BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21638_g2_i1 len=165 path=[2828:0-16 2476:17-43 2503:44-69
2529:70-164]

Length=165
                                                                      Score     E

ref|XP_002533718.1|  conserved hypothetical protein                   75.5    4e-15   Ricinus communis
ref|XP_008388326.1|  PREDICTED: proactivator polypeptide-like 1       74.3    1e-14   
ref|XP_009371991.1|  PREDICTED: prosaposin                            73.9    1e-14   
ref|XP_008245127.1|  PREDICTED: proactivator polypeptide-like 1       71.6    1e-13   
ref|XP_007207246.1|  hypothetical protein PRUPE_ppa009037m1g          71.6    1e-13   
ref|XP_007033574.1|  Saposin B domain-containing protein, putativ...  71.2    1e-13   
ref|XP_010042407.1|  PREDICTED: prosaposin-like                       70.9    2e-13   
ref|XP_007207245.1|  hypothetical protein PRUPE_ppa009037m1g          71.2    2e-13   
gb|KDP22785.1|  hypothetical protein JCGZ_00372                       70.9    2e-13   
ref|XP_002323058.1|  saposin B domain-containing family protein       70.9    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_002308246.1|  saposin B domain-containing family protein       70.5    3e-13   Populus trichocarpa [western balsam poplar]
ref|XP_011019027.1|  PREDICTED: proactivator polypeptide-like 1       70.5    3e-13   
gb|EYU41997.1|  hypothetical protein MIMGU_mgv1a013247mg              70.1    4e-13   
gb|KHG03118.1|  Proactivator polypeptide                              69.7    4e-13   
ref|XP_004249637.1|  PREDICTED: prosaposin                            70.1    5e-13   
ref|XP_010091067.1|  Proactivator polypeptide                         69.7    5e-13   
ref|XP_009774594.1|  PREDICTED: prosaposin-like                       69.3    8e-13   
ref|XP_009599219.1|  PREDICTED: prosaposin-like                       68.9    9e-13   
ref|XP_009764732.1|  PREDICTED: prosaposin-like                       68.9    1e-12   
ref|XP_006481164.1|  PREDICTED: uncharacterized protein LOC102619717  68.6    1e-12   
ref|XP_004302581.1|  PREDICTED: proactivator polypeptide-like 1-like  68.6    1e-12   
ref|XP_006338961.1|  PREDICTED: uncharacterized protein LOC102600...  68.2    2e-12   
ref|XP_006349570.1|  PREDICTED: proactivator polypeptide-like iso...  67.4    3e-12   
ref|XP_011095112.1|  PREDICTED: prosaposin-like isoform X2            67.4    4e-12   
ref|XP_011095111.1|  PREDICTED: prosaposin-like isoform X1            67.4    4e-12   
ref|XP_011095113.1|  PREDICTED: prosaposin-like isoform X3            67.0    4e-12   
ref|XP_010035988.1|  PREDICTED: prosaposin-like                       67.0    4e-12   
ref|XP_009590656.1|  PREDICTED: prosaposin-like isoform X1            67.0    4e-12   
ref|XP_009590658.1|  PREDICTED: prosaposin-like isoform X2            67.0    5e-12   
ref|XP_006843736.1|  hypothetical protein AMTR_s00007p00225690        66.6    6e-12   
ref|XP_007033575.1|  Saposin B domain-containing protein, putativ...  66.6    6e-12   
ref|XP_011003593.1|  PREDICTED: prosaposin                            66.6    6e-12   
gb|AHZ31397.1|  saposin B domain-containing protein                   65.1    7e-12   
ref|XP_006429547.1|  hypothetical protein CICLE_v10011064mg           69.3    7e-12   
emb|CDP06403.1|  unnamed protein product                              66.6    1e-11   
gb|EPS73961.1|  hypothetical protein M569_00799                       65.9    1e-11   
gb|AAF32354.1|AF220198_1  putative protein                            65.5    1e-11   Vitis riparia [frost grape]
ref|XP_006338959.1|  PREDICTED: proactivator polypeptide-like iso...  66.2    1e-11   
ref|XP_010426757.1|  PREDICTED: proactivator polypeptide-like 1       65.5    2e-11   
gb|AHZ31393.1|  saposin B domain-containing protein                   63.9    2e-11   
ref|XP_002876101.1|  predicted protein                                65.1    2e-11   
ref|XP_010503868.1|  PREDICTED: prosaposin-like isoform X3            65.1    2e-11   
ref|XP_010503867.1|  PREDICTED: prosaposin-like isoform X2            65.1    2e-11   
ref|XP_010515602.1|  PREDICTED: prosaposin-like isoform X2            65.1    2e-11   
ref|XP_010503866.1|  PREDICTED: prosaposin-like isoform X1            65.1    2e-11   
ref|XP_010515601.1|  PREDICTED: prosaposin-like isoform X1            65.1    2e-11   
gb|AHZ31401.1|  saposin B domain-containing protein                   63.5    3e-11   
emb|CAN81220.1|  hypothetical protein VITISV_040421                   64.3    3e-11   Vitis vinifera
gb|ABQ42118.1|  saposin B domain-containing protein                   63.5    3e-11   Sonneratia caseolaris
ref|XP_006403887.1|  hypothetical protein EUTSA_v10010716mg           64.3    4e-11   
gb|AHZ31395.1|  saposin B domain-containing protein                   63.2    4e-11   
dbj|BAJ33968.1|  unnamed protein product                              64.3    4e-11   
gb|ABQ42119.1|  saposin B domain-containing protein                   63.2    4e-11   Sonneratia ovata
ref|XP_002268581.1|  PREDICTED: prosaposin                            64.3    4e-11   Vitis vinifera
ref|XP_006293287.1|  hypothetical protein CARUB_v10019623mg           64.3    4e-11   
ref|NP_190741.1|  saposin B domain-containing protein                 64.3    4e-11   Arabidopsis thaliana [mouse-ear cress]
gb|AHZ31399.1|  saposin B domain-containing protein                   63.2    5e-11   
gb|AHZ31400.1|  saposin B domain-containing protein                   62.4    7e-11   
gb|AHZ31394.1|  saposin B domain-containing protein                   62.4    7e-11   
gb|ABQ42117.1|  saposin B domain-containing protein                   62.8    8e-11   Sonneratia alba
ref|XP_010326217.1|  PREDICTED: prosaposin isoform X2                 63.5    8e-11   
gb|ACS68697.1|  saposin B domain-containing protein                   62.4    8e-11   Sonneratia alba
ref|XP_010529095.1|  PREDICTED: proactivator polypeptide-like 1       63.5    8e-11   
ref|XP_004246981.2|  PREDICTED: prosaposin isoform X1                 63.5    9e-11   
ref|XP_010937982.1|  PREDICTED: prosaposin-like                       63.2    1e-10   
gb|KFK34416.1|  hypothetical protein AALP_AA5G141700                  63.2    1e-10   
ref|XP_010264460.1|  PREDICTED: prosaposin-like                       63.2    1e-10   
ref|XP_009136631.1|  PREDICTED: prosaposin-like                       62.8    1e-10   
emb|CDY67661.1|  BnaA03g57960D                                        62.8    1e-10   
emb|CDY29042.1|  BnaC07g32480D                                        62.4    2e-10   
ref|XP_010256940.1|  PREDICTED: prosaposin                            62.4    2e-10   
emb|CBI18062.3|  unnamed protein product                              64.7    3e-10   
ref|XP_008782628.1|  PREDICTED: proactivator polypeptide-like 1       61.6    5e-10   
ref|XP_009115874.1|  PREDICTED: prosaposin-like                       61.2    6e-10   
ref|XP_010554922.1|  PREDICTED: proactivator polypeptide-like 1       60.8    6e-10   
ref|XP_010683542.1|  PREDICTED: prosaposin-like                       60.1    1e-09   
emb|CDX73698.1|  BnaC08g23050D                                        60.8    1e-09   
ref|XP_004149924.1|  PREDICTED: proactivator polypeptide-like 1-like  58.9    4e-09   
ref|XP_009419859.1|  PREDICTED: proactivator polypeptide-like 1       60.1    4e-09   
ref|XP_010921111.1|  PREDICTED: proactivator polypeptide-like 1 i...  58.5    4e-09   
ref|XP_004163784.1|  PREDICTED: proactivator polypeptide-like 1-like  58.9    4e-09   
ref|XP_008464263.1|  PREDICTED: proactivator polypeptide-like 1       58.9    5e-09   
ref|XP_010921104.1|  PREDICTED: proactivator polypeptide-like 1 i...  58.5    5e-09   
ref|XP_010922696.1|  PREDICTED: proactivator polypeptide-like 1       58.9    5e-09   
ref|XP_010921107.1|  PREDICTED: proactivator polypeptide-like 1 i...  58.5    5e-09   
gb|EMT05884.1|  hypothetical protein F775_27224                       57.8    7e-09   
ref|NP_001042117.2|  Os01g0166700                                     57.0    2e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EMS66984.1|  Proactivator polypeptide                              57.4    2e-08   
dbj|BAB39899.1|  P0028E10.2                                           57.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
gb|EAY72679.1|  hypothetical protein OsI_00546                        57.0    3e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_003623572.1|  Saposin B domain-containing protein              55.5    5e-08   
ref|XP_008810565.1|  PREDICTED: uncharacterized protein LOC103721950  56.2    5e-08   
gb|KHN14264.1|  Proactivator polypeptide                              55.8    5e-08   
ref|NP_001235368.1|  uncharacterized protein LOC100527899 precursor   55.5    6e-08   
ref|XP_010490507.1|  PREDICTED: proactivator polypeptide-like 1       55.5    7e-08   
ref|XP_010653354.1|  PREDICTED: prosaposin isoform X3                 55.5    7e-08   
ref|XP_009384319.1|  PREDICTED: prosaposin-like isoform X2            55.5    7e-08   
ref|XP_009384318.1|  PREDICTED: prosaposin-like isoform X1            55.5    8e-08   
ref|XP_010423994.1|  PREDICTED: prosaposin-like isoform X2            55.5    8e-08   
ref|XP_009414264.1|  PREDICTED: prosaposin-like                       55.5    8e-08   
ref|XP_010423993.1|  PREDICTED: prosaposin-like isoform X1            55.5    8e-08   
emb|CAN81219.1|  hypothetical protein VITISV_040420                   55.5    9e-08   Vitis vinifera
gb|AES79789.2|  saposin B domain protein                              55.5    9e-08   
gb|AFK40466.1|  unknown                                               55.5    9e-08   
dbj|BAJ92420.1|  predicted protein                                    55.5    1e-07   
ref|XP_003623571.1|  Saposin B domain-containing protein              55.5    1e-07   
ref|XP_006288609.1|  hypothetical protein CARUB_v10001904mg           55.1    1e-07   
ref|XP_009387676.1|  PREDICTED: proactivator polypeptide-like 1       54.3    2e-07   
ref|XP_004506438.1|  PREDICTED: proactivator polypeptide-like 1-l...  53.9    2e-07   
ref|XP_004506439.1|  PREDICTED: proactivator polypeptide-like 1-l...  53.9    3e-07   
gb|KHG00690.1|  Proactivator polypeptide                              53.9    3e-07   
ref|XP_002872994.1|  saposin B domain-containing protein              53.5    4e-07   
ref|XP_006643789.1|  PREDICTED: proactivator polypeptide-like 1-l...  53.5    4e-07   
emb|CBI18061.3|  unnamed protein product                              54.3    4e-07   
ref|NP_195800.1|  saposin B domain-containing protein                 53.1    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266541.2|  PREDICTED: prosaposin isoform X1                 53.5    5e-07   Vitis vinifera
ref|XP_010653353.1|  PREDICTED: proactivator polypeptide-like 1 i...  53.5    5e-07   
ref|XP_010553144.1|  PREDICTED: proactivator polypeptide-like 1 i...  53.9    5e-07   
ref|XP_010553143.1|  PREDICTED: proactivator polypeptide-like 1 i...  53.9    5e-07   
ref|XP_010451935.1|  PREDICTED: prosaposin-like                       53.1    6e-07   
ref|XP_010451936.1|  PREDICTED: prosaposin-like                       53.1    6e-07   
ref|XP_004492542.1|  PREDICTED: uncharacterized protein LOC101491...  52.8    8e-07   
ref|XP_004968308.1|  PREDICTED: proactivator polypeptide-like 1-l...  52.4    1e-06   
gb|KEH29214.1|  saposin B domain protein                              52.4    1e-06   
ref|XP_004968306.1|  PREDICTED: proactivator polypeptide-like 1-l...  52.4    1e-06   
ref|XP_006664871.1|  PREDICTED: uncharacterized protein LOC102703271  52.0    2e-06   
ref|XP_006662663.1|  PREDICTED: uncharacterized protein LOC102720...  52.0    2e-06   
ref|XP_003577837.1|  PREDICTED: prosaposin-like                       52.0    2e-06   
ref|NP_001130792.1|  uncharacterized protein LOC100191896             50.4    2e-06   Zea mays [maize]
gb|ACG39569.1|  surfactant protein B containing protein               50.4    3e-06   Zea mays [maize]
gb|ACL54359.1|  unknown                                               50.4    3e-06   Zea mays [maize]
ref|XP_003552303.1|  PREDICTED: uncharacterized protein LOC100802...  50.8    3e-06   
dbj|BAJ85030.1|  predicted protein                                    51.2    3e-06   
dbj|BAJ94609.1|  predicted protein                                    51.2    4e-06   
gb|AFK37011.1|  unknown                                               50.8    4e-06   
gb|AFK49521.1|  unknown                                               50.8    4e-06   
tpg|DAA59238.1|  TPA: hypothetical protein ZEAMMB73_970443            49.7    4e-06   
ref|XP_009382865.1|  PREDICTED: prosaposin-like isoform X4            50.4    4e-06   
ref|XP_009382866.1|  PREDICTED: prosaposin-like isoform X5            50.4    4e-06   
ref|NP_001176759.1|  Os12g0112250                                     51.2    4e-06   
gb|EEC67533.1|  hypothetical protein OsI_34843                        51.2    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_006602699.1|  PREDICTED: uncharacterized protein LOC100802...  50.8    5e-06   
ref|XP_006602698.1|  PREDICTED: uncharacterized protein LOC100802...  50.8    5e-06   
ref|XP_009382864.1|  PREDICTED: prosaposin-like isoform X3            50.4    5e-06   
ref|XP_009382862.1|  PREDICTED: prosaposin-like isoform X2            50.4    5e-06   
ref|XP_009382860.1|  PREDICTED: prosaposin-like isoform X1            50.4    5e-06   
ref|XP_008661332.1|  PREDICTED: uncharacterized protein LOC100191...  50.4    7e-06   
gb|ABA91162.1|  Saposin-like type B, region 1 family protein, exp...  50.4    8e-06   
ref|XP_008661333.1|  PREDICTED: uncharacterized protein LOC100191...  50.4    8e-06   
gb|EMS59792.1|  Proactivator polypeptide-like 1                       50.4    8e-06   
ref|XP_003579028.1|  PREDICTED: prosaposin-like                       50.4    8e-06   
ref|XP_004978548.1|  PREDICTED: uncharacterized protein LOC101762...  50.1    8e-06   
ref|XP_009383295.1|  PREDICTED: prosaposin-like isoform X3            50.1    8e-06   
ref|XP_004977585.1|  PREDICTED: uncharacterized protein LOC101753...  50.1    9e-06   
gb|ACG32625.1|  surfactant protein B containing protein               50.1    9e-06   Zea mays [maize]
emb|CDY62639.1|  BnaCnng40660D                                        49.3    1e-05   
ref|XP_004977586.1|  PREDICTED: uncharacterized protein LOC101753...  50.1    1e-05   
ref|NP_001174362.1|  Os05g0335100                                     49.7    1e-05   
ref|XP_009383292.1|  PREDICTED: prosaposin-like isoform X2            50.1    1e-05   
gb|EMT26474.1|  Proactivator polypeptide-like protein 1               49.7    1e-05   
ref|XP_006398578.1|  hypothetical protein EUTSA_v10014673mg           49.3    1e-05   
ref|XP_009383291.1|  PREDICTED: prosaposin-like isoform X1            50.1    1e-05   
ref|XP_003569147.1|  PREDICTED: proactivator polypeptide-like 1       49.7    1e-05   
ref|NP_001148899.1|  surfactant protein B containing protein prec...  49.7    1e-05   Zea mays [maize]
gb|ACN36749.1|  unknown                                               49.7    1e-05   Zea mays [maize]
tpg|DAA59239.1|  TPA: LOW QUALITY PROTEIN: surfactant protein B c...  49.3    1e-05   
emb|CDM81448.1|  unnamed protein product                              49.3    2e-05   
ref|NP_001148804.1|  LOC100282421 precursor                           48.1    4e-05   Zea mays [maize]
ref|XP_006654267.1|  PREDICTED: uncharacterized protein LOC102712...  48.1    4e-05   
gb|KHN29523.1|  Proactivator polypeptide                              47.4    6e-05   
gb|ABK24252.1|  unknown                                               48.5    9e-05   Picea sitchensis
ref|XP_006858241.1|  hypothetical protein AMTR_s00062p00198130        47.8    1e-04   
gb|KHN29522.1|  Proactivator polypeptide                              47.4    1e-04   
ref|XP_004962434.1|  PREDICTED: proactivator polypeptide-like iso...  46.6    2e-04   
ref|XP_003568678.1|  PREDICTED: proactivator polypeptide-like 1       45.8    3e-04   
ref|XP_007140108.1|  hypothetical protein PHAVU_008G084800g           45.1    6e-04   
ref|XP_007140107.1|  hypothetical protein PHAVU_008G084800g           45.1    6e-04   



