BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21616_g1_i1 len=2085 path=[3151:0-531 3683:532-832 6612:833-899
@3984@!:900-1722 4807:1723-1792 4877:1793-2084]

Length=2085
                                                                      Score     E

ref|XP_009764201.1|  PREDICTED: fe-S cluster assembly factor HCF1...    581   0.0      
ref|XP_009764200.1|  PREDICTED: fe-S cluster assembly factor HCF1...    582   0.0      
ref|XP_009627669.1|  PREDICTED: fe-S cluster assembly factor HCF1...    578   0.0      
ref|XP_009627670.1|  PREDICTED: fe-S cluster assembly factor HCF1...    577   0.0      
ref|XP_006353450.1|  PREDICTED: uncharacterized protein LOC102590...    580   0.0      
ref|XP_006353451.1|  PREDICTED: uncharacterized protein LOC102590...    580   0.0      
ref|XP_004251600.1|  PREDICTED: fe-S cluster assembly factor HCF1...    578   0.0      
ref|XP_004251599.1|  PREDICTED: fe-S cluster assembly factor HCF1...    578   0.0      
emb|CBI28104.3|  unnamed protein product                                579   0.0      
ref|XP_002281353.1|  PREDICTED: fe-S cluster assembly factor HCF1...    579   0.0      Vitis vinifera
emb|CDP03365.1|  unnamed protein product                                582   0.0      
ref|XP_004148711.1|  PREDICTED: protein mrp homolog                     572   0.0      
gb|KDP32311.1|  hypothetical protein JCGZ_13236                         569   0.0      
ref|XP_007013248.1|  ATP binding isoform 1                              566   0.0      
ref|XP_011078358.1|  PREDICTED: fe-S cluster assembly factor HCF1...    570   0.0      
ref|XP_008463360.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    570   0.0      
ref|XP_010254190.1|  PREDICTED: fe-S cluster assembly factor HCF1...    569   0.0      
gb|EYU23024.1|  hypothetical protein MIMGU_mgv1a004312mg                563   0.0      
ref|XP_004512951.1|  PREDICTED: protein mrp homolog isoform X2          572   0.0      
ref|XP_010532831.1|  PREDICTED: fe-S cluster assembly factor HCF1...    568   0.0      
ref|XP_009352487.1|  PREDICTED: fe-S cluster assembly factor HCF1...    575   0.0      
ref|XP_008337454.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    568   0.0      
ref|XP_004512950.1|  PREDICTED: protein mrp homolog isoform X1          571   0.0      
ref|XP_010049769.1|  PREDICTED: fe-S cluster assembly factor HCF1...    568   0.0      
ref|XP_010249844.1|  PREDICTED: fe-S cluster assembly factor HCF1...    564   0.0      
ref|XP_008242594.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    569   0.0      
ref|XP_010249845.1|  PREDICTED: fe-S cluster assembly factor HCF1...    564   0.0      
ref|XP_010249841.1|  PREDICTED: fe-S cluster assembly factor HCF1...    563   0.0      
ref|XP_010249843.1|  PREDICTED: fe-S cluster assembly factor HCF1...    563   0.0      
ref|XP_010249839.1|  PREDICTED: fe-S cluster assembly factor HCF1...    563   0.0      
ref|XP_010249840.1|  PREDICTED: fe-S cluster assembly factor HCF1...    563   0.0      
ref|XP_003528907.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    568   0.0      
ref|XP_010088861.1|  hypothetical protein L484_020848                   560   0.0      
ref|XP_006475727.1|  PREDICTED: uncharacterized protein LOC102622...    572   0.0      
ref|XP_003534183.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    567   0.0      
ref|XP_006451084.1|  hypothetical protein CICLE_v10007988mg             571   0.0      
ref|XP_004287077.1|  PREDICTED: protein mrp homolog                     553   0.0      
ref|XP_011009216.1|  PREDICTED: fe-S cluster assembly factor HCF1...    563   0.0      
gb|KHN20707.1|  Protein mrp like                                        561   0.0      
ref|XP_010688160.1|  PREDICTED: fe-S cluster assembly factor HCF1...    557   0.0      
ref|XP_007013249.1|  ATP binding isoform 2                              552   0.0      
emb|CDX92894.1|  BnaC07g41520D                                          567   0.0      
ref|XP_006297413.1|  hypothetical protein CARUB_v10013437mg             566   0.0      
gb|AES76761.2|  nucleotide-binding protein                              562   0.0      
ref|NP_189086.1|  protein high chlorophyll fluorescence 101             561   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AES76762.2|  nucleotide-binding protein                              562   0.0      
emb|CDY50924.1|  BnaA03g59020D                                          565   0.0      
ref|XP_009137808.1|  PREDICTED: probable cytosolic Fe-S cluster a...    564   0.0      
gb|AAM64337.1|  mrp protein, putative                                   561   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AFK38076.1|  unknown                                                 563   0.0      
ref|XP_007152803.1|  hypothetical protein PHAVU_004G160900g             556   0.0      
ref|XP_009416098.1|  PREDICTED: fe-S cluster assembly factor HCF1...    559   0.0      
ref|XP_007152802.1|  hypothetical protein PHAVU_004G160900g             555   0.0      
ref|XP_008776939.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    556   0.0      
ref|XP_006396125.1|  hypothetical protein EUTSA_v10002483mg             560   0.0      
ref|XP_010513436.1|  PREDICTED: fe-S cluster assembly factor HCF1...    556   0.0      
ref|XP_008776940.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    555   0.0      
ref|XP_010941458.1|  PREDICTED: fe-S cluster assembly factor HCF1...    556   0.0      
ref|XP_002885645.1|  high-chlorophyll-fluorescence 101                  560   0.0      
ref|XP_006844368.1|  hypothetical protein AMTR_s00142p00060790          552   0.0      
ref|XP_007013250.1|  ATP binding isoform 3                              564   0.0      
ref|XP_010488540.1|  PREDICTED: fe-S cluster assembly factor HCF1...    553   0.0      
ref|XP_010466845.1|  PREDICTED: fe-S cluster assembly factor HCF1...    554   0.0      
ref|XP_010466846.1|  PREDICTED: fe-S cluster assembly factor HCF1...    554   0.0      
ref|XP_006646268.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    558   0.0      
sp|Q0JJS8.3|HF101_ORYSJ  RecName: Full=Fe-S cluster assembly fact...    557   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232251.1|  PREDICTED: fe-S cluster assembly factor HCF1...    554   0.0      
ref|XP_003620543.1|  Mrp-like protein                                   538   0.0      
ref|XP_008669716.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    552   0.0      
ref|XP_006396124.1|  hypothetical protein EUTSA_v10002483mg             540   0.0      
ref|XP_006451083.1|  hypothetical protein CICLE_v10007988mg             538   0.0      
ref|XP_008669715.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    550   0.0      
ref|XP_004969777.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    550   0.0      
gb|KFK39886.1|  hypothetical protein AALP_AA3G301400                    536   0.0      
emb|CDM84696.1|  unnamed protein product                                550   0.0      
ref|XP_010488541.1|  PREDICTED: fe-S cluster assembly factor HCF1...    553   0.0      
ref|XP_010466847.1|  PREDICTED: fe-S cluster assembly factor HCF1...    554   0.0      
ref|XP_006451079.1|  hypothetical protein CICLE_v10007988mg             572   0.0      
gb|KHG19668.1|  Protein mrp                                             488   0.0      
dbj|BAB02944.1|  unnamed protein product                                501   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EPS72302.1|  hypothetical protein M569_02451                         513   0.0      
gb|EYU23025.1|  hypothetical protein MIMGU_mgv1a004312mg                561   0.0      
ref|XP_002324970.2|  HIGH-CHLOROPHYLL-FLUORESCENCE 101 family pro...    492   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010942914.1|  PREDICTED: fe-S cluster assembly factor HCF1...    555   0.0      
gb|KHN32011.1|  Protein mrp like                                        485   0.0      
ref|XP_001784629.1|  predicted protein                                  518   0.0      
ref|XP_006451076.1|  hypothetical protein CICLE_v10007988mg             538   0.0      
ref|XP_008463361.1|  PREDICTED: iron-sulfur protein NUBPL isoform X2    567   0.0      
ref|XP_002446055.1|  hypothetical protein SORBIDRAFT_06g001090          554   0.0      Sorghum bicolor [broomcorn]
ref|XP_006451073.1|  hypothetical protein CICLE_v10007988mg             571   0.0      
ref|XP_002990705.1|  hypothetical protein SELMODRAFT_185504             510   0.0      
ref|XP_002969039.1|  hypothetical protein SELMODRAFT_91144              510   0.0      
ref|XP_010254191.1|  PREDICTED: fe-S cluster assembly factor HCF1...    455   0.0      
ref|NP_001044086.2|  Os01g0719700                                       548   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY75635.1|  hypothetical protein OsI_03540                          548   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_007204393.1|  hypothetical protein PRUPE_ppa006650mg             568   0.0      
ref|XP_006371915.1|  hypothetical protein POPTR_0018s06210g             452   0.0      
ref|XP_004969778.1|  PREDICTED: cytosolic Fe-S cluster assembly f...    541   0.0      
ref|XP_006451074.1|  hypothetical protein CICLE_v10007988mg             538   0.0      
ref|XP_007204392.1|  hypothetical protein PRUPE_ppa006650mg             566   0.0      
tpg|DAA38715.1|  TPA: hypothetical protein ZEAMMB73_922984              550   0.0      
ref|XP_003620544.1|  Mrp-like protein                                   534   0.0      
ref|XP_008390520.1|  PREDICTED: uncharacterized protein LOC103452763    372   6e-179   
ref|XP_009336934.1|  PREDICTED: LOW QUALITY PROTEIN: fe-S cluster...    510   1e-178   
gb|EMT06327.1|  Protein mrp-like protein                                470   3e-177   
gb|EMS51714.1|  Protein mrp-like protein                                413   2e-162   
ref|XP_005852083.1|  hypothetical protein CHLNCDRAFT_133105             392   3e-162   
ref|XP_006371914.1|  hypothetical protein POPTR_0018s06210g             311   4e-162   
ref|XP_006451081.1|  hypothetical protein CICLE_v10007988mg             312   5e-160   
ref|XP_005647837.1|  P-loop containing nucleoside triphosphate hy...    367   1e-155   
ref|XP_002515581.1|  Protein mrp, putative                              309   2e-155   Ricinus communis
gb|KDO54141.1|  hypothetical protein CISIN_1g009574mg                   282   2e-148   
ref|XP_003083908.1|  Predicted ATPase, nucleotide-binding (ISS)         339   8e-143   
emb|CEG00577.1|  ATPase-like, ParA/MinD                                 338   4e-142   
ref|XP_001422009.1|  predicted protein                                  330   2e-139   Ostreococcus lucimarinus CCE9901
gb|KCW82748.1|  hypothetical protein EUGRSUZ_C04130                     426   8e-139   
ref|XP_002502646.1|  predicted protein                                  329   5e-137   Micromonas commoda
ref|XP_007512440.1|  predicted protein                                  333   1e-135   
ref|XP_010051695.1|  PREDICTED: fe-S cluster assembly factor HCF1...    295   4e-133   
gb|KCW82750.1|  hypothetical protein EUGRSUZ_C041312                    295   1e-132   
gb|KCW82552.1|  hypothetical protein EUGRSUZ_C039531                    295   2e-132   
gb|KCW82550.1|  hypothetical protein EUGRSUZ_C039532                    360   8e-117   
ref|XP_003064216.1|  predicted protein                                  282   6e-115   
gb|KCW82551.1|  hypothetical protein EUGRSUZ_C039532                    354   2e-114   
tpg|DAA38716.1|  TPA: hypothetical protein ZEAMMB73_922984              298   1e-113   
ref|XP_005711941.1|  unnamed protein product                            275   6e-111   
ref|XP_002958167.1|  hypothetical protein VOLCADRAFT_107985             353   9e-110   
ref|WP_007280871.1|  hypothetical protein                               249   2e-109   
gb|KCW82562.1|  hypothetical protein EUGRSUZ_C039601                    332   2e-105   
ref|XP_002186426.1|  predicted protein                                  246   1e-104   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002293925.1|  predicted protein                                  234   1e-102   Thalassiosira pseudonana CCMP1335
gb|KCW82749.1|  hypothetical protein EUGRSUZ_C04130                     329   6e-102   
ref|XP_005704479.1|  ATP-binding protein involved in chromosome p...    236   2e-98    
emb|CBJ25905.1|  HCF101 (HIGH-CHLOROPHYLL-FLUORESCENCE 101); ATP ...    216   3e-98    
ref|XP_005538557.1|  probable multidrug resistance protein              234   1e-97    
gb|EWM28719.1|  protein of unknown function, DUF971                     204   2e-96    
gb|KFM22705.1|  Mrp-like protein                                        327   5e-94    
gb|ETI34745.1|  hypothetical protein, variant 1                         239   8e-92    
gb|ETP32733.1|  hypothetical protein, variant 1                         239   8e-92    
gb|ETK75042.1|  hypothetical protein, variant 1                         239   9e-92    
gb|ETO63502.1|  hypothetical protein F444_18800                         239   2e-91    
ref|XP_008913548.1|  hypothetical protein, variant 1                    237   4e-91    
gb|ETL81718.1|  hypothetical protein, variant 1                         237   4e-91    
ref|XP_008604920.1|  hypothetical protein SDRG_01182                    236   5e-89    
gb|KDO35062.1|  hypothetical protein SPRG_01126                         233   5e-88    
gb|ETP32732.1|  hypothetical protein F442_18625                         239   1e-87    
gb|ETK75041.1|  hypothetical protein L915_18282                         239   2e-87    
gb|ETI34744.1|  hypothetical protein F443_18814                         239   2e-87    
ref|XP_009838180.1|  hypothetical protein, variant 1                    236   3e-87    
ref|XP_008913547.1|  hypothetical protein PPTG_17629                    237   7e-87    
ref|XP_008867789.1|  hypothetical protein H310_04976                    225   7e-87    
gb|ETL81717.1|  hypothetical protein L917_18006                         237   8e-87    
emb|CCA21133.1|  conserved hypothetical protein                         223   5e-86    
gb|EJY74228.1|  ParA multi-domain protein                               221   6e-85    
emb|CCI45349.1|  unnamed protein product                                222   5e-84    
ref|XP_009838179.1|  hypothetical protein H257_12605                    224   1e-83    
gb|ETP32735.1|  hypothetical protein, variant 3                         208   1e-82    
gb|ETI34747.1|  hypothetical protein, variant 3                         208   2e-82    
gb|ETK75044.1|  hypothetical protein, variant 3                         208   2e-82    
gb|ETL81720.1|  hypothetical protein, variant 3                         206   7e-82    
ref|XP_008913550.1|  hypothetical protein, variant 3                    206   7e-82    
tpg|DAA38717.1|  TPA: hypothetical protein ZEAMMB73_922984              271   8e-82    
ref|XP_001007903.1|  hypothetical protein TTHERM_00538790               218   2e-81    Tetrahymena thermophila
emb|CBN74480.1|  conserved unknown protein                              210   7e-81    
emb|CDW89606.1|  protein mrp homolog                                    208   2e-79    
gb|ETP32734.1|  hypothetical protein, variant 2                         209   2e-78    
gb|ETI34746.1|  hypothetical protein, variant 2                         209   3e-78    
gb|ETK75043.1|  hypothetical protein, variant 2                         208   3e-78    
ref|XP_008913549.1|  hypothetical protein, variant 2                    206   1e-77    
gb|ETL81719.1|  hypothetical protein, variant 2                         206   1e-77    
ref|XP_626042.1|  MRP like MinD family ATpase                           164   3e-77    Cryptosporidium parvum Iowa II
ref|XP_001429812.1|  hypothetical protein                               206   1e-76    Paramecium tetraurelia strain d4-2
gb|ETI34749.1|  hypothetical protein, variant 5                         185   1e-75    
gb|ETK75046.1|  hypothetical protein, variant 5                         186   1e-75    
gb|ETP32737.1|  hypothetical protein, variant 5                         185   1e-75    
ref|XP_009838182.1|  hypothetical protein, variant 2                    197   2e-75    
ref|WP_018287819.1|  mrp                                                159   3e-75    
ref|XP_008913552.1|  hypothetical protein, variant 5                    183   5e-75    
gb|ETL81722.1|  hypothetical protein, variant 5                         183   6e-75    
gb|EJK67207.1|  hypothetical protein THAOC_11789                        170   8e-75    
emb|CDM64485.1|  ATPase involved in chromosome partitioning             166   2e-74    
gb|EQB62938.1|  Protein mrp-like protein                                166   3e-73    
ref|WP_009850360.1|  mrp                                                155   3e-73    
ref|WP_018048831.1|  hypothetical protein                               174   1e-72    
ref|XP_005841455.1|  hypothetical protein GUITHDRAFT_156868             182   4e-72    
ref|WP_037571278.1|  hypothetical protein                               158   6e-72    
ref|WP_018284401.1|  mrp                                                154   1e-71    
gb|ETP32736.1|  hypothetical protein, variant 4                         185   2e-71    
gb|ETI34748.1|  hypothetical protein, variant 4                         185   2e-71    
gb|ETK75045.1|  hypothetical protein, variant 4                         185   3e-71    
ref|WP_018002338.1|  hypothetical protein                               152   1e-70    
ref|XP_008913551.1|  hypothetical protein, variant 4                    183   1e-70    
ref|XP_002785765.1|  polysaccharide export protein, putative            150   1e-70    Perkinsus marinus ATCC 50983
gb|ETL81721.1|  hypothetical protein, variant 4                         183   1e-70    
ref|XP_001443600.1|  hypothetical protein                               206   5e-70    Paramecium tetraurelia strain d4-2
ref|WP_035403775.1|  ATP-binding protein                                174   5e-70    
ref|WP_011889704.1|  ATP-binding protein                                168   2e-69    
ref|WP_008297498.1|  mrp                                                161   7e-68    
ref|WP_013482223.1|  mrp                                                156   9e-68    
ref|WP_014965552.1|  MULTISPECIES: mrp                                  159   9e-68    
ref|WP_038321364.1|  mrp                                                146   2e-67    
ref|XP_005821070.1|  hypothetical protein GUITHDRAFT_147485             174   2e-67    
ref|WP_012499874.1|  ATP-binding protein                                169   2e-67    
gb|AIF15206.1|  ATP-binding protein involved in chromosome partit...    164   2e-67    
ref|WP_014100437.1|  mrp                                                162   2e-67    
gb|KFM20347.1|  Protein mrp                                             160   3e-67    
gb|AIF17124.1|  ATP-binding protein involved in chromosome partit...    159   3e-67    
gb|AIF14615.1|  ATP-binding protein involved in chromosome partit...    162   3e-67    
emb|CDI05966.1|  putative ATPases involved in chromosome partitio...    153   3e-67    
gb|ETO22470.1|  hypothetical protein RFI_14729                          192   3e-67    
gb|AIE86198.1|  mrP protein                                             144   4e-67    
ref|WP_012465394.1|  ATP-binding protein                                169   4e-67    
gb|ABZ07104.1|  putative domain of unknown function DUF59               157   4e-67    uncultured marine crenarchaeote HF4000_ANIW97M7
gb|AIF05278.1|  ATP-binding protein involved in chromosome partit...    161   4e-67    
gb|AIF03243.1|  ATP-binding protein involved in chromosome partit...    161   5e-67    
gb|AIF00030.1|  ATP-binding protein involved in chromosome partit...    159   5e-67    
gb|AIF83767.1|  ATPase involved in chromosome partitioning              158   7e-67    
ref|WP_011357162.1|  ATP-binding protein                                158   8e-67    
gb|AIF25328.1|  ATP-binding protein involved in chromosome partit...    157   9e-67    
ref|WP_012506359.1|  ATP-binding protein                                162   9e-67    
gb|AIC14569.1|  Mrp family signature-containing protein and domai...    158   9e-67    
ref|WP_014963653.1|  MULTISPECIES: mrp                                  159   1e-66    
ref|WP_020248166.1|  hypothetical protein                               159   1e-66    
ref|WP_012215617.1|  mrp                                                159   2e-66    
ref|WP_012780225.1|  mrp                                                164   2e-66    
ref|XP_009516755.1|  hypothetical protein PHYSODRAFT_471037             232   3e-66    
gb|AIF12615.1|  ATP-binding protein involved in chromosome partit...    152   4e-66    
ref|WP_015744925.1|  mrp                                                144   5e-66    
ref|WP_007402098.1|  mrp                                                157   6e-66    
ref|WP_036675354.1|  ATP-binding protein                                162   8e-66    
ref|WP_011745830.1|  ATP-binding protein                                161   1e-65    
ref|WP_011242756.1|  mrp                                                166   2e-65    
ref|WP_010191223.1|  mrp                                                155   2e-65    
ref|WP_013457638.1|  mrp                                                153   4e-65    
ref|WP_039728291.1|  sodium:proton antiporter                           157   4e-65    
ref|WP_026369263.1|  mrp                                                157   5e-65    
ref|WP_007551075.1|  mrp                                                158   5e-65    
ref|XP_009838186.1|  hypothetical protein, variant 6                    161   6e-65    
ref|WP_017717311.1|  mrp                                                169   7e-65    
ref|WP_008478703.1|  mrp                                                152   1e-64    
ref|WP_004595267.1|  MULTISPECIES: hypothetical protein                 157   1e-64    
ref|WP_017344385.1|  ATP-binding protein                                157   2e-64    
ref|WP_012473003.1|  mrp                                                163   2e-64    
ref|WP_039749662.1|  ATP-binding protein                                159   2e-64    
ref|WP_017653912.1|  mrp                                                164   3e-64    
ref|WP_026464137.1|  ATP-binding protein                                162   4e-64    
gb|ETZ19296.1|  mrp                                                     154   5e-64    
ref|WP_015118640.1|  chromosome partitioning ATPase                     168   5e-64    
ref|WP_004368525.1|  hypothetical protein                               167   5e-64    
ref|XP_002997115.1|  conserved hypothetical protein                     225   6e-64    
ref|WP_009634067.1|  ATPase involved in chromosome partitioning         162   7e-64    
ref|WP_037437606.1|  ATP-binding protein                                151   8e-64    
ref|WP_012501676.1|  ATP-binding protein                                160   9e-64    
ref|WP_004312329.1|  MULTISPECIES: ATP-binding protein                  164   1e-63    
ref|WP_039450802.1|  ATP-binding protein                                164   2e-63    
ref|WP_029281507.1|  ATP-binding protein                                154   3e-63    
ref|WP_023497644.1|  ATPase involved in chromosome partitioning         154   3e-63    
ref|WP_017321383.1|  mrp                                                162   4e-63    
ref|WP_010600022.1|  mrp                                                152   4e-63    
ref|WP_039474123.1|  ATP-binding protein                                153   4e-63    
ref|WP_026957073.1|  ATP-binding protein                                160   4e-63    
ref|WP_034217793.1|  mrp                                                136   5e-63    
ref|WP_018474217.1|  mrp                                                168   5e-63    
ref|WP_009032308.1|  mrp                                                162   6e-63    
gb|KFF41151.1|  ATPase involved in chromosome partitioning              154   7e-63    
ref|WP_026904508.1|  ATP-binding protein                                162   7e-63    
ref|WP_008442120.1|  hypothetical protein                               153   8e-63    
gb|AJA92554.1|  ParA/MinD ATPase-like protein                           145   8e-63    
ref|WP_006112335.1|  hypothetical protein                               152   9e-63    
gb|ABZ07569.1|  putative domain of unknown function DUF59               167   1e-62    uncultured marine microorganism HF4000_ANIW137J11
ref|WP_006563532.1|  mrp                                                164   1e-62    
ref|WP_008241653.1|  mrp                                                147   1e-62    
ref|WP_013560223.1|  mrp                                                143   1e-62    
ref|WP_002703228.1|  mrp                                                160   1e-62    
ref|WP_007355402.1|  MULTISPECIES: mrp                                  155   2e-62    
ref|WP_011432409.1|  mrp                                                159   2e-62    
ref|WP_015201085.1|  ParA/MinD-like ATPase                              161   3e-62    
ref|WP_012628025.1|  mrp                                                152   3e-62    
ref|WP_011429455.1|  mrp                                                162   3e-62    
ref|WP_012954176.1|  mrp                                                153   3e-62    
ref|WP_006365314.1|  ATP-binding protein                                154   4e-62    
ref|WP_038038567.1|  mrp                                                154   4e-62    
ref|WP_038312356.1|  hypothetical protein                               141   5e-62    
ref|WP_029274885.1|  ATP-binding protein                                152   6e-62    
ref|WP_016482742.1|  ATPases involved in chromosome partitioning        140   6e-62    
ref|WP_007999923.1|  hypothetical protein                               151   7e-62    
ref|WP_018342995.1|  mrp                                                157   7e-62    
ref|WP_008250824.1|  ATP-binding protein                                164   7e-62    
ref|WP_009183884.1|  mrp                                                162   8e-62    
ref|WP_020404545.1|  hypothetical protein                               179   8e-62    
ref|WP_025141623.1|  ATP-binding protein                                153   8e-62    
ref|WP_010933445.1|  ATP-binding protein                                152   9e-62    
ref|WP_009344442.1|  mrp                                                157   1e-61    
ref|WP_020863628.1|  ATP-binding protein involved in chromosome p...    134   1e-61    
ref|WP_019597140.1|  mrp                                                164   1e-61    
ref|WP_035070055.1|  ATP-binding protein                                160   1e-61    
ref|WP_012641930.1|  mrp                                                151   1e-61    
ref|WP_008314472.1|  ATPase involved in chromosome partitioning         153   1e-61    
ref|WP_024281845.1|  ATP-binding protein                                162   1e-61    
ref|WP_011584320.1|  mrp                                                159   2e-61    
ref|WP_015333897.1|  ATPase-like, ParA/MinD                             153   2e-61    
ref|WP_026945025.1|  ATP-binding protein                                162   2e-61    
ref|WP_004046461.1|  hypothetical protein                               153   2e-61    
ref|WP_027002644.1|  ATP-binding protein                                152   2e-61    
ref|WP_026969154.1|  ATP-binding protein                                157   3e-61    
ref|WP_028083517.1|  sodium:proton antiporter                           157   3e-61    
ref|WP_006278553.1|  mrp                                                156   4e-61    
ref|WP_006628050.1|  hypothetical protein                               152   4e-61    
ref|WP_005433796.1|  ATP-binding protein                                175   4e-61    
ref|WP_008628636.1|  Septum site-determining protein MinD               158   4e-61    
ref|WP_015227913.1|  chromosome partitioning ATPase                     151   5e-61    
ref|WP_014220731.1|  mrp                                                154   8e-61    
ref|WP_026752351.1|  ATP-binding protein                                154   8e-61    
ref|WP_012257064.1|  MULTISPECIES: mrp                                  158   9e-61    
ref|WP_026897453.1|  ATP-binding protein                                150   9e-61    
ref|WP_009284071.1|  mrp                                                154   9e-61    
ref|WP_010468485.1|  mrp                                                149   1e-60    
ref|WP_022967852.1|  ATP-binding protein                                161   1e-60    
ref|WP_015148895.1|  chromosome partitioning ATPase                     154   1e-60    
ref|WP_017732554.1|  mrp                                                161   1e-60    
ref|WP_015201971.1|  ParA/MinD-like ATPase                              159   1e-60    
ref|WP_021249386.1|  ATP-binding protein                                166   1e-60    
ref|WP_015267148.1|  chromosome partitioning ATPase                     158   2e-60    
ref|WP_022608929.1|  ATPase involved in chromosome partitioning         155   2e-60    
ref|WP_018195602.1|  MULTISPECIES: hypothetical protein                 145   2e-60    
ref|WP_015226743.1|  ParA/MinD-like ATPase                              154   2e-60    
ref|WP_015195488.1|  ATPase-like, ParA/MinD                             155   2e-60    
ref|WP_008583676.1|  hypothetical protein                               152   2e-60    
ref|WP_012120278.1|  mrp                                                146   2e-60    
ref|WP_029666425.1|  mrp                                                145   2e-60    
ref|WP_014856510.1|  Chromosome-partitioning ATPase                     179   2e-60    
ref|WP_011956836.1|  mrp                                                146   2e-60    
ref|WP_036207341.1|  ATP-binding protein                                168   2e-60    
ref|WP_012762564.1|  ATP-binding protein                                165   2e-60    
ref|WP_007695306.1|  ATP-binding protein Mrp 1                          151   3e-60    
ref|WP_021780006.1|  scaffold protein for [4Fe-4S] cluster assemb...    152   3e-60    
ref|WP_023176139.1|  antiporter inner membrane protein                  150   3e-60    
ref|WP_008008446.1|  hypothetical protein                               151   3e-60    
ref|WP_015910544.1|  ATP-binding protein                                154   4e-60    
ref|WP_012187886.1|  mrp                                                156   5e-60    
ref|WP_004334495.1|  hypothetical protein                               167   6e-60    
ref|WP_012871126.1|  mrp                                                144   6e-60    
ref|WP_014773797.1|  mrp                                                163   6e-60    
ref|WP_017257474.1|  mrp                                                158   7e-60    
ref|WP_012162007.1|  mrp                                                146   7e-60    
ref|WP_008924191.1|  ATP-binding protein                                161   7e-60    
ref|WP_014021471.1|  mrp                                                157   8e-60    
ref|WP_027881498.1|  mrp                                                150   8e-60    
ref|WP_022831164.1|  mrp                                                153   8e-60    
ref|WP_028988817.1|  ATPase                                             157   9e-60    
ref|WP_015941221.1|  mrp                                                155   9e-60    
ref|WP_026618452.1|  sodium:proton antiporter                           174   9e-60    
ref|WP_026797809.1|  sodium:proton antiporter                           157   9e-60    
ref|WP_014799099.1|  mrp                                                151   1e-59    
ref|WP_014450017.1|  mrp                                                137   1e-59    
ref|WP_009583175.1|  Septum site-determining protein MinD               162   1e-59    
ref|WP_009053059.1|  mrp                                                158   1e-59    
ref|WP_007978895.1|  ATP-binding protein                                155   1e-59    
ref|WP_019559944.1|  ATP-binding protein                                160   1e-59    
ref|WP_026769446.1|  ATP-binding protein                                152   1e-59    
ref|WP_026775002.1|  ATP-binding protein                                152   1e-59    
ref|WP_027302932.1|  ATP-binding protein                                147   1e-59    
ref|WP_012925712.1|  mrp                                                149   1e-59    
ref|WP_039803270.1|  ATP-binding protein                                161   2e-59    
ref|WP_013929330.1|  mrp                                                152   2e-59    
gb|EWS65179.1|  Cell division inhibitor MinD                            163   2e-59    
ref|WP_028296404.1|  ATP-binding protein                                155   2e-59    
ref|WP_038108123.1|  ATP-binding protein                                149   2e-59    
gb|AIZ63848.1|  ATP-binding protein                                     155   2e-59    
ref|WP_018419712.1|  ATP-binding protein                                163   2e-59    
ref|WP_026612992.1|  sodium:proton antiporter                           172   2e-59    
ref|WP_028736796.1|  sodium:proton antiporter                           169   2e-59    
ref|WP_020890547.1|  Septum site-determining protein MinD               160   3e-59    
ref|WP_021039647.1|  ATPase involved in chromosome partitioning         162   3e-59    
ref|WP_028526718.1|  ATP-binding protein                                150   3e-59    
ref|WP_004260902.1|  hypothetical protein                               166   3e-59    
ref|WP_008276757.1|  mrp                                                145   3e-59    
ref|WP_037261868.1|  lipoprotein                                        149   3e-59    
ref|WP_014546611.1|  chromosome partitioning protein ParA               152   3e-59    
ref|WP_012475394.1|  ATP-binding protein                                161   4e-59    
ref|WP_028665565.1|  ATP-binding protein                                150   4e-59    
ref|WP_006076162.1|  Cobyrinic acid ac-diamide synthase                 150   4e-59    
ref|WP_016868308.1|  mrp                                                165   4e-59    
ref|WP_038701179.1|  ATP-binding protein                                151   5e-59    
ref|WP_007898456.1|  ATP-binding protein                                171   5e-59    
ref|WP_037016079.1|  ATP-binding protein                                174   5e-59    
ref|WP_020288956.1|  ParA family protein                                166   5e-59    
ref|WP_008523711.1|  ATP-binding protein                                150   6e-59    
ref|WP_037012279.1|  ATP-binding protein                                165   6e-59    
ref|WP_038803769.1|  ATP-binding protein                                174   7e-59    
gb|ENN88980.1|  Mrp protein                                             168   7e-59    
ref|WP_016195302.1|  Septum site-determining protein MinD               154   7e-59    
ref|WP_007307830.1|  mrp                                                147   7e-59    
ref|WP_007312860.1|  mrp                                                147   7e-59    
ref|WP_037149623.1|  sodium:proton antiporter                           168   8e-59    
ref|WP_013205413.1|  ATP-binding protein                                166   8e-59    
ref|WP_012874920.1|  mrp                                                153   8e-59    
ref|WP_028482916.1|  sodium:proton antiporter                           162   9e-59    
ref|WP_009546153.1|  MULTISPECIES: mrp                                  146   1e-58    
ref|WP_038106662.1|  ATP-binding protein                                150   1e-58    
ref|WP_027196993.1|  ATP-binding protein                                162   1e-58    
ref|WP_028872987.1|  ATP-binding protein                                152   1e-58    
ref|WP_018431687.1|  ATP-binding protein                                159   1e-58    
ref|WP_017740545.1|  mrp                                                160   1e-58    
ref|WP_037044415.1|  ATP-binding protein                                165   1e-58    
gb|KFE52519.1|  ATP-binding protein                                     166   1e-58    
gb|ADD93148.1|  putative domain of unknown function DUF59               162   1e-58    
gb|ENZ77045.1|  ATPase involved in chromosome partitioning              165   1e-58    
ref|WP_020532284.1|  hypothetical protein                               153   1e-58    
ref|WP_013088721.1|  ATP-binding protein                                159   1e-58    
ref|WP_038084461.1|  sodium:proton antiporter                           162   1e-58    
ref|WP_002931746.1|  hypothetical protein                               167   1e-58    
ref|WP_034445271.1|  hypothetical protein                               145   1e-58    
ref|WP_020603816.1|  mrp                                                145   1e-58    
ref|WP_015124500.1|  chromosome partitioning ATPase                     144   1e-58    
ref|WP_003262469.1|  ATP-binding protein                                166   2e-58    
ref|WP_015030330.1|  mrp                                                150   2e-58    
ref|WP_026794066.1|  MULTISPECIES: sodium:proton antiporter             158   2e-58    
ref|WP_039555505.1|  ATP-binding protein                                166   2e-58    
ref|WP_003273064.1|  ATP-binding protein                                166   2e-58    
ref|WP_002938859.1|  hypothetical protein                               167   2e-58    
ref|WP_011712372.1|  mrp                                                143   2e-58    
ref|WP_013634016.1|  mrp                                                148   2e-58    
emb|CDS92297.1|  Protein mrp homolog                                    151   2e-58    
ref|WP_008507642.1|  mrp                                                150   2e-58    
ref|WP_003272351.1|  ATP-binding protein                                166   2e-58    
ref|WP_015790256.1|  ATP-binding protein                                152   2e-58    
ref|WP_005043266.1|  ATP-binding protein Mrp 1                          150   2e-58    
ref|WP_038110842.1|  ATP-binding protein                                148   2e-58    
ref|WP_037028805.1|  ATP-binding protein                                165   2e-58    
ref|WP_034833477.1|  ATP-binding protein                                160   3e-58    
ref|WP_015220931.1|  ParA/MinD-like ATPase                              149   3e-58    
ref|WP_007799137.1|  sodium:proton antiporter                           167   3e-58    
emb|CCA84710.1|  Na+/H+ antiporter                                      166   3e-58    
ref|WP_008932448.1|  ATP-binding protein                                153   3e-58    
ref|WP_027680795.1|  ATP-binding protein                                165   3e-58    
ref|WP_008417414.1|  ATP-binding protein                                150   3e-58    
emb|CBK22444.2|  unnamed protein product                                157   3e-58    
ref|WP_026786588.1|  sodium:proton antiporter                           158   3e-58    
ref|WP_015476192.1|  ATP-binding Mrp/Nbp35 family protein               173   3e-58    
ref|WP_021189414.1|  mrp                                                150   3e-58    
ref|WP_027898446.1|  ATP-binding protein                                165   3e-58    
ref|WP_020654207.1|  ATP-binding protein                                164   3e-58    
ref|WP_006787012.1|  ATP-binding protein                                162   3e-58    
ref|WP_035615435.1|  mrp                                                172   3e-58    
gb|AIE96653.1|  ATP-binding protein involved in chromosome partit...    159   4e-58    
gb|KES21590.1|  ATP-binding protein                                     172   4e-58    
ref|WP_022963706.1|  ATP-binding protein                                164   4e-58    
ref|WP_021039353.1|  MULTISPECIES: ATPase involved in chromosome ...    154   4e-58    
ref|WP_012789893.1|  mrp                                                147   4e-58    
ref|WP_014431615.1|  mrp                                                140   4e-58    
ref|WP_018399373.1|  mrp                                                145   4e-58    
ref|WP_013345366.1|  sodium:proton antiporter                           169   5e-58    
ref|WP_011610912.1|  mrp                                                156   5e-58    
emb|CCA82594.1|  Na+/H+ antiporter                                      165   5e-58    
ref|WP_020598300.1|  mrp                                                143   5e-58    
ref|WP_004060278.1|  ATP-binding protein                                146   5e-58    
ref|WP_018620496.1|  mrp                                                145   5e-58    
ref|WP_027863748.1|  ATP-binding protein                                166   5e-58    
ref|WP_016552928.1|  hypothetical protein                               166   5e-58    
ref|WP_026920551.1|  ATP-binding protein                                158   5e-58    
gb|EPX96880.1|  ATP-binding protein                                     166   6e-58    
ref|WP_021830571.1|  Scaffold protein for [4Fe-4S] cluster assemb...    147   6e-58    
ref|WP_031329591.1|  ATP-binding protein                                166   6e-58    
ref|WP_005666710.1|  hypothetical protein                               162   7e-58    
ref|WP_039597124.1|  ATP-binding protein                                165   7e-58    
ref|WP_038323967.1|  hypothetical protein                               166   7e-58    
ref|WP_007597634.1|  sodium:proton antiporter                           168   7e-58    
ref|WP_023502658.1|  ATPase involved in chromosome partitioning         154   7e-58    
ref|WP_014682350.1|  mrp                                                150   7e-58    
ref|WP_038032558.1|  ATP-binding protein                                149   8e-58    
ref|WP_031458502.1|  mrp                                                157   8e-58    
ref|WP_034852129.1|  sodium:proton antiporter                           171   8e-58    
ref|WP_028747744.1|  sodium:proton antiporter                           167   8e-58    
ref|WP_036248792.1|  ATP-binding protein                                166   8e-58    
ref|WP_008320592.1|  ATP-binding protein mrp                            146   8e-58    
ref|WP_024960405.1|  ATP-binding protein                                166   8e-58    
ref|WP_007248729.1|  ATP-binding protein                                163   8e-58    
ref|WP_011903242.1|  ATP-binding protein                                160   8e-58    
ref|WP_006726628.1|  sodium:proton antiporter                           167   9e-58    
ref|WP_037139572.1|  sodium:proton antiporter                           166   9e-58    
ref|WP_023014558.1|  MULTISPECIES: sodium:proton antiporter             156   9e-58    
ref|WP_024972306.1|  ATP-binding protein                                165   9e-58    
ref|WP_024542202.1|  MULTISPECIES: ATP-binding protein                  165   1e-57    
ref|WP_019949481.1|  mrp                                                151   1e-57    
gb|AIE91338.1|  ATP-binding protein involved in chromosome partit...    158   1e-57    
ref|WP_004969353.1|  ATP-binding protein Mrp                            147   1e-57    
ref|WP_017902776.1|  ATP-binding protein                                174   1e-57    
ref|WP_017521036.1|  ATP-binding protein                                171   1e-57    
ref|WP_009620715.1|  ParA family protein                                172   1e-57    
ref|WP_009241258.1|  MULTISPECIES: ATP-binding protein                  165   1e-57    
ref|WP_003428798.1|  ParA family protein                                166   1e-57    
ref|WP_024639298.1|  ATP-binding protein                                166   1e-57    
emb|CBI80413.1|  ATP/GTP-binding protein                                163   1e-57    
gb|EUJ15544.1|  ATP-binding protein                                     164   1e-57    
ref|WP_010852163.1|  Septum site-determining protein MinD               139   1e-57    
ref|WP_007530454.1|  sodium:proton antiporter                           167   1e-57    
ref|WP_012357584.1|  ATP-binding protein                                160   1e-57    
ref|WP_013211787.1|  ATP-binding protein                                165   1e-57    
ref|WP_018127527.1|  hypothetical protein                               171   2e-57    



