BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21638_g1_i2 len=929 path=[34:0-38 73:39-43 78:44-76 110:77-133
167:134-143 177:144-179 213:180-928]

Length=929
                                                                      Score     E

ref|XP_011019027.1|  PREDICTED: proactivator polypeptide-like 1       60.8    2e-11   
ref|XP_002308246.1|  saposin B domain-containing family protein       60.8    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_011095113.1|  PREDICTED: prosaposin-like isoform X3            68.2    5e-10   
ref|XP_011095112.1|  PREDICTED: prosaposin-like isoform X2            68.2    5e-10   
ref|XP_011095111.1|  PREDICTED: prosaposin-like isoform X1            68.2    5e-10   
gb|EYU41997.1|  hypothetical protein MIMGU_mgv1a013247mg              67.4    7e-10   
ref|XP_010091067.1|  Proactivator polypeptide                         67.0    8e-10   
ref|XP_011003593.1|  PREDICTED: prosaposin                            59.7    1e-09   
gb|KHN14264.1|  Proactivator polypeptide                              65.1    4e-09   
ref|NP_001235368.1|  uncharacterized protein LOC100527899 precursor   65.1    5e-09   
ref|XP_002533718.1|  conserved hypothetical protein                   63.9    8e-09   Ricinus communis
ref|XP_006349570.1|  PREDICTED: proactivator polypeptide-like iso...  64.7    9e-09   
emb|CBI18062.3|  unnamed protein product                              48.9    1e-08   
ref|XP_009764732.1|  PREDICTED: prosaposin-like                       63.5    2e-08   
ref|XP_010326217.1|  PREDICTED: prosaposin isoform X2                 62.8    3e-08   
ref|XP_004246981.2|  PREDICTED: prosaposin isoform X1                 62.8    4e-08   
ref|XP_004506438.1|  PREDICTED: proactivator polypeptide-like 1-l...  62.0    6e-08   
ref|XP_004506439.1|  PREDICTED: proactivator polypeptide-like 1-l...  61.6    6e-08   
gb|KDP22785.1|  hypothetical protein JCGZ_00372                       62.0    6e-08   
ref|XP_003552303.1|  PREDICTED: uncharacterized protein LOC100802...  61.2    1e-07   
ref|XP_009590658.1|  PREDICTED: prosaposin-like isoform X2            61.2    1e-07   
ref|XP_006602698.1|  PREDICTED: uncharacterized protein LOC100802...  60.8    2e-07   
ref|XP_009774594.1|  PREDICTED: prosaposin-like                       60.5    2e-07   
ref|XP_010937982.1|  PREDICTED: prosaposin-like                       60.5    2e-07   
ref|XP_006602699.1|  PREDICTED: uncharacterized protein LOC100802...  60.5    2e-07   
ref|XP_009371991.1|  PREDICTED: prosaposin                            59.3    5e-07   
ref|XP_008388326.1|  PREDICTED: proactivator polypeptide-like 1       59.3    5e-07   
ref|XP_006403887.1|  hypothetical protein EUTSA_v10010716mg           58.9    6e-07   
dbj|BAJ33968.1|  unnamed protein product                              58.9    6e-07   
ref|XP_006481164.1|  PREDICTED: uncharacterized protein LOC102619717  59.3    7e-07   
gb|AFK37011.1|  unknown                                               58.9    7e-07   
gb|AFK49521.1|  unknown                                               58.5    7e-07   
ref|XP_006429547.1|  hypothetical protein CICLE_v10011064mg           60.8    7e-07   
ref|XP_006293287.1|  hypothetical protein CARUB_v10019623mg           58.5    8e-07   
ref|XP_009599219.1|  PREDICTED: prosaposin-like                       58.5    9e-07   
ref|XP_002323058.1|  saposin B domain-containing family protein       58.2    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010503867.1|  PREDICTED: prosaposin-like isoform X2            57.8    2e-06   
ref|XP_010503866.1|  PREDICTED: prosaposin-like isoform X1            57.8    2e-06   
ref|XP_010042407.1|  PREDICTED: prosaposin-like                       57.8    2e-06   
ref|XP_009136631.1|  PREDICTED: prosaposin-like                       57.8    2e-06   
ref|XP_009590656.1|  PREDICTED: prosaposin-like isoform X1            58.2    2e-06   
ref|XP_010503868.1|  PREDICTED: prosaposin-like isoform X3            57.8    2e-06   
emb|CDY67661.1|  BnaA03g57960D                                        57.4    2e-06   
ref|XP_010515602.1|  PREDICTED: prosaposin-like isoform X2            57.4    2e-06   
emb|CDY29042.1|  BnaC07g32480D                                        57.4    2e-06   
ref|XP_010515601.1|  PREDICTED: prosaposin-like isoform X1            57.4    2e-06   
ref|XP_007207246.1|  hypothetical protein PRUPE_ppa009037m1g          57.8    2e-06   
gb|KFK34416.1|  hypothetical protein AALP_AA5G141700                  57.4    2e-06   
ref|XP_008245127.1|  PREDICTED: proactivator polypeptide-like 1       57.8    2e-06   
gb|KHG03118.1|  Proactivator polypeptide                              57.4    2e-06   
ref|XP_007140107.1|  hypothetical protein PHAVU_008G084800g           57.4    3e-06   
ref|XP_007207245.1|  hypothetical protein PRUPE_ppa009037m1g          57.8    3e-06   
ref|XP_010426757.1|  PREDICTED: proactivator polypeptide-like 1       57.0    3e-06   
ref|XP_010529095.1|  PREDICTED: proactivator polypeptide-like 1       56.6    3e-06   
emb|CDP06403.1|  unnamed protein product                              57.4    4e-06   
ref|XP_007140108.1|  hypothetical protein PHAVU_008G084800g           56.2    5e-06   
dbj|BAB39899.1|  P0028E10.2                                           43.9    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643789.1|  PREDICTED: proactivator polypeptide-like 1-l...  43.9    6e-06   
gb|EAY72679.1|  hypothetical protein OsI_00546                        43.5    8e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001042117.2|  Os01g0166700                                     43.5    8e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002876101.1|  predicted protein                                55.5    9e-06   
ref|NP_190741.1|  saposin B domain-containing protein                 55.5    9e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KDO49655.1|  hypothetical protein CISIN_1g0286131mg                52.8    1e-05   
ref|NP_001138322.1|  proactivator polypeptide-like 1 precursor        57.0    1e-05   Rattus norvegicus [brown rat]
ref|XP_004249637.1|  PREDICTED: prosaposin                            55.8    1e-05   
gb|KEH29214.1|  saposin B domain protein                              54.7    2e-05   
ref|XP_007033575.1|  Saposin B domain-containing protein, putativ...  54.7    2e-05   
ref|XP_006288609.1|  hypothetical protein CARUB_v10001904mg           46.6    3e-05   
ref|XP_007033574.1|  Saposin B domain-containing protein, putativ...  54.3    3e-05   
gb|AHZ31393.1|  saposin B domain-containing protein                   52.4    3e-05   
gb|AHZ31401.1|  saposin B domain-containing protein                   52.4    3e-05   
gb|ABQ42118.1|  saposin B domain-containing protein                   52.4    3e-05   Sonneratia caseolaris
ref|XP_004302581.1|  PREDICTED: proactivator polypeptide-like 1-like  53.9    3e-05   
ref|XP_006338961.1|  PREDICTED: uncharacterized protein LOC102600...  53.9    4e-05   
ref|XP_009387676.1|  PREDICTED: proactivator polypeptide-like 1       53.5    4e-05   
ref|XP_009115874.1|  PREDICTED: prosaposin-like                       53.1    5e-05   
ref|XP_003623572.1|  Saposin B domain-containing protein              52.0    6e-05   
gb|AHZ31397.1|  saposin B domain-containing protein                   51.2    7e-05   
gb|EPS73961.1|  hypothetical protein M569_00799                       53.1    8e-05   
gb|AHZ31395.1|  saposin B domain-containing protein                   51.2    8e-05   
gb|ABQ42119.1|  saposin B domain-containing protein                   51.2    9e-05   Sonneratia ovata
ref|XP_005319124.1|  PREDICTED: proactivator polypeptide-like 1       53.9    9e-05   
gb|KHG00690.1|  Proactivator polypeptide                              52.8    1e-04   
emb|CDX73698.1|  BnaC08g23050D                                        53.1    1e-04   
ref|XP_007134685.1|  hypothetical protein PHAVU_010G0675000g          50.1    1e-04   
gb|AHZ31399.1|  saposin B domain-containing protein                   50.4    1e-04   
gb|AHZ31394.1|  saposin B domain-containing protein                   50.1    2e-04   
ref|XP_006843736.1|  hypothetical protein AMTR_s00007p00225690        51.6    2e-04   
gb|AHZ31400.1|  saposin B domain-containing protein                   50.1    2e-04   
gb|ABQ42117.1|  saposin B domain-containing protein                   50.1    2e-04   Sonneratia alba
gb|ACS68697.1|  saposin B domain-containing protein                   50.1    2e-04   Sonneratia alba
ref|XP_003623571.1|  Saposin B domain-containing protein              52.0    2e-04   
gb|AAI19541.2|  Psapl1 protein                                        52.8    2e-04   Mus musculus [mouse]
gb|AFK40466.1|  unknown                                               51.6    2e-04   
gb|AES79789.2|  saposin B domain protein                              51.6    2e-04   
ref|NP_780458.2|  proactivator polypeptide-like 1 precursor           52.4    3e-04   Mus musculus [mouse]
sp|Q8C1C1.2|SAPL1_MOUSE  RecName: Full=Proactivator polypeptide-l...  52.4    3e-04   Mus musculus [mouse]
gb|ACG32625.1|  surfactant protein B containing protein               51.6    3e-04   Zea mays [maize]
ref|XP_009419859.1|  PREDICTED: proactivator polypeptide-like 1       51.6    4e-04   
dbj|BAC25258.1|  unnamed protein product                              51.6    5e-04   Mus musculus [mouse]
ref|XP_010035988.1|  PREDICTED: prosaposin-like                       50.4    6e-04   
ref|XP_008810565.1|  PREDICTED: uncharacterized protein LOC103721950  50.4    6e-04   
ref|XP_006338959.1|  PREDICTED: proactivator polypeptide-like iso...  50.4    7e-04   
tpg|DAA59240.1|  TPA: hypothetical protein ZEAMMB73_970443            48.5    7e-04   
ref|XP_010921104.1|  PREDICTED: proactivator polypeptide-like 1 i...  50.1    8e-04   
gb|AAF32354.1|AF220198_1  putative protein                            48.9    8e-04   Vitis riparia [frost grape]
gb|KHN29523.1|  Proactivator polypeptide                              49.7    0.001   



>ref|XP_011019027.1| PREDICTED: proactivator polypeptide-like 1 [Populus euphratica]
 ref|XP_011019028.1| PREDICTED: proactivator polypeptide-like 1 [Populus euphratica]
 ref|XP_011019030.1| PREDICTED: proactivator polypeptide-like 1 [Populus euphratica]
Length=242

 Score = 60.8 bits (146),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I+  L ++C    +++ KCK++VFEY P IL+NAEQF  T D+CTLLH    P    E
Sbjct  173  LEIIDLLLKACNSMENYAKKCKRMVFEYGPLILINAEQFLETKDVCTLLHACKVPKDSGE  232

Query  117  HSAS  106
             +++
Sbjct  233  QAST  236


 Score = 36.2 bits (82),  Expect(2) = 2e-11, Method: Compositional matrix adjust.
 Identities = 20/89 (22%), Positives = 40/89 (45%), Gaps = 8/89 (9%)
 Frame = -1

Query  506  EKQVQVSGN----EDQCLKCKQLVV----TYSDKQKQSQIINALHSFCQINFPFPQQCIN  351
            E  +Q S N    ++ C  CK+         ++ + Q++I+  LH  C  +  F ++CI 
Sbjct  50   ETDIQTSNNVTRKDEVCTLCKEFAAQALDYMAENETQTEILEILHETCSWSAIFKRECIT  109

Query  350  QFEPILTNLFKLINSSTPESLCKLFNFCE  264
              +   +  F  ++S   +  C+ +N C 
Sbjct  110  LVDSYSSIFFSYVSSVQSDDFCRKYNLCH  138



>ref|XP_002308246.1| saposin B domain-containing family protein [Populus trichocarpa]
 ref|XP_006381254.1| hypothetical protein POPTR_0006s10790g [Populus trichocarpa]
 gb|EEE91769.1| saposin B domain-containing family protein [Populus trichocarpa]
 gb|ERP59051.1| hypothetical protein POPTR_0006s10790g [Populus trichocarpa]
Length=242

 Score = 60.8 bits (146),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 42/64 (66%), Gaps = 3/64 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I+  L ++C    +++ KCK++VFEY P IL+NAEQF  T D+CTLLH    P    E
Sbjct  173  LEIIDLLLKACNSMENYAKKCKRMVFEYGPLILINAEQFLETKDVCTLLHACKVPKDSGE  232

Query  117  HSAS  106
             +++
Sbjct  233  QAST  236


 Score = 33.9 bits (76),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 21/89 (24%), Positives = 38/89 (43%), Gaps = 8/89 (9%)
 Frame = -1