>ref|XP_002533718.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28663.1| conserved hypothetical protein [Ricinus communis]
Length=199

 Score = 75.5 bits (184),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLKNPD+Q+E++++ LK CDS +N++ KCK+L+FEY P IL N+EQ 
Sbjct  114  RAVAEVLIKLKNPDTQLEIIEVLLKGCDSMENYAAKCKRLVFEYGPIILTNAEQF  168



>ref|XP_008388326.1| PREDICTED: proactivator polypeptide-like 1 [Malus domestica]
 ref|XP_008388327.1| PREDICTED: proactivator polypeptide-like 1 [Malus domestica]
Length=230

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLK+PD+Q+E+++L LKAC+S +N++ KCK+L+FEY P IL N+EQ 
Sbjct  146  RAVSEVLVKLKDPDTQLEIIELLLKACNSVENYTKKCKRLVFEYGPLILTNAEQF  200



>ref|XP_009371991.1| PREDICTED: prosaposin [Pyrus x bretschneideri]
 ref|XP_009371992.1| PREDICTED: prosaposin [Pyrus x bretschneideri]
Length=230

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLK+PD+Q+E+++L LKAC+S +N++ KCK+L+FEY P IL N+EQ 
Sbjct  146  RAVSEVLVKLKDPDTQLEIIELLLKACNSVENYTKKCKRLVFEYGPLILANAEQF  200



>ref|XP_008245127.1| PREDICTED: proactivator polypeptide-like 1 [Prunus mume]
 ref|XP_008245133.1| PREDICTED: proactivator polypeptide-like 1 [Prunus mume]
Length=240

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLK+PD+Q+E+++L LKAC+S +N++ KCK+++FEY P  L N+EQ 
Sbjct  151  RAVSEVLVKLKDPDTQLEIIELLLKACNSVENYAKKCKRIVFEYGPLFLANAEQF  205



>ref|XP_007207246.1| hypothetical protein PRUPE_ppa009037m1g [Prunus persica]
 gb|EMJ08445.1| hypothetical protein PRUPE_ppa009037m1g [Prunus persica]
Length=253

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLK+PD+Q+E+++L LKAC+S +N++ KCK+++FEY P  L N+EQ 
Sbjct  151  RAVSEVLVKLKDPDTQLEIIELLLKACNSVENYAKKCKRIVFEYGPLFLANAEQF  205



>ref|XP_007033574.1| Saposin B domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY04500.1| Saposin B domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=227

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RA+ E + KLK+PD+Q+++++L LK CDS +N+  KCK+++FEY P IL N+EQ 
Sbjct  149  RAIAEVLIKLKDPDTQLDIIELLLKGCDSMQNYVKKCKRIVFEYGPLILTNAEQF  203



>ref|XP_010042407.1| PREDICTED: prosaposin-like [Eucalyptus grandis]
 gb|KCW88298.1| hypothetical protein EUGRSUZ_A00687 [Eucalyptus grandis]
Length=219

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             AV E + KLK+PD+Q++++Q+ LKAC+S +N++ KCKK++FEY P +L N+EQ 
Sbjct  131  HAVSEVLDKLKDPDTQMDIIQILLKACNSMENYAKKCKKMVFEYGPLVLANAEQF  185



>ref|XP_007207245.1| hypothetical protein PRUPE_ppa009037m1g, partial [Prunus persica]
 gb|EMJ08444.1| hypothetical protein PRUPE_ppa009037m1g, partial [Prunus persica]
Length=290

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLK+PD+Q+E+++L LKAC+S +N++ KCK+++FEY P  L N+EQ 
Sbjct  188  RAVSEVLVKLKDPDTQLEIIELLLKACNSVENYAKKCKRIVFEYGPLFLANAEQF  242