>ref|XP_009764201.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=521

 Score =   581 bits (1498),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 274/297 (92%), Positives = 291/297 (98%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  225   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  284

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  285   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  344

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+PTLSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  345   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPTLSASGDSGMPEVVADPQGEVSRTFQELGV  404

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EW+GE
Sbjct  405   CVVQQCAKIRQQVSTAVSYDRSIKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWTGE  464

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+P+DIEPEEIRP+GNYAV ITWPDGF+QIAPYDQLQ +ERLVEVP+LTPA
Sbjct  465   QKLQYSDIPDDIEPEEIRPLGNYAVEITWPDGFNQIAPYDQLQMMERLVEVPQLTPA  521


 Score =   338 bits (867),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 200/228 (88%), Gaps = 7/228 (3%)
 Frame = +1

Query  151  LLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTRSILTPkaa  330
            LLQAPSS TL+F   +SQ K+GLYVAE   L       +QRH+R L+++ T S L+  + 
Sbjct  4    LLQAPSSPTLTFHHCTSQPKSGLYVAEKSFLQS-----TQRHVRSLNISYTYSSLS--SF  56

Query  331  svkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTT  510
            + KA+++ VS QTAE+EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E+LGEVSFRLELTT
Sbjct  57   TAKAASNGVSGQTAESEVLKALSQIIDPDFGTDIVSCGFVKDLLVDESLGEVSFRLELTT  116

Query  511  PACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCK  690
            PACPIKDMFEQKANEVVAALPWVK V VTMSAQPAKP++AGQLP GLQTISNI+AVSSCK
Sbjct  117  PACPIKDMFEQKANEVVAALPWVKKVNVTMSAQPAKPMYAGQLPAGLQTISNIIAVSSCK  176

Query  691  GGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            GGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  177  GGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  224



>ref|XP_009764200.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=526

 Score =   582 bits (1499),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 274/297 (92%), Positives = 291/297 (98%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  230   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  289

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  290   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  349

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+PTLSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  350   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPTLSASGDSGMPEVVADPQGEVSRTFQELGV  409

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EW+GE
Sbjct  410   CVVQQCAKIRQQVSTAVSYDRSIKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWTGE  469

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+P+DIEPEEIRP+GNYAV ITWPDGF+QIAPYDQLQ +ERLVEVP+LTPA
Sbjct  470   QKLQYSDIPDDIEPEEIRPLGNYAVEITWPDGFNQIAPYDQLQMMERLVEVPQLTPA  526


 Score =   337 bits (865),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/231 (80%), Positives = 200/231 (87%), Gaps = 8/231 (3%)
 Frame = +1

Query  151  LLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTRSIL---TP  321
            LLQAPSS TL+F   +SQ K+GLYVAE   L       +QRH+R L+++ T S L   T 
Sbjct  4    LLQAPSSPTLTFHHCTSQPKSGLYVAEKSFLQS-----TQRHVRSLNISYTYSSLSSFTA  58

Query  322  kaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLE  501
            KAAS  A AS VS QTAE+EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E+LGEVSFRLE
Sbjct  59   KAASNGACASTVSGQTAESEVLKALSQIIDPDFGTDIVSCGFVKDLLVDESLGEVSFRLE  118

Query  502  LTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVS  681
            LTTPACPIKDMFEQKANEVVAALPWVK V VTMSAQPAKP++AGQLP GLQTISNI+AVS
Sbjct  119  LTTPACPIKDMFEQKANEVVAALPWVKKVNVTMSAQPAKPMYAGQLPAGLQTISNIIAVS  178

Query  682  SCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  179  SCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  229



>ref|XP_009627669.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=527

 Score =   578 bits (1490),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 273/297 (92%), Positives = 290/297 (98%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  231   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  291   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  350

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+PTLSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  351   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPTLSASGDSGMPEVVADPQGEVSRTFQELGV  410

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EW+GE
Sbjct  411   CVVQQCAKIRQQVSTAVSYDRSIKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWTGE  470

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+ +DIEPEEIRP+GNYAV ITWPDGF+QIAPYDQLQ +ERLVEVP+LTPA
Sbjct  471   QKLQYSDILDDIEPEEIRPLGNYAVEITWPDGFNQIAPYDQLQMMERLVEVPQLTPA  527


 Score =   339 bits (869),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/233 (80%), Positives = 198/233 (85%), Gaps = 11/233 (5%)
 Frame = +1

Query  151  LLQAPSSVTLSFLPLSSQSKAGLYVAENC--CLLCNSPFPSQRHLRPLSVASTRSIL---  315
            L Q PSS TL+F   +SQ KAGLYVAE    CLL      SQRH+R L+V+ T S L   
Sbjct  4    LFQVPSSSTLTFHQFTSQPKAGLYVAEKSGSCLL------SQRHVRNLNVSYTYSNLSSF  57

Query  316  TPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFR  495
            T K AS  A AS VS QTAE+EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E LGEVSFR
Sbjct  58   TAKVASNGACASTVSGQTAESEVLKALSQIIDPDFGTDIVSCGFVKDLLVDEGLGEVSFR  117

Query  496  LELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVA  675
            LELTTPACPIKDMFEQKANEVVAALPWVK V VTMSAQPAKP++AGQLP GLQTISNI+A
Sbjct  118  LELTTPACPIKDMFEQKANEVVAALPWVKKVNVTMSAQPAKPMYAGQLPAGLQTISNIIA  177

Query  676  VSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  178  VSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  230



>ref|XP_009627670.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=522

 Score =   577 bits (1487),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 273/297 (92%), Positives = 290/297 (98%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  226   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  285

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  286   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  345

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+PTLSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  346   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPTLSASGDSGMPEVVADPQGEVSRTFQELGV  405

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EW+GE
Sbjct  406   CVVQQCAKIRQQVSTAVSYDRSIKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWTGE  465

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+ +DIEPEEIRP+GNYAV ITWPDGF+QIAPYDQLQ +ERLVEVP+LTPA
Sbjct  466   QKLQYSDILDDIEPEEIRPLGNYAVEITWPDGFNQIAPYDQLQMMERLVEVPQLTPA  522


 Score =   339 bits (870),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/230 (78%), Positives = 198/230 (86%), Gaps = 10/230 (4%)
 Frame = +1

Query  151  LLQAPSSVTLSFLPLSSQSKAGLYVAENC--CLLCNSPFPSQRHLRPLSVASTRSILTPk  324
            L Q PSS TL+F   +SQ KAGLYVAE    CLL      SQRH+R L+V+ T S L+  
Sbjct  4    LFQVPSSSTLTFHQFTSQPKAGLYVAEKSGSCLL------SQRHVRNLNVSYTYSNLS--  55

Query  325  aasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLEL  504
            + + K +++ VS QTAE+EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E LGEVSFRLEL
Sbjct  56   SFTAKVASNGVSGQTAESEVLKALSQIIDPDFGTDIVSCGFVKDLLVDEGLGEVSFRLEL  115

Query  505  TTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSS  684
            TTPACPIKDMFEQKANEVVAALPWVK V VTMSAQPAKP++AGQLP GLQTISNI+AVSS
Sbjct  116  TTPACPIKDMFEQKANEVVAALPWVKKVNVTMSAQPAKPMYAGQLPAGLQTISNIIAVSS  175

Query  685  CKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            CKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  176  CKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  225



>ref|XP_006353450.1| PREDICTED: uncharacterized protein LOC102590013 isoform X1 [Solanum 
tuberosum]
Length=561

 Score =   580 bits (1496),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 274/297 (92%), Positives = 289/297 (97%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  265   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  324

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  325   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  384

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+P LSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  385   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPALSASGDSGMPEVVADPQGEVSRTFQELGV  444

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRS KAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EWSGE
Sbjct  445   CVVQQCAKIRQQVSTAVSYDRSFKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWSGE  504

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+P+DIEPEEIRP+GNYAV ITWPDGFSQIAPYDQLQ +ERLVEVP+LTPA
Sbjct  505   QKLQYSDIPDDIEPEEIRPLGNYAVEITWPDGFSQIAPYDQLQMMERLVEVPQLTPA  561


 Score =   330 bits (847),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 187/241 (78%), Positives = 203/241 (84%), Gaps = 8/241 (3%)
 Frame = +1

Query  136  VKEMPLLQAPSSVTLSFLPL-SSQSKAGLYVAENCCL---LCNSPF-PSQRHLRPLSVAS  300
            +K+M LLQAPSS TL+F    +SQ KAGLYVAE   L   L  S F  SQR ++ L+ + 
Sbjct  24   LKKMTLLQAPSSPTLTFHQYCTSQPKAGLYVAEKSFLQSTLSGSCFLSSQRQVKALNFSY  83

Query  301  TRSIL---TPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNE  471
            T S L   T KAAS  A AS VS QTAE+EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E
Sbjct  84   TCSRLSSFTAKAASNGACASSVSGQTAESEVLKALSQIIDPDFGTDIVSCGFVKDLLVDE  143

Query  472  ALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGL  651
             LGEVSF+LELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPAKP++AGQLP GL
Sbjct  144  NLGEVSFQLELTTPACPIKDMFEQKANEVVAELPWVKKVNVTMSAQPAKPIYAGQLPAGL  203

Query  652  QTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            QTISNI+AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LE
Sbjct  204  QTISNIIAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILE  263

Query  832  M  834
            M
Sbjct  264  M  264



>ref|XP_006353451.1| PREDICTED: uncharacterized protein LOC102590013 isoform X2 [Solanum 
tuberosum]
Length=556

 Score =   580 bits (1496),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 274/297 (92%), Positives = 289/297 (97%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  260   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  319

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  320   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  379

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+P LSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  380   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPALSASGDSGMPEVVADPQGEVSRTFQELGV  439

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRS KAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EWSGE
Sbjct  440   CVVQQCAKIRQQVSTAVSYDRSFKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWSGE  499

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+P+DIEPEEIRP+GNYAV ITWPDGFSQIAPYDQLQ +ERLVEVP+LTPA
Sbjct  500   QKLQYSDIPDDIEPEEIRPLGNYAVEITWPDGFSQIAPYDQLQMMERLVEVPQLTPA  556


 Score =   330 bits (847),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 203/238 (85%), Gaps = 7/238 (3%)
 Frame = +1

Query  136  VKEMPLLQAPSSVTLSFLPL-SSQSKAGLYVAENCCL---LCNSPF-PSQRHLRPLSVAS  300
            +K+M LLQAPSS TL+F    +SQ KAGLYVAE   L   L  S F  SQR ++ L+ + 
Sbjct  24   LKKMTLLQAPSSPTLTFHQYCTSQPKAGLYVAEKSFLQSTLSGSCFLSSQRQVKALNFSY  83

Query  301  TRSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALG  480
            T S L+  + + KA+++ VS QTAE+EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E LG
Sbjct  84   TCSRLS--SFTAKAASNGVSGQTAESEVLKALSQIIDPDFGTDIVSCGFVKDLLVDENLG  141

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            EVSF+LELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPAKP++AGQLP GLQTI
Sbjct  142  EVSFQLELTTPACPIKDMFEQKANEVVAELPWVKKVNVTMSAQPAKPIYAGQLPAGLQTI  201

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SNI+AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  202  SNIIAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  259



>ref|XP_004251600.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=530

 Score =   578 bits (1491),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 273/297 (92%), Positives = 289/297 (97%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  234   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  293

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  294   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  353

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+P LSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  354   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPALSASGDSGMPEVVADPQGEVSRTFQELGV  413

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRS KAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EWSGE
Sbjct  414   CVVQQCAKIRQQVSTAVSYDRSFKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWSGE  473

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+P+DIEPEEIRP+GNYAV ITWPDGF+QIAPYDQLQ +ERLVEVP+LTPA
Sbjct  474   QKLQYSDIPDDIEPEEIRPLGNYAVEITWPDGFNQIAPYDQLQMMERLVEVPQLTPA  530


 Score =   327 bits (837),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/235 (76%), Positives = 201/235 (86%), Gaps = 7/235 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPL-SSQSKAGLYVAENCCL---LCNSPF-PSQRHLRPLSVASTRS  309
            M LLQAPSS TL+F    +SQSKAGLYVAE   +   L  S F  SQR ++ L+ + T S
Sbjct  1    MTLLQAPSSPTLTFHQYCTSQSKAGLYVAEKSFIQSTLSGSCFLSSQRQVKGLNFSYTCS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             L+  + + KA+++ VS QTA++EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E LGEVS
Sbjct  61   RLS--SVTAKAASNGVSGQTADSEVLKALSQIIDPDFGTDIVSCGFVKDLLVDENLGEVS  118

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            F+LELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPAKP++AGQLP GLQTISNI
Sbjct  119  FQLELTTPACPIKDMFEQKANEVVAELPWVKKVNVTMSAQPAKPIYAGQLPAGLQTISNI  178

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            +AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  179  IAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  233



>ref|XP_004251599.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=535

 Score =   578 bits (1491),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 273/297 (92%), Positives = 289/297 (97%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  239   NAEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  298

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  299   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  358

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPI+P LSASGDSG PEVVADP+GEV+ TFQELGV
Sbjct  359   KRYYPFGRGSGSQVVQQFGIPHLFDLPIQPALSASGDSGMPEVVADPQGEVSRTFQELGV  418

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRS KAIKVKVP+SDEEFYLHPATVRRNDRSA+SV EWSGE
Sbjct  419   CVVQQCAKIRQQVSTAVSYDRSFKAIKVKVPDSDEEFYLHPATVRRNDRSAQSVDEWSGE  478

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQYSD+P+DIEPEEIRP+GNYAV ITWPDGF+QIAPYDQLQ +ERLVEVP+LTPA
Sbjct  479   QKLQYSDIPDDIEPEEIRPLGNYAVEITWPDGFNQIAPYDQLQMMERLVEVPQLTPA  535


 Score =   325 bits (834),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/238 (77%), Positives = 200/238 (84%), Gaps = 8/238 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPL-SSQSKAGLYVAENCCL---LCNSPF-PSQRHLRPLSVASTRS  309
            M LLQAPSS TL+F    +SQSKAGLYVAE   +   L  S F  SQR ++ L+ + T S
Sbjct  1    MTLLQAPSSPTLTFHQYCTSQSKAGLYVAEKSFIQSTLSGSCFLSSQRQVKGLNFSYTCS  60

Query  310  IL---TPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALG  480
             L   T KAAS  A A  VS QTA++EVLKAL+QIIDPDFGTDIVSCGFVKDLLV+E LG
Sbjct  61   RLSSVTAKAASNGACAPSVSGQTADSEVLKALSQIIDPDFGTDIVSCGFVKDLLVDENLG  120

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            EVSF+LELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPAKP++AGQLP GLQTI
Sbjct  121  EVSFQLELTTPACPIKDMFEQKANEVVAELPWVKKVNVTMSAQPAKPIYAGQLPAGLQTI  180

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SNI+AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  181  SNIIAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  238



>emb|CBI28104.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   579 bits (1493),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 275/298 (92%), Positives = 291/298 (98%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  258   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  317

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  318   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  377

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP GE+A TFQ LGV
Sbjct  378   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPLGEIAQTFQNLGV  437

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ IKAI+VKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  438   CVVQQCAKIRQQVSTAVTYDKFIKAIRVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  497

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP+LTPAQ
Sbjct  498   QKLQYADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQLTPAQ  555


 Score =   318 bits (816),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 188/232 (81%), Gaps = 6/232 (3%)
 Frame = +1

Query  142  EMPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTRSILTP  321
            +M LL APSS+ LSF     QS+    ++  CC    S  P QRH +P  ++  RS+L+ 
Sbjct  31   KMQLLHAPSSLHLSFNNSRPQSEKSFLLSSVCC----SSHP-QRHHKPTWISYKRSVLSS  85

Query  322  kaasvkasasvvsNQ-TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRL  498
                  ++++   +  TAEA+VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALGEVSFRL
Sbjct  86   ITPKSASASTSAISSGTAEADVLKALSQIIDPDFGTDIVSCGFVKDLQINEALGEVSFRL  145

Query  499  ELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAV  678
            ELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVFAGQLP GLQTISNI+AV
Sbjct  146  ELTTPACPIKDMFEQKANEVVAMLPWVKNVNVTMSAQPARPVFAGQLPAGLQTISNIIAV  205

Query  679  SSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  206  SSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  257



>ref|XP_002281353.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Vitis vinifera]
Length=525

 Score =   579 bits (1492),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 275/298 (92%), Positives = 291/298 (98%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  227   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  286

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  287   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  346

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP GE+A TFQ LGV
Sbjct  347   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPLGEIAQTFQNLGV  406

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ IKAI+VKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  407   CVVQQCAKIRQQVSTAVTYDKFIKAIRVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  466

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP+LTPAQ
Sbjct  467   QKLQYADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQLTPAQ  524


 Score =   317 bits (813),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 189/231 (82%), Gaps = 6/231 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTRSILTPk  324
            M LL APSS+ LSF     QS+    ++  CC    S  P QRH +P  ++  RS+L+  
Sbjct  1    MQLLHAPSSLHLSFNNSRPQSEKSFLLSSVCC----SSHP-QRHHKPTWISYKRSVLSSI  55

Query  325  a-asvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLE  501
               S  AS S +S+ TAEA+VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALGEVSFRLE
Sbjct  56   TPKSASASTSAISSGTAEADVLKALSQIIDPDFGTDIVSCGFVKDLQINEALGEVSFRLE  115

Query  502  LTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVS  681
            LTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVFAGQLP GLQTISNI+AVS
Sbjct  116  LTTPACPIKDMFEQKANEVVAMLPWVKNVNVTMSAQPARPVFAGQLPAGLQTISNIIAVS  175

Query  682  SCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  176  SCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  226



>emb|CDP03365.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   582 bits (1500),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/297 (92%), Positives = 292/297 (98%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPT+YLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLV+DMPP
Sbjct  227   NPEKKTIIPTDYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVVDMPP  286

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  287   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  346

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRP+LSASGDSG PEVVADP+GE+ASTFQ+LGV
Sbjct  347   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPSLSASGDSGVPEVVADPQGEIASTFQDLGV  406

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YDR+IK IKVKVP SDEEFYLHPATVRRND+SA+SV EW+GE
Sbjct  407   CVVQQCAKIRQQVSTAVTYDRTIKVIKVKVPASDEEFYLHPATVRRNDQSAQSVDEWTGE  466

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQY+D+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQ +ERLV+VP+LTPA
Sbjct  467   QKLQYTDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQEMERLVDVPQLTPA  523


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 189/230 (82%), Gaps = 10/230 (4%)
 Frame = +1

Query  154  LQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVA---STRSILTPk  324
            L   SS TL F   + Q KA       C    +S F S R+++ L  +   S+ S +T K
Sbjct  4    LHTSSSPTLPFHHSTFQPKA-------CVHAVSSSFLSHRNVKSLWASFGHSSFSSITAK  56

Query  325  aasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLEL  504
            AASV+A+AS VS  TAE++VLKAL+QIIDPDFGTDIVSCGFVKDLLVNEA+GEVSFRLEL
Sbjct  57   AASVEANASTVSLHTAESDVLKALSQIIDPDFGTDIVSCGFVKDLLVNEAVGEVSFRLEL  116

Query  505  TTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSS  684
            TTPACPIKDMFEQKANEVVAALPWV+ V VTMSAQPAKP+FAG LP GLQTISNI+AVSS
Sbjct  117  TTPACPIKDMFEQKANEVVAALPWVRKVNVTMSAQPAKPMFAGALPMGLQTISNIIAVSS  176

Query  685  CKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            CKGGVGKSTVAVNLA+TLA MGARVG+FDADVYGPSLPTMVSPENRLLEM
Sbjct  177  CKGGVGKSTVAVNLAFTLAGMGARVGLFDADVYGPSLPTMVSPENRLLEM  226



>ref|XP_004148711.1| PREDICTED: protein mrp homolog [Cucumis sativus]
 ref|XP_004163266.1| PREDICTED: protein mrp homolog [Cucumis sativus]
 gb|KGN65376.1| hypothetical protein Csa_1G391590 [Cucumis sativus]
Length=529

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 290/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE ++I+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTT EWGELDYLVIDMPP
Sbjct  230   NPETRSILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVISQLLTTAEWGELDYLVIDMPP  289

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  290   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  349

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PE VADP+GEVA TFQ+LGV
Sbjct  350   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGIPEAVADPQGEVAKTFQDLGV  409

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YDR+I+AI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  410   CVVQQCAKIRQQVSTAVTYDRTIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  469