Query  506  EKQVQVSGN----EDQCLKCKQLVVTYSD----KQKQSQIINALHSFCQINFPFPQQCIN  351
            E  +Q S N    ++ C  C++      D     + Q++I+  LH  C     F Q+CI 
Sbjct  50   ETDIQTSNNVTRKDEVCTLCEEFAAQALDYMAENKTQTEILEILHKTCSRLTTFKQECIT  109

Query  350  QFEPILTNLFKLINSSTPESLCKLFNFCE  264
              +   +  F  ++S   +  C+ +N C 
Sbjct  110  LVDYYSSIFFSYVSSVQSDDFCRKYNLCH  138



>ref|XP_011095113.1| PREDICTED: prosaposin-like isoform X3 [Sesamum indicum]
Length=231

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+IVQ L ++C        KCK+LVFEYAP I+VNAEQF  TNDIC +LH  DS   G+ 
Sbjct  158  LEIVQLLLKACNSIGKNVQKCKRLVFEYAPVIIVNAEQFLETNDICAILHACDSAAAGMN  217

Query  117  HS  112
             +
Sbjct  218  EA  219


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 53/120 (44%), Gaps = 18/120 (15%)
 Frame = -1

Query  845  CCSAKDLAAADLKTQSLDVSEKQVEG------SLCVQCKEFVTT----YSDEQKQRELIN  696
            CC+A+DL         L   E Q  G       LC  C+EF T      S+ + Q E+I 
Sbjct  17   CCNARDLTEVLQSYDKLPEGEAQHVGELRKNEKLCTLCEEFATEALNYLSENKTQTEIIG  76

Query  695  SLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVSISQ  522
             LH  C  I      P++ QQCI  VD   P  F  +SS   E  C+    CE  VSISQ
Sbjct  77   ILHKSCSRI------PSFKQQCIVLVDYYAPLFFLEVSSIQAEDFCRKVDLCEEGVSISQ  130



>ref|XP_011095112.1| PREDICTED: prosaposin-like isoform X2 [Sesamum indicum]
Length=237

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+IVQ L ++C        KCK+LVFEYAP I+VNAEQF  TNDIC +LH  DS   G+ 
Sbjct  164  LEIVQLLLKACNSIGKNVQKCKRLVFEYAPVIIVNAEQFLETNDICAILHACDSAAAGMN  223

Query  117  HS  112
             +
Sbjct  224  EA  225


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 55/123 (45%), Gaps = 25/123 (20%)
 Frame = -1

Query  845  CCSAKDLAAADLKTQSLD---------VSEKQVEGSLCVQCKEFVTT----YSDEQKQRE  705
            CC+A+DL       QS D         V E +    LC  C+EF T      S+ + Q E
Sbjct  24   CCNARDLTV----LQSYDKLPEGEAQHVGELRKNEKLCTLCEEFATEALNYLSENKTQTE  79

Query  704  LINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVS  531
            +I  LH  C  I      P++ QQCI  VD   P  F  +SS   E  C+    CE  VS
Sbjct  80   IIGILHKSCSRI------PSFKQQCIVLVDYYAPLFFLEVSSIQAEDFCRKVDLCEEGVS  133

Query  530  ISQ  522
            ISQ
Sbjct  134  ISQ  136



>ref|XP_011095111.1| PREDICTED: prosaposin-like isoform X1 [Sesamum indicum]
Length=238

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+IVQ L ++C        KCK+LVFEYAP I+VNAEQF  TNDIC +LH  DS   G+ 
Sbjct  165  LEIVQLLLKACNSIGKNVQKCKRLVFEYAPVIIVNAEQFLETNDICAILHACDSAAAGMN  224

Query  117  HS  112
             +
Sbjct  225  EA  226


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 53/120 (44%), Gaps = 18/120 (15%)
 Frame = -1

Query  845  CCSAKDLAAADLKTQSLDVSEKQVEG------SLCVQCKEFVTT----YSDEQKQRELIN  696
            CC+A+DL         L   E Q  G       LC  C+EF T      S+ + Q E+I 
Sbjct  24   CCNARDLTEVLQSYDKLPEGEAQHVGELRKNEKLCTLCEEFATEALNYLSENKTQTEIIG  83

Query  695  SLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVSISQ  522
             LH  C  I      P++ QQCI  VD   P  F  +SS   E  C+    CE  VSISQ
Sbjct  84   ILHKSCSRI------PSFKQQCIVLVDYYAPLFFLEVSSIQAEDFCRKVDLCEEGVSISQ  137



>gb|EYU41997.1| hypothetical protein MIMGU_mgv1a013247mg [Erythranthe guttata]
Length=226

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFS---TKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDS  136
            L+IVQ L ++C       TKCK+LVFEYAP ILVNAEQF  TND+CT+LH  DS
Sbjct  160  LEIVQLLLKACSSAGKNVTKCKRLVFEYAPIILVNAEQFLETNDVCTILHACDS  213


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 20/126 (16%)
 Frame = -1

Query  854  SSWCCSAKDLAA------ADLKT--QSLDVSEKQVEGSLCVQCKEFVT---TYSDEQK-Q  711
            S WCC+A+DL A      +D+ T  ++  V E +   +LC  C+EF +    Y  E K Q
Sbjct  14   SFWCCNARDLTANYNTKKSDIVTGSEAQHVEEVRKNENLCTLCEEFASDALNYLAENKTQ  73

Query  710  RELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGV  537
             E+I++LH  C  +      P++ QQCI  VD   P  F  +S+   E  C     CE  
Sbjct  74   TEIISTLHKSCSKV------PSFKQQCIVLVDYYAPLFFLEVSTLQAEDFCLKVDLCEKK  127

Query  536  VSISQY  519
             S++Q+
Sbjct  128  ASVAQH  133



>ref|XP_010091067.1| Proactivator polypeptide [Morus notabilis]
 gb|EXB42357.1| Proactivator polypeptide [Morus notabilis]
Length=215

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (69%), Gaps = 3/58 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLG  124
            L+I++ L ++C     F  KCK++VFEY P IL NAEQF  T DICTLLH  DSPT+ 
Sbjct  146  LEIIEVLLKACKSTKDFEKKCKRMVFEYGPLILANAEQFLETKDICTLLHACDSPTVN  203



>ref|XP_011003593.1| PREDICTED: prosaposin [Populus euphratica]
Length=242

 Score = 59.7 bits (143),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C     ++ KCK++VFEY P IL +AEQF  T D+C++LH  + P   IE
Sbjct  173  LEIIELLLKACNSMEKYANKCKRMVFEYGPVILTSAEQFLETTDLCSMLHACEVPEDNIE  232

Query  117  HSA  109
             ++
Sbjct  233  QAS  235


 Score = 30.8 bits (68),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/116 (28%), Positives = 54/116 (47%), Gaps = 14/116 (12%)
 Frame = -1

Query  587  ISSSTPETICKLFCEGVVSISQYAESTEKQVQVSGN----EDQCLKCK----QLVVTYSD  432
            I S+T ET      E  V I +  E  EK++Q + N    ++ C  C+    Q +   ++
Sbjct  29   IFSTTAETY-----EISVEIMENQEK-EKEIQTTNNVTRKDEVCTLCEEFASQALDYLAE  82

Query  431  KQKQSQIINALHSFCQINFPFPQQCINQFEPILTNLFKLINSSTPESLCKLFNFCE  264
             + Q++I+  LH  C     F Q+CI   +   +  F  I+S   E  C+ FN C+
Sbjct  83   NKTQTEILEKLHRSCSQLTTFEQECITLVDYYSSIFFSYISSVHSEDFCRKFNLCQ  138



>gb|KHN14264.1| Proactivator polypeptide [Glycine soja]
Length=216

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 99/217 (46%), Gaps = 40/217 (18%)
 Frame = -1

Query  848  WCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT----YSDEQKQRELINSLHNY  681
            W C  ++LA          +SE   +  +C  C+E+        +D++ QRE+I+SLHN 
Sbjct  17   WACDTRELAI---------ISELNRKSDVCELCEEYTAEALDYLNDKENQREIIDSLHNI  67

Query  680  CKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAESTEK  501
            C +I       ++ QQCI  VD   P  F  I+S  P  +CK      + I Q A+ +  
Sbjct  68   CNHIL------SFKQQCIELVDHYAPRFFLEIASVQPGELCK-----QIHICQSAKISS-  115

Query  500  QVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQINFPFPQQC---INQFE  342
              +V GN   C  CK     L+V  +D   + +I+ AL   C     F ++C   + ++ 
Sbjct  116  --EVEGN--SCDSCKDTVSALLVKLNDPDTKLEIMEALLKACNSMDKFSKKCKRMVFEYG  171

Query  341  P-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQSA  234
            P IL    K + ++    +C   + C  + ++S + A
Sbjct  172  PLILVKAEKFLKTA---DICTTLHACPASTAVSNKEA  205


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 39/64 (61%), Gaps = 3/64 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C     FS KCK++VFEY P ILV AE+F  T DICT LH   + T    
Sbjct  143  LEIMEALLKACNSMDKFSKKCKRMVFEYGPLILVKAEKFLKTADICTTLHACPASTAVSN  202

Query  117  HSAS  106
              AS
Sbjct  203  KEAS  206



>ref|NP_001235368.1| uncharacterized protein LOC100527899 precursor [Glycine max]
 gb|ACU17107.1| unknown [Glycine max]
Length=214

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 59/219 (27%), Positives = 99/219 (45%), Gaps = 40/219 (18%)
 Frame = -1

Query  848  WCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT----YSDEQKQRELINSLHNY  681
            W C  ++LA          +SE   +  +C  C+E+        +D++ QRE+I+SLHN 
Sbjct  17   WACDTRELAI---------ISELNRKSDVCELCEEYTAEALDYLNDKENQREIIDSLHNI  67

Query  680  CKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAESTEK  501
            C +I       ++ QQCI  VD   P  F  I+S  P  +CK      + I Q A+ +  
Sbjct  68   CNHI------LSFKQQCIELVDHCAPRFFLEIASVQPGELCK-----QIHICQSAKISS-  115

Query  500  QVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQINFPFPQQC---INQFE  342
              +V GN   C  CK     L+V  +D   + +I+ AL   C     F ++C   + ++ 
Sbjct  116  --EVEGN--SCDSCKDTVSVLLVKLNDPDTKLEIMEALLKACNSMDKFSKKCKRMVFEYG  171

Query  341  P-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQSARN  228
            P IL    K + ++    +C     C  + ++S + + N
Sbjct  172  PLILVKAEKFLKTA---DICTTLRACPASTAVSNKGSLN  207


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L+I++ L ++C     FS KCK++VFEY P ILV AE+F  T DICT L    + T
Sbjct  143  LEIMEALLKACNSMDKFSKKCKRMVFEYGPLILVKAEKFLKTADICTTLRACPAST  198



>ref|XP_002533718.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28663.1| conserved hypothetical protein [Ricinus communis]
Length=199

 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 46/72 (64%), Gaps = 3/72 (4%)
 Frame = -3

Query  312  QLLNA*KSLQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVS  142
            +L N    L+I++ L + C    +++ KCK+LVFEY P IL NAEQF  + DICT+LH  
Sbjct  122  KLKNPDTQLEIIEVLLKGCDSMENYAAKCKRLVFEYGPIILTNAEQFLESRDICTMLHAC  181

Query  141  DSPTLGIEHSAS  106
            D+P +    +A+
Sbjct  182  DTPQVSSGEAAT  193



>ref|XP_006349570.1| PREDICTED: proactivator polypeptide-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006349571.1| PREDICTED: proactivator polypeptide-like isoform X2 [Solanum 
tuberosum]
Length=242

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 75/257 (29%), Positives = 109/257 (42%), Gaps = 61/257 (24%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAAD-LKTQSLDVSEKQVEG--------------  768
            MD RLC  + ++    SSWCC+A++LA  + L T++ DVS  Q+                
Sbjct  1    MDLRLCLCLFILG---SSWCCAARELAVLNPLITETEDVSVLQINNLEELRQVQPLEEVN  57

Query  767  ---SLCVQCKEFVT---TYSDEQK-QRELINSLHNYCKNIGAITDNPAWGQQCINNVDQT  609
                LC  C+E+      Y D  K Q E+I+ LH  C  +        + ++C   VD  
Sbjct  58   GNEQLCTLCEEYTAKALNYMDNNKTQTEIIDRLHKSCSKMR------FYKEECAILVDYY  111

Query  608  LPNIFEMISSSTPETICKLF--CEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLVVT--  441
             P  F  I+   PE  C+ F  CE VV IS        QV    N D C K    VVT  
Sbjct  112  APLFFLQINKMKPENFCQQFGLCEQVVIIS--------QVLSGKNCDLCHK----VVTEA  159

Query  440  ---YSDKQKQSQIINALHSFCQINFPFPQQC---INQFEPILTNLFKLINSS---TPESL  288
                 D   + +I+  L   C    P+ ++C   + +F P++     LIN+        +
Sbjct  160  ESKLKDPDTRLEILELLLKACGAIKPYAKKCKKLVFEFAPVI-----LINAEQFLEQNDI  214