>gb|KDP22785.1| hypothetical protein JCGZ_00372 [Jatropha curcas]
Length=242

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLKNPD+Q+E+++L LKACDS +  + KCK+++FEY P I+ N+EQ 
Sbjct  157  RAVSEVLIKLKNPDTQLEIIELLLKACDSLEKNAAKCKRMVFEYGPIIITNAEQF  211



>ref|XP_002323058.1| saposin B domain-containing family protein [Populus trichocarpa]
 gb|EEF04819.1| saposin B domain-containing family protein [Populus trichocarpa]
Length=242

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KLK+PD+Q+E+++L LKAC+S + ++ KCK+++FEY P IL N+EQ 
Sbjct  157  RAVSEVLVKLKDPDTQLEIIELLLKACNSMEKYAHKCKRMVFEYGPVILANAEQF  211



>ref|XP_002308246.1| saposin B domain-containing family protein [Populus trichocarpa]
 ref|XP_006381254.1| hypothetical protein POPTR_0006s10790g [Populus trichocarpa]
 gb|EEE91769.1| saposin B domain-containing family protein [Populus trichocarpa]
 gb|ERP59051.1| hypothetical protein POPTR_0006s10790g [Populus trichocarpa]
Length=242

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             A+ E + KLK+PD+Q+E++ L LKAC+S +N++ KCK+++FEY P IL+N+EQ 
Sbjct  157  HAISEVLVKLKDPDTQLEIIDLLLKACNSMENYAKKCKRMVFEYGPLILINAEQF  211



>ref|XP_011019027.1| PREDICTED: proactivator polypeptide-like 1 [Populus euphratica]
 ref|XP_011019028.1| PREDICTED: proactivator polypeptide-like 1 [Populus euphratica]
 ref|XP_011019030.1| PREDICTED: proactivator polypeptide-like 1 [Populus euphratica]
Length=242

 Score = 70.5 bits (171),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             A+ E + KLK+PD+Q+E++ L LKAC+S +N++ KCK+++FEY P IL+N+EQ 
Sbjct  157  HAISEVLIKLKDPDTQLEIIDLLLKACNSMENYAKKCKRMVFEYGPLILINAEQF  211



>gb|EYU41997.1| hypothetical protein MIMGU_mgv1a013247mg [Erythranthe guttata]
Length=226

 Score = 70.1 bits (170),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V EA+ KLK+PD+++E++QL LKAC SA    TKCK+L+FEYAP IL+N+EQ 
Sbjct  146  VTEALLKLKDPDTELEIVQLLLKACSSAGKNVTKCKRLVFEYAPIILVNAEQF  198



>gb|KHG03118.1| Proactivator polypeptide [Gossypium arboreum]
Length=233

 Score = 69.7 bits (169),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSE  7
             AV E + KLK+PD+Q+E+++L LK CDS +N+  KCK L+FEY P IL N+E
Sbjct  155  HAVSEVLTKLKDPDTQLEIIELLLKGCDSVQNYVKKCKSLVFEYGPLILANTE  207



>ref|XP_004249637.1| PREDICTED: prosaposin [Solanum lycopersicum]
Length=241

 Score = 70.1 bits (170),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KLK+PD+Q+++L + LKAC SA+ +S KCKK++FEYAP IL+N+E 
Sbjct  153  QVVEETVSKLKDPDTQLDILAILLKACGSAEKYSNKCKKMVFEYAPVILINAEH  206



>ref|XP_010091067.1| Proactivator polypeptide [Morus notabilis]
 gb|EXB42357.1| Proactivator polypeptide [Morus notabilis]
Length=215

 Score = 69.7 bits (169),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            R + E + KLK+PD+Q+E++++ LKAC S K+F  KCK+++FEY P IL N+EQ
Sbjct  130  RVISEVLTKLKDPDTQLEIIEVLLKACKSTKDFEKKCKRMVFEYGPLILANAEQ  183



>ref|XP_009774594.1| PREDICTED: prosaposin-like [Nicotiana sylvestris]
Length=238

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KLKNPD+Q+++L+L LKAC S + ++ KCKK++FEYAP IL+N+E 
Sbjct  150  QVVKETLLKLKNPDTQLDILELLLKACGSVEKYANKCKKMVFEYAPVILVNAEH  203



>ref|XP_009599219.1| PREDICTED: prosaposin-like [Nicotiana tomentosiformis]
 ref|XP_009599220.1| PREDICTED: prosaposin-like [Nicotiana tomentosiformis]
Length=238

 Score = 68.9 bits (167),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KLKNPD+Q+++L+L LKAC S + ++ KCKK++FEYAP IL+N+E 
Sbjct  150  QVVNETLLKLKNPDTQLDILELLLKACGSVEKYANKCKKMVFEYAPVILVNAEH  203



>ref|XP_009764732.1| PREDICTED: prosaposin-like [Nicotiana sylvestris]
Length=245

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAK--NFSTKCKKLLFEYAPSILMNSEQL  1
            + V EA  KLK+PD+Q+E+L+L LKAC + K   ++TKCKKL+FEYAP IL+N+EQ 
Sbjct  154  QVVTEAESKLKDPDTQLEILELLLKACGAVKLKPYATKCKKLIFEYAPVILVNAEQF  210



>ref|XP_006481164.1| PREDICTED: uncharacterized protein LOC102619717 [Citrus sinensis]
Length=237

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V E + KLK+PD+Q+E++++ LKAC+S   F+ KCKKL+FEY P IL N+EQ 
Sbjct  147  HTVSEVLTKLKDPDTQLEIIEVLLKACNSVDKFAKKCKKLVFEYGPLILANTEQF  201



>ref|XP_004302581.1| PREDICTED: proactivator polypeptide-like 1-like [Fragaria vesca 
subsp. vesca]
Length=229

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            R V E + KLK+PD+Q+E++++ LKAC+S +N+  KCK+L+F+Y P IL+N+E+
Sbjct  140  RTVSEVLVKLKDPDTQLEIIEILLKACNSVENYVKKCKRLVFQYGPLILVNAEE  193



>ref|XP_006338961.1| PREDICTED: uncharacterized protein LOC102600963 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338962.1| PREDICTED: uncharacterized protein LOC102600963 isoform X2 [Solanum 
tuberosum]
Length=241

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V EA+ KLK+PD+Q+++L + LKAC S + ++ KCKK++FEYAP IL+N+E 
Sbjct  153  QVVEEALSKLKDPDTQLDILAILLKACGSVEKYANKCKKMVFEYAPVILINAEH  206



>ref|XP_006349570.1| PREDICTED: proactivator polypeptide-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006349571.1| PREDICTED: proactivator polypeptide-like isoform X2 [Solanum 
tuberosum]
Length=242

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + V EA  KLK+PD+++E+L+L LKAC + K ++ KCKKL+FE+AP IL+N+EQ 
Sbjct  154  KVVTEAESKLKDPDTRLEILELLLKACGAIKPYAKKCKKLVFEFAPVILINAEQF  208



>ref|XP_011095112.1| PREDICTED: prosaposin-like isoform X2 [Sesamum indicum]
Length=237

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            AV EA+ KLK+PD+++E++QL LKAC+S      KCK+L+FEYAP I++N+EQ 
Sbjct  149  AVTEALLKLKDPDTELEIVQLLLKACNSIGKNVQKCKRLVFEYAPVIIVNAEQF  202



>ref|XP_011095111.1| PREDICTED: prosaposin-like isoform X1 [Sesamum indicum]
Length=238

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            AV EA+ KLK+PD+++E++QL LKAC+S      KCK+L+FEYAP I++N+EQ 
Sbjct  150  AVTEALLKLKDPDTELEIVQLLLKACNSIGKNVQKCKRLVFEYAPVIIVNAEQF  203



>ref|XP_011095113.1| PREDICTED: prosaposin-like isoform X3 [Sesamum indicum]
Length=231

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            AV EA+ KLK+PD+++E++QL LKAC+S      KCK+L+FEYAP I++N+EQ 
Sbjct  143  AVTEALLKLKDPDTELEIVQLLLKACNSIGKNVQKCKRLVFEYAPVIIVNAEQF  196



>ref|XP_010035988.1| PREDICTED: prosaposin-like [Eucalyptus grandis]
 gb|KCW47506.1| hypothetical protein EUGRSUZ_K01273 [Eucalyptus grandis]
 gb|KCW47507.1| hypothetical protein EUGRSUZ_K01273 [Eucalyptus grandis]
Length=227

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            AV + + KLK+PD+Q+++++L LKACDS +++  KCKK++FEY P IL N EQ+
Sbjct  139  AVSQVLDKLKDPDTQMDIIELLLKACDSLESYEDKCKKMVFEYGPLILGNMEQI  192



>ref|XP_009590656.1| PREDICTED: prosaposin-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009590657.1| PREDICTED: prosaposin-like isoform X1 [Nicotiana tomentosiformis]
Length=245

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA--KNFSTKCKKLLFEYAPSILMNSEQL  1
            + V EA  KLK+PD+Q+E+L+L LKAC++   K ++ KCKKL+FEYAP IL+N+EQ 
Sbjct  154  QVVTEAESKLKDPDTQLEILELLLKACEAVKLKPYARKCKKLIFEYAPVILVNAEQF  210



>ref|XP_009590658.1| PREDICTED: prosaposin-like isoform X2 [Nicotiana tomentosiformis]
Length=233

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 45/57 (79%), Gaps = 2/57 (4%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA--KNFSTKCKKLLFEYAPSILMNSEQL  1
            + V EA  KLK+PD+Q+E+L+L LKAC++   K ++ KCKKL+FEYAP IL+N+EQ 
Sbjct  142  QVVTEAESKLKDPDTQLEILELLLKACEAVKLKPYARKCKKLIFEYAPVILVNAEQF  198



>ref|XP_006843736.1| hypothetical protein AMTR_s00007p00225690 [Amborella trichopoda]
 gb|ERN05411.1| hypothetical protein AMTR_s00007p00225690 [Amborella trichopoda]
Length=214

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV+E + KLK+PD+Q+E++++ +K C  A+ F  KC+ L+FEYAP +L+N+EQ 
Sbjct  142  RAVLEILMKLKDPDTQLEIVEILIKECKKAQGFVEKCEDLVFEYAPLLLINAEQF  196



>ref|XP_007033575.1| Saposin B domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY04501.1| Saposin B domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=228

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQ-VEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RA+ E + KLK+PD+Q +++++L LK CDS +N+  KCK+++FEY P IL N+EQ 
Sbjct  149  RAIAEVLIKLKDPDTQQLDIIELLLKGCDSMQNYVKKCKRIVFEYGPLILTNAEQF  204



>ref|XP_011003593.1| PREDICTED: prosaposin [Populus euphratica]
Length=242

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RA+ E + KLK+PD+++E+++L LKAC+S + ++ KCK+++FEY P IL ++EQ 
Sbjct  157  RAISEVLVKLKDPDTKLEIIELLLKACNSMEKYANKCKRMVFEYGPVILTSAEQF  211