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDI+PEEI+PMGNYAV+ITWPDGF+QIAPYDQLQ +ERLV+VPELTPAQ
Sbjct  470   QKLQYADIPEDIQPEEIKPMGNYAVTITWPDGFNQIAPYDQLQMLERLVDVPELTPAQ  527


 Score =   306 bits (783),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/235 (73%), Positives = 190/235 (81%), Gaps = 14/235 (6%)
 Frame = +1

Query  151  LLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPS----QRHLRPLSVASTRSI--  312
            LL  PSS  LS   + +QSK      +N  LL  S F S    QR  R +S+    +I  
Sbjct  2    LLHTPSSPRLSLKIIKAQSKP-----DNVLLL--SAFKSLVYNQRFDRSISLLRGNTISS  54

Query  313  -LTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
              T  AAS +A ASV+S +TAE +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVS
Sbjct  55   SFTRNAASTEAGASVMSTETAETDVLKALSQIIDPDFGTDIVSCGFVKDLQIDEALGEVS  114

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACP+KDMFEQ+ANE VAALPWVK VKVTMSAQPAKP++AG+LPPGLQ ISNI
Sbjct  115  FRLELTTPACPVKDMFEQRANEEVAALPWVKNVKVTMSAQPAKPIYAGELPPGLQRISNI  174

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  175  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  229



>gb|KDP32311.1| hypothetical protein JCGZ_13236 [Jatropha curcas]
Length=533

 Score =   569 bits (1467),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/298 (91%), Positives = 287/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  235   NPEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  294

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  295   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  354

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRP LSASGDSG PEVVADP+GEV+  FQ+LG+
Sbjct  355   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPNLSASGDSGMPEVVADPQGEVSKIFQDLGI  414

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  415   CVVQQCAKIRQQVSTAVMYDKSIKAIKVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  474

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+DVPEDIEPEEI+PMGNYAV ITWPDGF+QIAPYDQLQTIERLV VPE TP +
Sbjct  475   QKLQYTDVPEDIEPEEIQPMGNYAVQITWPDGFNQIAPYDQLQTIERLVGVPEPTPMR  532


 Score =   306 bits (784),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 183/236 (78%), Gaps = 8/236 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQ----RHLRPLSVASTRSI  312
            M L+ APSS+      ++SQSK GL +   C  L  SPF       +  +PL ++  RS+
Sbjct  1    MQLIYAPSSLYFCSQTVNSQSKEGLLLPGKC--LQVSPFGYSVQPLKLEKPLCLSHKRSV  58

Query  313  LTPkaasvkasasvvsNQT--AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEV  486
            L+       +        T  AE++VLKAL+QIIDPDFGTDIVSCGFVKDL + E  GEV
Sbjct  59   LSSLKTRASSVQDASEISTGSAESDVLKALSQIIDPDFGTDIVSCGFVKDLYIVEDQGEV  118

Query  487  SFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISN  666
            SFRLELTTPACP+KDMFEQ+ANEVVA LPWVK VKVTMSAQPA+PVFAGQLP GLQTISN
Sbjct  119  SFRLELTTPACPVKDMFEQRANEVVAMLPWVKNVKVTMSAQPARPVFAGQLPAGLQTISN  178

Query  667  IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  179  IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  234



>ref|XP_007013248.1| ATP binding isoform 1 [Theobroma cacao]
 gb|EOY30867.1| ATP binding isoform 1 [Theobroma cacao]
Length=615

 Score =   566 bits (1460),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/298 (90%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVK+VSFGFAGQG AIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  317   NPEKRTIIPTEYLGVKMVSFGFAGQGHAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  376

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  377   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  436

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADP+GEVA TFQ LGV
Sbjct  437   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPQGEVAKTFQNLGV  496

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  497   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  556

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY D+PEDIEPEEIRPMGNYAVSITWPDGF+QIAPYDQLQ +ERLV+ P  T  Q
Sbjct  557   QKLQYGDIPEDIEPEEIRPMGNYAVSITWPDGFNQIAPYDQLQMMERLVDFPLPTSVQ  614


 Score =   307 bits (787),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/240 (72%), Positives = 187/240 (78%), Gaps = 9/240 (4%)
 Frame = +1

Query  136  VKEMPLLQAPSSVTLSFLPLSSQSKAGLYVAENC----CLLCNSPFPSQRHLRPLSVAST  303
            + +M LL APS   LSF       K GL   E C       C   F  Q+  R + V+  
Sbjct  79   LSKMQLLHAPSWPHLSFQTTKQHLKGGLLSLEKCLQPSAAYCF--FQPQKLERSIWVSHK  136

Query  304  RS---ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEA  474
            RS     TPKAAS++A +S  S  TAE +VLKAL+QI+DPDFGTDIVSCGFVKDLL++EA
Sbjct  137  RSNFSCFTPKAASLEAGSSATSIGTAEGDVLKALSQIMDPDFGTDIVSCGFVKDLLIDEA  196

Query  475  LGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQ  654
            LGEVSFRLELTTPACPIKDMFEQ+ANEVVA LPWV  V VTMSAQPAKP+FAGQLP GLQ
Sbjct  197  LGEVSFRLELTTPACPIKDMFEQQANEVVARLPWVSKVSVTMSAQPAKPIFAGQLPAGLQ  256

Query  655  TISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            TISNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  257  TISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  316



>ref|XP_011078358.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Sesamum indicum]
Length=575

 Score =   570 bits (1470),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/294 (90%), Positives = 288/294 (98%), Gaps = 0/294 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  279   NPEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  338

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPL+AAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  339   GTGDIQLTLCQVVPLSAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  398

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQ+FGIPHLF+LPIRPTLSASGDSG PEVVADP+GEVA  FQ+LGV
Sbjct  399   KRYYPFGRGSGSQVVQEFGIPHLFELPIRPTLSASGDSGVPEVVADPQGEVARAFQDLGV  458

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP SDEEF+LHPATVRRNDRSAESV EW+GE
Sbjct  459   CVVQQCAKIRQQVSTAVTYDKSMKAIRVKVPESDEEFFLHPATVRRNDRSAESVDEWTGE  518

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPEL  1783
             QKLQY+D+PEDIEPEEIRPMGNYAVSITWPDGF+QIAPYDQLQ +ERLV+VP+L
Sbjct  519   QKLQYADIPEDIEPEEIRPMGNYAVSITWPDGFNQIAPYDQLQMMERLVDVPQL  572


 Score =   298 bits (762),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/238 (71%), Positives = 190/238 (80%), Gaps = 8/238 (3%)
 Frame = +1

Query  139  KEMPLLQAPSSVTLSFLPLSSQSKAG-LYVAENCCL--LCNSPFPSQRHLRPLSVA---S  300
            ++M LL AP S T +     SQSK   ++VA    L  +  + F S+RHLR    +   S
Sbjct  43   RKMQLLHAPFSSTRALHCSISQSKERPVHVAGKSLLEPVTATLFTSKRHLRRAWYSYKDS  102

Query  301  TRSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALG  480
              S +TPKAA  + S     + TAE +VLKAL+QIIDPDFGTDIVSCGFVKDL V+E  G
Sbjct  103  GCSSVTPKAAPSQVSEVA--SGTAETDVLKALSQIIDPDFGTDIVSCGFVKDLKVSEESG  160

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            EVSFRLELTTPACP+KDMFE+KA+EVVAALPWV+TVKVTMSAQPA+PVFAG+LP GLQTI
Sbjct  161  EVSFRLELTTPACPVKDMFEKKAHEVVAALPWVETVKVTMSAQPARPVFAGELPAGLQTI  220

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SN+VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  221  SNVVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  278



>ref|XP_008463360.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X1 [Cucumis melo]
Length=529

 Score =   570 bits (1468),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 290/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTT EWGELDYL+IDMPP
Sbjct  230   NPETRTILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVISQLLTTAEWGELDYLIIDMPP  289

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  290   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  349

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PE VADP+GEVA TFQ+LGV
Sbjct  350   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGIPEAVADPQGEVAKTFQDLGV  409

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YDR+I+AI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  410   CVVQQCAKIRQQVSTAVTYDRTIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  469

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDI+PEEI+PMGNYAV+ITWPDGF+QIAPYDQLQ +ERLV+VPEL+PAQ
Sbjct  470   QKLQYADIPEDIQPEEIKPMGNYAVTITWPDGFNQIAPYDQLQMMERLVDVPELSPAQ  527


 Score =   297 bits (761),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/235 (73%), Positives = 188/235 (80%), Gaps = 14/235 (6%)
 Frame = +1

Query  151  LLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPS----QRHLRPLSVASTRSI--  312
            LL  PSS  LS   + +QSK      +N  LL  S F S    QR  R LS+     I  
Sbjct  2    LLHTPSSPCLSLNIIKAQSKP-----DNVLLL--SAFKSLVYNQRIDRSLSLLRGNFIPS  54

Query  313  -LTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
              T  AAS +A ASV+S +TAE +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVS
Sbjct  55   SFTRNAASTEAGASVMSTETAETDVLKALSQIIDPDFGTDIVSCGFVKDLQIDEALGEVS  114

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACP+KDMFEQ+ANE VAALPWVK VKVTMSAQPAKP++AG+LPPGLQ IS+I
Sbjct  115  FRLELTTPACPVKDMFEQRANEEVAALPWVKNVKVTMSAQPAKPIYAGELPPGLQRISSI  174

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  175  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  229



>ref|XP_010254190.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=534

 Score =   569 bits (1466),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 270/298 (91%), Positives = 287/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE ++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPETRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGD G PEVV DP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDIGMPEVVTDPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVMYDKSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+DVPEDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP+   AQ
Sbjct  476   QKLQYADVPEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQPARAQ  533


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = +1

Query  250  NSPFPSQRH---LRPLSVASTRSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDF  420
            N    SQRH   +R L   ST S +T +A   +A AS + N  AE +VL AL+QIIDPDF
Sbjct  38   NCSISSQRHEGIVRLLRNPSTSSPVTTRATPAEAGASTILNSNAEKDVLTALSQIIDPDF  97

Query  421  GTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTM  600
            GTDIVSCGFVKD+ +NEALGEVSFRLELTTPACP+KDMFEQKANEVVA LPWVK V VTM
Sbjct  98   GTDIVSCGFVKDMHINEALGEVSFRLELTTPACPVKDMFEQKANEVVAMLPWVKKVNVTM  157

Query  601  SAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADV  780
            SAQPA+PVFAGQLP GLQTISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADV
Sbjct  158  SAQPARPVFAGQLPTGLQTISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADV  217

Query  781  YGPSLPTMVSPENRLLEM  834
            YGPSLPTMVSPE+RLLEM
Sbjct  218  YGPSLPTMVSPEHRLLEM  235



>gb|EYU23024.1| hypothetical protein MIMGU_mgv1a004312mg [Erythranthe guttata]
Length=533

 Score =   563 bits (1450),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/294 (89%), Positives = 287/294 (98%), Gaps = 0/294 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  237   NPEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  296

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  297   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  356

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVV++FGIPHLF+LPIRPTLSASGDSG PEVV+DP+GEVA+ FQELGV
Sbjct  357   KRYYPFGRGSGSQVVKEFGIPHLFELPIRPTLSASGDSGVPEVVSDPQGEVATAFQELGV  416

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP SDEEFYLHPATVRRNDRSA+SV EW+GE
Sbjct  417   CVVQQCAKIRQQVSTAVTYDKSMKAIRVKVPESDEEFYLHPATVRRNDRSADSVDEWTGE  476

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPEL  1783
             QKL+Y+D+ +DIEPE+IR MGNYAVSITWPDGFSQIAPYDQLQ +ERLV+VP+L
Sbjct  477   QKLKYADIADDIEPEDIRAMGNYAVSITWPDGFSQIAPYDQLQMMERLVDVPQL  530


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/236 (68%), Positives = 189/236 (80%), Gaps = 6/236 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAG--LYVAENCC--LLCNSPFPSQRHLRPLSVASTRSI  312
            M +L AP + T +F   ++    G  L+V+      L+ ++ F SQR LR    +   S+
Sbjct  1    MQILHAPFASTPAFYSAAASQPKGRPLHVSGKSLAELITSTSFSSQRQLRSAWFSYGDSV  60

Query  313  LTPka--asvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEV  486
             +  +  A+   + S V++QTAE +VLKAL+QIIDPDFGTDIVSCGFVKDL V++ALGEV
Sbjct  61   CSSVSPRAASSQAVSEVASQTAETDVLKALSQIIDPDFGTDIVSCGFVKDLNVDKALGEV  120

Query  487  SFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISN  666
            SFRLELTTPACP+KDMFEQKANEVVAALPWV+ V VTMSAQPA+PV+AGQLP GLQT+SN
Sbjct  121  SFRLELTTPACPVKDMFEQKANEVVAALPWVEKVNVTMSAQPARPVYAGQLPAGLQTVSN  180

Query  667  IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            +VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  181  VVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  236



>ref|XP_004512951.1| PREDICTED: protein mrp homolog isoform X2 [Cicer arietinum]
Length=534

 Score =   572 bits (1474),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/291 (92%), Positives = 286/291 (98%), Gaps = 0/291 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  243   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  302

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  303   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  362

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+G+V+  FQELGV
Sbjct  363   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGDVSRIFQELGV  422

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+SDEEF+LHPATVRRNDRSA+SV EWSGE
Sbjct  423   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSDEEFFLHPATVRRNDRSAQSVDEWSGE  482

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
             QKLQY+DVPEDI+PEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  483   QKLQYTDVPEDIQPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTLERLVGV  533


 Score =   291 bits (746),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +NEALGEVSFRLELTTPACPIKD+FEQK
Sbjct  87   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLQINEALGEVSFRLELTTPACPIKDVFEQK  146

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK V VTMSAQPAKP+FA QLP GLQTISNIVAVSSCKGGVGKSTVAVNL
Sbjct  147  ANEVVAILPWVKNVNVTMSAQPAKPLFADQLPAGLQTISNIVAVSSCKGGVGKSTVAVNL  206

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  207  AYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  242



>ref|XP_010532831.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Tarenaya hassleriana]
Length=538

 Score =   568 bits (1464),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/298 (90%), Positives = 289/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  240   NPEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  299

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF+ADG
Sbjct  300   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFEADG  359

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSGTPEVV DP GEV+ TFQ+LGV
Sbjct  360   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVTDPLGEVSRTFQDLGV  419

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+S+KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  420   CVVQQCAKIRQQVSTAVMYDKSLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  479

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+QY D+PEDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+T+ERLV+VP L+P +
Sbjct  480   QKVQYGDIPEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLETMERLVDVPPLSPLE  537


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/240 (68%), Positives = 184/240 (77%), Gaps = 11/240 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSF-----LPLSSQSKAGL----YVAENCCLLCNSPFPSQR-HLRPLSV  294
            MPLL A S    SF     LP   +S+  L    ++     +  + P   +R    P  V
Sbjct  1    MPLLHAQSWRQPSFQGRASLPRRGKSRESLLSEEFLQPQASIFTSKPLGIRRSKWEPQKV  60

Query  295  ASTRSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEA  474
            + +RS++  KA S +AS  V   +TAE +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA
Sbjct  61   SVSRSLVV-KATSAQASNGVRVTETAEKDVLKALSQIIDPDFGTDIVSCGFVKDLEIDEA  119

Query  475  LGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQ  654
            LGEVSFRLELTTPACP+KDMFEQKANEVV ALPWVK V VTMSAQPAKP+FAG LPPGL 
Sbjct  120  LGEVSFRLELTTPACPVKDMFEQKANEVVEALPWVKKVSVTMSAQPAKPMFAGNLPPGLA  179

Query  655  TISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             ISNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMV+PENRLLEM
Sbjct  180  RISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVNPENRLLEM  239



>ref|XP_009352487.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Pyrus x bretschneideri]
Length=538

 Score =   575 bits (1481),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 274/298 (92%), Positives = 289/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  240   NPETKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  299

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HF+ADG
Sbjct  300   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFEADG  359

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVVQQFGIP+LFDLPIRPTLSASGDSGTPEVVADP GEV+ TFQELG+
Sbjct  360   KRYYPFGKGSGSQVVQQFGIPNLFDLPIRPTLSASGDSGTPEVVADPLGEVSKTFQELGI  419

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  420   CVVQQCAKIRQQVSTAVMYDKSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  479

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQ++DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP L P+Q
Sbjct  480   QKLQFADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPRLVPSQ  537


 Score =   288 bits (737),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 177/241 (73%), Gaps = 13/241 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLY------VAENCCLLCNSPFPSQRHLRPLSVASTR  306
            M LL  PSS+ LSF  + S   AGL       +  +  + C+     QR  R   V+   
Sbjct  1    MQLLHVPSSLYLSFQNVKSHEDAGLLSSYEKPLQSSTAVFCS--LQQQRPERSKWVSRRG  58

Query  307  SILTPkaasvkas-----asvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNE  471
            S L+       +      A  +    AE +VLKAL+QIIDPDFGTDIVSCGFVKDL +N+
Sbjct  59   SGLSSFTTKAASLEDVVGADEILKAEAEKDVLKALSQIIDPDFGTDIVSCGFVKDLDIND  118

Query  472  ALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGL  651
              GEVSFRLELTTPACPIKDMFEQ+ANEVV ALPWVK+V VTMSAQPAKP++AGQLP GL
Sbjct  119  TSGEVSFRLELTTPACPIKDMFEQQANEVVNALPWVKSVSVTMSAQPAKPIYAGQLPAGL  178

Query  652  QTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            QTISN++AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENR+L 
Sbjct  179  QTISNVIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRILV  238

Query  832  M  834
            M
Sbjct  239  M  239



>ref|XP_008337454.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
[Malus domestica]
Length=538

 Score =   568 bits (1465),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/298 (91%), Positives = 286/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  240   NPETKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  299

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HF+ADG
Sbjct  300   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFEADG  359

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVVQQFGIP+LFDLPIRPTLSASGDSGTPEVVADP GEV+  FQ+LG+
Sbjct  360   KRYYPFGKGSGSQVVQQFGIPNLFDLPIRPTLSASGDSGTPEVVADPLGEVSKXFQDLGI  419

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  420   CVVQQCAKIRQQVSTAVMYDKSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  479

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKL + DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP L P+Q
Sbjct  480   QKLXFDDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPRLVPSQ  537


 Score =   294 bits (752),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 179/241 (74%), Gaps = 13/241 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLY------VAENCCLLCNSPFPSQRHLRPLSVASTR  306
            M LL  PSS+ LSF  + S   AGL       +  +  + C+     QR  R   V+   
Sbjct  1    MQLLHVPSSLYLSFQNVKSHEDAGLLSSYEKPLQSSTAVFCS--LQQQRPERSKWVSRRD  58

Query  307  SILTPkaasvkas-----asvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNE  471
            S+L+       +      A  +    AE +VLKAL+QIIDPDFGTDIVSCGFVKDL +N+
Sbjct  59   SVLSSFTTKAASLEDVVGADEILKAEAEKDVLKALSQIIDPDFGTDIVSCGFVKDLDIND  118

Query  472  ALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGL  651
            A GEVSFRLELTTPACPIKDMFEQ+ANEVV ALPWVK+V VTMSAQPAKP++AGQLP GL
Sbjct  119  ASGEVSFRLELTTPACPIKDMFEQQANEVVNALPWVKSVSVTMSAQPAKPIYAGQLPAGL  178

Query  652  QTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            QTISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENR+L 
Sbjct  179  QTISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRILV  238

Query  832  M  834
            M
Sbjct  239  M  239



>ref|XP_004512950.1| PREDICTED: protein mrp homolog isoform X1 [Cicer arietinum]
Length=571

 Score =   571 bits (1471),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/291 (92%), Positives = 286/291 (98%), Gaps = 0/291 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  280   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  339

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  340   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  399

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+G+V+  FQELGV
Sbjct  400   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGDVSRIFQELGV  459

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+SDEEF+LHPATVRRNDRSA+SV EWSGE
Sbjct  460   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSDEEFFLHPATVRRNDRSAQSVDEWSGE  519

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
             QKLQY+DVPEDI+PEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  520   QKLQYTDVPEDIQPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTLERLVGV  570


 Score =   291 bits (746),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +NEALGEVSFRLELTTPACPIKD+FEQK
Sbjct  124  TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLQINEALGEVSFRLELTTPACPIKDVFEQK  183

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK V VTMSAQPAKP+FA QLP GLQTISNIVAVSSCKGGVGKSTVAVNL
Sbjct  184  ANEVVAILPWVKNVNVTMSAQPAKPLFADQLPAGLQTISNIVAVSSCKGGVGKSTVAVNL  243

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDADVYGPSLPTMVSPENR+LEM
Sbjct  244  AYTLADMGARVGIFDADVYGPSLPTMVSPENRILEM  279



>ref|XP_010049769.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
[Eucalyptus grandis]
Length=529

 Score =   568 bits (1463),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 270/292 (92%), Positives = 285/292 (98%), Gaps = 0/292 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  237   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  296

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  297   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  356

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG P+VVADP GEVA TFQ+LGV
Sbjct  357   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPDVVADPLGEVAKTFQDLGV  416

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             C+VQQCA+IRQQVSTAV+YD+ IKAIKVKVP+SDEEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  417   CIVQQCAKIRQQVSTAVTYDKVIKAIKVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGE  476

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVP  1777
             QKLQYSDVPEDIEPEEIRPMGNYAVSI WPDGFSQIAPYDQLQTIERLV VP
Sbjct  477   QKLQYSDVPEDIEPEEIRPMGNYAVSIVWPDGFSQIAPYDQLQTIERLVGVP  528


 Score =   294 bits (752),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QTAE +VLKAL+QIIDPDFGTDIVSCGFVKDLL++EALGEVSFRLELTTPACPIKDMFEQ
Sbjct  80   QTAEGDVLKALSQIIDPDFGTDIVSCGFVKDLLIDEALGEVSFRLELTTPACPIKDMFEQ  139

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVA L WVK VKVTMSAQPAKPVF G+LPPGLQTISNI+AVSSCKGGVGKSTVAVN
Sbjct  140  QANEVVANLHWVKNVKVTMSAQPAKPVFTGELPPGLQTISNIIAVSSCKGGVGKSTVAVN  199

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMVSP+NRLLEM
Sbjct  200  LAYTLAGMGARVGIFDADVYGPSLPTMVSPDNRLLEM  236



>ref|XP_010249844.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X5 [Nelumbo nucifera]
Length=540

 Score =   564 bits (1454),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAV+VTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVVVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDEEF+LHPATVRRND+SA+S+ EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEEFFLHPATVRRNDQSAQSIDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDIEPE+I PMGNYAVSITWPDGF QIAPYDQLQT+ERLV V +  PAQ
Sbjct  476   QKLQYTDIPEDIEPEDIWPMGNYAVSITWPDGFIQIAPYDQLQTMERLVHVCKPAPAQ  533


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRH---LRPLSVASTRS  309
            M LLQAPS   ++ L  +S    G    +    +   N    SQRH   +R L   S  S
Sbjct  1    MQLLQAPSLSNITLLSTTSSLNRGFLSPKKSFDISTVNCSISSQRHEGFVRLLRSQSISS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             +T +AASVKA AS+VS  TAE +VL  L+QIIDPDFGTDIVSCGFVKDL +NE LGEVS
Sbjct  61   TVTTRAASVKADASIVSIGTAENDVLAVLSQIIDPDFGTDIVSCGFVKDLHINETLGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVF GQLP GLQTISNI
Sbjct  121  FRLELTTPACPIKDMFEQKANEVVAMLPWVKKVNVTMSAQPARPVFEGQLPIGLQTISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPEN LLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENCLLEM  235



>ref|XP_008242594.1| PREDICTED: cytosolic Fe-S cluster assembly factor nubp1-A [Prunus 
mume]
Length=537

 Score =   569 bits (1467),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/298 (90%), Positives = 290/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKLVSFGFAGQGRA+MRGPMVSGVINQLLTTTEWGELDYLV+DMPP
Sbjct  239   NPEKKTIIPTEYLGVKLVSFGFAGQGRAVMRGPMVSGVINQLLTTTEWGELDYLVVDMPP  298

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  299   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  358

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVV+QFGIP+LFDLPIRPTLSASGDSGTPEVVADP GEV+ TFQ++G+
Sbjct  359   KRYYPFGRGSGSQVVEQFGIPNLFDLPIRPTLSASGDSGTPEVVADPLGEVSKTFQDIGI  418

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDE F LHPATVRRNDRSA+SV EW+GE
Sbjct  419   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEAFLLHPATVRRNDRSAQSVDEWTGE  478

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQ++DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP+  P+Q
Sbjct  479   QKLQFADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQQVPSQ  536


 Score =   289 bits (740),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/238 (67%), Positives = 176/238 (74%), Gaps = 8/238 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNS---PFPSQRHLRPLSVASTRSIL  315
            M LL  PSS  LSF  + +  +AGL   E    L ++       QR  R    +   S L
Sbjct  1    MQLLHVPSSFCLSFQNVKTHEEAGLPSYEKTLQLSSAICCSLQQQRPERSKWASRRGSAL  60

Query  316  TPkaasvkasasvv-----sNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALG  480
            +   A   +   V      S   AE++VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALG
Sbjct  61   SSFTAKAASLEDVAGAPAISKGAAESDVLKALSQIIDPDFGTDIVSCGFVKDLDINEALG  120

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            EVSFRLELTTPACPIKDMFEQKANEVV  LPWVK V VTMSAQPA+P++A QLP GLQTI
Sbjct  121  EVSFRLELTTPACPIKDMFEQKANEVVNLLPWVKNVSVTMSAQPARPIYAEQLPAGLQTI  180

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENR+L M
Sbjct  181  SNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRILVM  238



>ref|XP_010249845.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X6 [Nelumbo nucifera]
Length=534

 Score =   564 bits (1453),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAV+VTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVVVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDEEF+LHPATVRRND+SA+S+ EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEEFFLHPATVRRNDQSAQSIDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDIEPE+I PMGNYAVSITWPDGF QIAPYDQLQT+ERLV V +  PAQ
Sbjct  476   QKLQYTDIPEDIEPEDIWPMGNYAVSITWPDGFIQIAPYDQLQTMERLVHVCKPAPAQ  533


 Score =   295 bits (754),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRH---LRPLSVASTRS  309
            M LLQAPS   ++ L  +S    G    +    +   N    SQRH   +R L   S  S
Sbjct  1    MQLLQAPSLSNITLLSTTSSLNRGFLSPKKSFDISTVNCSISSQRHEGFVRLLRSQSISS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             +T +AASVKA AS+VS  TAE +VL  L+QIIDPDFGTDIVSCGFVKDL +NE LGEVS
Sbjct  61   TVTTRAASVKADASIVSIGTAENDVLAVLSQIIDPDFGTDIVSCGFVKDLHINETLGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVF GQLP GLQTISNI
Sbjct  121  FRLELTTPACPIKDMFEQKANEVVAMLPWVKKVNVTMSAQPARPVFEGQLPIGLQTISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPEN LLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENCLLEM  235



>ref|XP_010249841.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X3 [Nelumbo nucifera]
Length=552

 Score =   563 bits (1452),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAV+VTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVVVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDEEF+LHPATVRRND+SA+S+ EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEEFFLHPATVRRNDQSAQSIDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDIEPE+I PMGNYAVSITWPDGF QIAPYDQLQT+ERLV V +  PAQ
Sbjct  476   QKLQYTDIPEDIEPEDIWPMGNYAVSITWPDGFIQIAPYDQLQTMERLVHVCKPAPAQ  533


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRH---LRPLSVASTRS  309
            M LLQAPS   ++ L  +S    G    +    +   N    SQRH   +R L   S  S
Sbjct  1    MQLLQAPSLSNITLLSTTSSLNRGFLSPKKSFDISTVNCSISSQRHEGFVRLLRSQSISS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             +T +AASVKA AS+VS  TAE +VL  L+QIIDPDFGTDIVSCGFVKDL +NE LGEVS
Sbjct  61   TVTTRAASVKADASIVSIGTAENDVLAVLSQIIDPDFGTDIVSCGFVKDLHINETLGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVF GQLP GLQTISNI
Sbjct  121  FRLELTTPACPIKDMFEQKANEVVAMLPWVKKVNVTMSAQPARPVFEGQLPIGLQTISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPEN LLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENCLLEM  235



>ref|XP_010249843.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X4 [Nelumbo nucifera]
Length=541

 Score =   563 bits (1452),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAV+VTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVVVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDEEF+LHPATVRRND+SA+S+ EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEEFFLHPATVRRNDQSAQSIDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDIEPE+I PMGNYAVSITWPDGF QIAPYDQLQT+ERLV V +  PAQ
Sbjct  476   QKLQYTDIPEDIEPEDIWPMGNYAVSITWPDGFIQIAPYDQLQTMERLVHVCKPAPAQ  533


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRH---LRPLSVASTRS  309
            M LLQAPS   ++ L  +S    G    +    +   N    SQRH   +R L   S  S
Sbjct  1    MQLLQAPSLSNITLLSTTSSLNRGFLSPKKSFDISTVNCSISSQRHEGFVRLLRSQSISS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             +T +AASVKA AS+VS  TAE +VL  L+QIIDPDFGTDIVSCGFVKDL +NE LGEVS
Sbjct  61   TVTTRAASVKADASIVSIGTAENDVLAVLSQIIDPDFGTDIVSCGFVKDLHINETLGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVF GQLP GLQTISNI
Sbjct  121  FRLELTTPACPIKDMFEQKANEVVAMLPWVKKVNVTMSAQPARPVFEGQLPIGLQTISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPEN LLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENCLLEM  235



>ref|XP_010249839.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=597

 Score =   563 bits (1451),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAV+VTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVVVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDEEF+LHPATVRRND+SA+S+ EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEEFFLHPATVRRNDQSAQSIDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDIEPE+I PMGNYAVSITWPDGF QIAPYDQLQT+ERLV V +  PAQ
Sbjct  476   QKLQYTDIPEDIEPEDIWPMGNYAVSITWPDGFIQIAPYDQLQTMERLVHVCKPAPAQ  533


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRH---LRPLSVASTRS  309
            M LLQAPS   ++ L  +S    G    +    +   N    SQRH   +R L   S  S
Sbjct  1    MQLLQAPSLSNITLLSTTSSLNRGFLSPKKSFDISTVNCSISSQRHEGFVRLLRSQSISS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             +T +AASVKA AS+VS  TAE +VL  L+QIIDPDFGTDIVSCGFVKDL +NE LGEVS
Sbjct  61   TVTTRAASVKADASIVSIGTAENDVLAVLSQIIDPDFGTDIVSCGFVKDLHINETLGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVF GQLP GLQTISNI
Sbjct  121  FRLELTTPACPIKDMFEQKANEVVAMLPWVKKVNVTMSAQPARPVFEGQLPIGLQTISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPEN LLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENCLLEM  235