Query  287  CKLFNFCEGAVSISQQS  237
            C + + CE AV   Q S
Sbjct  215  CAILHACEPAVDKEQAS  231


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 4/63 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFH---FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C     ++ KCKKLVFE+AP IL+NAEQF   NDIC +LH  + P +  E
Sbjct  170  LEILELLLKACGAIKPYAKKCKKLVFEFAPVILINAEQFLEQNDICAILHACE-PAVDKE  228

Query  117  HSA  109
             ++
Sbjct  229  QAS  231



>emb|CBI18062.3| unnamed protein product [Vitis vinifera]
Length=716

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 32/55 (58%), Gaps = 3/55 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSP  133
            L+I++ L + C        KCK++VFEY P IL N E+F   ND+CT +H    P
Sbjct  647  LEILELLLKGCDAVEGLVRKCKRMVFEYGPIILNNTERFLEKNDVCTTVHACGVP  701


 Score = 38.1 bits (87),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 35/77 (45%), Gaps = 4/77 (5%)
 Frame = -1

Query  485  GNEDQCLKCKQLVVTYSD----KQKQSQIINALHSFCQINFPFPQQCINQFEPILTNLFK  318
            GNE+ C  C++L+    D     + Q  II  LH+ C     F QQCI   +     +F 
Sbjct  536  GNENVCTMCERLITEALDLLAENRTQKLIIEMLHATCSEVQSFKQQCITLVDYYAALIFS  595

Query  317  LINSSTPESLCKLFNFC  267
             +   TP + C+  N C
Sbjct  596  ELALITPGNFCEKANLC  612



>ref|XP_009764732.1| PREDICTED: prosaposin-like [Nicotiana sylvestris]
Length=245

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 71/264 (27%), Positives = 121/264 (46%), Gaps = 57/264 (22%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAA-ADLKTQSLDVS---------------EKQVE  771
            MD R+C    ++    SSWCC+A++L+A + L T++ D+S                ++V 
Sbjct  1    MDFRVCLCFFILG---SSWCCTARELSARSHLITETEDISVLQINNLEVPRQVQPPEEVR  57

Query  770  GS--LCVQCKEFVTT----YSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQT  609
            G+   C  C+E+        ++ + Q E+I+ LH  C N+      P + Q+C+  VD  
Sbjct  58   GNEQWCTLCEEYTAKALKYVANNKTQTEIIDHLHESCLNM------PFYKQECVVLVDYY  111

Query  608  LPNIFEMISSSTPETICKLF--CEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLVVTYS  435
             P  F  I+  +PE  C+ F  CE VV+ISQ          +SG    C  C Q+V    
Sbjct  112  APLFFSEINKISPEDFCEKFDLCERVVTISQV---------LSGQ--SCDLCHQVVTEAE  160

Query  434  DKQK----QSQIINALHSFC-QINF-PFPQQC---INQFEP-ILTNLFKLINSSTPESLC  285
             K K    Q +I+  L   C  +   P+  +C   I ++ P IL N  + +  +    +C
Sbjct  161  SKLKDPDTQLEILELLLKACGAVKLKPYATKCKKLIFEYAPVILVNAEQFLEKN---DIC  217

Query  284  KLFNFCEGAVSISQQSARNLFSNM  213
             + + CE A     Q++  + +++
Sbjct  218  AILHACEPAADKELQASPKMQASL  241


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 6/66 (9%)
 Frame = -3

Query  288  LQIVQFL*RSCFH-----FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLG  124
            L+I++ L ++C       ++TKCKKL+FEYAP ILVNAEQF   NDIC +LH  + P   
Sbjct  170  LEILELLLKACGAVKLKPYATKCKKLIFEYAPVILVNAEQFLEKNDICAILHACE-PAAD  228

Query  123  IEHSAS  106
             E  AS
Sbjct  229  KELQAS  234



>ref|XP_010326217.1| PREDICTED: prosaposin isoform X2 [Solanum lycopersicum]
Length=238

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 112/253 (44%), Gaps = 52/253 (21%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAADLKTQSLDVSE-------------KQVEGS-  765
            MD RLC  + ++    SSW C+A++LA    +T+ + V +             ++V GS 
Sbjct  1    MDLRLCLCLFIIG---SSWVCAARELAVLITETEDVSVLQINNLKELRQVQPLEEVNGSE  57

Query  764  -LCVQCKEF----VTTYSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPN  600
             LC  C+E+    +   ++ + Q E+I+ LH  C  +        + ++C   VD   P 
Sbjct  58   QLCTLCEEYTAKALNYMANNKTQTEIIDRLHKSCSKMR------FYKKECAILVDYYAPL  111

Query  599  IFEMISSSTPETICKLF--CEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLVVTYSDKQ  426
             F  I+   PE  C+ F  CE VV ISQ          +SG    C  C +LV     K 
Sbjct  112  FFLQINKMKPENFCQQFGLCEQVVIISQ---------ALSGK--NCNLCHKLVTDVESKL  160

Query  425  K----QSQIINALHSFCQINFPFPQQC---INQFEP-ILTNLFKLINSSTPESLCKLFNF  270
            K    Q +I+  L   C    P+ ++C   + +F P IL N  + +  +    +C + + 
Sbjct  161  KDPDTQFEILELLLKACGAIEPYTKKCKKLVFEFAPVILVNAEQFLEQN---DVCAILHA  217

Query  269  CEGAVSISQQSAR  231
            CE AV   Q S +
Sbjct  218  CEPAVDKEQASRK  230


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -3

Query  285  QIVQFL*RSCFH---FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIEH  115
            +I++ L ++C     ++ KCKKLVFE+AP ILVNAEQF   ND+C +LH  + P +  E 
Sbjct  168  EILELLLKACGAIEPYTKKCKKLVFEFAPVILVNAEQFLEQNDVCAILHACE-PAVDKEQ  226

Query  114  SA  109
            ++
Sbjct  227  AS  228



>ref|XP_004246981.2| PREDICTED: prosaposin isoform X1 [Solanum lycopersicum]
Length=252

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 70/253 (28%), Positives = 112/253 (44%), Gaps = 52/253 (21%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAADLKTQSLDVSE-------------KQVEGS-  765
            MD RLC  + ++    SSW C+A++LA    +T+ + V +             ++V GS 
Sbjct  15   MDLRLCLCLFIIG---SSWVCAARELAVLITETEDVSVLQINNLKELRQVQPLEEVNGSE  71

Query  764  -LCVQCKEF----VTTYSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPN  600
             LC  C+E+    +   ++ + Q E+I+ LH  C  +        + ++C   VD   P 
Sbjct  72   QLCTLCEEYTAKALNYMANNKTQTEIIDRLHKSCSKMR------FYKKECAILVDYYAPL  125

Query  599  IFEMISSSTPETICKLF--CEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLVVTYSDKQ  426
             F  I+   PE  C+ F  CE VV ISQ          +SG    C  C +LV     K 
Sbjct  126  FFLQINKMKPENFCQQFGLCEQVVIISQ---------ALSGK--NCNLCHKLVTDVESKL  174

Query  425  K----QSQIINALHSFCQINFPFPQQC---INQFEP-ILTNLFKLINSSTPESLCKLFNF  270
            K    Q +I+  L   C    P+ ++C   + +F P IL N  + +  +    +C + + 
Sbjct  175  KDPDTQFEILELLLKACGAIEPYTKKCKKLVFEFAPVILVNAEQFLEQN---DVCAILHA  231

Query  269  CEGAVSISQQSAR  231
            CE AV   Q S +
Sbjct  232  CEPAVDKEQASRK  244


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 4/62 (6%)
 Frame = -3

Query  285  QIVQFL*RSCFH---FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIEH  115
            +I++ L ++C     ++ KCKKLVFE+AP ILVNAEQF   ND+C +LH  + P +  E 
Sbjct  182  EILELLLKACGAIEPYTKKCKKLVFEFAPVILVNAEQFLEQNDVCAILHACE-PAVDKEQ  240

Query  114  SA  109
            ++
Sbjct  241  AS  242



>ref|XP_004506438.1| PREDICTED: proactivator polypeptide-like 1-like isoform X1 [Cicer 
arietinum]
Length=221

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (44%), Gaps = 41/219 (19%)
 Frame = -1

Query  857  ISSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT----YSDEQKQRELINSL  690
            +S+W C A++LA  +L   S           +C  C+E+ T       D   Q E+I+ L
Sbjct  20   VSAWACDARELANPELNITS----------DVCSLCEEYTTKALNYIKDNNTQAEIIDGL  69

Query  689  HNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAES  510
            HN C  +       ++ +QCI  VD   P  F  I+   P  +C+ F           ES
Sbjct  70   HNTCYQL------LSFKKQCIELVDYYAPLFFSKIALIKPGELCEKF--------NLCES  115

Query  509  TEKQVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQINFPFPQQC---IN  351
             +   QV GN   C  CK     L+V  +D   + +I+  L   C+    + ++C   + 
Sbjct  116  AKASSQVQGN--SCGLCKDAVAALLVELNDPDTKLEIMEKLLKACKSLEKYAKECKKIVF  173

Query  350  QFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
            ++ P IL N  K + ++    +C   + C  ++ ISQ++
Sbjct  174  EYGPLILINAEKFLKTA---DICTTLHACPASIVISQEA  209


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L+I++ L ++C     ++ +CKK+VFEY P IL+NAE+F  T DICT LH 
Sbjct  148  LEIMEKLLKACKSLEKYAKECKKIVFEYGPLILINAEKFLKTADICTTLHA  198



>ref|XP_004506439.1| PREDICTED: proactivator polypeptide-like 1-like isoform X2 [Cicer 
arietinum]
 ref|XP_004506440.1| PREDICTED: proactivator polypeptide-like 1-like isoform X3 [Cicer 
arietinum]
Length=215

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/219 (26%), Positives = 96/219 (44%), Gaps = 41/219 (19%)
 Frame = -1

Query  857  ISSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT----YSDEQKQRELINSL  690
            +S+W C A++LA  +L   S           +C  C+E+ T       D   Q E+I+ L
Sbjct  14   VSAWACDARELANPELNITS----------DVCSLCEEYTTKALNYIKDNNTQAEIIDGL  63

Query  689  HNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAES  510
            HN C  +       ++ +QCI  VD   P  F  I+   P  +C+ F           ES
Sbjct  64   HNTCYQL------LSFKKQCIELVDYYAPLFFSKIALIKPGELCEKF--------NLCES  109

Query  509  TEKQVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQINFPFPQQC---IN  351
             +   QV GN   C  CK     L+V  +D   + +I+  L   C+    + ++C   + 
Sbjct  110  AKASSQVQGN--SCGLCKDAVAALLVELNDPDTKLEIMEKLLKACKSLEKYAKECKKIVF  167

Query  350  QFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
            ++ P IL N  K + ++    +C   + C  ++ ISQ++
Sbjct  168  EYGPLILINAEKFLKTA---DICTTLHACPASIVISQEA  203


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L+I++ L ++C     ++ +CKK+VFEY P IL+NAE+F  T DICT LH 
Sbjct  142  LEIMEKLLKACKSLEKYAKECKKIVFEYGPLILINAEKFLKTADICTTLHA  192



>gb|KDP22785.1| hypothetical protein JCGZ_00372 [Jatropha curcas]
Length=242

 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 3/72 (4%)
 Frame = -3

Query  312  QLLNA*KSLQIVQFL*RSCFHF---STKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVS  142
            +L N    L+I++ L ++C      + KCK++VFEY P I+ NAEQF  T DICT+LH  
Sbjct  165  KLKNPDTQLEIIELLLKACDSLEKNAAKCKRMVFEYGPIIITNAEQFLETKDICTMLHAC  224

Query  141  DSPTLGIEHSAS  106
            DS     E +A+
Sbjct  225  DSAKPNSEEAAT  236


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 60/247 (24%), Positives = 107/247 (43%), Gaps = 54/247 (22%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSE------------KQVEGS--------LCVQCKEFVT  735
            + W C+A+ +A  +L  +S+ +SE            K+ + S        +C  C+EF T
Sbjct  15   AGWACAARQMADTELSRRSMAISELPATQMRDQVQEKENQASDGVIKNNQVCTLCEEFAT  74

Query  734  ---TYSDEQK-QRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPE  567
                Y  E K Q E+++ LH  C  + +      + +QCI  VD   P  F  ISS  P 
Sbjct  75   QALDYLTENKTQTEIVDILHGACSKVHS------FKEQCITLVDYYAPLFFLEISSVQPA  128

Query  566  TICKL--FCEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLV----VTYSDKQKQSQIIN  405
              CK    C+ +V I    +           ED+C  C + V    +   +   Q +II 
Sbjct  129  DFCKKVNLCQEIVLIFSKLQ-----------EDKCGICHRAVSEVLIKLKNPDTQLEIIE  177

Query  404  ALHSFC---QINFPFPQQCINQFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
             L   C   + N    ++ + ++ P I+TN  + + +   + +C + + C+ A   S+++
Sbjct  178  LLLKACDSLEKNAAKCKRMVFEYGPIIITNAEQFLET---KDICTMLHACDSAKPNSEEA  234

Query  236  ARNLFSN  216
            A  L ++
Sbjct  235  ATVLKAD  241



>ref|XP_003552303.1| PREDICTED: uncharacterized protein LOC100802366 isoformX1 [Glycine 
max]
 ref|XP_006602700.1| PREDICTED: uncharacterized protein LOC100802366 isoform X4 [Glycine 
max]
Length=212