>gb|AHZ31397.1| saposin B domain-containing protein, partial [Sonneratia griffithii]
 gb|AHZ31404.1| saposin B domain-containing protein, partial [Sonneratia griffithii]
Length=107

 Score = 65.1 bits (157),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQ  4
            RAV EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L N+EQ
Sbjct  35   RAVSEALDKLKDPDAQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLANAEQ  89



>ref|XP_006429547.1| hypothetical protein CICLE_v10011064mg [Citrus clementina]
 gb|ESR42787.1| hypothetical protein CICLE_v10011064mg [Citrus clementina]
Length=836

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V E + KLK+PD+Q+E++++ LKAC+S   F+ KCKKL+FEY P IL N+EQ 
Sbjct  746  HTVSEVLTKLKDPDTQLEIIEVLLKACNSVDKFAKKCKKLVFEYGPLILANTEQF  800



>emb|CDP06403.1| unnamed protein product [Coffea canephora]
Length=294

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             V EAI KLK+PD+Q+E+++  LKACD+ +    KCK+++FEY P IL+N+EQ 
Sbjct  206  VVSEAITKLKDPDTQLEIVEALLKACDAVQGHVNKCKRMVFEYVPVILVNAEQF  259



>gb|EPS73961.1| hypothetical protein M569_00799 [Genlisea aurea]
Length=243

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             V EA+ KL++PD+++E++++ L ACDS K  ++KCK+L+FEY P IL+N+EQ 
Sbjct  148  VVTEALLKLRDPDTELEIVKVLLNACDSVKKSTSKCKRLVFEYVPLILVNAEQF  201



>gb|AAF32354.1|AF220198_1 putative protein [Vitis riparia]
Length=174

 Score = 65.5 bits (158),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            VM+ + KL++PD+Q+E+L+L LK CD+ K    KCK+++FEY P IL N+E+
Sbjct  91   VMKVLIKLRDPDTQLEILELLLKGCDAVKGLVRKCKRMVFEYGPIILNNTER  142



>ref|XP_006338959.1| PREDICTED: proactivator polypeptide-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338960.1| PREDICTED: proactivator polypeptide-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSE  7
            + V E + K+K+PD+Q ++LQL LKAC S + ++ KCKK++F+YAP IL+N+E
Sbjct  153  QVVRETLSKMKDPDTQSDILQLLLKACGSVEKYTNKCKKMVFKYAPVILINAE  205



>ref|XP_010426757.1| PREDICTED: proactivator polypeptide-like 1 [Camelina sativa]
Length=217

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN++ KCK L+FEY P IL+N+E+ 
Sbjct  135  RTVSEILIKLQDPDTQLDIVELLLKGCKSFKNYAKKCKTLVFEYGPLILVNAEEF  189



>gb|AHZ31393.1| saposin B domain-containing protein, partial [Sonneratia caseolaris]
Length=107

 Score = 63.9 bits (154),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQ  4
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L+N+EQ
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNAEQ  89



>ref|XP_002876101.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52360.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=213

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDTQLDIVELLLKGCKSLKNYEKKCKTLVFEYGPLILVNAEEF  185



>ref|XP_010503868.1| PREDICTED: prosaposin-like isoform X3 [Camelina sativa]
Length=217

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  135  RTVSEILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEF  189



>ref|XP_010503867.1| PREDICTED: prosaposin-like isoform X2 [Camelina sativa]
Length=217

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  135  RTVSEILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEF  189



>ref|XP_010515602.1| PREDICTED: prosaposin-like isoform X2 [Camelina sativa]
Length=217

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  135  RTVSEILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEF  189



>ref|XP_010503866.1| PREDICTED: prosaposin-like isoform X1 [Camelina sativa]
Length=218

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  136  RTVSEILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEF  190



>ref|XP_010515601.1| PREDICTED: prosaposin-like isoform X1 [Camelina sativa]
Length=218

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  136  RTVSEILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEF  190



>gb|AHZ31401.1| saposin B domain-containing protein, partial [Sonneratia caseolaris]
Length=107

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQ  4
             A+ EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L+N+EQ
Sbjct  35   HAISEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNAEQ  89



>emb|CAN81220.1| hypothetical protein VITISV_040421 [Vitis vinifera]
Length=174

 Score = 64.3 bits (155),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             AV E + KL++PD+Q+E+L+L LK CD+ +    KCK+++FEY P IL N+E+ 
Sbjct  89   HAVDEVLIKLRDPDTQLEILELLLKGCDAVEGLVRKCKRMVFEYGPIILNNTERF  143



>gb|ABQ42118.1| saposin B domain-containing protein [Sonneratia caseolaris]
Length=114

 Score = 63.5 bits (153),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
             A+ EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L+N+EQ 
Sbjct  35   HAISEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNAEQF  90



>ref|XP_006403887.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
 ref|XP_006403888.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
 gb|ESQ45340.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
 gb|ESQ45341.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
Length=213

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S  N+  KCKKL+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDTQLDIVELLLKGCKSFNNYEKKCKKLVFEYGPLILVNAEEF  185



>gb|AHZ31395.1| saposin B domain-containing protein, partial [Sonneratia ovata]
 gb|AHZ31396.1| saposin B domain-containing protein, partial [Sonneratia apetala]
 gb|AHZ31398.1| saposin B domain-containing protein, partial [Sonneratia ovata]
 gb|AHZ31402.1| saposin B domain-containing protein, partial [Sonneratia apetala]
Length=107

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L N+EQ 
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLANAEQF  90



>dbj|BAJ33968.1| unnamed protein product [Thellungiella halophila]
Length=213

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L LK C S  N+  KCKKL+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDTQLDIVELLLKGCKSFNNYEKKCKKLVFEYGPLILVNAEEF  185



>gb|ABQ42119.1| saposin B domain-containing protein [Sonneratia ovata]
 gb|ABQ42120.1| saposin B domain-containing protein [Sonneratia apetala]
Length=114

 Score = 63.2 bits (152),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L N+EQ 
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLANAEQF  90



>ref|XP_002268581.1| PREDICTED: prosaposin [Vitis vinifera]
Length=241

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             AV E + KL++PD+Q+E+L+L LK CD+ +    KCK+++FEY P IL N+E+ 
Sbjct  156  HAVDEVLIKLRDPDTQLEILELLLKGCDAVEGLVRKCKRMVFEYGPIILNNTERF  210



>ref|XP_006293287.1| hypothetical protein CARUB_v10019623mg [Capsella rubella]
 gb|EOA26185.1| hypothetical protein CARUB_v10019623mg [Capsella rubella]
Length=213

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD Q++++++ LK C S KN+  KCKKL+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDIQLDIVEMLLKGCKSFKNYEKKCKKLVFEYGPLILVNAEEF  185



>ref|NP_190741.1| saposin B domain-containing protein [Arabidopsis thaliana]
 emb|CAB63159.1| putative protein [Arabidopsis thaliana]
 gb|AAM67054.1| unknown [Arabidopsis thaliana]
 gb|AAM78109.1| AT3g51730/T18N14_110 [Arabidopsis thaliana]
 gb|AAN28760.1| At3g51730/T18N14_110 [Arabidopsis thaliana]
 gb|AEE78831.1| saposin B domain-containing protein [Arabidopsis thaliana]
Length=213

 Score = 64.3 bits (155),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q+++++L +K C S KN+  KCK L+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDTQLDIVELLIKGCKSLKNYEKKCKTLVFEYGPLILVNAEEF  185



>gb|AHZ31399.1| saposin B domain-containing protein, partial [Sonneratia caseolaris]
Length=107

 Score = 63.2 bits (152),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQ  4
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  KCK+++FEY P +L+N EQ
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNVEQ  89



>gb|AHZ31400.1| saposin B domain-containing protein, partial [Sonneratia alba]
 gb|AHZ31403.1| saposin B domain-containing protein, partial [Sonneratia alba]
Length=107

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQ  4
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  +CK+++FEY P +L N+EQ
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQ  89



>gb|AHZ31394.1| saposin B domain-containing protein, partial [Sonneratia alba]
Length=107

 Score = 62.4 bits (150),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  +CK+++FEY P +L N+EQ 
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQF  90



>gb|ABQ42117.1| saposin B domain-containing protein [Sonneratia alba]
Length=114

 Score = 62.8 bits (151),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  +CK+++FEY P +L N+EQ 
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQF  90



>ref|XP_010326217.1| PREDICTED: prosaposin isoform X2 [Solanum lycopersicum]
Length=238

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + V +   KLK+PD+Q E+L+L LKAC + + ++ KCKKL+FE+AP IL+N+EQ 
Sbjct  151  KLVTDVESKLKDPDTQFEILELLLKACGAIEPYTKKCKKLVFEFAPVILVNAEQF  205



>gb|ACS68697.1| saposin B domain-containing protein [Sonneratia alba]
 gb|ACS68768.1| saposin B domain-containing protein [Sonneratia alba]
Length=114

 Score = 62.4 bits (150),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
             AV EA+ KLK+PD+Q+EV+++ + AC+S  K +  +CK+++FEY P +L N+EQ 
Sbjct  35   HAVSEALDKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQF  90



>ref|XP_010529095.1| PREDICTED: proactivator polypeptide-like 1 [Tarenaya hassleriana]
Length=210

 Score = 63.5 bits (153),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KL++PD+Q++++ + LK C S KN+  +CKKL+FEY P IL+N+E+
Sbjct  129  KTVSEILNKLQDPDTQLDIIGILLKGCKSLKNYEKQCKKLVFEYGPLILVNAEE  182



>ref|XP_004246981.2| PREDICTED: prosaposin isoform X1 [Solanum lycopersicum]
Length=252

 Score = 63.5 bits (153),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + V +   KLK+PD+Q E+L+L LKAC + + ++ KCKKL+FE+AP IL+N+EQ 
Sbjct  165  KLVTDVESKLKDPDTQFEILELLLKACGAIEPYTKKCKKLVFEFAPVILVNAEQF  219



>ref|XP_010937982.1| PREDICTED: prosaposin-like [Elaeis guineensis]
 ref|XP_010937983.1| PREDICTED: prosaposin-like [Elaeis guineensis]
 ref|XP_010937984.1| PREDICTED: prosaposin-like [Elaeis guineensis]
Length=227

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             AV+E + KLK+PD+Q E+L++ LK C+  +NF  +CK+L+F+Y+P I++N E+ 
Sbjct  144  HAVVEILTKLKDPDTQFEILEMLLKVCNKVENFVQQCKRLVFQYSPLIMVNLEKF  198