>ref|XP_010249840.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=554

 Score =   563 bits (1451),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 288/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAV+VTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVVVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDEEF+LHPATVRRND+SA+S+ EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEEFFLHPATVRRNDQSAQSIDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDIEPE+I PMGNYAVSITWPDGF QIAPYDQLQT+ERLV V +  PAQ
Sbjct  476   QKLQYTDIPEDIEPEDIWPMGNYAVSITWPDGFIQIAPYDQLQTMERLVHVCKPAPAQ  533


 Score =   294 bits (753),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/235 (72%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRH---LRPLSVASTRS  309
            M LLQAPS   ++ L  +S    G    +    +   N    SQRH   +R L   S  S
Sbjct  1    MQLLQAPSLSNITLLSTTSSLNRGFLSPKKSFDISTVNCSISSQRHEGFVRLLRSQSISS  60

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
             +T +AASVKA AS+VS  TAE +VL  L+QIIDPDFGTDIVSCGFVKDL +NE LGEVS
Sbjct  61   TVTTRAASVKADASIVSIGTAENDVLAVLSQIIDPDFGTDIVSCGFVKDLHINETLGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQKANEVVA LPWVK V VTMSAQPA+PVF GQLP GLQTISNI
Sbjct  121  FRLELTTPACPIKDMFEQKANEVVAMLPWVKKVNVTMSAQPARPVFEGQLPIGLQTISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPEN LLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENCLLEM  235



>ref|XP_003528907.1| PREDICTED: cytosolic Fe-S cluster assembly factor nubp1-A-like 
[Glycine max]
Length=533

 Score =   568 bits (1464),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/293 (92%), Positives = 284/293 (97%), Gaps = 0/293 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKL+SFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYL+IDMPP
Sbjct  236   NPEKKTIIPTEYLGVKLISFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLIIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S EEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSKEEFFLHPATVRRNDRSAQSVDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE  1780
             QKLQY DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQ IERLV+V E
Sbjct  476   QKLQYGDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQMIERLVDVFE  528


 Score =   289 bits (740),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/237 (70%), Positives = 184/237 (78%), Gaps = 9/237 (4%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSS--QSKAGLY---VAENCCLLCNSPFP--SQRHLRPLSVAST  303
            M +LQAPSS     +  S   Q   GL    V+ N  L     F   SQR    L     
Sbjct  1    MQVLQAPSSSPYFSIQTSKAPQRTWGLLPSSVSVNSSLFSTFHFSLHSQRDQHLLWTPHK  60

Query  304  RSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGE  483
            R  +T +AASV+   S VS  TAE +VLKAL+QIIDPDFGTDIV+CGFVKDLL+++ALGE
Sbjct  61   R--VTTRAASVEVGDSSVSTGTAEDDVLKALSQIIDPDFGTDIVTCGFVKDLLIDKALGE  118

Query  484  VSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTIS  663
            VSFRLELTTPACPIKD+FEQKANEVVA LPWVK VKVTMSAQPA+P++A QLP GLQTIS
Sbjct  119  VSFRLELTTPACPIKDVFEQKANEVVAMLPWVKNVKVTMSAQPARPIYAEQLPAGLQTIS  178

Query  664  NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVG+FDADVYGPSLPTMVSPENRLL M
Sbjct  179  NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGLFDADVYGPSLPTMVSPENRLLVM  235



>ref|XP_010088861.1| hypothetical protein L484_020848 [Morus notabilis]
 gb|EXB37058.1| hypothetical protein L484_020848 [Morus notabilis]
Length=543

 Score =   560 bits (1444),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/310 (86%), Positives = 288/310 (93%), Gaps = 12/310 (4%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLV+DMPP
Sbjct  233   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVVDMPP  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  293   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  352

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEVA+TFQ+LGV
Sbjct  353   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVATTFQDLGV  412

Query  1442  CVVQQCARIRQQ------------VSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRND  1585
             C+VQQCA+IRQQ            +STAVSYD+S+K I+VKVP+SDEEF LHPATVRRND
Sbjct  413   CIVQQCAKIRQQGILIVLYVLQKKMSTAVSYDKSLKVIRVKVPDSDEEFLLHPATVRRND  472

Query  1586  RSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
             RSA+SV EW+GEQKLQY+DVPEDIEPEEI+PMGNYAV I+WPDGF+QIAPYDQLQT+ERL
Sbjct  473   RSAQSVDEWTGEQKLQYTDVPEDIEPEEIQPMGNYAVQISWPDGFNQIAPYDQLQTMERL  532

Query  1766  VEVPELTPAQ  1795
             V+ P  T AQ
Sbjct  533   VDAPRPTAAQ  542


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/236 (72%), Positives = 183/236 (78%), Gaps = 10/236 (4%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRP------LSVASTR  306
            M LL A SS+  S       S  GL   E   L    P      L+P      L V+   
Sbjct  1    MQLLHASSSLCASLHISKPYSSTGLVSPEKTLL----PSSISCSLQPKGIESSLWVSRNN  56

Query  307  SILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEV  486
            SI T KAASV+A AS +S+ TAE +VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALGEV
Sbjct  57   SIFTTKAASVEAGASTISSGTAENDVLKALSQIIDPDFGTDIVSCGFVKDLQINEALGEV  116

Query  487  SFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISN  666
            SFRLELTTPACPIKDMFEQKANEVV  LPWVK+V VTMSAQPA+PV+AG LPPGLQ ISN
Sbjct  117  SFRLELTTPACPIKDMFEQKANEVVKMLPWVKSVNVTMSAQPARPVYAGLLPPGLQKISN  176

Query  667  IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            IVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  177  IVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  232



>ref|XP_006475727.1| PREDICTED: uncharacterized protein LOC102622559 isoform X1 [Citrus 
sinensis]
 gb|KDO54135.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=532

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/296 (92%), Positives = 289/296 (98%), Gaps = 0/296 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  236   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  416   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+VP+ TP
Sbjct  476   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTP  531


 Score =   282 bits (722),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIVSCGFVKD+ +NEALGEVSFRLELTTPACPIKDMFEQ+
Sbjct  80   TAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVSFRLELTTPACPIKDMFEQR  139

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKSTVAVNL
Sbjct  140  ANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNL  199

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  200  AYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  235



>ref|XP_003534183.1| PREDICTED: cytosolic Fe-S cluster assembly factor nubp1-A-like 
[Glycine max]
Length=530

 Score =   567 bits (1461),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/293 (91%), Positives = 285/293 (97%), Gaps = 0/293 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKL+SFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYL+IDMPP
Sbjct  233   NPEKKTIIPTEYLGVKLISFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLIIDMPP  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  293   GTGDIQLTLCQVVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  352

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  353   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  412

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S EEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  413   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSKEEFFLHPATVRRNDRSAQSVDEWTGE  472

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE  1780
             QKLQYSD+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQ IERLV+V E
Sbjct  473   QKLQYSDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQMIERLVDVFE  525


 Score =   286 bits (732),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEVSFRLELTTPACPIKD+FEQK
Sbjct  77   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLHIDKALGEVSFRLELTTPACPIKDVFEQK  136

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK VKVTMSAQPA+P++A QLP GLQTISNIVAVSSCKGGVGKSTVAVNL
Sbjct  137  ANEVVAMLPWVKNVKVTMSAQPARPIYAEQLPAGLQTISNIVAVSSCKGGVGKSTVAVNL  196

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDADVYGPSLPTMVSPENRLL M
Sbjct  197  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLVM  232



>ref|XP_006451084.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006475728.1| PREDICTED: uncharacterized protein LOC102622559 isoform X2 [Citrus 
sinensis]
 gb|ESR64324.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|KDO54134.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=527

 Score =   571 bits (1472),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/296 (92%), Positives = 289/296 (98%), Gaps = 0/296 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  231   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  291   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  350

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  351   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  410

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  411   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  470

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+VP+ TP
Sbjct  471   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTP  526


 Score =   282 bits (721),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIVSCGFVKD+ +NEALGEVSFRLELTTPACPIKDMFEQ+
Sbjct  75   TAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVSFRLELTTPACPIKDMFEQR  134

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKSTVAVNL
Sbjct  135  ANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNL  194

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  195  AYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  230



>ref|XP_004287077.1| PREDICTED: protein mrp homolog [Fragaria vesca subsp. vesca]
Length=541

 Score =   553 bits (1425),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/290 (90%), Positives = 283/290 (98%), Gaps = 0/290 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLV+DMPP
Sbjct  239   NLEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVVDMPP  298

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  299   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  358

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KR+YPFGKGSG++VV+QFGIP+LFDLPIRPTLSASGDSG PEVVADP GEV+ TFQELG+
Sbjct  359   KRHYPFGKGSGSEVVKQFGIPNLFDLPIRPTLSASGDSGVPEVVADPLGEVSKTFQELGI  418

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SD+EF LHPATVRRNDRSA+SV EW+GE
Sbjct  419   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDDEFLLHPATVRRNDRSAQSVDEWTGE  478

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+
Sbjct  479   QKLQYNDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVD  528


 Score =   300 bits (767),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/240 (70%), Positives = 190/240 (79%), Gaps = 12/240 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKA-GLYVAEN------CCLLCNSPFPSQRHLRPLSVAST  303
            M LL  PSS  LSF  L + ++A GL + E         + C+     +R  R   V+  
Sbjct  1    MQLLHLPSSPYLSFQTLKTHAEAAGLALYEKPVVSSSSSIFCS--LQQERVERSRWVSRR  58

Query  304  RSIL---TPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEA  474
             S+L   T KA+S++A  + VSN  AE++VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA
Sbjct  59   GSVLGSLTTKASSLEAGTAAVSNGVAESDVLKALSQIIDPDFGTDIVSCGFVKDLQIDEA  118

Query  475  LGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQ  654
            LGEVSFRLELTTPACP+KDMFEQKANEVV  LPWVK VKVTMSAQPAKP++AGQLP GLQ
Sbjct  119  LGEVSFRLELTTPACPVKDMFEQKANEVVNELPWVKNVKVTMSAQPAKPLYAGQLPAGLQ  178

Query  655  TISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            TISNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  179  TISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  238



>ref|XP_011009216.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Populus euphratica]
Length=527

 Score =   563 bits (1451),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/296 (90%), Positives = 283/296 (96%), Gaps = 0/296 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  229   NPEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  288

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  289   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  348

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGD G PEV ADP+GEVA  FQ LG+
Sbjct  349   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDGGMPEVAADPQGEVAKIFQNLGI  408

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  409   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  468

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             QKLQY DVPEDIEPEEIRPMGNYAV ITWPDGFSQIAPYD LQT+ERLV+VP+  P
Sbjct  469   QKLQYVDVPEDIEPEEIRPMGNYAVEITWPDGFSQIAPYDHLQTMERLVDVPDPAP  524


 Score =   289 bits (740),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 185/235 (79%), Gaps = 12/235 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCL---LCNSP--FPSQRHLRPLSVASTRS  309
            M LL AP+   LS   L ++ K GL  +    L   + N P   P ++      +  TR+
Sbjct  1    MQLLYAPTCHNLSLRSLHTRPKEGLLSSLEKWLHLSVYNQPCKLPPRKCFY---LKKTRA  57

Query  310  ILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
            +     +SV+A  S VS + AE++VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA GEVS
Sbjct  58   L----NSSVQAGGSAVSTRNAESDVLKALSQIIDPDFGTDIVSCGFVKDLNIDEAQGEVS  113

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACP+KDMFEQKANEVVA LPWVK VKVTMSAQPA+PV+AGQLP GLQTISNI
Sbjct  114  FRLELTTPACPVKDMFEQKANEVVALLPWVKNVKVTMSAQPARPVYAGQLPQGLQTISNI  173

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            +AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  174  IAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  228



>gb|KHN20707.1| Protein mrp like [Glycine soja]
Length=540

 Score =   561 bits (1446),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/300 (90%), Positives = 284/300 (95%), Gaps = 7/300 (2%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKL+SFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYL+IDMPP
Sbjct  236   NPEKKTIIPTEYLGVKLISFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLIIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  355

Query  1262  KRYYPFGKGSGAQ-------VVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             KRYYPFG+GSG+Q       VVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+ 
Sbjct  356   KRYYPFGRGSGSQARIMSLIVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSK  415

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAES  1600
              FQ LGVCVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S EEF+LHPATVRRNDRSA+S
Sbjct  416   IFQNLGVCVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSKEEFFLHPATVRRNDRSAQS  475

Query  1601  VVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE  1780
             V EW+GEQKLQY DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQ IERLV+V E
Sbjct  476   VDEWTGEQKLQYGDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQMIERLVDVFE  535


 Score =   290 bits (742),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/237 (71%), Positives = 184/237 (78%), Gaps = 9/237 (4%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSS--QSKAGLY---VAENCCLLCNSPFP--SQRHLRPLSVAST  303
            M +LQAPSS     +  S   Q   GL    V+ N  L     F   SQR    L     
Sbjct  1    MQVLQAPSSSPYFSIQTSKAPQRTWGLLPSSVSVNSSLFSTLHFSLHSQRDQHLLWTPHK  60

Query  304  RSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGE  483
            R  +T +AASV+   S VS  TAE +VLKAL+QIIDPDFGTDIV+CGFVKDLL+++ALGE
Sbjct  61   R--VTTRAASVEVGDSSVSTGTAEDDVLKALSQIIDPDFGTDIVTCGFVKDLLIDKALGE  118

Query  484  VSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTIS  663
            VSFRLELTTPACPIKD+FEQKANEVVA LPWVK VKVTMSAQPA+P++A QLP GLQTIS
Sbjct  119  VSFRLELTTPACPIKDVFEQKANEVVAMLPWVKNVKVTMSAQPARPIYAEQLPAGLQTIS  178

Query  664  NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL M
Sbjct  179  NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLVM  235



>ref|XP_010688160.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=523

 Score =   557 bits (1436),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/295 (89%), Positives = 284/295 (96%), Gaps = 0/295 (0%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             E +TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT
Sbjct  229   ETRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  288

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKR  1267
             GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKR
Sbjct  289   GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKR  348

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCV  1447
             YYPFG+GSG+QVVQQFGIP+LF+LPI+P LSASGDSG PEVVADP GEVA+TFQELGVCV
Sbjct  349   YYPFGRGSGSQVVQQFGIPNLFELPIKPALSASGDSGQPEVVADPLGEVATTFQELGVCV  408

Query  1448  VQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQK  1627
             VQQCA+IRQQVSTAVSYD+S+KAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GEQ 
Sbjct  409   VQQCAKIRQQVSTAVSYDKSMKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGEQM  468

Query  1628  LQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             LQY+D+ EDIEPEEIRPMGNYAV ITWPDGF+QIAPYDQLQT+ERLVE+P+ T A
Sbjct  469   LQYTDISEDIEPEEIRPMGNYAVQITWPDGFNQIAPYDQLQTMERLVEIPQPTLA  523


 Score =   292 bits (748),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 166/235 (71%), Positives = 182/235 (77%), Gaps = 12/235 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSS-QSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTR---SI  312
            M LL AP S  +SF P    Q K GL        + N     QR L+   V       S 
Sbjct  1    MHLLHAPISPNISFQPSKILQHKNGL--------VFNGLIQQQRQLKSTWVLQNHVNFSS  52

Query  313  LTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSF  492
            +  KAASV+A  S  S++TAE++VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA GEVSF
Sbjct  53   IIAKAASVEAGVSTSSSKTAESDVLKALSQIIDPDFGTDIVSCGFVKDLQIDEAAGEVSF  112

Query  493  RLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIV  672
            RLELTTPACP+KD+FEQKANEVV ALPWV  V VTMSAQPA+PVFAG LP GLQTISNIV
Sbjct  113  RLELTTPACPVKDVFEQKANEVVLALPWVTKVNVTMSAQPARPVFAGDLPKGLQTISNIV  172

Query  673  AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM+
Sbjct  173  AVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEMM  227



>ref|XP_007013249.1| ATP binding isoform 2, partial [Theobroma cacao]
 gb|EOY30868.1| ATP binding isoform 2, partial [Theobroma cacao]
Length=517

 Score =   552 bits (1423),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 281/298 (94%), Gaps = 3/298 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVK+VSFGFAGQG AIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  222   NPEKRTIIPTEYLGVKMVSFGFAGQGHAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  281

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTL    PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  282   GTGDIQLTL---FPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  338

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADP+GEVA TFQ LGV
Sbjct  339   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPQGEVAKTFQNLGV  398

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  399   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  458

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY D+PEDIEPEEIRPMGNYAVSITWPDGF+QIAPYDQLQ +ERLV+ P  T  Q
Sbjct  459   QKLQYGDIPEDIEPEEIRPMGNYAVSITWPDGFNQIAPYDQLQMMERLVDFPLPTSVQ  516


 Score =   295 bits (755),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 176/214 (82%), Gaps = 5/214 (2%)
 Frame = +1

Query  208  KAGLYVAENCCLLCNSP--FPSQRHLRPLSVASTRS---ILTPkaasvkasasvvsNQTA  372
            K GL   E C     +   F  Q+  R + V+  RS     TPKAAS++A +S  S  TA
Sbjct  8    KGGLLSLEKCLQPSAAYCFFQPQKLERSIWVSHKRSNFSCFTPKAASLEAGSSATSIGTA  67

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E +VLKAL+QI+DPDFGTDIVSCGFVKDLL++EALGEVSFRLELTTPACPIKDMFEQ+AN
Sbjct  68   EGDVLKALSQIMDPDFGTDIVSCGFVKDLLIDEALGEVSFRLELTTPACPIKDMFEQQAN  127

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            EVVA LPWV  V VTMSAQPAKP+FAGQLP GLQTISNIVAVSSCKGGVGKSTVAVNLAY
Sbjct  128  EVVARLPWVSKVSVTMSAQPAKPIFAGQLPAGLQTISNIVAVSSCKGGVGKSTVAVNLAY  187

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            TLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  188  TLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  221



>emb|CDX92894.1| BnaC07g41520D [Brassica napus]
Length=533

 Score =   567 bits (1462),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 270/298 (91%), Positives = 286/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +PEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  235   DPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  294

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  295   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  354

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP  EVA TFQ+LGV
Sbjct  355   KRYYPFGKGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGVPEVVADPLSEVARTFQDLGV  414

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  415   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  474

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  475   QKIQFGDVAEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  532


 Score =   280 bits (716),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 134/154 (87%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            + EVLKAL+QIIDPDFGTDIVSCGFVKDL+++EALGEVSFRLELTTPACP+KDMFE++AN
Sbjct  81   QKEVLKALSQIIDPDFGTDIVSCGFVKDLVIDEALGEVSFRLELTTPACPVKDMFEKQAN  140

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            EVVA LPWVK V VTMSAQPAKP+FAGQLPPGL  IS+IVAVSSCKGGVGKSTVAVNLAY
Sbjct  141  EVVAVLPWVKKVNVTMSAQPAKPIFAGQLPPGLSRISSIVAVSSCKGGVGKSTVAVNLAY  200

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            TLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  201  TLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  234



>ref|XP_006297413.1| hypothetical protein CARUB_v10013437mg [Capsella rubella]
 gb|EOA30311.1| hypothetical protein CARUB_v10013437mg [Capsella rubella]
Length=532

 Score =   566 bits (1460),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 287/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  234   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  293

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  294   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  353

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  354   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  413

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  414   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  473

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+QY D+ EDIEP++IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLVEVP L+P +
Sbjct  474   QKVQYGDIAEDIEPDDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVEVPPLSPVE  531


 Score =   280 bits (717),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            T+E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE K
Sbjct  78   TSERDVLKALSQIIDPDFGTDIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFENK  137

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVAALPWVK V VTMSAQPAKP++AGQLP GL  ISNI+AVSSCKGGVGKSTVAVNL
Sbjct  138  ANEVVAALPWVKKVNVTMSAQPAKPIYAGQLPLGLSRISNIIAVSSCKGGVGKSTVAVNL  197

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  198  AYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  233



>gb|AES76761.2| nucleotide-binding protein [Medicago truncatula]
Length=526

 Score =   562 bits (1449),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/291 (90%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGV NQLLTTTEWGELDYLVIDMPP
Sbjct  235   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPP  294

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  295   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  354

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  355   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  414

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP+SDEEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  415   CVVQQCAKIRQQVSTAVTYDKSVKAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGE  474

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
             QKLQY+D+P+ IEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  475   QKLQYTDIPDYIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVGV  525


 Score =   285 bits (728),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEVSFRLELTTPACPIKD+FE++
Sbjct  79   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLQIDKALGEVSFRLELTTPACPIKDVFEKQ  138

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK V VTMSAQPAKP+FA QLP GLQTISNI+AVSSCKGGVGKSTVAVNL
Sbjct  139  ANEVVAVLPWVKNVNVTMSAQPAKPLFAEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNL  198

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDAD+YGPSLPTMVSPENR+LEM
Sbjct  199  AYTLADMGARVGIFDADIYGPSLPTMVSPENRILEM  234



>ref|NP_189086.1| protein high chlorophyll fluorescence 101 [Arabidopsis thaliana]
 sp|Q6STH5.1|HF101_ARATH RecName: Full=Fe-S cluster assembly factor HCF101, chloroplastic; 
AltName: Full=Protein HIGH CHLOROPHYLL FLUORESCENCE 101; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAR97892.1| [4Fe-4S] cluster assembly factor [Arabidopsis thaliana]
 dbj|BAE98532.1| putative mrp protein [Arabidopsis thaliana]
 gb|AEE76897.1| protein high chlorophyll fluorescence 101 [Arabidopsis thaliana]
Length=532

 Score =   561 bits (1447),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  234   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  293

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  294   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  353

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  354   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  413

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  414   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  473

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+ Y DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+ IERLV+VP L+P +
Sbjct  474   QKVLYGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLEEIERLVDVPPLSPVE  531


 Score =   285 bits (729),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QT+E +VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALGEVSFRLELTTPACP+KDMFE 
Sbjct  77   QTSEKDVLKALSQIIDPDFGTDIVSCGFVKDLGINEALGEVSFRLELTTPACPVKDMFEN  136

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVN
Sbjct  137  KANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVN  196

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  197  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  233



>gb|AES76762.2| nucleotide-binding protein [Medicago truncatula]
Length=517

 Score =   562 bits (1448),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/291 (90%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGV NQLLTTTEWGELDYLVIDMPP
Sbjct  226   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPP  285

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  286   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  345

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  346   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  405

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP+SDEEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  406   CVVQQCAKIRQQVSTAVTYDKSVKAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGE  465

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
             QKLQY+D+P+ IEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  466   QKLQYTDIPDYIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVGV  516


 Score =   284 bits (727),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEVSFRLELTTPACPIKD+FE++
Sbjct  70   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLQIDKALGEVSFRLELTTPACPIKDVFEKQ  129

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK V VTMSAQPAKP+FA QLP GLQTISNI+AVSSCKGGVGKSTVAVNL
Sbjct  130  ANEVVAVLPWVKNVNVTMSAQPAKPLFAEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNL  189

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDAD+YGPSLPTMVSPENR+LEM
Sbjct  190  AYTLADMGARVGIFDADIYGPSLPTMVSPENRILEM  225



>emb|CDY50924.1| BnaA03g59020D [Brassica napus]
Length=489

 Score =   565 bits (1455),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/298 (90%), Positives = 286/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +PEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  191   DPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  250

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  251   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  310

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVVQQFGIPHLFDLPIRPTLSASGD+G PEVV+DP  EVA TFQ+LGV
Sbjct  311   KRYYPFGKGSGSQVVQQFGIPHLFDLPIRPTLSASGDTGVPEVVSDPLSEVARTFQDLGV  370

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  371   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  430

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  431   QKIQFGDVAEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  488


 Score =   281 bits (719),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E EVLKAL+QIIDPDFGTDIVSCGFVKDL+++EALGEVSFRLELTTPACP+KDMFE++AN
Sbjct  37   EKEVLKALSQIIDPDFGTDIVSCGFVKDLVIDEALGEVSFRLELTTPACPVKDMFEKQAN  96

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            EVVA LPWVK V VTMSAQPAKP+FAGQLPPGL  IS+IVAVSSCKGGVGKSTVAVNLAY
Sbjct  97   EVVAVLPWVKKVNVTMSAQPAKPIFAGQLPPGLSRISSIVAVSSCKGGVGKSTVAVNLAY  156

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            TLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  157  TLAGMGARVGIFDADVYGPSLPTMVNPESRVLEM  190



>ref|XP_009137808.1| PREDICTED: probable cytosolic Fe-S cluster assembly factor SJAG_02895 
[Brassica rapa]
Length=534

 Score =   564 bits (1454),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/298 (90%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +PEKK IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  236   DPEKKAIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  296   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVV+DP  EVA TFQ+LGV
Sbjct  356   KRYYPFGKGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGVPEVVSDPLSEVARTFQDLGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  476   QKIQFGDVAEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  533


 Score =   281 bits (719),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E EVLKAL+QIIDPDFGTDIVSCGFVKDL+++EALGEVSFRLELTTPACP+KDMFE++AN
Sbjct  82   EKEVLKALSQIIDPDFGTDIVSCGFVKDLVIDEALGEVSFRLELTTPACPVKDMFEKQAN  141

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            EVVA LPWVK V VTMSAQPAKP+FAGQLPPGL  IS+IVAVSSCKGGVGKSTVAVNLAY
Sbjct  142  EVVAVLPWVKKVNVTMSAQPAKPIFAGQLPPGLSRISSIVAVSSCKGGVGKSTVAVNLAY  201

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            TLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  202  TLAGMGARVGIFDADVYGPSLPTMVNPESRVLEM  235



>gb|AAM64337.1| mrp protein, putative [Arabidopsis thaliana]
 emb|CAD90253.1| putative PSI stabilising protein precursor [Arabidopsis thaliana]
Length=532

 Score =   561 bits (1446),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  234   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  293

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  294   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  353

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  354   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  413

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  414   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  473

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+ Y DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+ IERLV+VP L+P +
Sbjct  474   QKVLYGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLEEIERLVDVPPLSPVE  531


 Score =   284 bits (727),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QT+E +VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALGEVSFRLELTTPACP+KDMFE 
Sbjct  77   QTSEKDVLKALSQIIDPDFGTDIVSCGFVKDLGINEALGEVSFRLELTTPACPVKDMFEN  136

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK V +TMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVN
Sbjct  137  KANEVVAALPWVKKVNLTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVN  196

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  197  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  233



>gb|AFK38076.1| unknown [Medicago truncatula]
Length=526

 Score =   563 bits (1450),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/291 (90%), Positives = 283/291 (97%), Gaps = 0/291 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGV NQLLTTTEWGELDYLVIDMPP
Sbjct  235   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPP  294

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  295   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  354

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  355   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  414

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP+SDEEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  415   CVVQQCAKIRQQVSTAVTYDKSVKAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGE  474

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
             QKLQY+D+P+ IEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  475   QKLQYTDIPDYIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVGV  525


 Score =   282 bits (721),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEVSFRLELTTPACPIKD+FE++
Sbjct  79   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLQIDKALGEVSFRLELTTPACPIKDVFEKQ  138

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK V VTMSAQPAKP+FA QLP GLQTISNI+AVSSCKGGVGKSTVAVNL
Sbjct  139  ANEVVAVLPWVKNVNVTMSAQPAKPLFAEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNL  198

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDAD+YGPSLPTMVS ENR+LEM
Sbjct  199  AYTLADMGARVGIFDADIYGPSLPTMVSSENRILEM  234



>ref|XP_007152803.1| hypothetical protein PHAVU_004G160900g [Phaseolus vulgaris]
 gb|ESW24797.1| hypothetical protein PHAVU_004G160900g [Phaseolus vulgaris]
Length=532

 Score =   556 bits (1432),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 282/292 (97%), Gaps = 0/292 (0%)
 Frame = +2

Query  896   L*NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDM  1075
             L +P KKTIIPTEY GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYL+IDM
Sbjct  232   LMDPVKKTIIPTEYSGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLIIDM  291

Query  1076  PPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA  1255
             PPGTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDA
Sbjct  292   PPGTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDA  351

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
             DGKRYYPFG+GSG+QVVQQFGIPHLFDLPIRP LSASGDSG PEVVADP+GEV+  FQ L
Sbjct  352   DGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPNLSASGDSGMPEVVADPQGEVSKIFQNL  411

Query  1436  GVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWS  1615
             GVCVVQQCA+IRQQVSTAV+YD++IKAIKVKVP+S EEF+LHPATVRRNDRSA+SV EW+
Sbjct  412   GVCVVQQCAKIRQQVSTAVTYDKTIKAIKVKVPDSKEEFFLHPATVRRNDRSAQSVDEWT  471

Query  1616  GEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             G+QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+
Sbjct  472   GDQKLQYNDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVD  523


 Score =   288 bits (738),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/236 (67%), Positives = 177/236 (75%), Gaps = 9/236 (4%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTRSILTPk  324
            M LL APSS  LS      Q     ++      + +SPF S  H    S    R + TP 
Sbjct  1    MQLLHAPSSPHLSIQTSKPQHLTWGFLP--SVTVNSSPF-STLHFSLHSQKDQRLLWTPH  57

Query  325  aasvkasasvvsNQ------TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEV  486
                  +ASV          TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEV
Sbjct  58   KRVTSRAASVEVGDSSVSTGTAEGDVLKALSQIIDPDFGTDIVTCGFVKDLQIDKALGEV  117

Query  487  SFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISN  666
            SFRLELTTPACP+KDMFEQ+ANEVVA LPWVK VKVTMSAQPA+P++A QLP GLQTISN
Sbjct  118  SFRLELTTPACPVKDMFEQQANEVVAMLPWVKNVKVTMSAQPARPIYAEQLPAGLQTISN  177

Query  667  IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+L M
Sbjct  178  IVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRVLLM  233



>ref|XP_009416098.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=529

 Score =   559 bits (1441),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/297 (89%), Positives = 286/297 (96%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+PTE++GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  227   NPETRTILPTEFMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  286

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMC+FDAD 
Sbjct  287   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCYFDADS  346

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVVQQFGIP+LFDLPIRPTLSASGDSGTPEVVADP+GEVA TFQ+LGV
Sbjct  347   KRYYPFGKGSGSQVVQQFGIPYLFDLPIRPTLSASGDSGTPEVVADPQGEVAKTFQDLGV  406

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYD+SI+AIKVKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  407   CVVQQCAKIRQQVSTAVSYDKSIRAIKVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  466

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QKLQY DV EDIEPE+IRPMGNYAVSITWPDGF+QIAPYDQL+T+ERLV+VPE T A
Sbjct  467   QKLQYGDVAEDIEPEDIRPMGNYAVSITWPDGFNQIAPYDQLETMERLVDVPEPTRA  523


