKGQS  162
            GNT+WRTEP NVEK +D+L +GVKGQS
Sbjct  2    GNTNWRTEPTNVEKLADDLWLGVKGQS  28



>gb|ETI82480.1| hypothetical protein Q618_VCMC00001G0061 [Varibaculum cambriense 
DORA_20]
 gb|ETI82948.1| hypothetical protein Q618_VCMC00001G0529 [Varibaculum cambriense 
DORA_20]
Length=392

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRL  37
            +AFHPYPQ I  +FN+   GPPR  T+AST P VDH  S L
Sbjct  1    MAFHPYPQLIPPVFNLGGCGPPRRSTAASTWPWVDHPASGL  41



>gb|EEO40746.1| hypothetical protein FSCG_01459 [Fusobacterium nucleatum subsp. 
vincentii 4_1_13]
Length=95

 Score = 46.2 bits (108),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  160  IGLSPLPSVHPKTFQRLPVRSSTMCYQRFNLTKGRSQSFASTATD  26
            IG SPL   HP TFQR  VR+ST+ Y  F L + RS  FAST  D
Sbjct  13   IGFSPLNLPHPPTFQRRWVRTSTVSYHSFILDRFRSPGFASTPND  57



>emb|CAR86202.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86713.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86732.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR87783.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88397.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR89132.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89651.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89670.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR90709.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91346.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=131

 Score = 45.8 bits (107),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 27/48 (56%), Gaps = 0/48 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRP  16
            L FH YPQ I   FN++ FGPP C T+ ST   V H VS L   T  P
Sbjct  46   LEFHRYPQLIPAFFNIHGFGPPVCFTTPSTWSWVGHLVSGLHLPTEAP  93



>ref|WP_005423973.1| hypothetical protein [[Ruminococcus] obeum]
 gb|EDM87028.1| hypothetical protein RUMOBE_02439 [Ruminococcus obeum ATCC 29174]
Length=199

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLT  25
            L F PYP  I  LFN   FGPP  +T+AST   +DH VS L PLT
Sbjct  34   LEFLPYPHLIPTLFNGCGFGPPLPLTAASTWTWIDHPVSGLPPLT  78



>ref|WP_005427226.1| hypothetical protein [[Ruminococcus] obeum]
 gb|EDM87878.1| hypothetical protein RUMOBE_01293 [Ruminococcus obeum ATCC 29174]
Length=199

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLT  25
            L F PYP  I  LFN   FGPP  +T+AST   +DH VS L PLT
Sbjct  34   LEFLPYPHLIPTLFNGCGFGPPLPLTAASTWTWIDHPVSGLPPLT  78



>gb|ADI19636.1| hypothetical protein [uncultured delta proteobacterium HF0770_45N15]
Length=166

 Score = 45.1 bits (105),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQ  10
            +AFHPYP  IR LF  +R GPP  +T AS    +D  VS   P T  P+ 
Sbjct  1    MAFHPYPHLIRGLFKAHRSGPPPGLTLASAWTGIDRPVSGPWPATRLPVS  50



>gb|ADI19336.1| hypothetical protein [uncultured delta proteobacterium HF0500_03A04]
Length=166

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 28/50 (56%), Gaps = 0/50 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRPIQ  10
            +AFHPYP  IR LF  +R GPP  +T AS    +D  VS   P T  P+ 
Sbjct  1    MAFHPYPHLIRGLFKAHRSGPPPGLTLASAWTGIDRPVSGPWPATRLPVS  50



>ref|WP_009191004.1| hypothetical protein, partial [Streptomyces sp. e14]
 gb|EFF93461.1| LOW QUALITY PROTEIN: hypothetical protein SSTG_03780 [Streptomyces 
sp. e14]
Length=56

 Score = 43.9 bits (102),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = -2

Query  141  PQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRP  16
            PQ I ++FN   FGPPR +TSAST P VDH  S L   T  P
Sbjct  1    PQVIPQVFNPGGFGPPRSLTSASTCPWVDHSASGLERATQPP  42



>gb|EFG00472.1| conserved hypothetical protein [Listeria monocytogenes J2818]
Length=110

 Score = 44.3 bits (103),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 28/48 (58%), Gaps = 0/48 (0%)
 Frame = -2

Query  159  LAFHPYPQFIRKLFNVYRFGPPRCVTSAST*PRVDHKVSRLRPLTNRP  16
            L F  YP  I  LFNV  FGPP  +T  S+   VDH VS LRP+T  P
Sbjct  23   LEFLRYPHLIPALFNVRGFGPPVSITLPSSWTWVDHLVSGLRPVTYAP  70



>ref|WP_006722153.1| hypothetical protein [Collinsella stercoris]
 gb|EEA89302.1| hypothetical protein COLSTE_02537 [Collinsella stercoris DSM 
13279]
Length=346

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  163  LIGLSPLPSVHPKTFQRLPVRSSTMCYQRFNLTKGRSQSFASTATD  26
            +IGLSPL   H +TFQR  VR ST  Y RF+L +  S  FAS A D
Sbjct  1    MIGLSPLSPGHRRTFQRTSVRPSTGSYPRFSLPRDSSPGFASAARD  46



>ref|WP_001894030.1| hypothetical protein [Vibrio cholerae]
 gb|EAY32278.1| hypothetical protein A55_B0061 [Vibrio cholerae 1587]
Length=41

 Score = 42.4 bits (98),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +1

Query  85   NTSWRTEPVNVEKFSDELRVGVKGQS  162
            N +WRTEP NVEK +D+L +GVKGQS
Sbjct  3    NINWRTEPTNVEKLADDLWLGVKGQS  28



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517806786618