>gb|KFK34416.1| hypothetical protein AALP_AA5G141700 [Arabis alpina]
Length=213

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KL++PD Q+++++L +K C S KN+  KCKKL+FEY P IL+N+E+
Sbjct  131  KTVSEILIKLQDPDVQLDIVELLIKGCKSLKNYEKKCKKLVFEYGPLILVNAEE  184



>ref|XP_010264460.1| PREDICTED: prosaposin-like [Nelumbo nucifera]
 ref|XP_010264461.1| PREDICTED: prosaposin-like [Nelumbo nucifera]
Length=228

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RAV E + KL++PD Q++++++FLK CD+ +N+  +CK L+F+Y P+I+ N +Q+
Sbjct  153  RAVAEVLVKLEDPDIQLDIIEIFLKGCDAVENYLKECKNLVFQYGPAIMDNVKQV  207



>ref|XP_009136631.1| PREDICTED: prosaposin-like [Brassica rapa]
Length=215

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFST--KCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q++V++L LK C S KN+    KCKKL+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDTQLDVIELLLKGCKSFKNYEYEKKCKKLVFEYGPLILVNAEEF  187



>emb|CDY67661.1| BnaA03g57960D [Brassica napus]
Length=215

 Score = 62.8 bits (151),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFST--KCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q++V++L LK C S KN+    KCKKL+FEY P IL+N+E+ 
Sbjct  131  RTVSEILIKLQDPDTQLDVIELLLKGCKSFKNYEYEKKCKKLVFEYGPLILVNAEEF  187



>emb|CDY29042.1| BnaC07g32480D [Brassica napus]
Length=216

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 2/57 (4%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFST--KCKKLLFEYAPSILMNSEQL  1
            R V E + KL++PD+Q++V++L LK C S KN+    KCKKL+FEY P IL+N+E+ 
Sbjct  132  RTVSEILIKLQDPDTQLDVIELLLKGCKSFKNYEYEKKCKKLVFEYGPLILVNAEEF  188



>ref|XP_010256940.1| PREDICTED: prosaposin [Nelumbo nucifera]
 ref|XP_010256941.1| PREDICTED: prosaposin [Nelumbo nucifera]
Length=243

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E + KLK+P +Q++++++FLK CD+ + +  +CKKL+FEYAP IL N++ +
Sbjct  157  RFVAEILVKLKDPGTQLDIIEIFLKGCDAVEGYLKECKKLVFEYAPLILDNAQHI  211



>emb|CBI18062.3| unnamed protein product [Vitis vinifera]
Length=716

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
             AV E + KL++PD+Q+E+L+L LK CD+ +    KCK+++FEY P IL N+E+
Sbjct  631  HAVDEVLIKLRDPDTQLEILELLLKGCDAVEGLVRKCKRMVFEYGPIILNNTER  684



>ref|XP_008782628.1| PREDICTED: proactivator polypeptide-like 1 [Phoenix dactylifera]
Length=230

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
             AV+E I KLK+PD+++E++++ LK C+  +NF  +CK+L+F+Y P I+ N
Sbjct  147  HAVVEIITKLKDPDTELEIIEMLLKGCNKVENFVQQCKRLVFQYGPLIMAN  197



>ref|XP_009115874.1| PREDICTED: prosaposin-like [Brassica rapa]
 ref|XP_009115875.1| PREDICTED: prosaposin-like [Brassica rapa]
 emb|CDX78031.1| BnaA09g32260D [Brassica napus]
 emb|CDX78032.1| BnaA09g32270D [Brassica napus]
Length=214

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNS  10
            + V + + KL++PD+Q+++++L LK C S KN+  KCKKL+FEY P IL+N+
Sbjct  132  KTVSDILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKKLVFEYGPLILVNA  183



>ref|XP_010554922.1| PREDICTED: proactivator polypeptide-like 1 [Tarenaya hassleriana]
Length=183

 Score = 60.8 bits (146),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
            RAV E + KL++PD+Q++++   LK C S KN+  +C+KL+FEY P++L+N
Sbjct  105  RAVSEVLNKLQDPDAQLDMIATLLKGCKSLKNYEKQCEKLVFEYGPAVLVN  155



>ref|XP_010683542.1| PREDICTED: prosaposin-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010683543.1| PREDICTED: prosaposin-like [Beta vulgaris subsp. vulgaris]
Length=214

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNS  10
            +A+ EA++KLK+PD+++EV+Q+ LKAC++   ++ KCK ++FE+ P +L+++
Sbjct  133  KAMDEALEKLKDPDTELEVIQILLKACNAVGRYAQKCKSMVFEFGPLVLVDA  184



>emb|CDX73698.1| BnaC08g23050D [Brassica napus]
Length=286

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNS  10
            + V + + KL++PD+Q+++++L LK C S KN+  KCKKL+FEY P IL+N+
Sbjct  204  KTVSDILIKLQDPDTQLDIVELLLKGCKSFKNYEKKCKKLVFEYGPLILVNA  255



>ref|XP_004149924.1| PREDICTED: proactivator polypeptide-like 1-like [Cucumis sativus]
 gb|KGN54439.1| hypothetical protein Csa_4G331080 [Cucumis sativus]
Length=233

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + + + + KLK+PD+Q+E+LQ  L  CDS      +CKKL+FEY P IL NSE++
Sbjct  144  QTISKILDKLKDPDTQIEILQTLLNMCDSINYRVKECKKLVFEYGPLILANSEKI  198



>ref|XP_009419859.1| PREDICTED: proactivator polypeptide-like 1 [Musa acuminata subsp. 
malaccensis]
Length=314

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSE  7
            V E + KL +PD Q+EV+++ LK C+   N++ KCKK++ EY P IL+N+E
Sbjct  234  VAEILTKLTDPDRQLEVIEILLKGCNKMGNYAKKCKKMVLEYGPLILINAE  284



>ref|XP_010921111.1| PREDICTED: proactivator polypeptide-like 1 isoform X3 [Elaeis 
guineensis]
Length=198

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
              + E + KL++PD+Q+E++++ LKAC+  +NF  +CK+L+F+Y P I+ N
Sbjct  115  HVIQEILTKLEDPDTQLEIIEMLLKACNRVENFVQQCKRLVFQYGPLIMAN  165



>ref|XP_004163784.1| PREDICTED: proactivator polypeptide-like 1-like [Cucumis sativus]
Length=233

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + + + + KLK+PD+Q+E+LQ  L  CDS      +CKKL+FEY P IL NSE++
Sbjct  144  QTISKILDKLKDPDTQIEILQTLLNMCDSINYRVKECKKLVFEYGPLILANSEKI  198



>ref|XP_008464263.1| PREDICTED: proactivator polypeptide-like 1 [Cucumis melo]
Length=233

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + + + + KLK+PD+Q+E+LQ  L  CDS      +CKKL+FEY P IL NSE++
Sbjct  144  QTISKILDKLKDPDTQIEILQTLLSLCDSINYRVKECKKLVFEYGPLILANSEKI  198



>ref|XP_010921104.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010921106.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010921109.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Elaeis 
guineensis]
Length=229

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
              + E + KL++PD+Q+E++++ LKAC+  +NF  +CK+L+F+Y P I+ N
Sbjct  146  HVIQEILTKLEDPDTQLEIIEMLLKACNRVENFVQQCKRLVFQYGPLIMAN  196



>ref|XP_010922696.1| PREDICTED: proactivator polypeptide-like 1 [Elaeis guineensis]
 ref|XP_010922697.1| PREDICTED: proactivator polypeptide-like 1 [Elaeis guineensis]
Length=236

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V E I KLK+PD+Q E+++  +K C+   N++ KCK+L+F Y P IL+N E+ 
Sbjct  148  HVVDEIITKLKDPDAQFEIIETLMKECNKMDNYAQKCKELVFRYGPLILVNGEKF  202



>ref|XP_010921107.1| PREDICTED: proactivator polypeptide-like 1 isoform X2 [Elaeis 
guineensis]
 ref|XP_010921108.1| PREDICTED: proactivator polypeptide-like 1 isoform X2 [Elaeis 
guineensis]
 ref|XP_010921110.1| PREDICTED: proactivator polypeptide-like 1 isoform X2 [Elaeis 
guineensis]
Length=229

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
              + E + KL++PD+Q+E++++ LKAC+  +NF  +CK+L+F+Y P I+ N
Sbjct  146  HVIQEILTKLEDPDTQLEIIEMLLKACNRVENFVQQCKRLVFQYGPLIMAN  196



>gb|EMT05884.1| hypothetical protein F775_27224 [Aegilops tauschii]
Length=155

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V E + K+K+PD+Q E+LQL +K C+  K    +CK+++ EY P IL+N E+L
Sbjct  70   VDEVLSKMKDPDAQFEILQLLIKECNKVKGHVQECKRMVLEYVPLILVNGEKL  122



>ref|NP_001042117.2| Os01g0166700 [Oryza sativa Japonica Group]
 dbj|BAD68299.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ10680.1| hypothetical protein OsJ_00511 [Oryza sativa Japonica Group]
 dbj|BAG90610.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04031.2| Os01g0166700 [Oryza sativa Japonica Group]
Length=226

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              ++E +  LK+PD Q+E++++FLKAC  A N+  +CKK++ EY P IL+ S++ 
Sbjct  142  HVLVEVLIMLKDPDMQLEIVEIFLKACSKADNYVQQCKKMVLEYTPLILVKSQKF  196



>gb|EMS66984.1| Proactivator polypeptide [Triticum urartu]
Length=246

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V E + K+++PD+Q E+LQL +K C+  K    +CK+++ EY P IL+N E+L
Sbjct  161  VDEVLSKMRDPDAQFEILQLLIKECNKVKGHVQECKRMVLEYVPLILVNGEKL  213



>dbj|BAB39899.1| P0028E10.2 [Oryza sativa Japonica Group]
Length=240

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              ++E +  LK+PD Q+E++++FLKAC  A N+  +CKK++ EY P IL+ S++ 
Sbjct  156  HVLVEVLIMLKDPDMQLEIVEIFLKACSKADNYVQQCKKMVLEYTPLILVKSQKF  210



>gb|EAY72679.1| hypothetical protein OsI_00546 [Oryza sativa Indica Group]
Length=262

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              ++E +  LK+PD Q+E++++FLKAC  A N+  +CKK++ EY P IL+ S++ 
Sbjct  178  HVLVEVLIMLKDPDMQLEIVEIFLKACSKADNYVQQCKKMVLEYTPLILVKSQKF  232



>ref|XP_003623572.1| Saposin B domain-containing protein [Medicago truncatula]
Length=140

 Score = 55.5 bits (132),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V   + K+K+PD+++E++++ LK C+S   F +KCKK++ EY P +  N+E+ 
Sbjct  36   ETVSSLLDKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKF  90



>ref|XP_008810565.1| PREDICTED: uncharacterized protein LOC103721950 [Phoenix dactylifera]
Length=234