 Score =   285 bits (728),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/234 (71%), Positives = 180/234 (77%), Gaps = 12/234 (5%)
 Frame = +1

Query  145  MPLLQAPSS----VTLSFLPLSSQSKAGLYVAENCCLLCNSPFPSQRHLRPLSVASTRSI  312
            M LLQ P S     T S LP S  +    +   +     +S    +R +RP S+      
Sbjct  1    MQLLQTPPSGLAISTQSPLPRSGANSLKAHRLSSTLRCSSSVRVHRRFVRPPSL------  54

Query  313  LTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSF  492
              P+A+SV+ASASV S   A+ EVL AL+QIIDPDFGTDIVSCGFVKDL V+EAL EVSF
Sbjct  55   --PRASSVEASASVESVDAAKKEVLVALSQIIDPDFGTDIVSCGFVKDLFVDEALKEVSF  112

Query  493  RLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIV  672
            RLELTTPACPIKDMFEQ+ANEVV ALPWVK V VTMSAQPAKPVFAG+LP GLQ ISNIV
Sbjct  113  RLELTTPACPIKDMFEQRANEVVGALPWVKKVNVTMSAQPAKPVFAGELPKGLQRISNIV  172

Query  673  AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AVSSCKGGVGKSTVAVNLAYTL  MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  173  AVSSCKGGVGKSTVAVNLAYTLVGMGARVGIFDADVYGPSLPTMVSPENRLLEM  226



>ref|XP_007152802.1| hypothetical protein PHAVU_004G160900g [Phaseolus vulgaris]
 gb|ESW24796.1| hypothetical protein PHAVU_004G160900g [Phaseolus vulgaris]
Length=534

 Score =   555 bits (1431),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/292 (90%), Positives = 282/292 (97%), Gaps = 0/292 (0%)
 Frame = +2

Query  896   L*NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDM  1075
             L +P KKTIIPTEY GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYL+IDM
Sbjct  234   LMDPVKKTIIPTEYSGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLIIDM  293

Query  1076  PPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA  1255
             PPGTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDA
Sbjct  294   PPGTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDA  353

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
             DGKRYYPFG+GSG+QVVQQFGIPHLFDLPIRP LSASGDSG PEVVADP+GEV+  FQ L
Sbjct  354   DGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPNLSASGDSGMPEVVADPQGEVSKIFQNL  413

Query  1436  GVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWS  1615
             GVCVVQQCA+IRQQVSTAV+YD++IKAIKVKVP+S EEF+LHPATVRRNDRSA+SV EW+
Sbjct  414   GVCVVQQCAKIRQQVSTAVTYDKTIKAIKVKVPDSKEEFFLHPATVRRNDRSAQSVDEWT  473

Query  1616  GEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             G+QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+
Sbjct  474   GDQKLQYNDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVD  525


 Score =   287 bits (735),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 176/237 (74%), Gaps = 9/237 (4%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCNSPFP-------SQRHLRPLSVAST  303
            M LL APSS  LS      Q     ++      + +SPF        SQ+  R L     
Sbjct  1    MQLLHAPSSPHLSIQTSKPQHLTWGFLP--SVTVNSSPFSTLHFSLHSQKDQRLLWTPHK  58

Query  304  RSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGE  483
            R      +       S VS  TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGE
Sbjct  59   RVTSRAASVEDAVGDSSVSTGTAEGDVLKALSQIIDPDFGTDIVTCGFVKDLQIDKALGE  118

Query  484  VSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTIS  663
            VSFRLELTTPACP+KDMFEQ+ANEVVA LPWVK VKVTMSAQPA+P++A QLP GLQTIS
Sbjct  119  VSFRLELTTPACPVKDMFEQQANEVVAMLPWVKNVKVTMSAQPARPIYAEQLPAGLQTIS  178

Query  664  NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR+L M
Sbjct  179  NIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRVLLM  235



>ref|XP_008776939.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X1 [Phoenix dactylifera]
Length=540

 Score =   556 bits (1434),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/298 (88%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYL+IDMPP
Sbjct  239   NPESRTILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLLIDMPP  298

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTA+VIVTTPQKLAFIDVAKGVRMFS LKVPCVAVVENMC+FDADG
Sbjct  299   GTGDIQLTLCQVAPLTASVIVTTPQKLAFIDVAKGVRMFSTLKVPCVAVVENMCYFDADG  358

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSGAQVVQQFGIPHLFDLPIR TLSASGDSG PEVVADP+GEVA  FQ+LGV
Sbjct  359   KRYYPFGKGSGAQVVQQFGIPHLFDLPIRSTLSASGDSGMPEVVADPQGEVAKIFQDLGV  418

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYD+SI+AI+VKVP+SD+EF LHPATVRRNDRSA+SV EW+GE
Sbjct  419   CVVQQCAKIRQQVSTAVSYDKSIRAIRVKVPDSDDEFLLHPATVRRNDRSAQSVDEWTGE  478

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DVPEDIEPE+IRPMGNYAVSITWPDGF+QIAPYDQL+T+ERLV+VPE T A+
Sbjct  479   QKIQHGDVPEDIEPEDIRPMGNYAVSITWPDGFNQIAPYDQLETLERLVDVPEPTVAK  536


 Score =   284 bits (727),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VLKAL+QIIDPDFGTDIVSCGFVKDL ++E L EVSFRLELTTPACPIKDMFEQKA
Sbjct  84   AKKDVLKALSQIIDPDFGTDIVSCGFVKDLTIDETLKEVSFRLELTTPACPIKDMFEQKA  143

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPAKPVFAG+LP GLQ+ISNI+AVSSCKGGVGKST+AVNL 
Sbjct  144  NEVVAALPWVKKVNVTMSAQPAKPVFAGELPKGLQSISNIIAVSSCKGGVGKSTIAVNLG  203

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  204  YTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  238



>ref|XP_006396125.1| hypothetical protein EUTSA_v10002483mg [Eutrema salsugineum]
 gb|ESQ36904.1| hypothetical protein EUTSA_v10002483mg [Eutrema salsugineum]
Length=525

 Score =   560 bits (1442),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +PEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYL+IDMPP
Sbjct  227   DPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLIIDMPP  286

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  287   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  346

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVV+QFGIPHLFDLPIR TLSASGDSG PEVV+DP  EVA TFQ+LGV
Sbjct  347   KRYYPFGKGSGSQVVEQFGIPHLFDLPIRSTLSASGDSGIPEVVSDPLSEVARTFQDLGV  406

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  407   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  466

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  467   QKIQFGDVAEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  524


 Score =   280 bits (717),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +T E +VLKAL+QIIDPDFGTDIVSCGFVKDL+++EALGEVS RLELTTPACP+KDMFEQ
Sbjct  70   KTLEKDVLKALSQIIDPDFGTDIVSCGFVKDLVIDEALGEVSLRLELTTPACPVKDMFEQ  129

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
             ANEVVA LPWVK V VTMSAQPAKP+FAGQLPPGL  IS+IVAVSSCKGGVGKSTVAVN
Sbjct  130  TANEVVAVLPWVKKVNVTMSAQPAKPIFAGQLPPGLSRISSIVAVSSCKGGVGKSTVAVN  189

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  190  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  226



>ref|XP_010513436.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Camelina sativa]
Length=540

 Score =   556 bits (1433),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/298 (88%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  242   NPETKTIIPTEYIGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  301

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  302   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  361

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  362   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  421

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  422   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  481

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+V  L+P +
Sbjct  482   QKIQFGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVSPLSPVE  539


 Score =   282 bits (721),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            ++T E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE
Sbjct  84   DKTLERDVLKALSQIIDPDFGTDIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFE  143

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
             KANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAV
Sbjct  144  NKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAV  203

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  204  NLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  241



>ref|XP_008776940.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X2 [Phoenix dactylifera]
Length=532

 Score =   555 bits (1430),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/298 (88%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYL+IDMPP
Sbjct  231   NPESRTILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLLIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTA+VIVTTPQKLAFIDVAKGVRMFS LKVPCVAVVENMC+FDADG
Sbjct  291   GTGDIQLTLCQVAPLTASVIVTTPQKLAFIDVAKGVRMFSTLKVPCVAVVENMCYFDADG  350

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSGAQVVQQFGIPHLFDLPIR TLSASGDSG PEVVADP+GEVA  FQ+LGV
Sbjct  351   KRYYPFGKGSGAQVVQQFGIPHLFDLPIRSTLSASGDSGMPEVVADPQGEVAKIFQDLGV  410

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYD+SI+AI+VKVP+SD+EF LHPATVRRNDRSA+SV EW+GE
Sbjct  411   CVVQQCAKIRQQVSTAVSYDKSIRAIRVKVPDSDDEFLLHPATVRRNDRSAQSVDEWTGE  470

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DVPEDIEPE+IRPMGNYAVSITWPDGF+QIAPYDQL+T+ERLV+VPE T A+
Sbjct  471   QKIQHGDVPEDIEPEDIRPMGNYAVSITWPDGFNQIAPYDQLETLERLVDVPEPTVAK  528


 Score =   283 bits (724),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VLKAL+QIIDPDFGTDIVSCGFVKDL ++E L EVSFRLELTTPACPIKDMFEQKA
Sbjct  76   AKKDVLKALSQIIDPDFGTDIVSCGFVKDLTIDETLKEVSFRLELTTPACPIKDMFEQKA  135

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPAKPVFAG+LP GLQ+ISNI+AVSSCKGGVGKST+AVNL 
Sbjct  136  NEVVAALPWVKKVNVTMSAQPAKPVFAGELPKGLQSISNIIAVSSCKGGVGKSTIAVNLG  195

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  196  YTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  230



>ref|XP_010941458.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=537

 Score =   556 bits (1433),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/298 (88%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+P EYLGVKLVSFGF GQGRAIMRGPMVSGVINQLLTT EWGELDYL+IDMPP
Sbjct  236   NPETRTILPAEYLGVKLVSFGFTGQGRAIMRGPMVSGVINQLLTTAEWGELDYLIIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  296   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG QVVQQFGIPHLFDLPIR TLSASGDSGTPEVVADP+G+VA  FQ+LGV
Sbjct  356   KRYYPFGKGSGTQVVQQFGIPHLFDLPIRSTLSASGDSGTPEVVADPQGDVAKIFQDLGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYD+SIKAI+VKVP+SD+EF LHPATVRRNDRSA+SV EW+GE
Sbjct  416   CVVQQCAKIRQQVSTAVSYDKSIKAIRVKVPDSDDEFLLHPATVRRNDRSAQSVDEWTGE  475

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+QY DVPEDIEPE+IRPMGNYAVSITWPDGF+QIAPYDQL+T+ERLV+VPE T A+
Sbjct  476   QKIQYGDVPEDIEPEDIRPMGNYAVSITWPDGFNQIAPYDQLETLERLVDVPEPTVAK  533


 Score =   281 bits (720),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VLKAL+QIIDPDFGTDIVSCGFVKDL  +E L EVSFRLELTTPACPIKDMFEQKA
Sbjct  81   AKKDVLKALSQIIDPDFGTDIVSCGFVKDLTFDETLKEVSFRLELTTPACPIKDMFEQKA  140

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V V MSAQPAKPVFAG+LP GLQ+ISNI+AVSSCKGGVGKST+AVNLA
Sbjct  141  NEVVAALPWVKKVNVKMSAQPAKPVFAGELPKGLQSISNIIAVSSCKGGVGKSTIAVNLA  200

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  201  YTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  235



>ref|XP_002885645.1| high-chlorophyll-fluorescence 101 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61904.1| high-chlorophyll-fluorescence 101 [Arabidopsis lyrata subsp. 
lyrata]
Length=531

 Score =   560 bits (1442),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  233   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  293   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  352

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  353   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  412

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  413   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  472

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+ Y DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+ IERLV+VP L+P +
Sbjct  473   QKVLYGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLEEIERLVDVPPLSPVE  530


 Score =   278 bits (710),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            ++T+E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE
Sbjct  75   DKTSEKDVLKALSQIIDPDFGTDIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFE  134

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
             KANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAV
Sbjct  135  NKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAV  194

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGARVGIFDADVYGPSLPTMV+PE+ +LEM
Sbjct  195  NLAYTLAGMGARVGIFDADVYGPSLPTMVNPESCILEM  232



>ref|XP_006844368.1| hypothetical protein AMTR_s00142p00060790 [Amborella trichopoda]
 gb|ERN06043.1| hypothetical protein AMTR_s00142p00060790 [Amborella trichopoda]
Length=545

 Score =   552 bits (1423),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/292 (89%), Positives = 282/292 (97%), Gaps = 0/292 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N EK+ IIPT+YLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  233   NLEKRMIIPTDYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  293   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  352

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPH FDLPIRPTLSASGDSG PEVV DP+GEVA TFQ++GV
Sbjct  353   KRYYPFGRGSGSQVVQQFGIPHRFDLPIRPTLSASGDSGMPEVVNDPQGEVAQTFQDIGV  412

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S++AI+VKVP+SDEEF LHPA VRRNDRSA+SV EW+GE
Sbjct  413   CVVQQCAKIRQQVSTAVTYDKSLRAIRVKVPDSDEEFLLHPAIVRRNDRSAQSVDEWTGE  472

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVP  1777
             +KLQY+DVPEDIEPE+IRPMGNYAVSITWPDGF+QIAPYDQLQ+IERLV+ P
Sbjct  473   RKLQYADVPEDIEPEDIRPMGNYAVSITWPDGFNQIAPYDQLQSIERLVDAP  524


 Score =   284 bits (726),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/155 (90%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
             E +VL AL+QIIDPDFGTDIVSCGFVKDL ++E LGEVSFRLELTTPACPIKDMFEQKA
Sbjct  78   GENDVLAALSQIIDPDFGTDIVSCGFVKDLHIDEVLGEVSFRLELTTPACPIKDMFEQKA  137

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPA+P FAG LP GLQTISNIVAVSSCKGGVGKSTVAVNLA
Sbjct  138  NEVVAALPWVKRVNVTMSAQPARPAFAGDLPQGLQTISNIVAVSSCKGGVGKSTVAVNLA  197

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  198  YTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  232



>ref|XP_007013250.1| ATP binding isoform 3 [Theobroma cacao]
 gb|EOY30869.1| ATP binding isoform 3 [Theobroma cacao]
Length=442

 Score =   564 bits (1454),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/298 (90%), Positives = 285/298 (96%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVK+VSFGFAGQG AIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  144   NPEKRTIIPTEYLGVKMVSFGFAGQGHAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  203

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  204   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  263

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADP+GEVA TFQ LGV
Sbjct  264   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPQGEVAKTFQNLGV  323

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  324   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  383

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY D+PEDIEPEEIRPMGNYAVSITWPDGF+QIAPYDQLQ +ERLV+ P  T  Q
Sbjct  384   QKLQYGDIPEDIEPEEIRPMGNYAVSITWPDGFNQIAPYDQLQMMERLVDFPLPTSVQ  441


 Score =   272 bits (696),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +1

Query  406  IDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKT  585
            +DPDFGTDIVSCGFVKDLL++EALGEVSFRLELTTPACPIKDMFEQ+ANEVVA LPWV  
Sbjct  1    MDPDFGTDIVSCGFVKDLLIDEALGEVSFRLELTTPACPIKDMFEQQANEVVARLPWVSK  60

Query  586  VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGI  765
            V VTMSAQPAKP+FAGQLP GLQTISNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGI
Sbjct  61   VSVTMSAQPAKPIFAGQLPAGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGI  120

Query  766  FDADVYGPSLPTMVSPENRLLEM  834
            FDADVYGPSLPTMVSPENRLLEM
Sbjct  121  FDADVYGPSLPTMVSPENRLLEM  143



>ref|XP_010488540.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X1 [Camelina sativa]
Length=541

 Score =   553 bits (1424),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/298 (88%), Positives = 283/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  243   NPETKTIIPTEYIGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  302

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  303   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  362

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  363   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  422

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+S  EW+GE
Sbjct  423   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSADEWTGE  482

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEP++IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  483   QKIQFGDVAEDIEPDDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  540


 Score =   282 bits (722),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            ++T+E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE
Sbjct  85   DKTSERDVLKALSQIIDPDFGTDIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFE  144

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
             KANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAV
Sbjct  145  NKANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAV  204

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  205  NLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  242



>ref|XP_010466845.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=543

 Score =   554 bits (1427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/298 (88%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  245   NPETKTIIPTEYIGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  304

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  305   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  364

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLF+LPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  365   KRYYPFGKGSGSEVVKQFGIPHLFELPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  424

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  425   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  484

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  485   QKVQFGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  542


 Score =   280 bits (716),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +T E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE 
Sbjct  88   KTLERDVLKALSQIIDPDFGTDIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFEN  147

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVN
Sbjct  148  RANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVN  207

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  208  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  244



>ref|XP_010466846.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=542

 Score =   554 bits (1427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/298 (88%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  244   NPETKTIIPTEYIGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  303

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  304   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  363

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLF+LPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  364   KRYYPFGKGSGSEVVKQFGIPHLFELPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  423

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  424   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  483

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  484   QKVQFGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  541


 Score =   280 bits (716),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +T E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE 
Sbjct  87   KTLERDVLKALSQIIDPDFGTDIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFEN  146

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVN
Sbjct  147  RANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVN  206

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  207  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  243



>ref|XP_006646268.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
[Oryza brachyantha]
Length=534

 Score =   558 bits (1438),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/297 (89%), Positives = 283/297 (95%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  233   NPESRTILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  293   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  352

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KR+YPFG+GSGAQVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ LGV
Sbjct  353   KRFYPFGQGSGAQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQNLGV  412

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  413   CVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  472

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QK+QY D+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+VP    A
Sbjct  473   QKVQYGDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDVPRAKTA  529


 Score =   272 bits (695),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + A+ +VL AL+QIIDPDFGTDIVSCGFVKDL ++EAL EVSFRLELTTPACP+KDMFE+
Sbjct  76   EDAKKDVLVALSQIIDPDFGTDIVSCGFVKDLEISEALEEVSFRLELTTPACPVKDMFEE  135

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK V VTMSAQPA+P FAG+LP GLQ ISNI+AVSSCKGGVGKSTVAVN
Sbjct  136  KANEVVAALPWVKKVNVTMSAQPAQPAFAGELPEGLQKISNIIAVSSCKGGVGKSTVAVN  195

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  196  LAYTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  232



>sp|Q0JJS8.3|HF101_ORYSJ RecName: Full=Fe-S cluster assembly factor HCF101, chloroplastic; 
AltName: Full=Protein HIGH CHLOROPHYLL FLUORESCENCE 101 
homolog; Flags: Precursor [Oryza sativa Japonica Group]
Length=531

 Score =   557 bits (1435),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/297 (88%), Positives = 284/297 (96%), Gaps = 0/297 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE ++I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  231   NPESRSILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  291   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  350

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KR+YPFG+GSGAQVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ LGV
Sbjct  351   KRFYPFGQGSGAQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQNLGV  410

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  411   CVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  470

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             QK+QY D+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+VP  T A
Sbjct  471   QKVQYGDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDVPRATTA  527


 Score =   271 bits (694),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/157 (85%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + A+ +VL AL+QIIDPDFGTDIVSCGFVKDL ++EAL EVSFRLELTTPACPIKDMFE+
Sbjct  74   EDAKKDVLVALSQIIDPDFGTDIVSCGFVKDLEISEALEEVSFRLELTTPACPIKDMFEE  133

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK V VTMSAQPA+P +AG+LP GLQ ISNI+AVSSCKGGVGKSTVAVN
Sbjct  134  KANEVVAALPWVKKVNVTMSAQPARPAYAGELPEGLQKISNIIAVSSCKGGVGKSTVAVN  193

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  194  LAYTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  230



>ref|XP_010232251.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
[Brachypodium distachyon]
Length=529

 Score =   554 bits (1428),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/299 (88%), Positives = 283/299 (95%), Gaps = 2/299 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K+I+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  228   NPESKSILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  287

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDAD 
Sbjct  288   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADE  347

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSGAQVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ LGV
Sbjct  348   KRYYPFGQGSGAQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQNLGV  407

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  408   CVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  467

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQP  1798
             QK+QY D+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  +ERLV+VP   PA P
Sbjct  468   QKVQYGDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLDMLERLVDVPR--PATP  524


 Score =   270 bits (690),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/153 (86%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGFVKDL ++EAL EVSFRLELTTPACP+KDMFE+KA
Sbjct  73   AKRDVLIALSQIIDPDFGTDIVSCGFVKDLEISEALEEVSFRLELTTPACPVKDMFEEKA  132

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPA+PV+AG LP GLQ ISNI+AVSSCKGGVGKSTVAVNLA
Sbjct  133  NEVVAALPWVKKVNVTMSAQPAQPVYAGDLPEGLQKISNIIAVSSCKGGVGKSTVAVNLA  192

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL
Sbjct  193  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLL  225



>ref|XP_003620543.1| Mrp-like protein [Medicago truncatula]
Length=516

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/291 (88%), Positives = 274/291 (94%), Gaps = 10/291 (3%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGV NQLLTTTEWGELDYLVIDMPP
Sbjct  235   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPP  294

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  295   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  354

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  355   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  414

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP+SDEEF+LHPATVRRNDRSA+SV      
Sbjct  415   CVVQQCAKIRQQVSTAVTYDKSVKAIRVKVPDSDEEFFLHPATVRRNDRSAQSV------  468

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
                 Y+D+P+ IEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  469   ----YTDIPDYIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVGV  515


 Score =   285 bits (729),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEVSFRLELTTPACPIKD+FE++
Sbjct  79   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLQIDKALGEVSFRLELTTPACPIKDVFEKQ  138

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK V VTMSAQPAKP+FA QLP GLQTISNI+AVSSCKGGVGKSTVAVNL
Sbjct  139  ANEVVAVLPWVKNVNVTMSAQPAKPLFAEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNL  198

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDAD+YGPSLPTMVSPENR+LEM
Sbjct  199  AYTLADMGARVGIFDADIYGPSLPTMVSPENRILEM  234



>ref|XP_008669716.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X2 [Zea mays]
Length=531

 Score =   552 bits (1422),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/290 (90%), Positives = 279/290 (96%), Gaps = 0/290 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  229   NPESKYILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  288

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  289   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  348

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG QVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA+TFQ LG 
Sbjct  349   KRYYPFGQGSGTQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVANTFQNLGA  408

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  409   CVVQQCAKIRQQVSTAVSYDRSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  468

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             QK+QYSD+P+DIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLVE
Sbjct  469   QKVQYSDIPDDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVE  518


 Score =   270 bits (689),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGF+KDL V+EAL EVSFRLELTTPACPIKD FEQKA
Sbjct  74   AKKDVLIALSQIIDPDFGTDIVSCGFIKDLEVSEALEEVSFRLELTTPACPIKDEFEQKA  133

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPA+PV+ G+LP GLQ ISNI+AVSSCKGGVGKSTVAVNLA
Sbjct  134  NEVVAALPWVKKVDVTMSAQPAQPVYGGELPEGLQKISNIIAVSSCKGGVGKSTVAVNLA  193

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  194  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  228



>ref|XP_006396124.1| hypothetical protein EUTSA_v10002483mg [Eutrema salsugineum]
 gb|ESQ36903.1| hypothetical protein EUTSA_v10002483mg [Eutrema salsugineum]
Length=517

 Score =   540 bits (1390),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/298 (87%), Positives = 277/298 (93%), Gaps = 8/298 (3%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +PEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYL+IDMPP
Sbjct  227   DPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLIIDMPP  286

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  287   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  346

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG+QVV+QFGIPHLFDLPIR TLSASGDSG PEVV+DP  EVA TFQ+LGV
Sbjct  347   KRYYPFGKGSGSQVVEQFGIPHLFDLPIRSTLSASGDSGIPEVVSDPLSEVARTFQDLGV  406

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+S       
Sbjct  407   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQS-------  459

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
              K+Q+ DV EDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  460   -KIQFGDVAEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  516


 Score =   281 bits (718),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 147/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +T E +VLKAL+QIIDPDFGTDIVSCGFVKDL+++EALGEVS RLELTTPACP+KDMFEQ
Sbjct  70   KTLEKDVLKALSQIIDPDFGTDIVSCGFVKDLVIDEALGEVSLRLELTTPACPVKDMFEQ  129

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
             ANEVVA LPWVK V VTMSAQPAKP+FAGQLPPGL  IS+IVAVSSCKGGVGKSTVAVN
Sbjct  130  TANEVVAVLPWVKKVNVTMSAQPAKPIFAGQLPPGLSRISSIVAVSSCKGGVGKSTVAVN  189

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  190  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  226



>ref|XP_006451083.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64323.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|KDO54139.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=516

 Score =   538 bits (1386),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/276 (92%), Positives = 270/276 (98%), Gaps = 0/276 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  231   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  291   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  350

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  351   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  410

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  411   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  470

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQI  1729
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQ+
Sbjct  471   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQV  506


 Score =   282 bits (722),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIVSCGFVKD+ +NEALGEVSFRLELTTPACPIKDMFEQ+
Sbjct  75   TAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVSFRLELTTPACPIKDMFEQR  134

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKSTVAVNL
Sbjct  135  ANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNL  194

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  195  AYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  230



>ref|XP_008669715.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X1 [Zea mays]
Length=532

 Score =   550 bits (1418),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/290 (90%), Positives = 279/290 (96%), Gaps = 0/290 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  230   NPESKYILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  289

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  290   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  349

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG QVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA+TFQ LG 
Sbjct  350   KRYYPFGQGSGTQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVANTFQNLGA  409

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  410   CVVQQCAKIRQQVSTAVSYDRSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  469

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             QK+QYSD+P+DIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLVE
Sbjct  470   QKVQYSDIPDDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVE  519


 Score =   269 bits (688),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGF+KDL V+EAL EVSFRLELTTPACPIKD FEQKA
Sbjct  75   AKKDVLIALSQIIDPDFGTDIVSCGFIKDLEVSEALEEVSFRLELTTPACPIKDEFEQKA  134

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPA+PV+ G+LP GLQ ISNI+AVSSCKGGVGKSTVAVNLA
Sbjct  135  NEVVAALPWVKKVDVTMSAQPAQPVYGGELPEGLQKISNIIAVSSCKGGVGKSTVAVNLA  194

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  195  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  229



>ref|XP_004969777.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X1 [Setaria italica]
Length=535

 Score =   550 bits (1418),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/298 (88%), Positives = 282/298 (95%), Gaps = 1/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE + I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  235   NPESRAILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  294

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  295   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  354

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG QVVQQFGIP+LFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ LGV
Sbjct  355   KRYYPFGQGSGTQVVQQFGIPNLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQNLGV  414

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  415   CVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  474

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE-LTPA  1792
             QK+QY DVP+DIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+ P   TPA
Sbjct  475   QKIQYDDVPDDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDAPRAATPA  532


 Score =   268 bits (686),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGFVKDL + +AL EVSFRLELTTPACPIKD FEQKA
Sbjct  80   AKKDVLIALSQIIDPDFGTDIVSCGFVKDLEIGDALDEVSFRLELTTPACPIKDEFEQKA  139

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPA+PV+ G+LP GLQ ISNI+AVSSCKGGVGKSTVAVNLA
Sbjct  140  NEVVAALPWVKKVDVTMSAQPAQPVYGGELPEGLQKISNIIAVSSCKGGVGKSTVAVNLA  199

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  200  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  234



>gb|KFK39886.1| hypothetical protein AALP_AA3G301400 [Arabis alpina]
Length=517

 Score =   536 bits (1381),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/298 (87%), Positives = 276/298 (93%), Gaps = 11/298 (4%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  228   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  287

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  288   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  347

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  348   KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  407

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNS+EEF LHPAT            EW+GE
Sbjct  408   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSEEEFLLHPAT-----------DEWTGE  456

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEP++IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  457   QKVQFGDVAEDIEPDDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  514


 Score =   280 bits (716),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
             +T+E +VLKAL+QIIDPDFGTDIVSCGFVKDL ++E++GEVSFRLELTTPACP+KDMFE
Sbjct  70   GKTSEKDVLKALSQIIDPDFGTDIVSCGFVKDLRIDESVGEVSFRLELTTPACPVKDMFE  129

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
            QKANEVVA +PWV+ V VTMSAQPAKP+FAGQLPPGL  IS+I+AVSSCKGGVGKSTVAV
Sbjct  130  QKANEVVAVIPWVQKVNVTMSAQPAKPIFAGQLPPGLSRISSIIAVSSCKGGVGKSTVAV  189

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  190  NLAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  227



>emb|CDM84696.1| unnamed protein product [Triticum aestivum]
Length=538

 Score =   550 bits (1417),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/292 (89%), Positives = 280/292 (96%), Gaps = 0/292 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K+I+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  237   NPESKSILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  296

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDAD 
Sbjct  297   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADE  356

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSGAQVVQQFGIP+LFDLPIRPTLS+SGD+G PEVV+DP+G+VA  FQ LGV
Sbjct  357   KRYYPFGKGSGAQVVQQFGIPNLFDLPIRPTLSSSGDTGIPEVVSDPQGDVAKIFQNLGV  416

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  417   CVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGE  476

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVP  1777
             QK+QY DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  +ERLV+VP
Sbjct  477   QKVQYGDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLDMLERLVDVP  528


 Score =   263 bits (673),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + A+ +VL AL+QIIDPDFGTDIVSCGF+KDL ++E L EVSFR+ELTTPACP+KDMFE+
Sbjct  80   EDAKRDVLIALSQIIDPDFGTDIVSCGFIKDLEISETLEEVSFRVELTTPACPVKDMFEE  139

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK V VTMSAQPA+PV+AG LP GL+ ISNI+AVSSCKGGVGKSTVAVN
Sbjct  140  KANEVVAALPWVKKVNVTMSAQPAQPVYAGDLPEGLKKISNIIAVSSCKGGVGKSTVAVN  199

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
            LAYTLA MGARVGIFDADV+GPSLP MVSPENRLL
Sbjct  200  LAYTLAGMGARVGIFDADVFGPSLPNMVSPENRLL  234



>ref|XP_010488541.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X2 [Camelina sativa]
Length=509

 Score =   553 bits (1425),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/298 (88%), Positives = 283/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  211   NPETKTIIPTEYIGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  270

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  271   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  330

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  331   KRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  390

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+S  EW+GE
Sbjct  391   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSADEWTGE  450

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEP++IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  451   QKIQFGDVAEDIEPDDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  508


 Score =   248 bits (632),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  427  DIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSA  606
            DIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE KANEVVAALPWVK V VTMSA
Sbjct  75   DIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFENKANEVVAALPWVKKVNVTMSA  134

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
            QPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYG
Sbjct  135  QPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYG  194