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 100/219 (46%), Gaps = 39/219 (18%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT---YSDEQK-QRELINSLH  687
            ++W C A++LA ++        SE  ++  +C  C+E++T    Y  E K + E+I+ LH
Sbjct  15   AAWACDARELANSE-------TSELSIKPDVCALCEEYITKALDYLHENKTETEIISILH  67

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVSISQYAE  513
            N C  +      P++ Q+C+  VD  +P  F  +++  P   C     C+ +  IS    
Sbjct  68   NTCHQL------PSFKQKCVALVDYYVPLFFSEVATIQPGEFCHKVNLCQDIAHIS----  117

Query  512  STEKQVQVSGNEDQCLKCKQLVVTYSDKQKQS----QIINALHSFCQINFPFPQQC---I  354
                   +   ED C  CK  V T  +K K+S    +II  L   C     +  +C   +
Sbjct  118  -------LKVQEDSCEFCKDTVSTLLEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMV  170

Query  353  NQFEPILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
             ++ P++ +  + I  +T   +C + + C+ +    QQ+
Sbjct  171  FEYGPLIFDHAEKILETT--DICNIIHACKSSDVAGQQA  207



>ref|XP_009590658.1| PREDICTED: prosaposin-like isoform X2 [Nicotiana tomentosiformis]
Length=233

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/253 (27%), Positives = 120/253 (47%), Gaps = 47/253 (19%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAADLKTQSLDVSE-----KQVEGS--LCVQCKE  744
            MD R+C  + ++    SSWCC+A++L+A  L+  +L+V       ++V G+  LC  C+E
Sbjct  1    MDFRVCLCLFILG---SSWCCTARELSAL-LQINNLEVPRQVQPPEEVGGNEQLCTLCEE  56

Query  743  F----VTTYSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSS  576
            +    +   ++ + Q E+I+ LH  C  +        + Q+C+  VD   P  F  I+  
Sbjct  57   YTAKALKYMANYKTQTEIIDHLHESCLKMS------FYKQECVVLVDYYAPLFFSEINKI  110

Query  575  TPETICKLF--CEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLVVTYSDKQK----QSQ  414
             PE  C+ F  CE VV++SQ          +SG    C  C Q+V     K K    Q +
Sbjct  111  RPEDFCEKFDLCERVVTVSQV---------LSGQ--SCDLCHQVVTEAESKLKDPDTQLE  159

Query  413  IINALHSFCQIN--FPFPQQC---INQFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVS  252
            I+  L   C+     P+ ++C   I ++ P IL N  + +  +    +C + + CE A  
Sbjct  160  ILELLLKACEAVKLKPYARKCKKLIFEYAPVILVNAEQFLEKN---DVCAILHDCEPAAD  216

Query  251  ISQQSARNLFSNM  213
               Q++  + +++
Sbjct  217  KELQASPKMQASL  229


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 6/66 (9%)
 Frame = -3

Query  288  LQIVQFL*RSCFH-----FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLG  124
            L+I++ L ++C       ++ KCKKL+FEYAP ILVNAEQF   ND+C +LH  + P   
Sbjct  158  LEILELLLKACEAVKLKPYARKCKKLIFEYAPVILVNAEQFLEKNDVCAILHDCE-PAAD  216

Query  123  IEHSAS  106
             E  AS
Sbjct  217  KELQAS  222



>ref|XP_006602698.1| PREDICTED: uncharacterized protein LOC100802366 isoform X2 [Glycine 
max]
Length=236

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 100/219 (46%), Gaps = 39/219 (18%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT---YSDEQK-QRELINSLH  687
            ++W C A++LA ++        SE  ++  +C  C+E++T    Y  E K + E+I+ LH
Sbjct  39   AAWACDARELANSE-------TSELSIKPDVCALCEEYITKALDYLHENKTETEIISILH  91

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVSISQYAE  513
            N C  +      P++ Q+C+  VD  +P  F  +++  P   C     C+ +  IS    
Sbjct  92   NTCHQL------PSFKQKCVALVDYYVPLFFSEVATIQPGEFCHKVNLCQDIAHIS----  141

Query  512  STEKQVQVSGNEDQCLKCKQLVVTYSDKQKQS----QIINALHSFCQINFPFPQQC---I  354
                   +   ED C  CK  V T  +K K+S    +II  L   C     +  +C   +
Sbjct  142  -------LKVQEDSCEFCKDTVSTLLEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMV  194

Query  353  NQFEPILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
             ++ P++ +  + I  +T   +C + + C+ +    QQ+
Sbjct  195  FEYGPLIFDHAEKILETT--DICNIIHACKSSDVAGQQA  231



>ref|XP_009774594.1| PREDICTED: prosaposin-like [Nicotiana sylvestris]
Length=238

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = -3

Query  312  QLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVS  142
            +L N    L I++ L ++C     ++ KCKK+VFEYAP ILVNAE F   ND+CT+LH  
Sbjct  158  KLKNPDTQLDILELLLKACGSVEKYANKCKKMVFEYAPVILVNAEHFLEKNDVCTILHAC  217

Query  141  DSPTLGIEH  115
            + P +G E 
Sbjct  218  E-PAVGKEE  225


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 65/249 (26%), Positives = 111/249 (45%), Gaps = 59/249 (24%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAADLKT-QSLDVSE---------------KQVE  771
            MD ++C  +++    + + CC+A++LAA DL   ++ DVS                K VE
Sbjct  1    MDVKVCLCLLI----LGAVCCTARELAAPDLLIKETTDVSALWISNLQAQKQLQSLKDVE  56

Query  770  GSLCVQCKEFVTT----YSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLP  603
            G LC  C+E+  +     S+ + Q ++++ L N C  +      P +  +C   VDQ + 
Sbjct  57   G-LCTLCEEYTASALGYLSNNETQTKILDLLLNTCSKM------PIYKLKCTALVDQYVR  109

Query  602  NIFEMISSSTPETICKL--FCEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLV----VT  441
              F +IS+  P+ IC+    C+ VVSISQ         Q S N   C  C Q+V    + 
Sbjct  110  PFFLVISTIKPDDICQKVDLCQKVVSISQ---------QFSQN--GCDLCHQVVKETLLK  158

Query  440  YSDKQKQSQIINALHSFCQINFPFPQQC---INQFEPILTNLFKLINSS---TPESLCKL  279
              +   Q  I+  L   C     +  +C   + ++ P++     L+N+        +C +
Sbjct  159  LKNPDTQLDILELLLKACGSVEKYANKCKKMVFEYAPVI-----LVNAEHFLEKNDVCTI  213

Query  278  FNFCEGAVS  252
             + CE AV 
Sbjct  214  LHACEPAVG  222



>ref|XP_010937982.1| PREDICTED: prosaposin-like [Elaeis guineensis]
 ref|XP_010937983.1| PREDICTED: prosaposin-like [Elaeis guineensis]
 ref|XP_010937984.1| PREDICTED: prosaposin-like [Elaeis guineensis]
Length=227

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/226 (26%), Positives = 100/226 (44%), Gaps = 36/226 (16%)
 Frame = -1

Query  860  AISSWCCSAKDLAAADLKTQSLDVSEKQVEGS------LCVQCKEFVT----TYSDEQKQ  711
            A +S C +A+DL   D+   +   SE ++  S      LC  C+EF +     + + + Q
Sbjct  14   ASTSACANARDLLTLDIMVDNKIQSESRMSESIARNQELCTICEEFTSQATYYFGENETQ  73

Query  710  RELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVS  531
             E+IN+LH+ C  +       ++ +QC+  VD   P  F  I++  PE  C     G V+
Sbjct  74   TEIINTLHHACSRLH------SFEKQCVLLVDYYAPLFFMEIATIHPEQFC-----GKVN  122

Query  530  ISQYAESTEKQVQVSGNEDQCLKCKQLVV----TYSDKQKQSQIINALHSFCQINFPFPQ  363
            + +    T     +   +D C  C   VV       D   Q +I+  L   C     F Q
Sbjct  123  LCEKTVLT----PLPKRDDACTICHHAVVEILTKLKDPDTQFEILEMLLKVCNKVENFVQ  178

Query  362  QC---INQFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
            QC   + Q+ P I+ NL K + ++    +C L + C+ +  +  +S
Sbjct  179  QCKRLVFQYSPLIMVNLEKFLETT---DVCTLIHACKASQEVVARS  221



>ref|XP_006602699.1| PREDICTED: uncharacterized protein LOC100802366 isoform X3 [Glycine 
max]
Length=229

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/219 (25%), Positives = 100/219 (46%), Gaps = 39/219 (18%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT---YSDEQK-QRELINSLH  687
            ++W C A++LA ++        SE  ++  +C  C+E++T    Y  E K + E+I+ LH
Sbjct  32   AAWACDARELANSE-------TSELSIKPDVCALCEEYITKALDYLHENKTETEIISILH  84

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVSISQYAE  513
            N C  +      P++ Q+C+  VD  +P  F  +++  P   C     C+ +  IS    
Sbjct  85   NTCHQL------PSFKQKCVALVDYYVPLFFSEVATIQPGEFCHKVNLCQDIAHIS----  134

Query  512  STEKQVQVSGNEDQCLKCKQLVVTYSDKQKQS----QIINALHSFCQINFPFPQQC---I  354
                   +   ED C  CK  V T  +K K+S    +II  L   C     +  +C   +
Sbjct  135  -------LKVQEDSCEFCKDTVSTLLEKLKESDTKLEIIETLLKVCNSVEKYANKCKRMV  187

Query  353  NQFEPILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
             ++ P++ +  + I  +T   +C + + C+ +    QQ+
Sbjct  188  FEYGPLIFDHAEKILETT--DICNIIHACKSSDVAGQQA  224



>ref|XP_009371991.1| PREDICTED: prosaposin [Pyrus x bretschneideri]
 ref|XP_009371992.1| PREDICTED: prosaposin [Pyrus x bretschneideri]
Length=230

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGI-  121
            L+I++ L ++C    +++ KCK+LVFEY P IL NAEQF  T DICT LH  +S    I 
Sbjct  162  LEIIELLLKACNSVENYTKKCKRLVFEYGPLILANAEQFLETTDICTALHACNSNKASIT  221

Query  120  EH  115
            EH
Sbjct  222  EH  223



>ref|XP_008388326.1| PREDICTED: proactivator polypeptide-like 1 [Malus domestica]
 ref|XP_008388327.1| PREDICTED: proactivator polypeptide-like 1 [Malus domestica]
Length=230

 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 4/62 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGI-  121
            L+I++ L ++C    +++ KCK+LVFEY P IL NAEQF  T DICT LH  +S    I 
Sbjct  162  LEIIELLLKACNSVENYTKKCKRLVFEYGPLILTNAEQFLETTDICTALHACNSNKASIT  221

Query  120  EH  115
            EH
Sbjct  222  EH  223



>ref|XP_006403887.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
 ref|XP_006403888.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
 gb|ESQ45340.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
 gb|ESQ45341.1| hypothetical protein EUTSA_v10010716mg [Eutrema salsugineum]
Length=213

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C  F+    KCKKLVFEY P ILVNAE+F V NDICTLL  
Sbjct  147  LDIVELLLKGCKSFNNYEKKCKKLVFEYGPLILVNAEEFLVKNDICTLLRA  197



>dbj|BAJ33968.1| unnamed protein product [Thellungiella halophila]
Length=213

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C  F+    KCKKLVFEY P ILVNAE+F V NDICTLL  
Sbjct  147  LDIVELLLKGCKSFNNYEKKCKKLVFEYGPLILVNAEEFLVKNDICTLLRA  197



>ref|XP_006481164.1| PREDICTED: uncharacterized protein LOC102619717 [Citrus sinensis]
Length=237

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L+I++ L ++C     F+ KCKKLVFEY P IL N EQF  T DICT+LH   S T
Sbjct  163  LEIIEVLLKACNSVDKFAKKCKKLVFEYGPLILANTEQFLETTDICTILHACKSST  218



>gb|AFK37011.1| unknown [Lotus japonicus]
Length=216

 Score = 58.9 bits (141),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 108/229 (47%), Gaps = 44/229 (19%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT----YSDEQKQRELINSLH  687
            ++W C A++LA  +L  +S           +C  C+E+         D + Q E+I++LH
Sbjct  15   TAWACDARELANPELNRKS----------DVCALCEEYTVEALDYLKDNKTQSEIIDALH  64

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAEST  507
            N C  + +      + QQCI  VD  +P  F  ++S  PE +CK      V + Q A+ +
Sbjct  65   NTCNQLFS------FKQQCIELVDNYVPLFFIELASVQPEELCK-----TVFLCQSAKLS  113

Query  506  EKQVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQ-INFPFPQQC---IN  351
              QV+    E+ C  CK     L+V  +D   + +I+ +L   C  +     ++C   + 
Sbjct  114  -SQVR----ENSCGFCKDAVSALLVKLNDPDIKLEIMESLLKACNSMEKKLAKECKRMVF  168

Query  350  QFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQSARNLFSNMPL  207
            ++ P +L N  K + ++    +C   + C  + ++SQ+++  +   +PL
Sbjct  169  EYGPFVLMNAEKFLKTT---GICTALHACPASTAVSQEAS--IMGEIPL  212