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            R V E   KLK+PD++ E++++ +K C+   ++  +CKKL+F Y P IL+N E+ 
Sbjct  148  RVVSEITTKLKDPDAEFEIVKMLMKECNKMDHYGQECKKLVFRYVPLILVNGEKF  202



>gb|KHN14264.1| Proactivator polypeptide [Glycine soja]
Length=216

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  KLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            KL +PD+++E+++  LKAC+S   FS KCK+++FEY P IL+ +E+ 
Sbjct  135  KLNDPDTKLEIMEALLKACNSMDKFSKKCKRMVFEYGPLILVKAEKF  181



>ref|NP_001235368.1| uncharacterized protein LOC100527899 precursor [Glycine max]
 gb|ACU17107.1| unknown [Glycine max]
Length=214

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  KLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            KL +PD+++E+++  LKAC+S   FS KCK+++FEY P IL+ +E+ 
Sbjct  135  KLNDPDTKLEIMEALLKACNSMDKFSKKCKRMVFEYGPLILVKAEKF  181



>ref|XP_010490507.1| PREDICTED: proactivator polypeptide-like 1 [Camelina sativa]
Length=216

 Score = 55.5 bits (132),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L++ E+
Sbjct  131  QTVSEVVSKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEK  184



>ref|XP_010653354.1| PREDICTED: prosaposin isoform X3 [Vitis vinifera]
Length=232

 Score = 55.5 bits (132),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDS-AKNFSTKCKKLLFEYAPSILMNSE  7
             AV E + KLK+PD QV +++L LK CD+  + +  KCK ++ EYAP +L N+E
Sbjct  154  HAVAEVVVKLKDPDRQVLIMELLLKGCDAVVEGYVNKCKNMVSEYAPLVLTNAE  207



>ref|XP_009384319.1| PREDICTED: prosaposin-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=228

 Score = 55.5 bits (132),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
             V +   KLK+PD+Q EV+++ LK C+  +N+  +CKKL+ +Y P IL+N E+ 
Sbjct  146  VVAKVFIKLKDPDTQFEVIKMLLKECNEVENYVKECKKLVLQYGPLILVNGEKF  199



>ref|XP_009384318.1| PREDICTED: prosaposin-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=230

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  KLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            KLK+PD+Q EV+++ LK C+  +N+  +CKKL+ +Y P IL+N E+ 
Sbjct  155  KLKDPDTQFEVIKMLLKECNEVENYVKECKKLVLQYGPLILVNGEKF  201



>ref|XP_010423994.1| PREDICTED: prosaposin-like isoform X2 [Camelina sativa]
Length=220

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L++ E+
Sbjct  132  QTVSEVVSKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEK  185



>ref|XP_009414264.1| PREDICTED: prosaposin-like [Musa acuminata subsp. malaccensis]
Length=223

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V E + KL++PD+Q+EV+++ +K C+   ++  +CKKL+ +Y P IL+N+E+ 
Sbjct  144  VKEILTKLEDPDTQLEVIKMLMKGCEEVGSYVQQCKKLVLQYVPPILINAEKF  196



>ref|XP_010423993.1| PREDICTED: prosaposin-like isoform X1 [Camelina sativa]
Length=226

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L++ E+
Sbjct  138  QTVSEVVSKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEK  191



>emb|CAN81219.1| hypothetical protein VITISV_040420 [Vitis vinifera]
Length=239

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDS-AKNFSTKCKKLLFEYAPSILMNSE  7
             AV E + KLK+PD QV +++L LK CD+  + +  KCK ++ EYAP +L N+E
Sbjct  161  HAVAEVVVKLKDPDRQVLIMELLLKGCDAVVEGYVNKCKNMVSEYAPLVLTNAE  214



>gb|AES79789.2| saposin B domain protein [Medicago truncatula]
Length=242

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V   + K+K+PD+++E++++ LK C+S   F +KCKK++ EY P +  N+E+ 
Sbjct  138  ETVSSLLDKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKF  192



>gb|AFK40466.1| unknown [Medicago truncatula]
Length=242

 Score = 55.5 bits (132),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V   + K+K+PD+++E++++ LK C+S   F +KCKK++ EY P +  N+E+ 
Sbjct  138  ETVSSLLDKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKF  192



>dbj|BAJ92420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01204.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/49 (45%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  IQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + K+K+PDSQ E+LQL +K C+   +   +CK+++ EY P IL+N E+L
Sbjct  165  LSKMKDPDSQFEILQLLIKECNKVHDHVQECKRMVLEYVPLILVNGEKL  213



>ref|XP_003623571.1| Saposin B domain-containing protein [Medicago truncatula]
Length=247

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              V   + K+K+PD+++E++++ LK C+S   F +KCKK++ EY P +  N+E+ 
Sbjct  143  ETVSSLLDKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKF  197



>ref|XP_006288609.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
 ref|XP_006288610.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
 gb|EOA21507.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
 gb|EOA21508.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
Length=223

 Score = 55.1 bits (131),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L++ E+ 
Sbjct  133  QTVSEVVAKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEKF  187



>ref|XP_009387676.1| PREDICTED: proactivator polypeptide-like 1 [Musa acuminata subsp. 
malaccensis]
Length=224

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -1

Query  132  NPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            +PD+++EVL+  LK C   +NF+ KCKKL+F+Y P IL N+E  
Sbjct  153  DPDTELEVLETLLKGCSKMENFAQKCKKLVFQYGPLILANAENF  196



>ref|XP_004506438.1| PREDICTED: proactivator polypeptide-like 1-like isoform X1 [Cicer 
arietinum]
Length=221

 Score = 53.9 bits (128),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            AV   + +L +PD+++E+++  LKAC S + ++ +CKK++FEY P IL+N+E+ 
Sbjct  133  AVAALLVELNDPDTKLEIMEKLLKACKSLEKYAKECKKIVFEYGPLILINAEKF  186



>ref|XP_004506439.1| PREDICTED: proactivator polypeptide-like 1-like isoform X2 [Cicer 
arietinum]
 ref|XP_004506440.1| PREDICTED: proactivator polypeptide-like 1-like isoform X3 [Cicer 
arietinum]
Length=215

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 22/54 (41%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            AV   + +L +PD+++E+++  LKAC S + ++ +CKK++FEY P IL+N+E+ 
Sbjct  127  AVAALLVELNDPDTKLEIMEKLLKACKSLEKYAKECKKIVFEYGPLILINAEKF  180



>gb|KHG00690.1| Proactivator polypeptide [Gossypium arboreum]
Length=227

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            RA+ E + KL++PD+++E+L+L LK C+S +N+  KCK+L+FEY P IL N+E  
Sbjct  149  RAISEVLMKLQDPDTKLEILELLLKGCNSVQNYVQKCKRLVFEYGPLILANAEHF  203



>ref|XP_002872994.1| saposin B domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49253.1| saposin B domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=220

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + V E + KLK+P +++++++L LK C S  N+  KCKK++FEY P +L + E+ 
Sbjct  134  QTVSEVVAKLKDPQTKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLTDLEKF  188



>ref|XP_006643789.1| PREDICTED: proactivator polypeptide-like 1-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006643790.1| PREDICTED: proactivator polypeptide-like 1-like isoform X2 [Oryza 
brachyantha]
 ref|XP_006643791.1| PREDICTED: proactivator polypeptide-like 1-like isoform X3 [Oryza 
brachyantha]
Length=225

 Score = 53.5 bits (127),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              ++E +  LK+PD Q+E++ + LKAC  A N+  +CKK++ EY P IL+ S++ 
Sbjct  142  HVLVEVLIMLKDPDMQLEIVDILLKACGKADNYVQQCKKMVLEYIPLILVKSQKF  196



>emb|CBI18061.3| unnamed protein product [Vitis vinifera]
Length=278

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDS-AKNFSTKCKKLLFEYAPSILMNSE  7
            AV E + KLK+PD QV +++L LK CD+  + +  KCK ++ EYAP +L N+E
Sbjct  201  AVAEVVVKLKDPDRQVLIMELLLKGCDAVVEGYVNKCKNMVSEYAPLVLTNAE  253



>ref|NP_195800.1| saposin B domain-containing protein [Arabidopsis thaliana]
 emb|CAB82750.1| putative protein [Arabidopsis thaliana]
 gb|AAL08276.1| AT5g01800/T20L15_70 [Arabidopsis thaliana]
 gb|AAL87364.1| AT5g01800/T20L15_70 [Arabidopsis thaliana]
 gb|AED90393.1| saposin B domain-containing protein [Arabidopsis thaliana]
Length=217

 Score = 53.1 bits (126),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
             V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L +
Sbjct  132  TVSEVVTKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLTD  181



>ref|XP_002266541.2| PREDICTED: prosaposin isoform X1 [Vitis vinifera]
Length=239

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDS-AKNFSTKCKKLLFEYAPSILMNSE  7
            AV E + KLK+PD QV +++L LK CD+  + +  KCK ++ EYAP +L N+E
Sbjct  162  AVAEVVVKLKDPDRQVLIMELLLKGCDAVVEGYVNKCKNMVSEYAPLVLTNAE  214



>ref|XP_010653353.1| PREDICTED: proactivator polypeptide-like 1 isoform X2 [Vitis 
vinifera]
Length=237

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDS-AKNFSTKCKKLLFEYAPSILMNSE  7
            AV E + KLK+PD QV +++L LK CD+  + +  KCK ++ EYAP +L N+E
Sbjct  160  AVAEVVVKLKDPDRQVLIMELLLKGCDAVVEGYVNKCKNMVSEYAPLVLTNAE  212



>ref|XP_010553144.1| PREDICTED: proactivator polypeptide-like 1 isoform X2 [Tarenaya 
hassleriana]
Length=272

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
             V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P IL + ++
Sbjct  189  TVSEVVAKLKDPETKLKIIRLLLKECKSLDNYQDKCKKMVFEYGPLILADVQK  241



>ref|XP_010553143.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Tarenaya 
hassleriana]
Length=274

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
             V E + KLK+P++++++++L LK C S  N+  KCKK++FEY P IL + ++
Sbjct  191  TVSEVVAKLKDPETKLKIIRLLLKECKSLDNYQDKCKKMVFEYGPLILADVQK  243



>ref|XP_010451935.1| PREDICTED: prosaposin-like [Camelina sativa]
Length=221

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V   + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L++ E+
Sbjct  133  QTVSGVVSKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEK  186



>ref|XP_010451936.1| PREDICTED: prosaposin-like [Camelina sativa]
Length=220

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/54 (39%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            + V   + KLK+P++++++++L LK C S  N+  KCKK++FEY P +L++ E+
Sbjct  132  QTVSGVVSKLKDPETKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEK  185



>ref|XP_004492542.1| PREDICTED: uncharacterized protein LOC101491522 isoform X1 [Cicer 
arietinum]
 ref|XP_004492543.1| PREDICTED: uncharacterized protein LOC101491522 isoform X2 [Cicer 
arietinum]
Length=242