Query  787  PSLPTMVSPENRLLEM  834
            PSLPTMV+PE+R+LEM
Sbjct  195  PSLPTMVNPESRILEM  210



>ref|XP_010466847.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=510

 Score =   554 bits (1427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/298 (88%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE KTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  212   NPETKTIIPTEYIGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  271

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  272   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  331

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLF+LPIRPTLSASGDSGTPEVV+DP  +VA TFQ+LGV
Sbjct  332   KRYYPFGKGSGSEVVKQFGIPHLFELPIRPTLSASGDSGTPEVVSDPLSDVARTFQDLGV  391

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  392   CVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPATVRRNDRSAQSVDEWTGE  451

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+Q+ DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL+TIERLV+VP L+P +
Sbjct  452   QKVQFGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQLETIERLVDVPPLSPVE  509


 Score =   246 bits (629),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 119/136 (88%), Positives = 128/136 (94%), Gaps = 0/136 (0%)
 Frame = +1

Query  427  DIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSA  606
            DIVSCGFVKDL ++EALGEVSFRLELTTPACP+KDMFE +ANEVVAALPWVK V VTMSA
Sbjct  76   DIVSCGFVKDLGIDEALGEVSFRLELTTPACPVKDMFENRANEVVAALPWVKKVNVTMSA  135

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
            QPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYG
Sbjct  136  QPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYG  195

Query  787  PSLPTMVSPENRLLEM  834
            PSLPTMV+PE+R+LEM
Sbjct  196  PSLPTMVNPESRILEM  211



>ref|XP_006451079.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64319.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|KDO54136.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=423

 Score =   572 bits (1474),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/296 (92%), Positives = 289/296 (98%), Gaps = 0/296 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  127   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  186

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  187   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  246

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  247   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  306

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  307   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  366

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+VP+ TP
Sbjct  367   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTP  422


 Score =   227 bits (579),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  457  LLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQ  636
            + +NEALGEVSFRLELTTPACPIKDMFEQ+ANEVV A+PWV  V VTMSAQPA+P+FA Q
Sbjct  1    MQINEALGEVSFRLELTTPACPIKDMFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQ  60

Query  637  LPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPE  816
            LP GLQ ISNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPE
Sbjct  61   LPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPE  120

Query  817  NRLLEM  834
            NRLLEM
Sbjct  121  NRLLEM  126



>gb|KHG19668.1| Protein mrp [Gossypium arboreum]
Length=504

 Score =   488 bits (1257),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/298 (81%), Positives = 259/298 (87%), Gaps = 30/298 (10%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPT+YLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTT+EWGELDYLVIDMPP
Sbjct  236   NPEKRTIIPTDYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKV                
Sbjct  296   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKV----------------  339

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
                           VQQFGIPHLFDLPIRPTLSASGDSGTPEVVADP+GEVA TFQ LGV
Sbjct  340   --------------VQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPQGEVAQTFQNLGV  385

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+S+EEF LHPATVRRNDRSA+SV EW+GE
Sbjct  386   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSEEEFLLHPATVRRNDRSAQSVDEWTGE  445

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY D+PEDIEPEEIRPMGNYAVSITWPDGF+QIAPYDQLQ IERLV+VP+ T  Q
Sbjct  446   QKLQYGDIPEDIEPEEIRPMGNYAVSITWPDGFNQIAPYDQLQMIERLVDVPQPTAVQ  503


 Score =   303 bits (775),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/235 (71%), Positives = 184/235 (78%), Gaps = 5/235 (2%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLL--CNSPFPSQRHLRPLSVASTRSILT  318
            M LL APS   LSF      SK GL   E C  L   N  F  Q+  R + V+  R+  +
Sbjct  1    MQLLHAPSWPHLSFQTSDRNSKGGLLSLEKCLQLSTANCSFQPQKLERSIWVSHKRNFFS  60

Query  319  ---PkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVS  489
                KA SV+A +S  S+ TAE +VLKAL+QIIDPDFGTDIV+CGFVKDLL++EA GEVS
Sbjct  61   FCATKATSVEAGSSAASSGTAEGDVLKALSQIIDPDFGTDIVTCGFVKDLLIDEASGEVS  120

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNI  669
            FRLELTTPACPIKDMFEQ+ANEVVA LPWVK V VTMSAQPAKP+FAG LP GL+ ISNI
Sbjct  121  FRLELTTPACPIKDMFEQQANEVVARLPWVKKVAVTMSAQPAKPIFAGDLPAGLRRISNI  180

Query  670  VAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVSSCKGGVGKSTVAVNLAYTLA MGARVG+FDADVYGPSLPTMVSPENRLLEM
Sbjct  181  VAVSSCKGGVGKSTVAVNLAYTLAGMGARVGVFDADVYGPSLPTMVSPENRLLEM  235



>dbj|BAB02944.1| unnamed protein product [Arabidopsis thaliana]
Length=550

 Score =   501 bits (1289),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/316 (79%), Positives = 272/316 (86%), Gaps = 18/316 (6%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMP-  1078
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEW    + +ID   
Sbjct  234   NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWFVHFHKIIDFMF  293

Query  1079  -PGT-------------GDIQLTLCQ---VVPLTAAVIVTTPQKLAFIDVAKGVRMFSKL  1207
              P T               I L+ C    V PLTAAVIVTTPQKLAFIDVAKGVRMFSKL
Sbjct  294   FPETFINLFEEFDAGESWTILLSTCLLELVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKL  353

Query  1208  KVPCVAVVENMCHFDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPE  1387
             KVPCVAVVENMCHFDADGKRYYPFGKGSG++VV+QFGIPHLFDLPIRPTLSASGDSGTPE
Sbjct  354   KVPCVAVVENMCHFDADGKRYYPFGKGSGSEVVKQFGIPHLFDLPIRPTLSASGDSGTPE  413

Query  1388  VVADPRGEVASTFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPA  1567
             VV+DP  +VA TFQ+LGVCVVQQCA+IRQQVSTAV+YD+ +KAI+VKVPNSDEEF LHPA
Sbjct  414   VVSDPLSDVARTFQDLGVCVVQQCAKIRQQVSTAVTYDKYLKAIRVKVPNSDEEFLLHPA  473

Query  1568  TVRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  1747
             TVRRNDRSA+SV EW+GEQK+ Y DV EDIEPE+IRPMGNYAVSITWPDGFSQIAPYDQL
Sbjct  474   TVRRNDRSAQSVDEWTGEQKVLYGDVAEDIEPEDIRPMGNYAVSITWPDGFSQIAPYDQL  533

Query  1748  QTIERLVEVPELTPAQ  1795
             + IERLV+VP L+P +
Sbjct  534   EEIERLVDVPPLSPVE  549


 Score =   285 bits (730),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 148/157 (94%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QT+E +VLKAL+QIIDPDFGTDIVSCGFVKDL +NEALGEVSFRLELTTPACP+KDMFE 
Sbjct  77   QTSEKDVLKALSQIIDPDFGTDIVSCGFVKDLGINEALGEVSFRLELTTPACPVKDMFEN  136

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK V VTMSAQPAKP+FAGQLP GL  ISNI+AVSSCKGGVGKSTVAVN
Sbjct  137  KANEVVAALPWVKKVNVTMSAQPAKPIFAGQLPFGLSRISNIIAVSSCKGGVGKSTVAVN  196

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMV+PE+R+LEM
Sbjct  197  LAYTLAGMGARVGIFDADVYGPSLPTMVNPESRILEM  233



>gb|EPS72302.1| hypothetical protein M569_02451 [Genlisea aurea]
Length=518

 Score =   513 bits (1322),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/299 (80%), Positives = 278/299 (93%), Gaps = 9/299 (3%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT EWGELDYLVIDMPP
Sbjct  229   NPEKRSIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTAEWGELDYLVIDMPP  288

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPL+AAVIVTTPQKLAFIDVAKGV        PCVAVVENMCHFDADG
Sbjct  289   GTGDIQLTLCQIVPLSAAVIVTTPQKLAFIDVAKGV--------PCVAVVENMCHFDADG  340

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRY+PFG+GSG+QVV++FGIPHLF+LPI+P+LSASGDSG P+VVADP+GEVA TFQELGV
Sbjct  341   KRYHPFGRGSGSQVVREFGIPHLFELPIQPSLSASGDSGVPDVVADPQGEVAKTFQELGV  400

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             C+V QCA+IRQQ ST+V+Y++S+KAI+VK+P+S++EF+LHPATVRRNDRSAESV EW+GE
Sbjct  401   CMVHQCAKIRQQASTSVTYEKSLKAIRVKLPSSEDEFFLHPATVRRNDRSAESVDEWTGE  460

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQP  1798
             QKL+Y D+PEDIEPEEI+PMGNYAVSITWP+GF+QIAPYDQL+T+E L+ V    PA+P
Sbjct  461   QKLRYGDIPEDIEPEEIQPMGNYAVSITWPNGFNQIAPYDQLRTMEHLIGVHH-RPAKP  518


 Score =   271 bits (693),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/157 (83%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +TAE++VLKAL+QIIDPDFGTDIVSCGFVKDL V +A GEVSFRLELTTPACP+KD FE+
Sbjct  72   ETAESDVLKALSQIIDPDFGTDIVSCGFVKDLNVIKASGEVSFRLELTTPACPLKDTFER  131

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KA E+VA LPWV  V+VTMSAQP++PVF GQLP G+Q +SNI+AVSSCKGGVGKSTVAVN
Sbjct  132  KAREMVAELPWVDNVQVTMSAQPSRPVFDGQLPAGIQKVSNIIAVSSCKGGVGKSTVAVN  191

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  192  LAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  228



>gb|EYU23025.1| hypothetical protein MIMGU_mgv1a004312mg [Erythranthe guttata]
Length=450

 Score =   561 bits (1445),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/294 (89%), Positives = 287/294 (98%), Gaps = 0/294 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  154   NPEKRTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  213

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  214   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  273

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVV++FGIPHLF+LPIRPTLSASGDSG PEVV+DP+GEVA+ FQELGV
Sbjct  274   KRYYPFGRGSGSQVVKEFGIPHLFELPIRPTLSASGDSGVPEVVSDPQGEVATAFQELGV  333

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP SDEEFYLHPATVRRNDRSA+SV EW+GE
Sbjct  334   CVVQQCAKIRQQVSTAVTYDKSMKAIRVKVPESDEEFYLHPATVRRNDRSADSVDEWTGE  393

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPEL  1783
             QKL+Y+D+ +DIEPE+IR MGNYAVSITWPDGFSQIAPYDQLQ +ERLV+VP+L
Sbjct  394   QKLKYADIADDIEPEDIRAMGNYAVSITWPDGFSQIAPYDQLQMMERLVDVPQL  447


 Score =   223 bits (568),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            +VSFRLELTTPACP+KDMFEQKANEVVAALPWV+ V VTMSAQPA+PV+AGQLP GLQT+
Sbjct  36   QVSFRLELTTPACPVKDMFEQKANEVVAALPWVEKVNVTMSAQPARPVYAGQLPAGLQTV  95

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SN+VAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  96   SNVVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  153



>ref|XP_002324970.2| HIGH-CHLOROPHYLL-FLUORESCENCE 101 family protein [Populus trichocarpa]
 gb|EEF03535.2| HIGH-CHLOROPHYLL-FLUORESCENCE 101 family protein [Populus trichocarpa]
Length=517

 Score =   492 bits (1266),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/300 (81%), Positives = 260/300 (87%), Gaps = 18/300 (6%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  229   NPEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  288

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK  C   +          
Sbjct  289   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKRICATSM----------  338

Query  1262  KRYYPFGKGSG----AQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
                 P G         QVVQQFGIPHLFDLPIRPTLSASGD G PEV ADP+GEVA  FQ
Sbjct  339   ----PMGNAITHLVEVQVVQQFGIPHLFDLPIRPTLSASGDGGMPEVAADPQGEVAKIFQ  394

Query  1430  ELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVE  1609
              LG+C+VQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S+EEF LHPATVRRNDRSA+SV E
Sbjct  395   NLGICIVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSEEEFLLHPATVRRNDRSAQSVDE  454

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             W+GEQKLQY+DVPEDIEPEEIRPMGNYAV ITWPDGFSQIAPYDQLQT+ERLV+VPE  P
Sbjct  455   WTGEQKLQYADVPEDIEPEEIRPMGNYAVQITWPDGFSQIAPYDQLQTMERLVDVPEPAP  514


 Score =   291 bits (746),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 184/232 (79%), Gaps = 6/232 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVA-ENCCLLCNSPFPSQRHLRP-LSVASTRSILT  318
            M LL AP+   LS   L ++ K GL+ + E    L     P +   R    +  TR++  
Sbjct  1    MQLLYAPTCHNLSLRSLHTRPKEGLFSSLEKWLHLSVDNQPCKLPPRKCFYLKKTRAL--  58

Query  319  PkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRL  498
               +SV+A  S VS + AE++VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA GEVSFRL
Sbjct  59   --NSSVQAGGSAVSTRNAESDVLKALSQIIDPDFGTDIVSCGFVKDLNIDEAQGEVSFRL  116

Query  499  ELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAV  678
            ELTTPACP+KDMFEQKANEVVA LPWVK VKVTMSAQPA+PV+AGQLP GLQTISNI+AV
Sbjct  117  ELTTPACPVKDMFEQKANEVVALLPWVKNVKVTMSAQPARPVYAGQLPQGLQTISNIIAV  176

Query  679  SSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  177  SSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  228



>ref|XP_010942914.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=446

 Score =   555 bits (1430),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/298 (88%), Positives = 284/298 (95%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+P EYLGVKLVSFGF GQGRAIMRGPMVSGVINQLLTT EWGELDYL+IDMPP
Sbjct  145   NPETRTILPAEYLGVKLVSFGFTGQGRAIMRGPMVSGVINQLLTTAEWGELDYLIIDMPP  204

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  205   GTGDIQLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  264

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG QVVQQFGIPHLFDLPIR TLSASGDSGTPEVVADP+G+VA  FQ+LGV
Sbjct  265   KRYYPFGKGSGTQVVQQFGIPHLFDLPIRSTLSASGDSGTPEVVADPQGDVAKIFQDLGV  324

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYD+SIKAI+VKVP+SD+EF LHPATVRRNDRSA+SV EW+GE
Sbjct  325   CVVQQCAKIRQQVSTAVSYDKSIKAIRVKVPDSDDEFLLHPATVRRNDRSAQSVDEWTGE  384

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QK+QY DVPEDIEPE+IRPMGNYAVSITWPDGF+QIAPYDQL+T+ERLV+VPE T A+
Sbjct  385   QKIQYGDVPEDIEPEDIRPMGNYAVSITWPDGFNQIAPYDQLETLERLVDVPEPTVAK  442


 Score =   224 bits (570),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +1

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            EVSFRLELTTPACPIKDMFEQKANEVVAALPWVK V V MSAQPAKPVFAG+LP GLQ+I
Sbjct  27   EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKKVNVKMSAQPAKPVFAGELPKGLQSI  86

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SNI+AVSSCKGGVGKST+AVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  87   SNIIAVSSCKGGVGKSTIAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  144



>gb|KHN32011.1| Protein mrp like [Glycine soja]
Length=500

 Score =   485 bits (1248),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/293 (82%), Positives = 254/293 (87%), Gaps = 30/293 (10%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKL+SFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYL+IDMPP
Sbjct  233   NPEKKTIIPTEYLGVKLISFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLIIDMPP  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKV                
Sbjct  293   GTGDIQLTLCQVVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKV----------------  336

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
                           VQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  337   --------------VQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  382

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S EEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  383   CVVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSKEEFFLHPATVRRNDRSAQSVDEWTGE  442

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE  1780
             QKLQY DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQ IERLV+V E
Sbjct  443   QKLQYGDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQMIERLVDVFE  495


 Score =   287 bits (734),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIV+CGFVKDL +++ALGEVSFRLELTTPACPIKD+FEQK
Sbjct  77   TAEDDVLKALSQIIDPDFGTDIVTCGFVKDLHIDKALGEVSFRLELTTPACPIKDVFEQK  136

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVVA LPWVK VKVTMSAQPA+P++A QLP GLQTISNIVAVSSCKGGVGKSTVAVNL
Sbjct  137  ANEVVAMLPWVKNVKVTMSAQPARPIYAEQLPAGLQTISNIVAVSSCKGGVGKSTVAVNL  196

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLADMGARVGIFDADVYGPSLPTMVSPENRLL M
Sbjct  197  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLVM  232



>ref|XP_001784629.1| predicted protein [Physcomitrella patens]
 gb|EDQ50561.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   518 bits (1334),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/296 (80%), Positives = 269/296 (91%), Gaps = 0/296 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE + IIPTEYLGVKLVSFG+AGQG AIMRGPMVSGVINQ LTTT+WGELDYLVIDMPP
Sbjct  256   NPETRAIIPTEYLGVKLVSFGYAGQGSAIMRGPMVSGVINQFLTTTDWGELDYLVIDMPP  315

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMC F+ D 
Sbjct  316   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCFFEGDD  375

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFGKGSG++VV+QFGIPHLF+LPIRP LSA+GD+G PEVV DP+G+VA+ F ++GV
Sbjct  376   KRYYPFGKGSGSKVVEQFGIPHLFELPIRPELSAAGDTGNPEVVVDPQGQVANIFSDVGV  435

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA++RQ VSTAV YD++I AI+VKVP + EEF LHPATVRRNDRSA+S+ EWSGE
Sbjct  436   CVVQQCAKLRQAVSTAVMYDKAINAIRVKVPGTTEEFLLHPATVRRNDRSAKSIDEWSGE  495

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             QKL+Y+DV ED+ PE IRPMGNYA +I WPDGFSQIAPYDQL T+ERLV++PE  P
Sbjct  496   QKLRYTDVAEDLAPESIRPMGNYAAAINWPDGFSQIAPYDQLATMERLVDIPEPVP  551


 Score =   251 bits (642),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +TA+ +VL AL+QIIDPDFGTDIV+CGFVK+L V+E+ GEVSF+LELTTPACP+KDMFEQ
Sbjct  99   ETAKKDVLGALSQIIDPDFGTDIVTCGFVKELTVDESTGEVSFQLELTTPACPVKDMFEQ  158

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +A E V+A+PWVK V V M+AQPAKP+ A  +P GL+ +SNIVAVSSCKGGVGKSTVAVN
Sbjct  159  QAKEKVSAIPWVKGVNVKMTAQPAKPLIADDVPAGLKKVSNIVAVSSCKGGVGKSTVAVN  218

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAY+LA MGARVGIFDAD+YGPSLPTMVSPE ++L+M
Sbjct  219  LAYSLAQMGARVGIFDADIYGPSLPTMVSPEVKVLQM  255



>ref|XP_006451076.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64316.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
Length=412

 Score =   538 bits (1387),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/276 (92%), Positives = 270/276 (98%), Gaps = 0/276 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  127   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  186

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  187   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  246

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  247   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  306

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  307   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  366

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQI  1729
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQ+
Sbjct  367   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQV  402


 Score =   228 bits (580),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +1

Query  457  LLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQ  636
            + +NEALGEVSFRLELTTPACPIKDMFEQ+ANEVV A+PWV  V VTMSAQPA+P+FA Q
Sbjct  1    MQINEALGEVSFRLELTTPACPIKDMFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQ  60

Query  637  LPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPE  816
            LP GLQ ISNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPE
Sbjct  61   LPEGLQKISNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPE  120

Query  817  NRLLEM  834
            NRLLEM
Sbjct  121  NRLLEM  126



>ref|XP_008463361.1| PREDICTED: iron-sulfur protein NUBPL isoform X2 [Cucumis melo]
Length=441

 Score =   567 bits (1461),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/298 (89%), Positives = 290/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE +TI+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTT EWGELDYL+IDMPP
Sbjct  142   NPETRTILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVISQLLTTAEWGELDYLIIDMPP  201

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  202   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  261

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PE VADP+GEVA TFQ+LGV
Sbjct  262   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGIPEAVADPQGEVAKTFQDLGV  321

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YDR+I+AI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  322   CVVQQCAKIRQQVSTAVTYDRTIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  381

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQY+D+PEDI+PEEI+PMGNYAV+ITWPDGF+QIAPYDQLQ +ERLV+VPEL+PAQ
Sbjct  382   QKLQYADIPEDIQPEEIKPMGNYAVTITWPDGFNQIAPYDQLQMMERLVDVPELSPAQ  439


 Score =   189 bits (480),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 107/127 (84%), Gaps = 4/127 (3%)
 Frame = +1

Query  466  NEALGEVSFRLELTTPACPIKDM----FEQKANEVVAALPWVKTVKVTMSAQPAKPVFAG  633
             E +G   + +E + P   ++ +    FEQ+ANE VAALPWVK VKVTMSAQPAKP++AG
Sbjct  15   KELIGRFPYYVETSFPVHSLEMLLLLKFEQRANEEVAALPWVKNVKVTMSAQPAKPIYAG  74

Query  634  QLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSP  813
            +LPPGLQ IS+IVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSP
Sbjct  75   ELPPGLQRISSIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSP  134

Query  814  ENRLLEM  834
            ENRLLEM
Sbjct  135  ENRLLEM  141



>ref|XP_002446055.1| hypothetical protein SORBIDRAFT_06g001090 [Sorghum bicolor]
 gb|EES10383.1| hypothetical protein SORBIDRAFT_06g001090 [Sorghum bicolor]
Length=505

 Score =   554 bits (1427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/295 (88%), Positives = 280/295 (95%), Gaps = 0/295 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE + I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  204   NPENRAILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  263

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  264   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  323

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG QVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP G+VA+ FQ LG 
Sbjct  324   KRYYPFGQGSGTQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPLGDVANIFQNLGA  383

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  384   CVVQQCAKIRQQVSTAVSYDRSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  443

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELT  1786
             QKLQYSD+P+DIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+VP  T
Sbjct  444   QKLQYSDIPDDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDVPSPT  498


 Score =   200 bits (508),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 113/155 (73%), Gaps = 35/155 (23%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGFVKDL ++EAL EVSFRLELTTPACPIKD FEQKA
Sbjct  84   AKKDVLIALSQIIDPDFGTDIVSCGFVKDLEISEALEEVSFRLELTTPACPIKDEFEQKA  143

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK                                   KGGVGKSTVAVNLA
Sbjct  144  NEVVAALPWVK-----------------------------------KGGVGKSTVAVNLA  168

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  169  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  203



>ref|XP_006451073.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451075.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451078.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451085.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451087.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64313.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64315.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64318.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64325.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64327.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|KDO54137.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
 gb|KDO54138.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=398

 Score =   571 bits (1472),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/296 (92%), Positives = 289/296 (98%), Gaps = 0/296 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  102   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  161

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  162   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  221

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  222   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  281

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  282   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  341

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV+VP+ TP
Sbjct  342   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVDVPQPTP  397


 Score =   181 bits (459),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  532  MFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKST  711
            MFEQ+ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKST
Sbjct  1    MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKST  60

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  61   VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  101



>ref|XP_002990705.1| hypothetical protein SELMODRAFT_185504 [Selaginella moellendorffii]
 gb|EFJ08337.1| hypothetical protein SELMODRAFT_185504 [Selaginella moellendorffii]
Length=536

 Score =   510 bits (1313),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 239/296 (81%), Positives = 270/296 (91%), Gaps = 6/296 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             + K IIPTEYLGVKLVSFGFAGQG AIMRGPMVSGVINQLLTTT+WGELDYL+IDMPPGT
Sbjct  205   DTKQIIPTEYLGVKLVSFGFAGQGTAIMRGPMVSGVINQLLTTTDWGELDYLIIDMPPGT  264

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKR  1267
             GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMC+FDADGKR
Sbjct  265   GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCLAVVENMCYFDADGKR  324

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRP------TLSASGDSGTPEVVADPRGEVASTFQ  1429
             YYPFG+GSG QVVQQFGI +LF+ PIRP       LSA+GDSGTPEVV DP+G+VA +F 
Sbjct  325   YYPFGRGSGKQVVQQFGISNLFEFPIRPEARLYKALSAAGDSGTPEVVHDPQGDVARSFS  384

Query  1430  ELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVE  1609
             ELGVCVVQQCA+IRQQVSTAV+YD +++AIKVKVP ++E FYLHPATVRRNDRSA+S+ E
Sbjct  385   ELGVCVVQQCAKIRQQVSTAVTYDDAMRAIKVKVPGTEEPFYLHPATVRRNDRSAKSIDE  444

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVP  1777
             W+GEQKL+Y DV EDIEPE I+P+GNYAV I+WPDGF+Q+APYDQL+ +ERLV+ P
Sbjct  445   WTGEQKLRYGDVREDIEPEAIQPLGNYAVMISWPDGFNQVAPYDQLEALERLVDTP  500


 Score =   242 bits (617),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL AL+ IIDPDFG DIV+CGFVKDL  +++ GEV+FRLELTTPACP+KDMFEQ+A E 
Sbjct  51   DVLVALSTIIDPDFGADIVTCGFVKDLQADKSSGEVAFRLELTTPACPVKDMFEQQAKEK  110

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTL  738
            VAALPWV  VKVTMSAQPAK + A  LP  LQ +SNI+AVSSCKGGVGKSTVAVNLAY+L
Sbjct  111  VAALPWVTNVKVTMSAQPAKALAAEGLPRSLQNVSNIIAVSSCKGGVGKSTVAVNLAYSL  170

Query  739  ADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            A MGA+VGIFDADVYGPSLPTMVSPE R+L+MV
Sbjct  171  AGMGAKVGIFDADVYGPSLPTMVSPELRVLQMV  203



>ref|XP_002969039.1| hypothetical protein SELMODRAFT_91144 [Selaginella moellendorffii]
 gb|EFJ30155.1| hypothetical protein SELMODRAFT_91144 [Selaginella moellendorffii]
Length=508

 Score =   510 bits (1313),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 239/296 (81%), Positives = 270/296 (91%), Gaps = 6/296 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             + K IIPTEYLGVKLVSFGFAGQG AIMRGPMVSGVINQLLTTT+WGELDYL+IDMPPGT
Sbjct  181   DTKQIIPTEYLGVKLVSFGFAGQGTAIMRGPMVSGVINQLLTTTDWGELDYLIIDMPPGT  240

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKR  1267
             GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMC+FDADGKR
Sbjct  241   GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCLAVVENMCYFDADGKR  300

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRP------TLSASGDSGTPEVVADPRGEVASTFQ  1429
             YYPFG+GSG QVVQQFGI +LF+ PIRP       LSA+GDSGTPEVV DP+G+VA +F 
Sbjct  301   YYPFGRGSGKQVVQQFGISNLFEFPIRPEARLYKALSAAGDSGTPEVVHDPQGDVARSFS  360

Query  1430  ELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVE  1609
             ELGVCVVQQCA+IRQQVSTAV+YD +++AIKVKVP ++E FYLHPATVRRNDRSA+S+ E
Sbjct  361   ELGVCVVQQCAKIRQQVSTAVTYDEAMRAIKVKVPGTEEPFYLHPATVRRNDRSAKSIDE  420

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVP  1777
             W+GEQKL+Y DV EDIEPE I+P+GNYAV I+WPDGF+Q+APYDQL+ +ERLV+ P
Sbjct  421   WTGEQKLRYGDVREDIEPEAIQPLGNYAVMISWPDGFNQVAPYDQLEALERLVDTP  476


 Score =   242 bits (617),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL AL+ IIDPDFG DIV+CGFVKDL  +++ GEV+FRLELTTPACP+KDMFEQ+A E 
Sbjct  27   DVLVALSTIIDPDFGADIVTCGFVKDLQADKSSGEVAFRLELTTPACPVKDMFEQQAKEK  86

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTL  738
            VAALPWV  VKVTMSAQPAK + A  LP  LQ +SNI+AVSSCKGGVGKSTVAVNLAY+L
Sbjct  87   VAALPWVTNVKVTMSAQPAKALAAEGLPRSLQNVSNIIAVSSCKGGVGKSTVAVNLAYSL  146

Query  739  ADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            A MGA+VGIFDADVYGPSLPTMVSPE R+L+MV
Sbjct  147  AGMGAKVGIFDADVYGPSLPTMVSPELRVLQMV  179



>ref|XP_010254191.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=470

 Score =   455 bits (1170),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/235 (92%), Positives = 228/235 (97%), Gaps = 0/235 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE ++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTT+EWGELDYLVIDMPP
Sbjct  236   NPETRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTSEWGELDYLVIDMPP  295

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  296   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  355

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGD G PEVV DP+GEVA TFQELGV
Sbjct  356   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDIGMPEVVTDPQGEVARTFQELGV  415

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVV  1606
             CVVQQCA+IRQQVSTAV YD+SIKAI+VKVP+SDEEF LHPATVRRNDRSA+SVV
Sbjct  416   CVVQQCAKIRQQVSTAVMYDKSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVV  470


 Score =   296 bits (758),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/198 (78%), Positives = 168/198 (85%), Gaps = 3/198 (2%)
 Frame = +1

Query  250  NSPFPSQRH---LRPLSVASTRSILTPkaasvkasasvvsNQTAEAEVLKALAQIIDPDF  420
            N    SQRH   +R L   ST S +T +A   +A AS + N  AE +VL AL+QIIDPDF
Sbjct  38   NCSISSQRHEGIVRLLRNPSTSSPVTTRATPAEAGASTILNSNAEKDVLTALSQIIDPDF  97

Query  421  GTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTM  600
            GTDIVSCGFVKD+ +NEALGEVSFRLELTTPACP+KDMFEQKANEVVA LPWVK V VTM
Sbjct  98   GTDIVSCGFVKDMHINEALGEVSFRLELTTPACPVKDMFEQKANEVVAMLPWVKKVNVTM  157

Query  601  SAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADV  780
            SAQPA+PVFAGQLP GLQTISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDADV
Sbjct  158  SAQPARPVFAGQLPTGLQTISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADV  217

Query  781  YGPSLPTMVSPENRLLEM  834
            YGPSLPTMVSPE+RLLEM
Sbjct  218  YGPSLPTMVSPEHRLLEM  235



>ref|NP_001044086.2| Os01g0719700 [Oryza sativa Japonica Group]
 gb|EAZ13354.1| hypothetical protein OsJ_03276 [Oryza sativa Japonica Group]
 dbj|BAF06000.2| Os01g0719700 [Oryza sativa Japonica Group]
Length=500

 Score =   548 bits (1411),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/301 (87%), Positives = 285/301 (95%), Gaps = 4/301 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE ++I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  196   NPESRSILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  255

Query  1082  GTGDIQLTLCQVV-PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             GTGDI LTLCQVV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDAD
Sbjct  256   GTGDIHLTLCQVVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDAD  315