>gb|AFK49521.1| unknown [Lotus japonicus]
Length=216

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 57/229 (25%), Positives = 108/229 (47%), Gaps = 44/229 (19%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT----YSDEQKQRELINSLH  687
            ++W C A++LA  +L  +S           +C  C+E+         D + Q E+I++LH
Sbjct  15   AAWACDARELANPELNRKS----------DVCALCEEYTVEALDYLKDNKTQSEIIDALH  64

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAEST  507
            N C  + +      + QQCI  VD  +P  F  ++S  PE +CK      V + Q A+ +
Sbjct  65   NTCNQLFS------FKQQCIELVDNYVPLFFIELASVQPEELCK-----TVFLCQSAKLS  113

Query  506  EKQVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQ-INFPFPQQC---IN  351
              QV+    E+ C  CK     L+V  +D   + +I+ +L   C  +     ++C   + 
Sbjct  114  -SQVR----ENSCGFCKDAVSALLVKLNDPDIKLEIMESLLKACNSMEKKLAKECKRMVF  168

Query  350  QFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQSARNLFSNMPL  207
            ++ P +L N  K + ++    +C   + C  + ++SQ+++  +   +PL
Sbjct  169  EYGPFVLMNAEKFLKTT---GICTALHACPASTAVSQEAS--IMGEIPL  212



>ref|XP_006429547.1| hypothetical protein CICLE_v10011064mg [Citrus clementina]
 gb|ESR42787.1| hypothetical protein CICLE_v10011064mg [Citrus clementina]
Length=836

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L+I++ L ++C     F+ KCKKLVFEY P IL N EQF  T DICT+LH   S T
Sbjct  762  LEIIEVLLKACNSVDKFAKKCKKLVFEYGPLILANTEQFLETTDICTILHACKSST  817



>ref|XP_006293287.1| hypothetical protein CARUB_v10019623mg [Capsella rubella]
 gb|EOA26185.1| hypothetical protein CARUB_v10019623mg [Capsella rubella]
Length=213

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C  F     KCKKLVFEY P ILVNAE+F V NDICTLL  
Sbjct  147  LDIVEMLLKGCKSFKNYEKKCKKLVFEYGPLILVNAEEFLVKNDICTLLRA  197



>ref|XP_009599219.1| PREDICTED: prosaposin-like [Nicotiana tomentosiformis]
 ref|XP_009599220.1| PREDICTED: prosaposin-like [Nicotiana tomentosiformis]
Length=238

 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 4/69 (6%)
 Frame = -3

Query  312  QLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVS  142
            +L N    L I++ L ++C     ++ KCKK+VFEYAP ILVNAE F   ND+C +LH  
Sbjct  158  KLKNPDTQLDILELLLKACGSVEKYANKCKKMVFEYAPVILVNAEHFLEKNDVCAILHAC  217

Query  141  DSPTLGIEH  115
            + P +G E 
Sbjct  218  E-PAVGKEE  225


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 62/249 (25%), Positives = 112/249 (45%), Gaps = 59/249 (24%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAADLKT-QSLDVSE---------------KQVE  771
            MD ++C  +++    + + CC+A++LAA DL   ++ DVS                K VE
Sbjct  1    MDVKVCLCLLI----LGAVCCTARELAAPDLLIKETTDVSALWISNLQAQKQLQPLKDVE  56

Query  770  GSLCVQCKEFVTT----YSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLP  603
            G LC  C+E+  +     S+ + Q ++++ L N C  +      P +  +C   VDQ + 
Sbjct  57   G-LCTLCEEYTASALGYLSNNETQTKILDLLLNTCSKM------PIYKLKCTALVDQYVR  109

Query  602  NIFEMISSSTPETICKL--FCEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLV----VT  441
              F +IS+  P+ IC+    C+ VVSIS+Y            +++ C  C Q+V    + 
Sbjct  110  PFFLVISTIKPDDICQKVDLCQKVVSISRY-----------FSQNGCDLCHQVVNETLLK  158

Query  440  YSDKQKQSQIINALHSFCQINFPFPQQC---INQFEPILTNLFKLINSS---TPESLCKL  279
              +   Q  I+  L   C     +  +C   + ++ P++     L+N+        +C +
Sbjct  159  LKNPDTQLDILELLLKACGSVEKYANKCKKMVFEYAPVI-----LVNAEHFLEKNDVCAI  213

Query  278  FNFCEGAVS  252
             + CE AV 
Sbjct  214  LHACEPAVG  222



>ref|XP_002323058.1| saposin B domain-containing family protein [Populus trichocarpa]
 gb|EEF04819.1| saposin B domain-containing family protein [Populus trichocarpa]
Length=242

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C     ++ KCK++VFEY P IL NAEQF  T D+CT+LH        +E
Sbjct  173  LEIIELLLKACNSMEKYAHKCKRMVFEYGPVILANAEQFLETTDLCTVLHACKESEDSME  232

Query  117  HSAS  106
             +++
Sbjct  233  QASA  236



>ref|XP_010503867.1| PREDICTED: prosaposin-like isoform X2 [Camelina sativa]
Length=217

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L IV+ L + C  F     KCK LVFEY P ILVNAE+F V NDICTLL    + T
Sbjct  151  LDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEFLVKNDICTLLRACPAET  206



>ref|XP_010503866.1| PREDICTED: prosaposin-like isoform X1 [Camelina sativa]
Length=218

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L IV+ L + C  F     KCK LVFEY P ILVNAE+F V NDICTLL    + T
Sbjct  152  LDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEFLVKNDICTLLRACPAET  207



>ref|XP_010042407.1| PREDICTED: prosaposin-like [Eucalyptus grandis]
 gb|KCW88298.1| hypothetical protein EUGRSUZ_A00687 [Eucalyptus grandis]
Length=219

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            D+L +    + I+Q L ++C    +++ KCKK+VFEY P +L NAEQF   ND+CT LH 
Sbjct  138  DKLKDPDTQMDIIQILLKACNSMENYAKKCKKMVFEYGPLVLANAEQFLEANDVCTTLHA  197



>ref|XP_009136631.1| PREDICTED: prosaposin-like [Brassica rapa]
Length=215

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = -3

Query  288  LQIVQFL*RSC-----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L +++ L + C     + +  KCKKLVFEY P ILVNAE+F V NDICTLL  
Sbjct  147  LDVIELLLKGCKSFKNYEYEKKCKKLVFEYGPLILVNAEEFLVKNDICTLLRA  199



>ref|XP_009590656.1| PREDICTED: prosaposin-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009590657.1| PREDICTED: prosaposin-like isoform X1 [Nicotiana tomentosiformis]
Length=245

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/264 (26%), Positives = 121/264 (46%), Gaps = 57/264 (22%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAAD-----------LKTQSLDVSE-----KQVE  771
            MD R+C  + ++    SSWCC+A++L+A +           L+  +L+V       ++V 
Sbjct  1    MDFRVCLCLFILG---SSWCCTARELSARNHLITETEYISVLQINNLEVPRQVQPPEEVG  57

Query  770  GS--LCVQCKEF----VTTYSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQT  609
            G+  LC  C+E+    +   ++ + Q E+I+ LH  C  +        + Q+C+  VD  
Sbjct  58   GNEQLCTLCEEYTAKALKYMANYKTQTEIIDHLHESCLKMS------FYKQECVVLVDYY  111

Query  608  LPNIFEMISSSTPETICKLF--CEGVVSISQYAESTEKQVQVSGNEDQCLKCKQLVVTYS  435
             P  F  I+   PE  C+ F  CE VV++SQ          +SG    C  C Q+V    
Sbjct  112  APLFFSEINKIRPEDFCEKFDLCERVVTVSQV---------LSGQ--SCDLCHQVVTEAE  160

Query  434  DKQK----QSQIINALHSFCQIN--FPFPQQC---INQFEP-ILTNLFKLINSSTPESLC  285
             K K    Q +I+  L   C+     P+ ++C   I ++ P IL N  + +  +    +C
Sbjct  161  SKLKDPDTQLEILELLLKACEAVKLKPYARKCKKLIFEYAPVILVNAEQFLEKN---DVC  217

Query  284  KLFNFCEGAVSISQQSARNLFSNM  213
             + + CE A     Q++  + +++
Sbjct  218  AILHDCEPAADKELQASPKMQASL  241


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 6/66 (9%)
 Frame = -3

Query  288  LQIVQFL*RSCFH-----FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLG  124
            L+I++ L ++C       ++ KCKKL+FEYAP ILVNAEQF   ND+C +LH  + P   
Sbjct  170  LEILELLLKACEAVKLKPYARKCKKLIFEYAPVILVNAEQFLEKNDVCAILHDCE-PAAD  228

Query  123  IEHSAS  106
             E  AS
Sbjct  229  KELQAS  234



>ref|XP_010503868.1| PREDICTED: prosaposin-like isoform X3 [Camelina sativa]
Length=217

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L IV+ L + C  F     KCK LVFEY P ILVNAE+F V NDICTLL    + T
Sbjct  151  LDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEFLVENDICTLLRACPAET  206



>emb|CDY67661.1| BnaA03g57960D [Brassica napus]
Length=215

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = -3

Query  288  LQIVQFL*RSC-----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L +++ L + C     + +  KCKKLVFEY P ILVNAE+F V NDICTLL  
Sbjct  147  LDVIELLLKGCKSFKNYEYEKKCKKLVFEYGPLILVNAEEFLVKNDICTLLRA  199


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 49/93 (53%), Gaps = 4/93 (4%)
 Frame = -1

Query  494  QVSGNEDQCLKCKQLV---VTYSDK-QKQSQIINALHSFCQINFPFPQQCINQFEPILTN  327
            +V+ NE+ C  C++ V   +TY +K + Q+QI+  LH  C +   F QQCI   +  L  
Sbjct  32   EVTKNENVCTLCEEYVTSALTYLEKNETQTQILEDLHDRCSLIRGFEQQCITLVDYYLPL  91

Query  326  LFKLINSSTPESLCKLFNFCEGAVSISQQSARN  228
             F  + S  P   CK  N C   V++ +++ ++
Sbjct  92   FFLHLESFQPHYFCKRMNLCGHVVALVEEARQD  124



>ref|XP_010515602.1| PREDICTED: prosaposin-like isoform X2 [Camelina sativa]
Length=217

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L IV+ L + C  F     KCK LVFEY P ILVNAE+F V NDICTLL    + T
Sbjct  151  LDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEFLVKNDICTLLRACPAET  206



>emb|CDY29042.1| BnaC07g32480D [Brassica napus]
Length=216

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 5/53 (9%)
 Frame = -3

Query  288  LQIVQFL*RSC-----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L +++ L + C     + +  KCKKLVFEY P ILVNAE+F V NDICTLL  
Sbjct  148  LDVIELLLKGCKSFKNYEYEKKCKKLVFEYGPLILVNAEEFLVKNDICTLLRA  200



>ref|XP_010515601.1| PREDICTED: prosaposin-like isoform X1 [Camelina sativa]
Length=218

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L IV+ L + C  F     KCK LVFEY P ILVNAE+F V NDICTLL    + T
Sbjct  152  LDIVELLLKGCKSFKNYEKKCKTLVFEYGPLILVNAEEFLVKNDICTLLRACPAET  207



>ref|XP_007207246.1| hypothetical protein PRUPE_ppa009037m1g [Prunus persica]
 gb|EMJ08445.1| hypothetical protein PRUPE_ppa009037m1g [Prunus persica]
Length=253

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C    +++ KCK++VFEY P  L NAEQF  T DICT LH  +S     E
Sbjct  167  LEIIELLLKACNSVENYAKKCKRIVFEYGPLFLANAEQFLETTDICTTLHACNSSVASTE  226

Query  117  HSA  109
             ++
Sbjct  227  EAS  229



>gb|KFK34416.1| hypothetical protein AALP_AA5G141700 [Arabis alpina]
Length=213

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C    ++  KCKKLVFEY P ILVNAE++ V NDICTLL  
Sbjct  147  LDIVELLIKGCKSLKNYEKKCKKLVFEYGPLILVNAEEYLVKNDICTLLRA  197



>ref|XP_008245127.1| PREDICTED: proactivator polypeptide-like 1 [Prunus mume]
 ref|XP_008245133.1| PREDICTED: proactivator polypeptide-like 1 [Prunus mume]
Length=240

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C    +++ KCK++VFEY P  L NAEQF  T DICT LH  +S     E
Sbjct  167  LEIIELLLKACNSVENYAKKCKRIVFEYGPLFLANAEQFLETTDICTTLHACNSSVASTE  226

Query  117  HSA  109
             ++
Sbjct  227  EAS  229



>gb|KHG03118.1| Proactivator polypeptide [Gossypium arboreum]
Length=233

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 105/244 (43%), Gaps = 44/244 (18%)
 Frame = -1

Query  917  LSEAGMDRRLCFvvvlvvLAISSWCCSAKDLAAADLKTQSLDV-------SEKQVEG---  768
            LS+  MD RL  + + V+ A  SW C A+ L AA +      V        E+ VE    
Sbjct  2    LSKGIMDVRLGLLFLFVLSA--SWVCDARQLEAAPVVLSGASVVQTNQGQDEEVVENIVW  59