 Score = 52.8 bits (125),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  IQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + K+K+PD+++E+++  LK C+S   F++KCK+++ EY P +  N+E+ 
Sbjct  146  LAKIKDPDTELEIIETLLKVCNSVDKFASKCKRVVLEYGPLVFENAEKF  194



>ref|XP_004968308.1| PREDICTED: proactivator polypeptide-like 1-like isoform X3 [Setaria 
italica]
Length=219

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
              ++E +  LK+P++Q+EV+ L LK C  A+N+  +CK+L+ +Y P IL+  ++
Sbjct  135  HVIVEVLVMLKDPNTQLEVIDLLLKTCSKAQNYEQQCKRLVLKYTPLILVKGQK  188



>gb|KEH29214.1| saposin B domain protein [Medicago truncatula]
Length=215

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
             V E + +L +P++++E++Q  LKAC++ + +  +CK+++FEY P IL+N+E+
Sbjct  127  TVAELLVELNDPETKLEIIQKLLKACNNMEKYKKECKRMVFEYGPLILVNAEK  179



>ref|XP_004968306.1| PREDICTED: proactivator polypeptide-like 1-like isoform X1 [Setaria 
italica]
 ref|XP_004968307.1| PREDICTED: proactivator polypeptide-like 1-like isoform X2 [Setaria 
italica]
Length=227

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
              ++E +  LK+P++Q+EV+ L LK C  A+N+  +CK+L+ +Y P IL+  ++
Sbjct  143  HVIVEVLVMLKDPNTQLEVIDLLLKTCSKAQNYEQQCKRLVLKYTPLILVKGQK  196



>ref|XP_006664871.1| PREDICTED: uncharacterized protein LOC102703271 [Oryza brachyantha]
Length=244

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V E + KLK+PD++ E++QL LK C+  +    +CK+++ +Y P +L+N E+ 
Sbjct  159  VDEIVSKLKDPDAEFEIIQLLLKECNKIEGHQQQCKRMVLQYVPLVLVNGEKF  211



>ref|XP_006662663.1| PREDICTED: uncharacterized protein LOC102720274 isoform X1 [Oryza 
brachyantha]
 ref|XP_006662664.1| PREDICTED: uncharacterized protein LOC102720274 isoform X2 [Oryza 
brachyantha]
Length=244

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V E + KLK+PD++ E++QL LK C+  +    +CK+++ +Y P +L+N E+ 
Sbjct  159  VDEIVSKLKDPDAEFEIIQLLLKECNKIEGHQQQCKRMVLQYVPLVLVNGEKF  211



>ref|XP_003577837.1| PREDICTED: prosaposin-like [Brachypodium distachyon]
Length=245

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V E + KLK+PD++ E++Q+ LK C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  160  VDEVMSKLKDPDAEFEIIQILLKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  212



>ref|NP_001130792.1| uncharacterized protein LOC100191896 [Zea mays]
 gb|ACF79147.1| unknown [Zea mays]
 gb|AFW55999.1| hypothetical protein ZEAMMB73_880574 [Zea mays]
 gb|AFW56000.1| hypothetical protein ZEAMMB73_880574 [Zea mays]
Length=135

 Score = 50.4 bits (119),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  51   EVMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  101



>gb|ACG39569.1| surfactant protein B containing protein [Zea mays]
Length=156

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  72   EVMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  122



>gb|ACL54359.1| unknown [Zea mays]
Length=187

 Score = 50.4 bits (119),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  103  EVMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  153



>ref|XP_003552303.1| PREDICTED: uncharacterized protein LOC100802366 isoformX1 [Glycine 
max]
 ref|XP_006602700.1| PREDICTED: uncharacterized protein LOC100802366 isoform X4 [Glycine 
max]
Length=212

 Score = 50.8 bits (120),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  IQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            ++KLK  D+++E+++  LK C+S + ++ KCK+++FEY P I  ++E++
Sbjct  136  LEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMVFEYGPLIFDHAEKI  184



>dbj|BAJ85030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ LK C   +    +CK+L+ +Y P IL+N E+ 
Sbjct  158  EVLSKLKDPDAEFEIIQILLKECKKIEGHEQQCKRLVLQYIPLILVNGEKF  208



>dbj|BAJ94609.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92778.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ LK C   +    +CK+L+ +Y P IL+N E+ 
Sbjct  158  EVLSKLKDPDAEFEIIQILLKECKKIEGHEQQCKRLVLQYIPLILVNGEKF  208



>gb|AFK37011.1| unknown [Lotus japonicus]
Length=216

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
            AV   + KL +PD ++E+++  LKAC+S  K  + +CK+++FEY P +LMN+E+ 
Sbjct  127  AVSALLVKLNDPDIKLEIMESLLKACNSMEKKLAKECKRMVFEYGPFVLMNAEKF  181



>gb|AFK49521.1| unknown [Lotus japonicus]
Length=216

 Score = 50.8 bits (120),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSA-KNFSTKCKKLLFEYAPSILMNSEQL  1
            AV   + KL +PD ++E+++  LKAC+S  K  + +CK+++FEY P +LMN+E+ 
Sbjct  127  AVSALLVKLNDPDIKLEIMESLLKACNSMEKKLAKECKRMVFEYGPFVLMNAEKF  181



>tpg|DAA59238.1| TPA: hypothetical protein ZEAMMB73_970443 [Zea mays]
Length=135

 Score = 49.7 bits (117),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  48   EIMSKLKDPDAEFEIIQILVKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  98



>ref|XP_009382865.1| PREDICTED: prosaposin-like isoform X4 [Musa acuminata subsp. 
malaccensis]
Length=210

 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V + + KL++PD+Q EV+++ L+ C+  +N+  +CKK++  Y P IL++ E+ 
Sbjct  131  VAKLLMKLQDPDTQFEVIKMLLQECNKVENYVQECKKMVLHYGPLILVDGEKF  183



>ref|XP_009382866.1| PREDICTED: prosaposin-like isoform X5 [Musa acuminata subsp. 
malaccensis]
Length=206

 Score = 50.4 bits (119),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V + + KL++PD+Q EV+++ L+ C+  +N+  +CKK++  Y P IL++ E+ 
Sbjct  127  VAKLLMKLQDPDTQFEVIKMLLQECNKVENYVQECKKMVLHYGPLILVDGEKF  179



>ref|NP_001176759.1| Os12g0112250 [Oryza sativa Japonica Group]
 gb|EEE52636.1| hypothetical protein OsJ_34984 [Oryza sativa Japonica Group]
 dbj|BAH95487.1| Os12g0112250 [Oryza sativa Japonica Group]
Length=245

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++QL LK C+  +    +CK+++ +Y P +L+N E+ 
Sbjct  162  EIMSKLKDPDAEFEIIQLLLKECNKIEGHQQQCKRMVLQYVPLVLVNGEKF  212



>gb|EEC67533.1| hypothetical protein OsI_34843 [Oryza sativa Indica Group]
Length=245

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++QL LK C+  +    +CK+++ +Y P +L+N E+ 
Sbjct  162  EIMSKLKDPDAEFEIIQLLLKECNKIEGHQQQCKRMVLQYVPLVLVNGEKF  212



>ref|XP_006602699.1| PREDICTED: uncharacterized protein LOC100802366 isoform X3 [Glycine 
max]
Length=229

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  IQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            ++KLK  D+++E+++  LK C+S + ++ KCK+++FEY P I  ++E++
Sbjct  153  LEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMVFEYGPLIFDHAEKI  201



>ref|XP_006602698.1| PREDICTED: uncharacterized protein LOC100802366 isoform X2 [Glycine 
max]
Length=236

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 18/49 (37%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  IQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            ++KLK  D+++E+++  LK C+S + ++ KCK+++FEY P I  ++E++
Sbjct  160  LEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMVFEYGPLIFDHAEKI  208



>ref|XP_009382864.1| PREDICTED: prosaposin-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=222

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V + + KL++PD+Q EV+++ L+ C+  +N+  +CKK++  Y P IL++ E+ 
Sbjct  143  VAKLLMKLQDPDTQFEVIKMLLQECNKVENYVQECKKMVLHYGPLILVDGEKF  195



>ref|XP_009382862.1| PREDICTED: prosaposin-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=224

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V + + KL++PD+Q EV+++ L+ C+  +N+  +CKK++  Y P IL++ E+ 
Sbjct  145  VAKLLMKLQDPDTQFEVIKMLLQECNKVENYVQECKKMVLHYGPLILVDGEKF  197



>ref|XP_009382860.1| PREDICTED: prosaposin-like isoform X1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009382861.1| PREDICTED: prosaposin-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=228

 Score = 50.4 bits (119),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 19/53 (36%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V + + KL++PD+Q EV+++ L+ C+  +N+  +CKK++  Y P IL++ E+ 
Sbjct  149  VAKLLMKLQDPDTQFEVIKMLLQECNKVENYVQECKKMVLHYGPLILVDGEKF  201



>ref|XP_008661332.1| PREDICTED: uncharacterized protein LOC100191896 isoform X1 [Zea 
mays]
 gb|ACR38240.1| unknown [Zea mays]
 gb|AFW56001.1| surfactant protein B containing protein [Zea mays]
Length=241

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  157  EVMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  207



>gb|ABA91162.1| Saposin-like type B, region 1 family protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA91161.2| Saposin-like type B, region 1 family protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEC68766.1| hypothetical protein OsI_37293 [Oryza sativa Indica Group]
 gb|EEE51516.1| hypothetical protein OsJ_32696 [Oryza sativa Japonica Group]
Length=245

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E   KLK+PD++ E++QL LK C+  +    +CK+++ +Y P +L+N E+ 
Sbjct  162  EITSKLKDPDAEFEIIQLLLKECNKIEGHQQQCKRMVLQYVPLVLVNGEKF  212



>ref|XP_008661333.1| PREDICTED: uncharacterized protein LOC100191896 isoform X2 [Zea 
mays]
 gb|ACF86135.1| unknown [Zea mays]
 gb|ACF88242.1| unknown [Zea mays]
 gb|AFW56002.1| surfactant protein B containing protein [Zea mays]
Length=239

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  155  EVMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  205



>gb|EMS59792.1| Proactivator polypeptide-like 1 [Triticum urartu]
Length=253

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
              ++E +  LK+P++++E++ L  K C  AKN+  +CK+L+ +Y P IL+ +++
Sbjct  172  HVLVEVLMMLKDPNTKLEIVGLLFKTCSKAKNYEPQCKRLVLDYIPLILLKTQE  225



>ref|XP_003579028.1| PREDICTED: prosaposin-like [Brachypodium distachyon]
Length=248