Query  1259  GKRYYPFGKGSGAQ---VVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             GKR+YPFG+GSGAQ   VVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ
Sbjct  316   GKRFYPFGQGSGAQARKVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQ  375

Query  1430  ELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVE  1609
              LGVCVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF LHPATVRRNDRSA+SV E
Sbjct  376   NLGVCVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDE  435

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             W+GEQK+QY D+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+VP  T 
Sbjct  436   WTGEQKVQYGDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDVPRATT  495

Query  1790  A  1792
             A
Sbjct  496   A  496


 Score =   201 bits (512),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 115/157 (73%), Gaps = 35/157 (22%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + A+ +VL AL+QIIDPDFGTDIVSCGFVKDL ++EAL EVSFRLELTTPACPIKDMFE+
Sbjct  74   EDAKKDVLVALSQIIDPDFGTDIVSCGFVKDLEISEALEEVSFRLELTTPACPIKDMFEE  133

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK                                   KGGVGKSTVAVN
Sbjct  134  KANEVVAALPWVK-----------------------------------KGGVGKSTVAVN  158

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  159  LAYTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  195



>gb|EAY75635.1| hypothetical protein OsI_03540 [Oryza sativa Indica Group]
Length=500

 Score =   548 bits (1411),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/301 (87%), Positives = 285/301 (95%), Gaps = 4/301 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE ++I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  196   NPESRSILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  255

Query  1082  GTGDIQLTLCQVV-PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             GTGDI LTLCQVV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDAD
Sbjct  256   GTGDIHLTLCQVVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDAD  315

Query  1259  GKRYYPFGKGSGAQ---VVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             GKR+YPFG+GSGAQ   VVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ
Sbjct  316   GKRFYPFGQGSGAQARKVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQ  375

Query  1430  ELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVE  1609
              LGVCVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF LHPATVRRNDRSA+SV E
Sbjct  376   NLGVCVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDE  435

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTP  1789
             W+GEQK+QY D+PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+VP  T 
Sbjct  436   WTGEQKVQYGDIPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDVPRATT  495

Query  1790  A  1792
             A
Sbjct  496   A  496


 Score =   201 bits (512),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 115/157 (73%), Gaps = 35/157 (22%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + A+ +VL AL+QIIDPDFGTDIVSCGFVKDL ++EAL EVSFRLELTTPACPIKDMFE+
Sbjct  74   EDAKKDVLVALSQIIDPDFGTDIVSCGFVKDLEISEALEEVSFRLELTTPACPIKDMFEE  133

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVVAALPWVK                                   KGGVGKSTVAVN
Sbjct  134  KANEVVAALPWVK-----------------------------------KGGVGKSTVAVN  158

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  159  LAYTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  195



>ref|XP_007204393.1| hypothetical protein PRUPE_ppa006650mg [Prunus persica]
 ref|XP_007204394.1| hypothetical protein PRUPE_ppa006650mg [Prunus persica]
 gb|EMJ05592.1| hypothetical protein PRUPE_ppa006650mg [Prunus persica]
 gb|EMJ05593.1| hypothetical protein PRUPE_ppa006650mg [Prunus persica]
Length=401

 Score =   568 bits (1464),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/298 (90%), Positives = 290/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLV+DMPP
Sbjct  102   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVVDMPP  161

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  162   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  221

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVV+QFGIP+LFDLPIRPTLSASGDSGTPEVVADP GEV+ TFQ++G+
Sbjct  222   KRYYPFGRGSGSQVVEQFGIPNLFDLPIRPTLSASGDSGTPEVVADPLGEVSKTFQDIGI  281

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDE F LHPATVRRNDRSA+SV EW+GE
Sbjct  282   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEAFLLHPATVRRNDRSAQSVDEWTGE  341

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQ++DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP+  P+Q
Sbjct  342   QKLQFADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQRVPSQ  399


 Score =   180 bits (456),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 88/101 (87%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  532  MFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKST  711
            MFEQKANEVV  LPWVK V VTMSAQPA+P++A QLP GLQTISNI+AVSSCKGGVGKST
Sbjct  1    MFEQKANEVVNLLPWVKNVSVTMSAQPARPIYAEQLPAGLQTISNIIAVSSCKGGVGKST  60

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENR+L M
Sbjct  61   VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRILVM  101



>ref|XP_006371915.1| hypothetical protein POPTR_0018s06210g [Populus trichocarpa]
 gb|ERP49712.1| hypothetical protein POPTR_0018s06210g [Populus trichocarpa]
Length=475

 Score =   452 bits (1164),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/237 (91%), Positives = 229/237 (97%), Gaps = 0/237 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  229   NPEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  288

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  289   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  348

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGD G PEV ADP+GEVA  FQ LG+
Sbjct  349   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDGGMPEVAADPQGEVAKIFQNLGI  408

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEW  1612
             C+VQQCA+IRQQVSTAV+YD+SIKAIKVKVP+S+EEF LHPATVRRNDRSA+SVV +
Sbjct  409   CIVQQCAKIRQQVSTAVTYDKSIKAIKVKVPDSEEEFLLHPATVRRNDRSAQSVVCY  465


 Score =   292 bits (747),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 184/232 (79%), Gaps = 6/232 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVA-ENCCLLCNSPFPSQRHLRP-LSVASTRSILT  318
            M LL AP+   LS   L ++ K GL+ + E    L     P +   R    +  TR++  
Sbjct  1    MQLLYAPTCHNLSLRSLHTRPKEGLFSSLEKWLHLSVDNQPCKLPPRKCFYLKKTRAL--  58

Query  319  PkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRL  498
               +SV+A  S VS + AE++VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA GEVSFRL
Sbjct  59   --NSSVQAGGSAVSTRNAESDVLKALSQIIDPDFGTDIVSCGFVKDLNIDEAQGEVSFRL  116

Query  499  ELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAV  678
            ELTTPACP+KDMFEQKANEVVA LPWVK VKVTMSAQPA+PV+AGQLP GLQTISNI+AV
Sbjct  117  ELTTPACPVKDMFEQKANEVVALLPWVKNVKVTMSAQPARPVYAGQLPQGLQTISNIIAV  176

Query  679  SSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  177  SSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  228



>ref|XP_004969778.1| PREDICTED: cytosolic Fe-S cluster assembly factor NUBP1 homolog 
isoform X2 [Setaria italica]
Length=499

 Score =   541 bits (1395),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/302 (87%), Positives = 283/302 (94%), Gaps = 5/302 (2%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE + I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  195   NPESRAILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  254

Query  1082  GTGDIQLTLCQVV-PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             GTGDI LTLCQVV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDAD
Sbjct  255   GTGDIHLTLCQVVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDAD  314

Query  1259  GKRYYPFGKGSGAQ---VVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             GKRYYPFG+GSG Q   VVQQFGIP+LFDLPIRPTLSASGD+G PEVVADP+G+VA TFQ
Sbjct  315   GKRYYPFGQGSGTQARQVVQQFGIPNLFDLPIRPTLSASGDTGIPEVVADPQGDVAKTFQ  374

Query  1430  ELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVE  1609
              LGVCVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF LHPATVRRNDRSA+SV E
Sbjct  375   NLGVCVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDE  434

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE-LT  1786
             W+GEQK+QY DVP+DIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLV+ P   T
Sbjct  435   WTGEQKIQYDDVPDDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVDAPRAAT  494

Query  1787  PA  1792
             PA
Sbjct  495   PA  496


 Score =   198 bits (504),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 112/155 (72%), Gaps = 35/155 (23%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGFVKDL + +AL EVSFRLELTTPACPIKD FEQKA
Sbjct  75   AKKDVLIALSQIIDPDFGTDIVSCGFVKDLEIGDALDEVSFRLELTTPACPIKDEFEQKA  134

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK                                   KGGVGKSTVAVNLA
Sbjct  135  NEVVAALPWVK-----------------------------------KGGVGKSTVAVNLA  159

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL M
Sbjct  160  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVM  194



>ref|XP_006451074.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451077.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451080.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451082.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 ref|XP_006451086.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64314.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64317.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64320.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64322.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64326.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
Length=387

 Score =   538 bits (1387),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/276 (92%), Positives = 270/276 (98%), Gaps = 0/276 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  102   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  161

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  162   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  221

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEV ADP GEVA+TFQ+LGV
Sbjct  222   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVAADPCGEVANTFQDLGV  281

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV YD+SIKAIKVKVP SDEEF+LHPATVRRNDRSA+SV EW+G+
Sbjct  282   CVVQQCAKIRQQVSTAVIYDKSIKAIKVKVPQSDEEFFLHPATVRRNDRSAQSVDEWTGD  341

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQI  1729
             QKLQY+DVPEDIEPEEIRPMGNYAVSITWPDGFSQ+
Sbjct  342   QKLQYTDVPEDIEPEEIRPMGNYAVSITWPDGFSQV  377


 Score =   181 bits (460),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 93/101 (92%), Gaps = 0/101 (0%)
 Frame = +1

Query  532  MFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKST  711
            MFEQ+ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKST
Sbjct  1    MFEQRANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKST  60

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  61   VAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  101



>ref|XP_007204392.1| hypothetical protein PRUPE_ppa006650mg [Prunus persica]
 gb|EMJ05591.1| hypothetical protein PRUPE_ppa006650mg [Prunus persica]
Length=350

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/298 (90%), Positives = 290/298 (97%), Gaps = 0/298 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLV+DMPP
Sbjct  51    NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVVDMPP  110

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM HFDADG
Sbjct  111   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMSHFDADG  170

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVV+QFGIP+LFDLPIRPTLSASGDSGTPEVVADP GEV+ TFQ++G+
Sbjct  171   KRYYPFGRGSGSQVVEQFGIPNLFDLPIRPTLSASGDSGTPEVVADPLGEVSKTFQDIGI  230

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+SIKAI+VKVP+SDE F LHPATVRRNDRSA+SV EW+GE
Sbjct  231   CVVQQCAKIRQQVSTAVTYDKSIKAIRVKVPDSDEAFLLHPATVRRNDRSAQSVDEWTGE  290

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPAQ  1795
             QKLQ++DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLV+VP+  P+Q
Sbjct  291   QKLQFADVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVDVPQRVPSQ  348


 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +1

Query  688  KGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            +GGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENR+L M
Sbjct  2    QGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRILVM  50



>tpg|DAA38715.1| TPA: hypothetical protein ZEAMMB73_922984 [Zea mays]
Length=382

 Score =   550 bits (1418),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/290 (90%), Positives = 279/290 (96%), Gaps = 0/290 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  80    NPESKYILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  139

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  140   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  199

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG QVVQQFGIPHLFDLPIRPTLSASGD+G PEVVADP+G+VA+TFQ LG 
Sbjct  200   KRYYPFGQGSGTQVVQQFGIPHLFDLPIRPTLSASGDTGIPEVVADPQGDVANTFQNLGA  259

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSIKAI+VKVP+SDEEF LHPATVRRNDRSA+SV EW+GE
Sbjct  260   CVVQQCAKIRQQVSTAVSYDRSIKAIRVKVPDSDEEFLLHPATVRRNDRSAQSVDEWTGE  319

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             QK+QYSD+P+DIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL+ +ERLVE
Sbjct  320   QKVQYSDIPDDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLEMLERLVE  369


 Score =   142 bits (358),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  598  MSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDAD  777
            MSAQPA+PV+ G+LP GLQ ISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDAD
Sbjct  1    MSAQPAQPVYGGELPEGLQKISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDAD  60

Query  778  VYGPSLPTMVSPENRLLEM  834
            V+GPSLPTMVSPENRLL M
Sbjct  61   VFGPSLPTMVSPENRLLVM  79



>ref|XP_003620544.1| Mrp-like protein [Medicago truncatula]
Length=361

 Score =   534 bits (1375),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/291 (88%), Positives = 274/291 (94%), Gaps = 10/291 (3%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEY+GVKLVSFGFAGQGRAIMRGPMVSGV NQLLTTTEWGELDYLVIDMPP
Sbjct  80    NPEKKTIIPTEYMGVKLVSFGFAGQGRAIMRGPMVSGVTNQLLTTTEWGELDYLVIDMPP  139

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ+VPLTAAVIVTTPQKL+FIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  140   GTGDIQLTLCQIVPLTAAVIVTTPQKLSFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  199

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG PEVVADP+GEV+  FQ LGV
Sbjct  200   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPEVVADPQGEVSKIFQNLGV  259

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAV+YD+S+KAI+VKVP+SDEEF+LHPATVRRNDRSA+SV      
Sbjct  260   CVVQQCAKIRQQVSTAVTYDKSVKAIRVKVPDSDEEFFLHPATVRRNDRSAQSV------  313

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEV  1774
                 Y+D+P+ IEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT+ERLV V
Sbjct  314   ----YTDIPDYIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTMERLVGV  360


 Score =   152 bits (384),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/79 (92%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +1

Query  598  MSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDAD  777
            MSAQPAKP+FA QLP GLQTISNI+AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDAD
Sbjct  1    MSAQPAKPLFAEQLPAGLQTISNIIAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDAD  60

Query  778  VYGPSLPTMVSPENRLLEM  834
            +YGPSLPTMVSPENR+LEM
Sbjct  61   IYGPSLPTMVSPENRILEM  79



>ref|XP_008390520.1| PREDICTED: uncharacterized protein LOC103452763 [Malus domestica]
Length=491

 Score =   372 bits (954),  Expect(2) = 6e-179, Method: Compositional matrix adjust.
 Identities = 199/301 (66%), Positives = 216/301 (72%), Gaps = 53/301 (18%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NP KKTIIPTE LGVKL SFGFA QGRAIMRGP VSGVINQ   +   G   Y       
Sbjct  240   NPGKKTIIPTENLGVKLXSFGFARQGRAIMRGPKVSGVINQ--NSRTQGRKPYFF-----  292

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMF-SKLKVPCVAVVENMCHFDAD  1258
                                                VR F S ++VPCVAVVENM HF+AD
Sbjct  293   ----------------------------------NVRAFVSTIQVPCVAVVENMSHFEAD  318

Query  1259  GKRYYPFGKGSGA--QVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
             GKRY PFGKGSG+  QVVQQFGIP+LFDLPIRPTLSASGDSGTPEV ADP GEV+ TFQ 
Sbjct  319   GKRYQPFGKGSGSGSQVVQQFGIPNLFDLPIRPTLSASGDSGTPEVXADPLGEVSKTFQG  378

Query  1433  LGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEW  1612
             LG+CVVQQCA+IRQQVSTAV YD+SI+A  VKVP+SDEEF LH         SA+SV EW
Sbjct  379   LGICVVQQCAKIRQQVSTAVMYDKSIRAXXVKVPDSDEEFLLH---------SAQSVDEW  429

Query  1613  SGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             +GEQKLQ++DVPEDIEPEEIRPMGNYAVSITW DGFSQIAPYDQLQTIERLV+VP L P 
Sbjct  430   TGEQKLQFADVPEDIEPEEIRPMGNYAVSITWSDGFSQIAPYDQLQTIERLVDVPRLVPY  489

Query  1793  Q  1795
             Q
Sbjct  490   Q  490


 Score =   286 bits (731),  Expect(2) = 6e-179, Method: Compositional matrix adjust.
 Identities = 153/241 (63%), Positives = 173/241 (72%), Gaps = 13/241 (5%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLY------VAENCCLLCNSPFPSQRHLRPLSVASTR  306
            M +L  PSS+ LSF  + S   AGL       +  +  + C+     QRH R   V    
Sbjct  1    MQILHVPSSLYLSFQNVKSHEDAGLISSYEKPLQSSTAVFCS--LQQQRHERSQWVHRRG  58

Query  307  SILTPkaasvkasasvv-----sNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNE  471
            S+L+       +    V         AE +VLKAL+QIIDPDFGTDIVSCGFVKDL +N+
Sbjct  59   SVLSSLTTKAASLEDAVGADEILKAEAEKDVLKALSQIIDPDFGTDIVSCGFVKDLDIND  118

Query  472  ALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGL  651
            A GEVSFRLELTTPACPIKDMFE +ANEVV ALPWVK V VTMSAQP K ++AGQLP GL
Sbjct  119  ASGEVSFRLELTTPACPIKDMFEXQANEVVNALPWVKNVXVTMSAQPXKXIYAGQLPXGL  178

Query  652  QTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            Q ISNI+AVSSCKGGVGKSTVAV+LAYTLA MGARVGIFDADVYGPSLPTMVSPENR+L 
Sbjct  179  QMISNIIAVSSCKGGVGKSTVAVDLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRILV  238

Query  832  M  834
            M
Sbjct  239  M  239



>ref|XP_009336934.1| PREDICTED: LOW QUALITY PROTEIN: fe-S cluster assembly factor 
HCF101, chloroplastic-like [Pyrus x bretschneideri]
Length=381

 Score =   510 bits (1313),  Expect(2) = 1e-178, Method: Compositional matrix adjust.
 Identities = 252/301 (84%), Positives = 271/301 (90%), Gaps = 3/301 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEKKTIIPTEYLGVKLVS GFAGQGRAIMRGPMVSGV+NQLLTT+E GELDYLVIDMPP
Sbjct  80    NPEKKTIIPTEYLGVKLVSLGFAGQGRAIMRGPMVSGVVNQLLTTSEXGELDYLVIDMPP  139

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVEN+ HF+ADG
Sbjct  140   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENVSHFEADG  199

Query  1262  KRYYPF---GKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
             KRYY      +    QVVQQ GIP+LFDLPIRPTLSASGDSGTPEVVADP GEV+ TFQ 
Sbjct  200   KRYYIHLVKDQAHSLQVVQQVGIPNLFDLPIRPTLSASGDSGTPEVVADPLGEVSKTFQG  259

Query  1433  LGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEW  1612
             L +CVVQQCA+IRQQVSTAV YD+SI+AI+VKVP+SDEEF LHPATVRRND SA+SV EW
Sbjct  260   LRICVVQQCAKIRQQVSTAVMYDKSIRAIRVKVPDSDEEFLLHPATVRRNDCSAQSVDEW  319

Query  1613  SGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPELTPA  1792
             + EQKLQ++DVPED+E EEIRPMGNYA SI WPDGFSQIAPYDQLQTIERLV V +L P 
Sbjct  320   TVEQKLQFADVPEDVEREEIRPMGNYAESIKWPDGFSQIAPYDQLQTIERLVVVRQLVPY  379

Query  1793  Q  1795
             Q
Sbjct  380   Q  380


 Score =   146 bits (369),  Expect(2) = 1e-178, Method: Compositional matrix adjust.
 Identities = 70/79 (89%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  598  MSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDAD  777
            MSAQPAKP++AGQLP GLQ ISNI+AVS CKGGVGKSTVAVNLAYTLA MGARVGIFDAD
Sbjct  1    MSAQPAKPIYAGQLPSGLQAISNIIAVSGCKGGVGKSTVAVNLAYTLAGMGARVGIFDAD  60

Query  778  VYGPSLPTMVSPENRLLEM  834
            VYGPSLPTMVSPENR+L M
Sbjct  61   VYGPSLPTMVSPENRILVM  79



>gb|EMT06327.1| Protein mrp-like protein [Aegilops tauschii]
Length=446

 Score =   470 bits (1209),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 231/292 (79%), Positives = 250/292 (86%), Gaps = 30/292 (10%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K+I+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  175   NPESKSILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  234

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKV                
Sbjct  235   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKV----------------  278

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
                           VQQFGIP+LFDLPIR TLS+SGD+G PEVV+DP+G+VA  FQ LGV
Sbjct  279   --------------VQQFGIPNLFDLPIRTTLSSSGDTGIPEVVSDPQGDVAKIFQNLGV  324

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
             CVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF+LHPATVRRNDRSA+SV EW+GE
Sbjct  325   CVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGE  384

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVP  1777
             QK+QY DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  +ERLV+VP
Sbjct  385   QKVQYGDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLDMLERLVDVP  436


 Score =   182 bits (461),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 111/169 (66%), Gaps = 49/169 (29%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDM---  534
            + A+ +VL AL+QIIDPDFGTDIVSCGF+KDL ++E L EVSFR+ELTTPACP+KDM   
Sbjct  39   EDAKRDVLIALSQIIDPDFGTDIVSCGFIKDLEISETLEEVSFRVELTTPACPVKDMEWL  98

Query  535  -----------FEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVS  681
                       FE+KANEVVAALPWVK                                 
Sbjct  99   CLKLFCICAVQFEEKANEVVAALPWVK---------------------------------  125

Query  682  SCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
              KGGVGKSTVAVNLAYTLA MGARVGIFDADV+GPSLP MVSP NRLL
Sbjct  126  --KGGVGKSTVAVNLAYTLAGMGARVGIFDADVFGPSLPNMVSPVNRLL  172



>gb|EMS51714.1| Protein mrp-like protein [Triticum urartu]
Length=465

 Score =   413 bits (1061),  Expect(2) = 2e-162, Method: Compositional matrix adjust.
 Identities = 212/291 (73%), Positives = 226/291 (78%), Gaps = 56/291 (19%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K+I+PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  161   NPENKSILPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  220

Query  1082  GTGDIQLTLCQVV-PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             GTGDI LTLCQVV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKV               
Sbjct  221   GTGDIHLTLCQVVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKV---------------  265

Query  1259  GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELG  1438
                            VQQFGIP+LFDLPIRPT                          LG
Sbjct  266   ---------------VQQFGIPNLFDLPIRPT-------------------------NLG  285

Query  1439  VCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSG  1618
             VCVVQQCA+IRQQVSTAVSYDRSI+AI+VKVP+SDEEF+LHPATVRRNDRSA+SV EW+G
Sbjct  286   VCVVQQCAKIRQQVSTAVSYDRSIRAIRVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTG  345

Query  1619  EQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             EQK+QY DVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  +ER  +
Sbjct  346   EQKVQYGDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLDMLERTTQ  396


 Score =   189 bits (481),  Expect(2) = 2e-162, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 110/155 (71%), Gaps = 35/155 (23%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + A+ +VL AL+QIIDPDFGTDIVSCGF+KDL ++E L EVSFR+ELTTPACP+KDMFE+
Sbjct  39   EDAKRDVLIALSQIIDPDFGTDIVSCGFIKDLEISETLEEVSFRVELTTPACPVKDMFEE  98

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            KANEVV ALPWVK                                   KGGVGKSTVAVN
Sbjct  99   KANEVVVALPWVK-----------------------------------KGGVGKSTVAVN  123

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
            LAYTLA MGARVGIFDADV+GPSLP MVSP NRLL
Sbjct  124  LAYTLAGMGARVGIFDADVFGPSLPNMVSPVNRLL  158



>ref|XP_005852083.1| hypothetical protein CHLNCDRAFT_133105 [Chlorella variabilis]
 gb|EFN59981.1| hypothetical protein CHLNCDRAFT_133105 [Chlorella variabilis]
Length=518

 Score =   392 bits (1007),  Expect(2) = 3e-162, Method: Compositional matrix adjust.
 Identities = 184/288 (64%), Positives = 226/288 (78%), Gaps = 0/288 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K I P EY GVK VSFGFAGQG AIMRGPMVSG+I QLLTT+EWG LDYL++D PP
Sbjct  176   NPETKAITPVEYEGVKAVSFGFAGQGSAIMRGPMVSGLIQQLLTTSEWGALDYLIVDFPP  235

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQ V  +AAVIVTTPQKLAFIDVAKG+RMF+KL VPCVAVVENM +FDADG
Sbjct  236   GTGDIQLTLCQSVAFSAAVIVTTPQKLAFIDVAKGIRMFAKLMVPCVAVVENMSYFDADG  295

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
             KRY+PFGKGSG ++  +FG+P+L   PI P LSA+GD G P VV DP G  +  F ELG 
Sbjct  296   KRYFPFGKGSGERIQHEFGLPNLVRFPIVPELSAAGDGGRPVVVQDPAGPTSQAFLELGA  355

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
              VV++ A++R+     V YD+ + A+ V++PN++E+F L PATVRRND+SA S+ EW+GE
Sbjct  356   AVVREVAKLRRVPQNCVRYDQELGALVVRLPNTEEDFLLDPATVRRNDQSAASINEWTGE  415

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
             + L+ SD+ +DI+P  ++P+GNYAV I W DGFSQIA Y+ L  + RL
Sbjct  416   RTLRDSDIADDIQPVGVQPVGNYAVQINWQDGFSQIAAYELLDALPRL  463


 Score =   209 bits (533),  Expect(2) = 3e-162, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            + E EV  AL+ IIDPDFG +IV  GF KDL V+   G V+FRLELTTPACPIKD FE+ 
Sbjct  19   SKEGEVRAALSPIIDPDFGMNIVDGGFFKDLAVDGEAGSVAFRLELTTPACPIKDDFEKA  78

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQ-LPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            A E V ALPWVK++ + M A+P +P+      P GL+++S+++AVSSCKGGVGKST AVN
Sbjct  79   AREYVTALPWVKSLDLKMDARPPQPLLPDDSRPSGLRSVSHVIAVSSCKGGVGKSTTAVN  138

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGA+VGIFDADVYGPSLPTM+SPE R+L+M
Sbjct  139  LAYTLAQMGAKVGIFDADVYGPSLPTMISPEIRVLQM  175



>ref|XP_006371914.1| hypothetical protein POPTR_0018s06210g [Populus trichocarpa]
 gb|ERP49711.1| hypothetical protein POPTR_0018s06210g [Populus trichocarpa]
Length=383

 Score =   311 bits (797),  Expect(2) = 4e-162, Method: Compositional matrix adjust.
 Identities = 147/152 (97%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  229   NPEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  288

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG
Sbjct  289   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  348

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTL  1357
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPT+
Sbjct  349   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTV  380


 Score =   290 bits (742),  Expect(2) = 4e-162, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 184/232 (79%), Gaps = 6/232 (3%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVA-ENCCLLCNSPFPSQRHLRP-LSVASTRSILT  318
            M LL AP+   LS   L ++ K GL+ + E    L     P +   R    +  TR++  
Sbjct  1    MQLLYAPTCHNLSLRSLHTRPKEGLFSSLEKWLHLSVDNQPCKLPPRKCFYLKKTRAL--  58

Query  319  PkaasvkasasvvsNQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRL  498
               +SV+A  S VS + AE++VLKAL+QIIDPDFGTDIVSCGFVKDL ++EA GEVSFRL
Sbjct  59   --NSSVQAGGSAVSTRNAESDVLKALSQIIDPDFGTDIVSCGFVKDLNIDEAQGEVSFRL  116

Query  499  ELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAV  678
            ELTTPACP+KDMFEQKANEVVA LPWVK VKVTMSAQPA+PV+AGQLP GLQTISNI+AV
Sbjct  117  ELTTPACPVKDMFEQKANEVVALLPWVKNVKVTMSAQPARPVYAGQLPQGLQTISNIIAV  176

Query  679  SSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SSCKGGVGKSTVAVNLAYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  177  SSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  228



>ref|XP_006451081.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|ESR64321.1| hypothetical protein CICLE_v10007988mg [Citrus clementina]
 gb|KDO54140.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=386

 Score =   312 bits (800),  Expect(2) = 5e-160, Method: Compositional matrix adjust.
 Identities = 147/153 (96%), Positives = 153/153 (100%), Gaps = 0/153 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  231   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  291   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  350

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLS  1360
             KRYYPFG+GSG+QVVQQFGIPHLFDLPIRPT+S
Sbjct  351   KRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTVS  383


 Score =   282 bits (721),  Expect(2) = 5e-160, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIVSCGFVKD+ +NEALGEVSFRLELTTPACPIKDMFEQ+
Sbjct  75   TAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVSFRLELTTPACPIKDMFEQR  134

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKSTVAVNL
Sbjct  135  ANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNL  194

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  195  AYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  230



>ref|XP_005647837.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE23293.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
Length=470

 Score =   367 bits (942),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 173/290 (60%), Positives = 218/290 (75%), Gaps = 2/290 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +PE +TI PTEY GVKL+SFGFAGQG AIMRGPMVSGVI QLLT+  WG+LDYLV+D PP
Sbjct  170   DPETRTINPTEYEGVKLMSFGFAGQGSAIMRGPMVSGVIQQLLTSANWGKLDYLVVDFPP  229

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-D  1258
             GTGDIQLTLCQ V  +AAVIVTTPQKLAF+DVAKG+RMF+++ VPC AV ENM  FD  D
Sbjct  230   GTGDIQLTLCQTVQFSAAVIVTTPQKLAFVDVAKGIRMFARMAVPCAAVAENMSFFDGDD  289

Query  1259  GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELG  1438
             G RY+PFG GSG ++   FGIPHL   PI P LSA+GD G P VV+DP    A +F ELG
Sbjct  290   GTRYHPFGTGSGDRIKADFGIPHLVHFPILPELSAAGDGGRPLVVSDPASVPAESFMELG  349

Query  1439  VCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDE-EFYLHPATVRRNDRSAESVVEWS  1615
               VV++ A++++    AV YD  ++A  V +P+S   EFYLHPA VRRND SA+S+ EW+
Sbjct  350   AIVVREVAKLQRAQRNAVRYDEDLRAFVVSLPDSGRPEFYLHPAVVRRNDTSAKSINEWT  409

Query  1616  GEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
             GE+ L  +DV +D+ P  ++P+GNYAV I+W DG +Q+AP++ L  +  +
Sbjct  410   GEKILNDADVADDVAPASVQPLGNYAVQISWQDGLNQVAPFELLAGLPEM  459


 Score =   213 bits (541),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 129/160 (81%), Gaps = 3/160 (2%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
             +  + +VL+ LA+IIDPDFG DIVSCGFVK+L V+   G+V F LELTTPACPIKD FE
Sbjct  11   QEAGKEQVLRELARIIDPDFGQDIVSCGFVKNLAVDPEAGQVQFALELTTPACPIKDEFE  70

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVF--AGQLPPGLQTISNIVAVSSCKGGVGKSTV  714
            QKA + V  L WV+ V VTM+AQP +P+    G++  GL+ +++I+AVSSCKGGVGKSTV
Sbjct  71   QKARQYVGQLEWVEQVDVTMTAQPQRPLAPDDGRV-GGLKDVTHIIAVSSCKGGVGKSTV  129

Query  715  AVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AVNLAYTLA MGA+VGIFDADVYGPSLPTMVSPE R+L M
Sbjct  130  AVNLAYTLAQMGAKVGIFDADVYGPSLPTMVSPEVRVLIM  169



>ref|XP_002515581.1| Protein mrp, putative [Ricinus communis]
 gb|EEF47030.1| Protein mrp, putative [Ricinus communis]
Length=474

 Score =   309 bits (792),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 166/238 (70%), Positives = 194/238 (82%), Gaps = 9/238 (4%)
 Frame = +1