Query  767  --SLCVQCKEFVTT----YSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTL  606
              ++C  C+EF T      S  + Q E++  LH  C  I      P++ QQCI  VD  +
Sbjct  60   KDNVCTVCEEFATEAINFLSQNKTQTEIVEVLHKSCSRI------PSFEQQCITLVDYYV  113

Query  605  PNIFEMISSSTPETICKLFCEGVVSISQYAESTEKQVQVSGNEDQCLKCK----QLVVTY  438
            P  F  IS   PE +CK      V++ Q       Q++    ED C  C     +++   
Sbjct  114  PLFFVEISLIQPEVLCK-----EVNLCQKFALISTQIR----EDCCGVCHHAVSEVLTKL  164

Query  437  SDKQKQSQIINALHSFCQINFPFPQQC---INQFEP-ILTNLFKLINSSTPESLCKLFNF  270
             D   Q +II  L   C     + ++C   + ++ P IL N    + ++    +C + + 
Sbjct  165  KDPDTQLEIIELLLKGCDSVQNYVKKCKSLVFEYGPLILANTENFLETT---DVCTILHA  221

Query  269  CEGA  258
            C GA
Sbjct  222  CNGA  225


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 33/55 (60%), Gaps = 3/55 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSP  133
            L+I++ L + C    ++  KCK LVFEY P IL N E F  T D+CT+LH  +  
Sbjct  171  LEIIELLLKGCDSVQNYVKKCKSLVFEYGPLILANTENFLETTDVCTILHACNGA  225



>ref|XP_007140107.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
 gb|ESW12101.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
Length=222

 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 47/177 (27%), Positives = 77/177 (44%), Gaps = 26/177 (15%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLK---TQSLDVSEKQVEGSLCVQCKEFVTTYSDEQKQ----RELIN  696
            ++W C A+++   D     T +  +SE + +  +C  C+E+ T   +  KQ     E+I+
Sbjct  15   AAWACDAREVPNLDQMRNYTANTGISELKTKLDMCALCEEYTTKALEYIKQNMTDEEIID  74

Query  695  SLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYA  516
            +LHN C  +      P++ Q+CI  VD   P     ++S  P   C       + I Q  
Sbjct  75   TLHNTCHLL------PSFKQKCIALVDYYTPIFLSEVASLKPREFCH-----KIDICQLT  123

Query  515  ESTEKQVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQINFPFPQQC  357
            E    QVQ    ED C  C++    L+V   D   + +II  L   C     +  +C
Sbjct  124  EHISLQVQ----EDACEFCEETVSTLLVKLKDSDTKLEIIETLLKLCNAVEKYANKC  176



>ref|XP_007207245.1| hypothetical protein PRUPE_ppa009037m1g, partial [Prunus persica]
 gb|EMJ08444.1| hypothetical protein PRUPE_ppa009037m1g, partial [Prunus persica]
Length=290

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 40/63 (63%), Gaps = 3/63 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C    +++ KCK++VFEY P  L NAEQF  T DICT LH  +S     E
Sbjct  204  LEIIELLLKACNSVENYAKKCKRIVFEYGPLFLANAEQFLETTDICTTLHACNSSVASTE  263

Query  117  HSA  109
             ++
Sbjct  264  EAS  266



>ref|XP_010426757.1| PREDICTED: proactivator polypeptide-like 1 [Camelina sativa]
Length=217

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHF---STKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C  F   + KCK LVFEY P ILVNAE+F V NDICTLL  
Sbjct  151  LDIVELLLKGCKSFKNYAKKCKTLVFEYGPLILVNAEEFLVKNDICTLLRA  201



>ref|XP_010529095.1| PREDICTED: proactivator polypeptide-like 1 [Tarenaya hassleriana]
Length=210

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -3

Query  291  SLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
             L I+  L + C    ++  +CKKLVFEY P ILVNAE+F V ND+CT+LH 
Sbjct  144  QLDIIGILLKGCKSLKNYEKQCKKLVFEYGPLILVNAEEFLVKNDVCTILHA  195



>emb|CDP06403.1| unnamed protein product [Coffea canephora]
Length=294

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 5/66 (8%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFS---TKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDS--PTLG  124
            L+IV+ L ++C        KCK++VFEY P ILVNAEQF  T DICT+LH  +S  PT  
Sbjct  221  LEIVEALLKACDAVQGHVNKCKRMVFEYVPVILVNAEQFLETKDICTMLHACESAAPTAQ  280

Query  123  IEHSAS  106
            +  S S
Sbjct  281  VLSSTS  286



>ref|XP_007140108.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
 gb|ESW12102.1| hypothetical protein PHAVU_008G084800g [Phaseolus vulgaris]
Length=219

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 74/174 (43%), Gaps = 23/174 (13%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTTYSDEQKQ----RELINSLH  687
            ++W C A+++   D        +E + +  +C  C+E+ T   +  KQ     E+I++LH
Sbjct  15   AAWACDAREVPNLDQMRNYTANTELKTKLDMCALCEEYTTKALEYIKQNMTDEEIIDTLH  74

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAEST  507
            N C  +      P++ Q+CI  VD   P     ++S  P   C       + I Q  E  
Sbjct  75   NTCHLL------PSFKQKCIALVDYYTPIFLSEVASLKPREFCH-----KIDICQLTEHI  123

Query  506  EKQVQVSGNEDQCLKCKQ----LVVTYSDKQKQSQIINALHSFCQINFPFPQQC  357
              QVQ    ED C  C++    L+V   D   + +II  L   C     +  +C
Sbjct  124  SLQVQ----EDACEFCEETVSTLLVKLKDSDTKLEIIETLLKLCNAVEKYANKC  173



>dbj|BAB39899.1| P0028E10.2 [Oryza sativa Japonica Group]
Length=240

 Score = 43.9 bits (102),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L+IV+   ++C    ++  +CKK+V EY P ILV +++F  T D+C+ +H   + T
Sbjct  172  LEIVEIFLKACSKADNYVQQCKKMVLEYTPLILVKSQKFLETTDVCSTIHACKTGT  227


 Score = 34.3 bits (77),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 16/55 (29%), Positives = 27/55 (49%), Gaps = 0/55 (0%)
 Frame = -1

Query  428  QKQSQIINALHSFCQINFPFPQQCINQFEPILTNLFKLINSSTPESLCKLFNFCE  264
            + Q++I++ LH  C    P  QQCI   +  +   F  ++  TPE  C+  + C 
Sbjct  83   ETQTEILSILHHACANVGPLKQQCITLVDYYIPLFFLEVSMVTPEKFCESVHLCR  137



>ref|XP_006643789.1| PREDICTED: proactivator polypeptide-like 1-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006643790.1| PREDICTED: proactivator polypeptide-like 1-like isoform X2 [Oryza 
brachyantha]
 ref|XP_006643791.1| PREDICTED: proactivator polypeptide-like 1-like isoform X3 [Oryza 
brachyantha]
Length=225

 Score = 43.9 bits (102),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/60 (37%), Positives = 36/60 (60%), Gaps = 3/60 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+IV  L ++C    ++  +CKK+V EY P ILV +++F  T D+C+ +H   + T   E
Sbjct  158  LEIVDILLKACGKADNYVQQCKKMVLEYIPLILVKSQKFLETTDVCSEIHACKTGTQASE  217


 Score = 34.3 bits (77),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/97 (23%), Positives = 41/97 (42%), Gaps = 4/97 (4%)
 Frame = -1

Query  542  GVVSISQYAESTEKQVQVSGNEDQCLKCKQL----VVTYSDKQKQSQIINALHSFCQINF  375
            GV++   +  + ++    S N   C  C+Q     +      + Q++I++ LH  C    
Sbjct  27   GVLAQKSFPLANKRAGLTSANGKLCQLCEQYSTEALFYLQQNETQTEILSILHHACANVG  86

Query  374  PFPQQCINQFEPILTNLFKLINSSTPESLCKLFNFCE  264
            P  QQCI   +  +   F  ++   PE  C+  + C 
Sbjct  87   PLKQQCITLVDYYIPLFFLEVSVVQPEKFCESVHLCR  123



>gb|EAY72679.1| hypothetical protein OsI_00546 [Oryza sativa Indica Group]
Length=262

 Score = 43.5 bits (101),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L+IV+   ++C    ++  +CKK+V EY P ILV +++F  T D+C+ +H   + T
Sbjct  194  LEIVEIFLKACSKADNYVQQCKKMVLEYTPLILVKSQKFLETTDVCSTIHACKTGT  249


 Score = 34.3 bits (77),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/96 (24%), Positives = 40/96 (42%), Gaps = 4/96 (4%)
 Frame = -1

Query  539  VVSISQYAESTEKQVQVSGNEDQCLKCKQL----VVTYSDKQKQSQIINALHSFCQINFP  372
            V++   +    +K    S N   C  C+Q     +      + Q++I++ LH  C    P
Sbjct  64   VLAHKSFPLENKKTGLTSANGKLCQLCEQYSTEALFYLQQNETQTEILSILHHACANVGP  123

Query  371  FPQQCINQFEPILTNLFKLINSSTPESLCKLFNFCE  264
              QQCI   +  +   F  ++  TPE  C+  + C 
Sbjct  124  LKQQCITLVDYYIPLFFLEVSVVTPEKFCESVHLCR  159



>ref|NP_001042117.2| Os01g0166700 [Oryza sativa Japonica Group]
 dbj|BAD68299.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ10680.1| hypothetical protein OsJ_00511 [Oryza sativa Japonica Group]
 dbj|BAG90610.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF04031.2| Os01g0166700 [Oryza sativa Japonica Group]
Length=226

 Score = 43.5 bits (101),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            L+IV+   ++C    ++  +CKK+V EY P ILV +++F  T D+C+ +H   + T
Sbjct  158  LEIVEIFLKACSKADNYVQQCKKMVLEYTPLILVKSQKFLETTDVCSTIHACKTGT  213


 Score = 34.3 bits (77),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 21/79 (27%), Positives = 34/79 (43%), Gaps = 4/79 (5%)
 Frame = -1

Query  488  SGNEDQCLKCKQL----VVTYSDKQKQSQIINALHSFCQINFPFPQQCINQFEPILTNLF  321
            S N   C  C+Q     +      + Q++I++ LH  C    P  QQCI   +  +   F
Sbjct  45   SANGKLCQLCEQYSTEALFYLQQNETQTEILSILHHACANVGPLKQQCITLVDYYIPLFF  104

Query  320  KLINSSTPESLCKLFNFCE  264
              ++  TPE  C+  + C 
Sbjct  105  LEVSMVTPEKFCESVHLCR  123



>ref|XP_002876101.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52360.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=213

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C    ++  KCK LVFEY P ILVNAE+F V ND+CTLL  
Sbjct  147  LDIVELLLKGCKSLKNYEKKCKTLVFEYGPLILVNAEEFLVKNDVCTLLRA  197



>ref|NP_190741.1| saposin B domain-containing protein [Arabidopsis thaliana]
 emb|CAB63159.1| putative protein [Arabidopsis thaliana]
 gb|AAM67054.1| unknown [Arabidopsis thaliana]
 gb|AAM78109.1| AT3g51730/T18N14_110 [Arabidopsis thaliana]
 gb|AAN28760.1| At3g51730/T18N14_110 [Arabidopsis thaliana]
 gb|AEE78831.1| saposin B domain-containing protein [Arabidopsis thaliana]
Length=213

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C    ++  KCK LVFEY P ILVNAE+F V ND+CTLL  
Sbjct  147  LDIVELLIKGCKSLKNYEKKCKTLVFEYGPLILVNAEEFLVKNDVCTLLRA  197



>gb|KDO49655.1| hypothetical protein CISIN_1g0286131mg, partial [Citrus sinensis]
Length=55

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = -3

Query  237  CKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPT  130
            CKKLVFEY P IL N EQF  T DICT+LH   S T
Sbjct  1    CKKLVFEYGPLILANTEQFLETTDICTILHACKSST  36



>ref|NP_001138322.1| proactivator polypeptide-like 1 precursor [Rattus norvegicus]
 gb|EDM00050.1| rCG35862 [Rattus norvegicus]
Length=527

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 66/140 (47%), Gaps = 16/140 (11%)
 Frame = -1

Query  638  QQCINNVDQTLPNIFEMISSSTPETICKL--FCEG---VVSISQYAESTEKQVQVSGNED  474
            QQCI  VD   PN+ +++S  TPE +C+    C       SIS+ A +T   +    N+ 
Sbjct  340  QQCITLVDTYGPNLVQLVSKVTPEKVCETIRLCGSKRQARSISRVATTTPPLLMDEENQG  399

Query  473  Q-CLKCKQLVVTYSD----KQKQSQIINALHSFCQI-NFPFPQQC---INQFEPILTNLF  321
              C  CK+L+   S     K  +  I+NA    C+I   P+  QC   + ++EP+L    
Sbjct  400  SFCQGCKRLLGVSSQNLDRKSTKRDILNAFKGGCRILPLPYVLQCNRFVAEYEPVLIESL  459