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + K+K+PD+Q E++QL +K C+  +    +CK+++ +Y P I+ N E+ 
Sbjct  165  EVLSKMKDPDAQFEIIQLLIKECNKVQGHVQQCKRMVLQYVPLIVANGEKF  215



>ref|XP_004978548.1| PREDICTED: uncharacterized protein LOC101762796 isoform X1 [Setaria 
italica]
 ref|XP_004978549.1| PREDICTED: uncharacterized protein LOC101762796 isoform X2 [Setaria 
italica]
 ref|XP_004978550.1| PREDICTED: uncharacterized protein LOC101762796 isoform X3 [Setaria 
italica]
 ref|XP_004978551.1| PREDICTED: uncharacterized protein LOC101762796 isoform X4 [Setaria 
italica]
 ref|XP_004978552.1| PREDICTED: uncharacterized protein LOC101762796 isoform X5 [Setaria 
italica]
Length=226

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  143  EIMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYVPLILINGEKF  193



>ref|XP_009383295.1| PREDICTED: prosaposin-like isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=221

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V   + KLK+PD Q EV+++ L+ C+  ++   +CKKL+  Y P IL N E  
Sbjct  135  VANVLVKLKDPDIQFEVIKMLLEGCNGVQHHVNECKKLVLHYGPLILENGENF  187



>ref|XP_004977585.1| PREDICTED: uncharacterized protein LOC101753602 isoform X1 [Setaria 
italica]
Length=244

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  161  EIMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  211



>gb|ACG32625.1| surfactant protein B containing protein [Zea mays]
Length=235

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  151  EVMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  201



>emb|CDY62639.1| BnaCnng40660D [Brassica napus]
Length=199

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSE  7
             V + + KLK+P +++++++L LK C S  N+  KCKK++FEY P +L + E
Sbjct  118  TVSQLLPKLKDPQTKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLADLE  169



>ref|XP_004977586.1| PREDICTED: uncharacterized protein LOC101753602 isoform X2 [Setaria 
italica]
 ref|XP_004977587.1| PREDICTED: uncharacterized protein LOC101753602 isoform X3 [Setaria 
italica]
Length=230

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  147  EIMSKLKDPDAEFEIIQILIKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  197



>ref|NP_001174362.1| Os05g0335100 [Oryza sativa Japonica Group]
 gb|AAW57783.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAY97571.1| hypothetical protein OsI_19500 [Oryza sativa Indica Group]
 gb|EEE63293.1| hypothetical protein OsJ_18103 [Oryza sativa Japonica Group]
 dbj|BAH93090.1| Os05g0335100 [Oryza sativa Japonica Group]
Length=223

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/49 (43%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSIL  19
              V E +  L+NPD +++++++ LK C++A+NF  KCKKL+ + AP IL
Sbjct  138  EVVDEILTDLENPDVELKIIEVLLKGCNNAENFVQKCKKLIIQNAPIIL  186



>ref|XP_009383292.1| PREDICTED: prosaposin-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009383293.1| PREDICTED: prosaposin-like isoform X2 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009383294.1| PREDICTED: prosaposin-like isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=239

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V   + KLK+PD Q EV+++ L+ C+  ++   +CKKL+  Y P IL N E  
Sbjct  153  VANVLVKLKDPDIQFEVIKMLLEGCNGVQHHVNECKKLVLHYGPLILENGENF  205



>gb|EMT26474.1| Proactivator polypeptide-like protein 1 [Aegilops tauschii]
Length=233

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
              ++E +  LK+P++++E++ L  K C  AKN+  +CK+L+ +Y P IL+ +++
Sbjct  152  HVLVEVLMMLKDPNTKLEIVGLLFKTCSKAKNYEPQCKRLVLDYIPLILVKTQE  205



>ref|XP_006398578.1| hypothetical protein EUTSA_v10014673mg [Eutrema salsugineum]
 ref|XP_006398579.1| hypothetical protein EUTSA_v10014673mg [Eutrema salsugineum]
 gb|ESQ40031.1| hypothetical protein EUTSA_v10014673mg [Eutrema salsugineum]
 gb|ESQ40032.1| hypothetical protein EUTSA_v10014673mg [Eutrema salsugineum]
Length=209

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            + V + +  LK+P+ ++++++L LK C S  N+  KCKK++FEY P +L + E+ 
Sbjct  125  QTVSQVVSNLKDPEIKLKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLADLEKF  179



>ref|XP_009383291.1| PREDICTED: prosaposin-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=254

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            V   + KLK+PD Q EV+++ L+ C+  ++   +CKKL+  Y P IL N E  
Sbjct  168  VANVLVKLKDPDIQFEVIKMLLEGCNGVQHHVNECKKLVLHYGPLILENGENF  220



>ref|XP_003569147.1| PREDICTED: proactivator polypeptide-like 1 [Brachypodium distachyon]
Length=235

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
              ++E +  LK+P+ ++E++   LK C  A+N++ +CK+L+ EY P IL+ +++L
Sbjct  151  HVLVEVLTMLKDPNMKLEIVGFLLKQCSKAENYAPQCKRLVLEYIPLILVKTQKL  205



>ref|NP_001148899.1| surfactant protein B containing protein precursor [Zea mays]
 gb|ACG33349.1| surfactant protein B containing protein [Zea mays]
Length=232

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  145  EIMSKLKDPDAEFEIIQILVKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  195



>gb|ACN36749.1| unknown [Zea mays]
 tpg|DAA59243.1| TPA: LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_970443 
[Zea mays]
Length=240

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  153  EIMSKLKDPDAEFEIIQILVKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  203



>tpg|DAA59239.1| TPA: LOW QUALITY PROTEIN: surfactant protein B containing protein 
[Zea mays]
Length=232

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -1

Query  153  EAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            E + KLK+PD++ E++Q+ +K C+  +    +CK+L+ +Y P IL+N E+ 
Sbjct  145  EIMSKLKDPDAEFEIIQILVKECNKIEGHVQQCKRLVLQYIPLILVNGEKF  195



>emb|CDM81448.1| unnamed protein product [Triticum aestivum]
Length=235

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 18/53 (34%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSE  7
              ++E +  LK+P++++E++ L  K C  AKN+  +CK+L+ +Y P IL+ ++
Sbjct  154  HVLVEVLTMLKDPNTKLEIVGLLFKTCSKAKNYEPQCKRLVLDYIPLILVKTQ  206



>ref|NP_001148804.1| LOC100282421 precursor [Zea mays]
 gb|ACG32963.1| saposin-like type B, region 1 family protein [Zea mays]
Length=229

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
              V+E +  LK+P+ Q+EV+ L  K C  A+N+  +CK+L+ +Y P IL+  ++
Sbjct  145  HVVVEILIMLKDPNMQLEVIDLLTKTCSKAQNYEQQCKRLVLKYIPLILVKGQK  198



>ref|XP_006654267.1| PREDICTED: uncharacterized protein LOC102712725 isoform X1 [Oryza 
brachyantha]
 ref|XP_006654268.1| PREDICTED: uncharacterized protein LOC102712725 isoform X2 [Oryza 
brachyantha]
 ref|XP_006654269.1| PREDICTED: uncharacterized protein LOC102712725 isoform X3 [Oryza 
brachyantha]
Length=224

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 20/49 (41%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSIL  19
              V E +  L++PD +++++++ LK C++A+NF  KCKKL+ + AP IL
Sbjct  139  EVVDEILTDLEDPDMELKIIEVLLKGCNNAENFVQKCKKLIIQNAPIIL  187



>gb|KHN29523.1| Proactivator polypeptide [Glycine soja]
Length=212

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/49 (35%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  IQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            ++KLK  D+++E+++  LK C+S + ++ KCK+++FEY   I  ++E++
Sbjct  136  LEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMVFEYGHLIFDHAEKI  184



>gb|ABK24252.1| unknown [Picea sitchensis]
Length=430

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/53 (38%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = -1

Query  162  AVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            A++E    LK+P+++++V+++ L  C   +    +CKKL+FEY P IL N E+
Sbjct  331  AMLEIETHLKDPETKMKVIEMLLDGCKRVQGHEQECKKLVFEYGPLILTNLEK  383



>ref|XP_006858241.1| hypothetical protein AMTR_s00062p00198130 [Amborella trichopoda]
 gb|ERN19708.1| hypothetical protein AMTR_s00062p00198130 [Amborella trichopoda]
Length=320

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/54 (37%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQ  4
            RA+ E  + L+NP ++++++++ L+AC+  ++   +CKKL+ EY P IL+N E+
Sbjct  246  RAIDEIEKDLRNPVTKLKLIKILLQACEEVQDHVKECKKLVLEYVPLILVNLEK  299



>gb|KHN29522.1| Proactivator polypeptide [Glycine soja]
Length=237

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  KLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            KLK+ D+++E+++  LK C+S + ++ KCK+++ EY P +  N+E+ 
Sbjct  139  KLKDSDTKLEIIETSLKVCNSVEKYANKCKRMVLEYGPLVFDNAEKF  185



>ref|XP_004962434.1| PREDICTED: proactivator polypeptide-like isoform X3 [Setaria 
italica]
Length=224

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -1

Query  159  VMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSIL  19
            V E +  L++PD +++++++ LK C++A+NF  KCK+L+ + AP ++
Sbjct  141  VDEIVTNLEDPDMELKIIEILLKGCNNAENFVQKCKRLIIQNAPIVM  187



>ref|XP_003568678.1| PREDICTED: proactivator polypeptide-like 1 [Brachypodium distachyon]
 ref|XP_010231547.1| PREDICTED: proactivator polypeptide-like 1 [Brachypodium distachyon]
 ref|XP_010231548.1| PREDICTED: proactivator polypeptide-like 1 [Brachypodium distachyon]
Length=223

 Score = 45.8 bits (107),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -1

Query  165  RAVMEAIQKLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMN  13
            + V E +  L++P++++++ ++ LK C++A+NF  KCK L+ + AP IL +
Sbjct  138  QVVNEVLTGLEDPETELKITEILLKGCNNAENFVQKCKMLIIQNAPVILQD  188



>ref|XP_007140108.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
 gb|ESW12102.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
Length=219

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  KLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            KLK+ D+++E+++  LK C++ + ++ KCK+++FEY   +  N+E+ 
Sbjct  145  KLKDSDTKLEIIETLLKLCNAVEKYANKCKRMVFEYGLLVFDNAEKF  191



>ref|XP_007140107.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
 gb|ESW12101.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
Length=222

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 16/47 (34%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  KLKNPDSQVEVLQLFLKACDSAKNFSTKCKKLLFEYAPSILMNSEQL  1
            KLK+ D+++E+++  LK C++ + ++ KCK+++FEY   +  N+E+ 
Sbjct  148  KLKDSDTKLEIIETLLKLCNAVEKYANKCKRMVFEYGLLVFDNAEKF  194



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516244808268