Query  320  KLINSSTPESLCKLFNFCEG  261
            + + +  P  LCK    C G
Sbjct  460  RFMMN--PTDLCKKMGACHG  477



>ref|XP_004249637.1| PREDICTED: prosaposin [Solanum lycopersicum]
Length=241

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L I+  L ++C     +S KCKK+VFEYAP IL+NAE F   ND+CT++H 
Sbjct  169  LDILAILLKACGSAEKYSNKCKKMVFEYAPVILINAEHFLEKNDVCTIMHA  219



>gb|KEH29214.1| saposin B domain protein [Medicago truncatula]
Length=215

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/234 (24%), Positives = 102/234 (44%), Gaps = 43/234 (18%)
 Frame = -1

Query  902  MDRRLCFvvvlvvLAISSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT---  732
            M+ ++ F+ ++++ A+  W C A++ A  +L  +             C  C+E+ T    
Sbjct  1    MEGKIGFLFLILLGAV--WACDAREFANPELNRKP----------DACSICEEYTTEILD  48

Query  731  -YSDEQKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICK  555
               D + Q ++I+ LHN C  +      PA+ +QC   VD  +   F  I+   P  +C+
Sbjct  49   YLKDNKTQAKIIDDLHNTCHQL------PAFSEQCFELVDHHVQLFFSKIARMMPAELCE  102

Query  554  LFCEGVVSISQYAESTEKQVQVSGNEDQCLKCK----QLVVTYSDKQKQSQIINALHSFC  387
             +           ES     QV GN   C  CK    +L+V  +D + + +II  L   C
Sbjct  103  KY--------HLCESATISSQVHGN--SCGFCKDTVAELLVELNDPETKLEIIQKLLKAC  152

Query  386  QINFPFPQQC---INQFEP-ILTNLFKLINSSTPESLCKLFNFCEGAVSISQQS  237
                 + ++C   + ++ P IL N  K +  +    +C   + C  +  +SQ++
Sbjct  153  NNMEKYKKECKRMVFEYGPLILVNAEKYLKKA---DICTTLHACPSSTIVSQEA  203


 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 3/57 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCFH---FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTL  127
            L+I+Q L ++C +   +  +CK++VFEY P ILVNAE++    DICT LH   S T+
Sbjct  142  LEIIQKLLKACNNMEKYKKECKRMVFEYGPLILVNAEKYLKKADICTTLHACPSSTI  198



>ref|XP_007033575.1| Saposin B domain-containing protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY04501.1| Saposin B domain-containing protein, putative isoform 2 [Theobroma 
cacao]
Length=228

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -3

Query  294  KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            + L I++ L + C    ++  KCK++VFEY P IL NAEQF  T D+CT+LH
Sbjct  164  QQLDIIELLLKGCDSMQNYVKKCKRIVFEYGPLILTNAEQFLETTDVCTILH  215



>ref|XP_006288609.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
 ref|XP_006288610.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
 gb|EOA21507.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
 gb|EOA21508.1| hypothetical protein CARUB_v10001904mg [Capsella rubella]
Length=223

 Score = 46.6 bits (109),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 38/61 (62%), Gaps = 5/61 (8%)
 Frame = -3

Query  288  LQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV--SDSPTLG  124
            L+I++ L + C    ++  KCKK+VFEY P +LV+ E+F    D+C++L V  S   T G
Sbjct  149  LKIIRLLLKECKSLNNYQDKCKKMVFEYGPLMLVDLEKFLENKDVCSILRVCPSQWATQG  208

Query  123  I  121
            +
Sbjct  209  V  209


 Score = 29.3 bits (64),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 18/70 (26%), Positives = 29/70 (41%), Gaps = 1/70 (1%)
 Frame = -1

Query  470  CLKCKQLVVTY-SDKQKQSQIINALHSFCQINFPFPQQCINQFEPILTNLFKLINSSTPE  294
            C K   L + Y  D   Q  ++ ALH  C    P  +QC++  +      F  ++     
Sbjct  44   CDKYVSLAIDYLQDHDNQDALVQALHISCSQIPPLQKQCLSMVDHYTQLFFTQVSVIKSG  103

Query  293  SLCKLFNFCE  264
             +CK  N C+
Sbjct  104  QICKKLNLCQ  113



>ref|XP_007033574.1| Saposin B domain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY04500.1| Saposin B domain-containing protein, putative isoform 1 [Theobroma 
cacao]
Length=227

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/50 (50%), Positives = 34/50 (68%), Gaps = 3/50 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            L I++ L + C    ++  KCK++VFEY P IL NAEQF  T D+CT+LH
Sbjct  165  LDIIELLLKGCDSMQNYVKKCKRIVFEYGPLILTNAEQFLETTDVCTILH  214



>gb|AHZ31393.1| saposin B domain-containing protein, partial [Sonneratia caseolaris]
Length=107

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +LVNAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|AHZ31401.1| saposin B domain-containing protein, partial [Sonneratia caseolaris]
Length=107

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +LVNAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|ABQ42118.1| saposin B domain-containing protein [Sonneratia caseolaris]
Length=114

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 38/64 (59%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +LVNAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>ref|XP_004302581.1| PREDICTED: proactivator polypeptide-like 1-like [Fragaria vesca 
subsp. vesca]
Length=229

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 41/64 (64%), Gaps = 3/64 (5%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIE  118
            L+I++ L ++C    ++  KCK+LVF+Y P ILVNAE++    DICT LH  +  T+   
Sbjct  156  LEIIEILLKACNSVENYVKKCKRLVFQYGPLILVNAEEYLEKTDICTALHACNPSTVSTM  215

Query  117  HSAS  106
             ++S
Sbjct  216  EASS  219



>ref|XP_006338961.1| PREDICTED: uncharacterized protein LOC102600963 isoform X1 [Solanum 
tuberosum]
 ref|XP_006338962.1| PREDICTED: uncharacterized protein LOC102600963 isoform X2 [Solanum 
tuberosum]
Length=241

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L I+  L ++C     ++ KCKK+VFEYAP IL+NAE F   ND+CT++H 
Sbjct  169  LDILAILLKACGSVEKYANKCKKMVFEYAPVILINAEHFLEKNDVCTIVHA  219



>ref|XP_009387676.1| PREDICTED: proactivator polypeptide-like 1 [Musa acuminata subsp. 
malaccensis]
Length=224

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L++++ L + C    +F+ KCKKLVF+Y P IL NAE F  TND+CT +H 
Sbjct  158  LEVLETLLKGCSKMENFAQKCKKLVFQYGPLILANAENFLETNDVCTAIHA  208



>ref|XP_009115874.1| PREDICTED: prosaposin-like [Brassica rapa]
 ref|XP_009115875.1| PREDICTED: prosaposin-like [Brassica rapa]
 emb|CDX78031.1| BnaA09g32260D [Brassica napus]
 emb|CDX78032.1| BnaA09g32270D [Brassica napus]
Length=214

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C  F     KCKKLVFEY P ILVNA  F V ND+C LL  
Sbjct  148  LDIVELLLKGCKSFKNYEKKCKKLVFEYGPLILVNANDFIVKNDVCKLLRA  198



>ref|XP_003623572.1| Saposin B domain-containing protein [Medicago truncatula]
Length=140

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            D++ +    L+I++ L + C     F +KCKK+V EY P +  NAE+F    DICT LH 
Sbjct  43   DKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKFLEKTDICTALHA  102

Query  144  SDSPTLGIEHS  112
                T+ +E S
Sbjct  103  CKESTVVLEKS  113



>gb|AHZ31397.1| saposin B domain-containing protein, partial [Sonneratia griffithii]
 gb|AHZ31404.1| saposin B domain-containing protein, partial [Sonneratia griffithii]
Length=107

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDAQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|EPS73961.1| hypothetical protein M569_00799 [Genlisea aurea]
Length=243

 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHF---STKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDS  136
            L+IV+ L  +C      ++KCK+LVFEY P ILVNAEQF  T DIC +L V  S
Sbjct  163  LEIVKVLLNACDSVKKSTSKCKRLVFEYVPLILVNAEQFLETRDICGILRVCKS  216



>gb|AHZ31395.1| saposin B domain-containing protein, partial [Sonneratia ovata]
 gb|AHZ31396.1| saposin B domain-containing protein, partial [Sonneratia apetala]
 gb|AHZ31398.1| saposin B domain-containing protein, partial [Sonneratia ovata]
 gb|AHZ31402.1| saposin B domain-containing protein, partial [Sonneratia apetala]
Length=107

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|ABQ42119.1| saposin B domain-containing protein [Sonneratia ovata]
 gb|ABQ42120.1| saposin B domain-containing protein [Sonneratia apetala]
Length=114

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>ref|XP_005319124.1| PREDICTED: proactivator polypeptide-like 1 [Ictidomys tridecemlineatus]
Length=522

 Score = 53.9 bits (128),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/139 (29%), Positives = 63/139 (45%), Gaps = 16/139 (12%)
 Frame = -1

Query  638  QQCINNVDQTLPNIFEMISSSTPETICKL--FCEGVVSISQYAESTEKQVQVSGNEDQ--  471
            Q+CI  VD   P++ +M+S  TPE +CK    C         + +  K+  +  NED   
Sbjct  335  QECITLVDTYSPSLVQMVSRVTPERVCKTIRLCSSRRQARAVSGAHSKEPSLLLNEDGQG  394

Query  470  --CLKCKQLVVTYSD----KQKQSQIINALHSFCQI-NFPFPQQC---INQFEPILTNLF  321
              C  CK+L+   S     K  +  I+ AL   C I   P+  QC   + ++EP+L    
Sbjct  395  SFCNGCKRLLGVSSQNLELKSTKRDILKALKGGCHILPLPYMVQCSRFVTEYEPVLIESL  454

Query  320  KLINSSTPESLCKLFNFCE  264
            K +    PE++C+    C 
Sbjct  455  KEMMD--PEAVCRKMRACH  471



>gb|KHG00690.1| Proactivator polypeptide [Gossypium arboreum]
Length=227

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = -3

Query  252  HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDS  136
            ++  KCK+LVFEY P IL NAE F  T DICT+LH  D 
Sbjct  180  NYVQKCKRLVFEYGPLILANAEHFLETTDICTILHACDG  218



>emb|CDX73698.1| BnaC08g23050D [Brassica napus]
Length=286

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 31/51 (61%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFHFST---KCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L IV+ L + C  F     KCKKLVFEY P ILVNA  F V ND+C LL  
Sbjct  220  LDIVELLLKGCKSFKNYEKKCKKLVFEYGPLILVNANDFLVKNDVCKLLRA  270



>ref|XP_007134685.1| hypothetical protein PHAVU_010G0675000g [Phaseolus vulgaris]
 gb|ESW06679.1| hypothetical protein PHAVU_010G0675000g [Phaseolus vulgaris]
Length=72

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -3

Query  252  HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDSPTLGIEHSAS  106
              + KCK++VFEY P I+V AE++  T DICT LHV  + T    + AS
Sbjct  13   QLAKKCKRMVFEYGPLIIVKAEKYLKTTDICTALHVCPASTAVSNNEAS  61



>gb|AHZ31399.1| saposin B domain-containing protein, partial [Sonneratia caseolaris]
Length=107

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 37/64 (58%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC----FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C      +  KCK++VFEY P +LVN EQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKKCKRMVFEYGPQVLVNVEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|AHZ31394.1| saposin B domain-containing protein, partial [Sonneratia alba]
Length=107

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCFHFSTK----CKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C     K    CK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>ref|XP_006843736.1| hypothetical protein AMTR_s00007p00225690 [Amborella trichopoda]
 gb|ERN05411.1| hypothetical protein AMTR_s00007p00225690 [Amborella trichopoda]
Length=214

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -3

Query  288  LQIVQFL*RSCFH---FSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            L+IV+ L + C     F  KC+ LVFEYAP +L+NAEQF  T DIC  +HV
Sbjct  158  LEIVEILIKECKKAQGFVEKCEDLVFEYAPLLLINAEQFLETKDICASVHV  208



>gb|AHZ31400.1| saposin B domain-containing protein, partial [Sonneratia alba]
 gb|AHZ31403.1| saposin B domain-containing protein, partial [Sonneratia alba]
Length=107

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCFHFSTK----CKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C     K    CK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|ABQ42117.1| saposin B domain-containing protein [Sonneratia alba]
Length=114

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCFHFSTK----CKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C     K    CK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>gb|ACS68697.1| saposin B domain-containing protein [Sonneratia alba]
 gb|ACS68768.1| saposin B domain-containing protein [Sonneratia alba]
Length=114

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/64 (38%), Positives = 36/64 (56%), Gaps = 4/64 (6%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCFHFSTK----CKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            D+L +    +++++ L  +C     K    CK++VFEY P +L NAEQF  T D+C  LH
Sbjct  42   DKLKDPDTQMEVIEVLMNACNSVEKKYVKRCKRMVFEYGPQVLANAEQFLETKDLCAALH  101

Query  147  VSDS  136
               S
Sbjct  102  ACKS  105



>ref|XP_003623571.1| Saposin B domain-containing protein [Medicago truncatula]
Length=247

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            D++ +    L+I++ L + C     F +KCKK+V EY P +  NAE+F    DICT LH 
Sbjct  150  DKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKFLEKTDICTALHA  209

Query  144  SDSPTLGIEHS  112
                T+ +E S
Sbjct  210  CKESTVVLEKS  220



>gb|AAI19541.2| Psapl1 protein, partial [Mus musculus]
Length=479

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 65/142 (46%), Gaps = 20/142 (14%)
 Frame = -1

Query  638  QQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAESTEKQVQVSGN-----ED  474
            QQCI  VD   P + +++S  TPE +C+     +    + A S  + V  + +     E+
Sbjct  338  QQCITLVDTYSPELVQLMSKVTPEKVCETI--KLCGSKRRARSISRAVATTPSLPVDEEN  395

Query  473  Q---CLKCKQLVVTYS----DKQKQSQIINALHSFCQI-NFPFPQQC---INQFEPILTN  327
            Q   C  CK+L+   S     K  +  I+NA    C+I   P+  QC   + ++EP+L  
Sbjct  396  QGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIE  455

Query  326  LFKLINSSTPESLCKLFNFCEG  261
              K + +  P  LCK    C G
Sbjct  456  SLKFMMN--PTDLCKKMGACHG  475



>gb|AFK40466.1| unknown [Medicago truncatula]
Length=242

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            D++ +    L+I++ L + C     F +KCKK+V EY P +  NAE+F    DICT LH 
Sbjct  145  DKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKFLEKTDICTALHA  204

Query  144  SDSPTLGIEHS  112
                T+ +E S
Sbjct  205  CKESTVVLEKS  215



>gb|AES79789.2| saposin B domain protein [Medicago truncatula]
Length=242

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 3/71 (4%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            D++ +    L+I++ L + C     F +KCKK+V EY P +  NAE+F    DICT LH 
Sbjct  145  DKIKDPDTELEIIEILLKVCNSVDKFGSKCKKIVLEYGPLVFENAEKFLEKTDICTALHA  204

Query  144  SDSPTLGIEHS  112
                T+ +E S
Sbjct  205  CKESTVVLEKS  215



>ref|NP_780458.2| proactivator polypeptide-like 1 precursor [Mus musculus]
 dbj|BAC25961.1| unnamed protein product [Mus musculus]
 gb|EDL37503.1| RIKEN cDNA 2310020A21 [Mus musculus]
Length=525

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 65/142 (46%), Gaps = 20/142 (14%)
 Frame = -1

Query  638  QQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAESTEKQVQVSGN-----ED  474
            QQCI  VD   P + +++S  TPE +C+     +    + A S  + V  + +     E+
Sbjct  338  QQCITLVDTYSPELVQLMSKVTPEKVCETI--KLCGSKRRARSISRAVATTPSLPVDEEN  395

Query  473  Q---CLKCKQLVVTYS----DKQKQSQIINALHSFCQI-NFPFPQQC---INQFEPILTN  327
            Q   C  CK+L+   S     K  +  I+NA    C+I   P+  QC   + ++EP+L  
Sbjct  396  QGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIE  455

Query  326  LFKLINSSTPESLCKLFNFCEG  261
              K + +  P  LCK    C G
Sbjct  456  SLKFMMN--PTDLCKKMGACHG  475



>sp|Q8C1C1.2|SAPL1_MOUSE RecName: Full=Proactivator polypeptide-like 1; Contains: RecName: 
Full=Saposin A-like; Contains: RecName: Full=Saposin B-Val-like; 
Contains: RecName: Full=Saposin B-like; Contains: 
RecName: Full=Saposin C-like; Contains: RecName: Full=Saposin 
D-like; Flags: Precursor [Mus musculus]
Length=522

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 65/142 (46%), Gaps = 20/142 (14%)
 Frame = -1

Query  638  QQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAESTEKQVQVSGN-----ED  474
            QQCI  VD   P + +++S  TPE +C+     +    + A S  + V  + +     E+
Sbjct  335  QQCITLVDTYSPELVQLMSKVTPEKVCETI--KLCGSKRRARSISRAVATTPSLPVDEEN  392

Query  473  Q---CLKCKQLVVTYS----DKQKQSQIINALHSFCQI-NFPFPQQC---INQFEPILTN  327
            Q   C  CK+L+   S     K  +  I+NA    C+I   P+  QC   + ++EP+L  
Sbjct  393  QGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIE  452

Query  326  LFKLINSSTPESLCKLFNFCEG  261
              K + +  P  LCK    C G
Sbjct  453  SLKFMMN--PTDLCKKMGACHG  472



>gb|ACG32625.1| surfactant protein B containing protein [Zea mays]
Length=235

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 47/102 (46%), Gaps = 4/102 (4%)
 Frame = -1

Query  539  VVSISQYAESTEKQVQVSGNEDQCLKCKQL---VVTY-SDKQKQSQIINALHSFCQINFP  372
             +++ +   STE  V++      C  C+      V+Y S+KQ Q +++  LH  C  +F 
Sbjct  33   AITLKEQVSSTEIPVRLKSGSPLCSACENFTSKAVSYISEKQTQDKVMGFLHDACSQSFS  92

Query  371  FPQQCINQFEPILTNLFKLINSSTPESLCKLFNFCEGAVSIS  246
            F Q+C    +   T LF  I    PE+ CK +  C G    S
Sbjct  93   FEQKCDELMDSYATLLFAKITEIKPEAFCKQYGLCRGTALFS  134



>ref|XP_009419859.1| PREDICTED: proactivator polypeptide-like 1 [Musa acuminata subsp. 
malaccensis]
Length=314

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = -3

Query  294  KSLQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            + L++++ L + C    +++ KCKK+V EY P IL+NAE F   ND+C  +H 
Sbjct  246  RQLEVIEILLKGCNKMGNYAKKCKKMVLEYGPLILINAENFLQKNDVCAAIHA  298



>dbj|BAC25258.1| unnamed protein product [Mus musculus]
Length=402

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 41/142 (29%), Positives = 65/142 (46%), Gaps = 20/142 (14%)
 Frame = -1

Query  638  QQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAESTEKQVQVSGN-----ED  474
            QQCI  VD   P + +++S  TPE +C+     +    + A S  + V  + +     E+
Sbjct  215  QQCITLVDTYSPELVQLMSKVTPEKVCETI--KLCGSKRRARSISRAVATTPSLPVDEEN  272

Query  473  Q---CLKCKQLVVTYS----DKQKQSQIINALHSFCQI-NFPFPQQC---INQFEPILTN  327
            Q   C  CK+L+   S     K  +  I+NA    C+I   P+  QC   + ++EP+L  
Sbjct  273  QGSFCQGCKRLLGMSSQNLDHKSTKRDILNAFKGGCRILPLPYVMQCNRFVAEYEPVLIE  332

Query  326  LFKLINSSTPESLCKLFNFCEG  261
              K + +  P  LCK    C G
Sbjct  333  SLKFMMN--PTDLCKKMGACHG  352



>ref|XP_010035988.1| PREDICTED: prosaposin-like [Eucalyptus grandis]
 gb|KCW47506.1| hypothetical protein EUGRSUZ_K01273 [Eucalyptus grandis]
 gb|KCW47507.1| hypothetical protein EUGRSUZ_K01273 [Eucalyptus grandis]
Length=227

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 3/79 (4%)
 Frame = -3

Query  315  DQLLNA*KSLQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHV  145
            D+L +    + I++ L ++C     +  KCKK+VFEY P IL N EQ     D+C+LLH+
Sbjct  145  DKLKDPDTQMDIIELLLKACDSLESYEDKCKKMVFEYGPLILGNMEQILEAADVCSLLHL  204

Query  144  SDSPTLGIEHSAS*GRKPV  88
              +  +  E S      P+
Sbjct  205  CAATEIKSEESVPTKEMPL  223



>ref|XP_008810565.1| PREDICTED: uncharacterized protein LOC103721950 [Phoenix dactylifera]
Length=234

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/64 (39%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = -3

Query  318  TDQLLNA*KSLQIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLH  148
            T +L +     +IV+ L + C    H+  +CKKLVF Y P ILVN E+F  T D+C  +H
Sbjct  154  TTKLKDPDAEFEIVKMLMKECNKMDHYGQECKKLVFRYVPLILVNGEKFLETTDVCASIH  213

Query  147  VSDS  136
              ++
Sbjct  214  ACEA  217



>ref|XP_006338959.1| PREDICTED: proactivator polypeptide-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338960.1| PREDICTED: proactivator polypeptide-like isoform X2 [Solanum 
tuberosum]
Length=273

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 3/48 (6%)
 Frame = -3

Query  285  QIVQFL*RSCF---HFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLL  151
             I+Q L ++C     ++ KCKK+VF+YAP IL+NAE F   ND+CT+L
Sbjct  170  DILQLLLKACGSVEKYTNKCKKMVFKYAPVILINAEYFLEKNDVCTIL  217



>tpg|DAA59240.1| TPA: hypothetical protein ZEAMMB73_970443 [Zea mays]
 tpg|DAA59241.1| TPA: hypothetical protein ZEAMMB73_970443 [Zea mays]
 tpg|DAA59242.1| TPA: hypothetical protein ZEAMMB73_970443 [Zea mays]
Length=140

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/101 (28%), Positives = 46/101 (46%), Gaps = 4/101 (4%)
 Frame = -1

Query  533  SISQYAESTEKQVQVSGNEDQCLKCKQL---VVTYSDK-QKQSQIINALHSFCQINFPFP  366
            ++ ++  ST+   ++      C  C+      VTY  K Q Q +I+  LH  C  +F F 
Sbjct  37   ALKEHISSTKIPARLKRGSGLCSACENFTSEAVTYLGKEQTQDRIVEFLHDACSQSFSFE  96

Query  365  QQCINQFEPILTNLFKLINSSTPESLCKLFNFCEGAVSISQ  243
            Q+C+   +   T LF  I    PE+ CK +  C     +S+
Sbjct  97   QKCVELMDSYATLLFAKITEIRPEAFCKRYGLCRDTALLSR  137



>ref|XP_010921104.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010921106.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Elaeis 
guineensis]
 ref|XP_010921109.1| PREDICTED: proactivator polypeptide-like 1 isoform X1 [Elaeis 
guineensis]
Length=229

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/209 (25%), Positives = 89/209 (43%), Gaps = 40/209 (19%)
 Frame = -1

Query  860  AISSWCCSAKDLAAADLKTQSLDV---SEKQVEGS------LCVQCKEFVT----TYSDE  720
             IS  C +A++L   D+     D    SE ++  S      +C  C+E+ +       + 
Sbjct  13   VISCTCANARNLITLDIMVMPGDYRIQSESRMSESIARNEEMCTLCEEYTSQAMYYLGEN  72

Query  719  QKQRELINSLHNYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKL--FC  546
            + Q E+IN+LH  C  +       ++ +QC+  VD   P  F  +++  PE  C+    C
Sbjct  73   ETQVEIINTLHQACSRLH------SFVKQCVLLVDYYAPLFFMEVATIRPEQFCEKVNLC  126

Query  545  EGVVSISQYAESTEKQVQVSGNEDQCLKC----KQLVVTYSDKQKQSQIINALHSFCQIN  378
            E  V            V +  ++D C  C    ++++    D   Q +II  L   C   
Sbjct  127  EKTVL-----------VPLPKHDDACTICHHVIQEILTKLEDPDTQLEIIEMLLKACNRV  175

Query  377  FPFPQQC---INQFEP-ILTNLFKLINSS  303
              F QQC   + Q+ P I+ NL K + ++
Sbjct  176  ENFVQQCKRLVFQYGPLIMANLVKFLETT  204



>gb|AAF32354.1|AF220198_1 putative protein [Vitis riparia]
Length=174

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 4/65 (6%)
 Frame = -3

Query  288  LQIVQFL*RSC---FHFSTKCKKLVFEYAPPILVNAEQFPVTNDICTLLHVSDS-PTLGI  121
            L+I++ L + C        KCK++VFEY P IL N E+F   ND+CT +H     P   +
Sbjct  105  LEILELLLKGCDAVKGLVRKCKRMVFEYGPIILNNTERFLEKNDVCTTVHACGVPPAASV  164

Query  120  EHSAS  106
            E +A+
Sbjct  165  EEAAA  169



>gb|KHN29523.1| Proactivator polypeptide [Glycine soja]
Length=212

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 77/174 (44%), Gaps = 30/174 (17%)
 Frame = -1

Query  854  SSWCCSAKDLAAADLKTQSLDVSEKQVEGSLCVQCKEFVTT---YSDEQK-QRELINSLH  687
            ++W C +++L  +         SE  ++  +C  C+E++T    Y  E K + E+IN LH
Sbjct  15   AAWACDSRELTNSG-------TSELSIKPDVCALCEEYITKALDYLHENKTETEIINILH  67

Query  686  NYCKNIGAITDNPAWGQQCINNVDQTLPNIFEMISSSTPETICKLFCEGVVSISQYAEST  507
            N C  +      P++ Q+C+  VD   P  F  +++  P   C       V++ Q     
Sbjct  68   NTCHQL------PSFKQKCVALVDFYAPLFFSEVATIQPGEFCH-----KVNLCQKIAYI  116

Query  506  EKQVQVSGNEDQCLKCKQLVVTYSDKQKQS----QIINALHSFCQINFPFPQQC  357
              +VQ    +D C  C+  V T  +K K+S    +II  L   C     +  +C
Sbjct  117  ALKVQ----DDSCEFCQDTVSTLLEKLKESDTKLEIIETLLKVCNSVEKYANKC  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2006933691294