Query  145  MPLLQAPSSVTLSFLPLSSQSKAGLYVAENCCLLCN---SPFPSQRHLRPLSVASTRSIL  315
            M LL APSS+++S   L SQSK+GL +A  C        SP+P + +   L+++  RS+ 
Sbjct  1    MQLLHAPSSLSISLQTLKSQSKSGLVLAGKCLQFSATDCSPYPLKVN-TALALSLKRSVF  59

Query  316  ----TPkaasvkasasvvsNQTAEAE-VLKALAQIIDPDFGTDIVSCGFVKDLLVNEALG  480
                T  A+    ++++ S+ TA++E VLKAL+QIIDPDFGTDIV+CGF+KDL + EA G
Sbjct  60   NCLTTRAASVQGGASTISSSGTAKSEEVLKALSQIIDPDFGTDIVTCGFIKDLQIEEAQG  119

Query  481  EVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTI  660
            EVSFRLELTTPACPIKD+FEQ+ANEVVAALPWVK VKVTMSAQPA+PVFAGQLP GLQTI
Sbjct  120  EVSFRLELTTPACPIKDLFEQQANEVVAALPWVKNVKVTMSAQPARPVFAGQLPAGLQTI  179

Query  661  SNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            SNIVAVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDAD+YGPSLPTMVSPENRLLEM
Sbjct  180  SNIVAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDADIYGPSLPTMVSPENRLLEM  237


 Score =   270 bits (690),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 127/135 (94%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  238   NPEKRTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  297

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  298   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  357

Query  1262  KRYYPFGKGSGAQVV  1306
             KRYYPFG+GS +  V
Sbjct  358   KRYYPFGRGSVSTAV  372


 Score =   191 bits (486),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = +2

Query  1469  RQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQKLQYSDVP  1648
             R  VSTAV YD+S+KAIKVKVP+SDEEF+LHPATVRRNDRSA+SV EW+GEQKLQY+D+P
Sbjct  365   RGSVSTAVMYDKSMKAIKVKVPDSDEEFFLHPATVRRNDRSAQSVDEWTGEQKLQYTDIP  424

Query  1649  EDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPE  1780
             EDIEPEEIRPMGNYAV ITWPDGF+QIAPYDQLQT+ERLV VP+
Sbjct  425   EDIEPEEIRPMGNYAVQITWPDGFNQIAPYDQLQTMERLVGVPQ  468



>gb|KDO54141.1| hypothetical protein CISIN_1g009574mg [Citrus sinensis]
Length=370

 Score =   282 bits (721),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            TAE +VLKAL+QIIDPDFGTDIVSCGFVKD+ +NEALGEVSFRLELTTPACPIKDMFEQ+
Sbjct  75   TAENDVLKALSQIIDPDFGTDIVSCGFVKDMQINEALGEVSFRLELTTPACPIKDMFEQR  134

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            ANEVV A+PWV  V VTMSAQPA+P+FA QLP GLQ ISNIVAVSSCKGGVGKSTVAVNL
Sbjct  135  ANEVVLAIPWVNKVNVTMSAQPARPIFAEQLPEGLQKISNIVAVSSCKGGVGKSTVAVNL  194

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            AYTLA MGARVGIFDADVYGPSLPTMVSPENRLLEM
Sbjct  195  AYTLAGMGARVGIFDADVYGPSLPTMVSPENRLLEM  230


 Score =   274 bits (701),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 129/134 (96%), Positives = 134/134 (100%), Gaps = 0/134 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK+TIIPTEYLGVKLVSFGF+GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP
Sbjct  231   NPEKRTIIPTEYLGVKLVSFGFSGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  290

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPC+AVVENMCHFDADG
Sbjct  291   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCIAVVENMCHFDADG  350

Query  1262  KRYYPFGKGSGAQV  1303
             KRYYPFG+GSG+QV
Sbjct  351   KRYYPFGRGSGSQV  364



>ref|XP_003083908.1| Predicted ATPase, nucleotide-binding (ISS) [Ostreococcus tauri]
Length=686

 Score =   339 bits (869),  Expect(2) = 8e-143, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 217/292 (74%), Gaps = 4/292 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + E  TI P EY GVK+VSFGFAGQG AIMRGPMVSG+INQLLTTT+WGELDYL+IDMPP
Sbjct  390   DKETGTIKPVEYEGVKVVSFGFAGQGSAIMRGPMVSGLINQLLTTTDWGELDYLIIDMPP  449

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGD+QLTLCQVVP+TAAV+VTTPQKLAFIDV KGVRMF+KL VPCV+VVENM +F+ DG
Sbjct  450   GTGDVQLTLCQVVPITAAVVVTTPQKLAFIDVEKGVRMFAKLAVPCVSVVENMSYFEVDG  509

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
              ++ PFG+GSGA++ +Q+G+P+L  +PI P LSA GD+G P V+ DP  E +S +QE+  
Sbjct  510   VKHKPFGEGSGAKICEQYGVPNLLQMPIVPDLSACGDTGRPLVLRDPTCETSSRYQEVAA  569

Query  1442  CVVQQCARIRQQVSTAVSYDRSIK-AIKVKVP--NSDEEFYLHPATVRRNDRSAE-SVVE  1609
              VV++ A++       V  D     A +V++P  N+D+ F++    VR +D SA     +
Sbjct  570   TVVREVAKLNNGKKPRVDIDPGYDGAFRVEIPGENNDKAFWITAKNVRLSDESARVKGSD  629

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
              S ++ L  + +P+DI P E+  +GNYA+SITWPDG SQ+A +  L  +ERL
Sbjct  630   ESPDRLLNGAPIPDDIAPVEMSVIGNYAMSITWPDGLSQVAAFSTLAKLERL  681


 Score =   198 bits (503),  Expect(2) = 8e-143, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            + + E+EVL  L ++IDPDFG DIV+CGFVK L+++E+ G V F +ELTTPACP+K  FE
Sbjct  233  DGSKESEVLSKLRRVIDPDFGEDIVNCGFVKALVIDESAGSVLFAIELTTPACPVKAEFE  292

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
            ++A   V  L WVK V VTM+AQPA+   A +   GL+ +S+I+AVSSCKGGVGKST +V
Sbjct  293  RQAKAFVEELDWVKRVSVTMTAQPARN-DAPETVEGLRRVSHIIAVSSCKGGVGKSTTSV  351

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGA+VGI DADVYGPSLPTM+SP+  +LEM
Sbjct  352  NLAYTLAMMGAKVGILDADVYGPSLPTMISPDVPVLEM  389



>emb|CEG00577.1| ATPase-like, ParA/MinD [Ostreococcus tauri]
Length=518

 Score =   338 bits (867),  Expect(2) = 4e-142, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 217/292 (74%), Gaps = 4/292 (1%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + E  TI P EY GVK+VSFGFAGQG AIMRGPMVSG+INQLLTTT+WGELDYL+IDMPP
Sbjct  222   DKETGTIKPVEYEGVKVVSFGFAGQGSAIMRGPMVSGLINQLLTTTDWGELDYLIIDMPP  281

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGD+QLTLCQVVP+TAAV+VTTPQKLAFIDV KGVRMF+KL VPCV+VVENM +F+ DG
Sbjct  282   GTGDVQLTLCQVVPITAAVVVTTPQKLAFIDVEKGVRMFAKLAVPCVSVVENMSYFEVDG  341

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
              ++ PFG+GSGA++ +Q+G+P+L  +PI P LSA GD+G P V+ DP  E +S +QE+  
Sbjct  342   VKHKPFGEGSGAKICEQYGVPNLLQMPIVPDLSACGDTGRPLVLRDPTCETSSRYQEVAA  401

Query  1442  CVVQQCARIRQQVSTAVSYDRSIK-AIKVKVP--NSDEEFYLHPATVRRNDRSAE-SVVE  1609
              VV++ A++       V  D     A +V++P  N+D+ F++    VR +D SA     +
Sbjct  402   TVVREVAKLNNGKKPRVDIDPGYDGAFRVEIPGENNDKAFWITAKNVRLSDESARVKGSD  461

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
              S ++ L  + +P+DI P E+  +GNYA+SITWPDG SQ+A +  L  +ERL
Sbjct  462   ESPDRLLNGAPIPDDIAPVEMSVIGNYAMSITWPDGLSQVAAFSTLAKLERL  513


 Score =   196 bits (499),  Expect(2) = 4e-142, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            + + E+EVL  L ++IDPDFG DIV+CGFVK L+++E+ G V F +ELTTPACP+K  FE
Sbjct  65   DGSKESEVLSKLRRVIDPDFGEDIVNCGFVKALVIDESAGSVLFAIELTTPACPVKAEFE  124

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
            ++A   V  L WVK V VTM+AQPA+   A +   GL+ +S+I+AVSSCKGGVGKST +V
Sbjct  125  RQAKAFVEELDWVKRVSVTMTAQPARN-DAPETVEGLRRVSHIIAVSSCKGGVGKSTTSV  183

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGA+VGI DADVYGPSLPTM+SP+  +LEM
Sbjct  184  NLAYTLAMMGAKVGILDADVYGPSLPTMISPDVPVLEM  221



>ref|XP_001422009.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00303.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=462

 Score =   330 bits (845),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 161/287 (56%), Positives = 214/287 (75%), Gaps = 4/287 (1%)
 Frame = +2

Query  917   TIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI  1096
             TI P EY GVK+VSFGFAGQG AIMRGPMVSG+INQLLTTT+WGELDYL++DMPPGTGDI
Sbjct  171   TITPVEYEGVKVVSFGFAGQGSAIMRGPMVSGLINQLLTTTDWGELDYLILDMPPGTGDI  230

Query  1097  QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYP  1276
             QLTLCQVVP+TAAV+VTTPQKLAFIDV KGVRMF+KL VPCV+VVEN+ +F+ DG ++ P
Sbjct  231   QLTLCQVVPITAAVVVTTPQKLAFIDVEKGVRMFAKLAVPCVSVVENLSYFEVDGVKHKP  290

Query  1277  FGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQ  1456
             FG+GSGA + +Q+G+P+L  +PI P LSA GD+G P V+ DP  + +S +Q++   VV++
Sbjct  291   FGEGSGAAICEQYGVPNLLQMPIVPELSACGDTGRPLVLRDPACKTSSRYQDVAATVVRE  350

Query  1457  CARIRQQVSTAVSYDRSIK-AIKVKVP--NSDEEFYLHPATVRRNDRSAE-SVVEWSGEQ  1624
              A++       V  D     A +V++P  N D+ F++    VR +D SA     + S ++
Sbjct  351   VAKLNNGKKPRVDIDPGYDGAFRVELPGENDDKPFWITAKNVRMSDTSARVKGSDESPDR  410

Query  1625  KLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
              L  + +P+DI P E+  +GNYA+S+TWPDG SQ+A ++ L  +ERL
Sbjct  411   LLNGTPIPDDIAPIEMSVIGNYAMSVTWPDGLSQVAAFNTLAKLERL  457


 Score =   196 bits (497),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            + + EA VL+ L ++IDPDFG DIV+CGFVK L V+E+ G V F +ELTTPACP+K  FE
Sbjct  9    DGSKEAAVLEKLRRVIDPDFGEDIVNCGFVKALNVDESAGNVLFAIELTTPACPVKAEFE  68

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
            ++A   V  L WVK V+VTM+AQPA+   A +   GL+ + +I+AVSSCKGGVGKST +V
Sbjct  69   RQAKAFVGELEWVKNVRVTMTAQPARN-DAPETVEGLRRVRHIIAVSSCKGGVGKSTTSV  127

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            NLAYTLA MGA+VGI DADVYGPSLPTM+SPE+ +LEM
Sbjct  128  NLAYTLAMMGAKVGILDADVYGPSLPTMISPESPVLEM  165



>gb|KCW82748.1| hypothetical protein EUGRSUZ_C04130 [Eucalyptus grandis]
Length=440

 Score =   426 bits (1096),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 208/256 (81%), Positives = 225/256 (88%), Gaps = 13/256 (5%)
 Frame = +2

Query  1046  GELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK-----  1210
             GELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDV KGVRMFSKLK     
Sbjct  183   GELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVVKGVRMFSKLKSHLLT  242

Query  1211  -------VPCVAVVENMCHFDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASG  1369
                    VPCVA VENMCHFDADGKRYYP  +GSG+QVVQQFGIPHLF+LPIRPTLSASG
Sbjct  243   IHCSCTRVPCVAAVENMCHFDADGKRYYPLDRGSGSQVVQQFGIPHLFNLPIRPTLSASG  302

Query  1370  DSGTPEVVADPRGEVASTFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEE  1549
             DSG PEVVADP GEVA TFQ+L VCVVQ CA+IRQQVSTAV++D+ I+AIK KVP+SDEE
Sbjct  303   DSGMPEVVADPLGEVAKTFQDLRVCVVQPCAKIRQQVSTAVTHDKVIEAIKAKVPDSDEE  362

Query  1550  FYLHPATVRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQI  1729
              +LHP TVRRN+RSA+S  EW+GEQKLQYS+V EDIEPEEI+PMGNYAVSI WPDGF+QI
Sbjct  363   CFLHPTTVRRNNRSAQS-DEWTGEQKLQYSNVLEDIEPEEIQPMGNYAVSIVWPDGFNQI  421

Query  1730  APYDQLQTIERLVEVP  1777
             APYDQLQ IERLV VP
Sbjct  422   APYDQLQMIERLVSVP  437


 Score =   138 bits (348),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 89/135 (66%), Gaps = 31/135 (23%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QTAE++VLKAL+Q++                             LE T     +   FEQ
Sbjct  76   QTAESDVLKALSQLL--------------------------ILTLERT-----LFHEFEQ  104

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVA L WVK VK TMSAQPAKPVF G+LPPGLQ ISNI+AVSSCKGGVGKSTVAVN
Sbjct  105  QANEVVANLHWVKNVKATMSAQPAKPVFTGELPPGLQMISNIIAVSSCKGGVGKSTVAVN  164

Query  724  LAYTLADMGARVGIF  768
            LAYTLA MGARVGI 
Sbjct  165  LAYTLARMGARVGIL  179



>ref|XP_002502646.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63904.1| predicted protein [Micromonas sp. RCC299]
Length=526

 Score =   329 bits (844),  Expect(2) = 5e-137, Method: Compositional matrix adjust.
 Identities = 165/297 (56%), Positives = 217/297 (73%), Gaps = 9/297 (3%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + E  +I PTEY GV +VSFGFAGQG AIMRGPMVSG+INQ+LTTT WG+LDYL+IDMPP
Sbjct  222   DKETGSITPTEYEGVGIVSFGFAGQGSAIMRGPMVSGLINQMLTTTAWGDLDYLIIDMPP  281

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-D  1258
             GTGD+QLT+CQV+P+TAAV+VTTPQKLAFIDV KGVRMFSKL+VPCVAVVENM +FD  D
Sbjct  282   GTGDVQLTICQVLPITAAVVVTTPQKLAFIDVEKGVRMFSKLRVPCVAVVENMSYFDGDD  341

Query  1259  GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELG  1438
             GKRY PFG+GSG ++   +G+P+LF +PI P LSA GD+G P V+ DP G+V++ +  + 
Sbjct  342   GKRYKPFGEGSGQRICDDYGVPNLFQMPIVPDLSACGDTGRPLVLVDPAGDVSTIYGAVA  401

Query  1439  VCVVQQCARIRQQVSTAVSYD-RSIKAIK--VKVPNSDEE---FYLHPATVRRNDRSAES  1600
               VVQ+ A+++     +++ D   +  +   ++V  +DE    FY+    VRR+D+SA +
Sbjct  402   AKVVQEVAKLQAGPKGSLALDTEGVAGVDGALRVQLADEGGMPFYVRGCDVRRSDKSATA  461

Query  1601  VVEWSGEQKLQ--YSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
               E      L    + VP+DI P E   +GNYAV I+WPDGFSQ+A + Q+Q + RL
Sbjct  462   DGESKKADFLMDGVTPVPDDIAPVEAHVVGNYAVQISWPDGFSQVATFAQIQALSRL  518


 Score =   188 bits (478),  Expect(2) = 5e-137, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 8/161 (5%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            + + EA+VL AL  +IDPDFG DIV+CGFVKDL V++A G+V+F LELTTPACP+K+ F+
Sbjct  66   DGSREADVLNALRNVIDPDFGEDIVNCGFVKDLRVSDA-GDVTFTLELTTPACPVKEEFD  124

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPP---GLQTISNIVAVSSCKGGVGKST  711
            + + + V AL W K+  V M+AQP        +P    GL+ + +I+AVSSCKGGVGKST
Sbjct  125  RLSKQYVTALEWAKSCNVNMTAQP----VTNDMPDAVEGLKGVRHIIAVSSCKGGVGKST  180

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             +VNLAYTL  MGA+VGIFDADV+GPSLPTM SPE  +L+M
Sbjct  181  TSVNLAYTLRMMGAKVGIFDADVFGPSLPTMTSPEQAVLQM  221



>ref|XP_007512440.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17040.1| predicted protein [Bathycoccus prasinos]
Length=466

 Score =   333 bits (855),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 164/291 (56%), Positives = 215/291 (74%), Gaps = 5/291 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             E  TI P EY GVK+VSFG+AGQG AIMRGPMVSG++NQLLTT+EWGELDYL++DMPPGT
Sbjct  176   EDGTITPVEYEGVKVVSFGYAGQGSAIMRGPMVSGLVNQLLTTSEWGELDYLLLDMPPGT  235

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DGK  1264
             GDI LTL QVVP+TAAV+VTTPQ+LAFIDV KGVRMF+KL+VPCVAVVENM  F   DGK
Sbjct  236   GDIHLTLGQVVPITAAVVVTTPQRLAFIDVDKGVRMFAKLEVPCVAVVENMSTFTGDDGK  295

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVC  1444
              Y PFG+GSG  + + + IPHL ++PI P LS+ GDSGTP  ++DP G +A+ +Q++G C
Sbjct  296   VYRPFGRGSGKSICEAYDIPHLIEMPIEPGLSSGGDSGTPLSLSDPTGPIAALYQDIGAC  355

Query  1445  VVQQCARIRQQVSTAVSYD---RSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESV-VEW  1612
             VV++ A+I        + D   R    +++   N    FY+  ++VR++D+SA +   + 
Sbjct  356   VVREVAKINSGRGPTAALDPDRRGCLKVQISDVNDGLPFYVSGSSVRKSDQSARAKNSDE  415

Query  1613  SGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERL  1765
             S +  L    VP+D+EP  +  +GNYAVS+TWPDGFSQ+AP+  L+T+ RL
Sbjct  416   SPDILLTGERVPDDLEPVSVATVGNYAVSVTWPDGFSQVAPFRVLRTLPRL  466


 Score =   180 bits (456),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E +VL+ L  +IDPDFG +IV+CGFVK L V+E+  +V+  LELTTPACP+KD F + + 
Sbjct  20   EQQVLECLKNVIDPDFGENIVNCGFVKVLKVSESGKDVALVLELTTPACPVKDEFNRLSK  79

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAG--QLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            E V  L WV  V V M+A P K   A   + PPGL+ + NI+A+SSCKGGVGKST  VNL
Sbjct  80   EFVKRLEWVDDVDVIMTASP-KSAMADVPEAPPGLRGVKNIIAISSCKGGVGKSTTCVNL  138

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            A TLA MGA+VGIFDADVYGPSLPTM++P    LEM
Sbjct  139  AMTLAQMGAKVGIFDADVYGPSLPTMITPAFDKLEM  174



>ref|XP_010051695.1| PREDICTED: fe-S cluster assembly factor HCF101, chloroplastic-like 
[Eucalyptus grandis]
Length=380

 Score =   295 bits (755),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QTAE++VLKAL+QIIDPDFGTDIVSCGFVKDLL++EALGEVSFRLELTTPACPIKDMFEQ
Sbjct  80   QTAESDVLKALSQIIDPDFGTDIVSCGFVKDLLIDEALGEVSFRLELTTPACPIKDMFEQ  139

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVA L WVK VKVTMSAQPAKPVF G+LPPGLQTISNI+AVSSCKGGVGKSTVAVN
Sbjct  140  QANEVVANLHWVKNVKVTMSAQPAKPVFTGELPPGLQTISNIIAVSSCKGGVGKSTVAVN  199

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMVSP+NRLLEM
Sbjct  200  LAYTLAGMGARVGIFDADVYGPSLPTMVSPDNRLLEM  236


 Score =   209 bits (533),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 112/126 (89%), Gaps = 7/126 (6%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  237   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  296

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVEN---MCHFD  1252
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK     VVEN   + HF 
Sbjct  297   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK----NVVENWLKVIHFW  352

Query  1253  ADGKRY  1270
               G  +
Sbjct  353   YSGNLH  358



>gb|KCW82750.1| hypothetical protein EUGRSUZ_C041312, partial [Eucalyptus grandis]
Length=339

 Score =   295 bits (756),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QTAE++VLKAL+QIIDPDFGTDIVSCGFVKDLL++EALGEVSFRLELTTPACPIKDMFEQ
Sbjct  80   QTAESDVLKALSQIIDPDFGTDIVSCGFVKDLLIDEALGEVSFRLELTTPACPIKDMFEQ  139

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVA L WVK VKVTMSAQPAKPVF G+LPPGLQTISNI+AVSSCKGGVGKSTVAVN
Sbjct  140  QANEVVANLHWVKNVKVTMSAQPAKPVFTGELPPGLQTISNIIAVSSCKGGVGKSTVAVN  199

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMVSP+NRLLEM
Sbjct  200  LAYTLAGMGARVGIFDADVYGPSLPTMVSPDNRLLEM  236


 Score =   207 bits (528),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  237   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  296

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK  1210
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK
Sbjct  297   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK  339



>gb|KCW82552.1| hypothetical protein EUGRSUZ_C039531, partial [Eucalyptus grandis]
 gb|KCW82553.1| hypothetical protein EUGRSUZ_C039531, partial [Eucalyptus grandis]
Length=339

 Score =   295 bits (755),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 151/157 (96%), Gaps = 0/157 (0%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QTAE +VLKAL+QIIDPDFGTDIVSCGFVKDLL++EALGEVSFRLELTTPACPIKDMFEQ
Sbjct  80   QTAEGDVLKALSQIIDPDFGTDIVSCGFVKDLLIDEALGEVSFRLELTTPACPIKDMFEQ  139

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVA L WVK VKVTMSAQPAKPVF G+LPPGLQTISNI+AVSSCKGGVGKSTVAVN
Sbjct  140  QANEVVANLHWVKNVKVTMSAQPAKPVFTGELPPGLQTISNIIAVSSCKGGVGKSTVAVN  199

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LAYTLA MGARVGIFDADVYGPSLPTMVSP+NRLLEM
Sbjct  200  LAYTLAGMGARVGIFDADVYGPSLPTMVSPDNRLLEM  236


 Score =   207 bits (527),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 100/103 (97%), Positives = 103/103 (100%), Gaps = 0/103 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPEK++IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI+QLLTTTEWGELDYLVIDMPP
Sbjct  237   NPEKRSIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVIDQLLTTTEWGELDYLVIDMPP  296

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK  1210
             GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK
Sbjct  297   GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK  339



>gb|KCW82550.1| hypothetical protein EUGRSUZ_C039532, partial [Eucalyptus grandis]
Length=190

 Score =   360 bits (924),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/189 (90%), Positives = 182/189 (96%), Gaps = 0/189 (0%)
 Frame = +2

Query  1211  VPCVAVVENMCHFDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEV  1390
             VPCVAVVENMCHFDADGKRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG P+V
Sbjct  1     VPCVAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPDV  60

Query  1391  VADPRGEVASTFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPAT  1570
             VADP GEVA TFQ+LGVC+VQQCA+IRQQVSTAV+YD+ IKAIKVKVP+SDEEF+LHPAT
Sbjct  61    VADPLGEVAKTFQDLGVCIVQQCAKIRQQVSTAVTYDKVIKAIKVKVPDSDEEFFLHPAT  120

Query  1571  VRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQ  1750
             VRRNDRSA+SV EW+GEQKLQYSDVPEDIEPEEIRPMGNYAVSI WPDGFSQIAPYDQLQ
Sbjct  121   VRRNDRSAQSVDEWTGEQKLQYSDVPEDIEPEEIRPMGNYAVSIVWPDGFSQIAPYDQLQ  180

Query  1751  TIERLVEVP  1777
             TIERLV VP
Sbjct  181   TIERLVGVP  189



>ref|XP_003064216.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51838.1| predicted protein [Micromonas pusilla CCMP1545]
Length=476

 Score =   282 bits (722),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 160/190 (84%), Gaps = 0/190 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             N E  TI PTEY GV +VSFGFAGQG AIMRGPMVSG+INQ+LTTT+WGELDYL+IDMPP
Sbjct  273   NKETGTITPTEYEGVGVVSFGFAGQGSAIMRGPMVSGLINQMLTTTDWGELDYLIIDMPP  332

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGD+QLT+CQVVP+TAAV+VTTPQKLAFIDV KGVRMFSKL+VPCVAVVENM +F+ DG
Sbjct  333   GTGDVQLTICQVVPITAAVVVTTPQKLAFIDVEKGVRMFSKLRVPCVAVVENMSYFEVDG  392

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
              R+ PFG+GSG ++  ++G+P+LF +PI P LSA GDSG P V+ADP GEV+  +  +  
Sbjct  393   VRHKPFGEGSGQRICDEYGVPNLFQMPIVPELSACGDSGKPLVLADPAGEVSGAYGAVAA  452

Query  1442  CVVQQCARIR  1471
              VVQ+ A++R
Sbjct  453   KVVQEVAKLR  462


 Score =   162 bits (409),  Expect(2) = 6e-115, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 119/206 (58%), Gaps = 54/206 (26%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EA+VL AL  +IDPDFG D+V+CGFVKDL + +  G+V+F LELTTPACP+K+ F++ + 
Sbjct  69   EADVLDALRNVIDPDFGEDVVNCGFVKDLRITDD-GDVTFTLELTTPACPVKEEFDRLSK  127

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + V+A+PWVK+  V M+AQ      A     GL+ + +I+AVSSCKGGVGKST +VNLAY
Sbjct  128  QHVSAVPWVKSCNVAMTAQEVTN-DAPDTVEGLRNVRHIIAVSSCKGGVGKSTTSVNLAY  186

Query  733  TLADMGA----------------------------------------------------R  756
             L +MGA                                                    R
Sbjct  187  KLKEMGARRVLLTLVPIRPRWRCERRSLRTFPGASLRPSLAFDPRPRRLSTPLLTPFNSR  246

Query  757  VGIFDADVYGPSLPTMVSPENRLLEM  834
            VGIFDADVYGPSLPTM SPE  +L+M
Sbjct  247  VGIFDADVYGPSLPTMTSPEIAVLQM  272



>gb|KCW82551.1| hypothetical protein EUGRSUZ_C039532, partial [Eucalyptus grandis]
Length=191

 Score =   354 bits (909),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/190 (89%), Positives = 182/190 (96%), Gaps = 1/190 (1%)
 Frame = +2

Query  1211  VPCVAVVENMCHFDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEV  1390
             VPCVAVVENMCHFDADGKRYYPFG+GSG+QVVQQFGIPHLFDLPIRPTLSASGDSG P+V
Sbjct  1     VPCVAVVENMCHFDADGKRYYPFGRGSGSQVVQQFGIPHLFDLPIRPTLSASGDSGMPDV  60

Query  1391  VADPRGEVASTFQELGVCVVQQCARIRQQ-VSTAVSYDRSIKAIKVKVPNSDEEFYLHPA  1567
             VADP GEVA TFQ+LGVC+VQQCA+IRQQ +STAV+YD+ IKAIKVKVP+SDEEF+LHPA
Sbjct  61    VADPLGEVAKTFQDLGVCIVQQCAKIRQQGMSTAVTYDKVIKAIKVKVPDSDEEFFLHPA  120

Query  1568  TVRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  1747
             TVRRNDRSA+SV EW+GEQKLQYSDVPEDIEPEEIRPMGNYAVSI WPDGFSQIAPYDQL
Sbjct  121   TVRRNDRSAQSVDEWTGEQKLQYSDVPEDIEPEEIRPMGNYAVSIVWPDGFSQIAPYDQL  180

Query  1748  QTIERLVEVP  1777
             QTIERLV VP
Sbjct  181   QTIERLVGVP  190



>tpg|DAA38716.1| TPA: hypothetical protein ZEAMMB73_922984 [Zea mays]
Length=244

 Score =   298 bits (764),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 142/153 (93%), Positives = 147/153 (96%), Gaps = 0/153 (0%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             NPE K I+PTEYLGVK+VSFGFAGQGRAIMRGPMVSGVINQLLTTT+WGELDYLVIDMPP
Sbjct  80    NPESKYILPTEYLGVKMVSFGFAGQGRAIMRGPMVSGVINQLLTTTDWGELDYLVIDMPP  139

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG  1261
             GTGDI LTLCQV PLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC+FDADG
Sbjct  140   GTGDIHLTLCQVAPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCYFDADG  199

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLS  1360
             KRYYPFG+GSG QVVQQFGIPHLFDLPIRPT S
Sbjct  200   KRYYPFGQGSGTQVVQQFGIPHLFDLPIRPTGS  232


 Score =   141 bits (356),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +1

Query  598  MSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDAD  777
            MSAQPA+PV+ G+LP GLQ ISNI+AVSSCKGGVGKSTVAVNLAYTLA MGARVGIFDAD
Sbjct  1    MSAQPAQPVYGGELPEGLQKISNIIAVSSCKGGVGKSTVAVNLAYTLAGMGARVGIFDAD  60

Query  778  VYGPSLPTMVSPENRLLEM  834
            V+GPSLPTMVSPENRLL M
Sbjct  61   VFGPSLPTMVSPENRLLVM  79



>ref|XP_005711941.1| unnamed protein product [Chondrus crispus]
 emb|CDF32276.1| unnamed protein product [Chondrus crispus]
Length=532

 Score =   275 bits (703),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 139/280 (50%), Positives = 190/280 (68%), Gaps = 4/280 (1%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQ  1099
             I P E  GVKL+SFG+     AIMRGPM++ V+NQLLTTTEWG LDYLVID+PPGTGD+Q
Sbjct  223   IRPLEAHGVKLMSFGYVNPDSAIMRGPMIANVLNQLLTTTEWGVLDYLVIDLPPGTGDVQ  282

Query  1100  LTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA--DGKRYY  1273
             LTL Q++ +TAAVIVTTPQKL+F+DV KG+ MF K+ VP VAVVENM +F A   G +++
Sbjct  283   LTLSQIINMTAAVIVTTPQKLSFVDVVKGIDMFDKVSVPSVAVVENMSYFVAPDTGVKHH  342

Query  1274  PFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQ  1453
              FGKG   ++++Q+GI   F +PI P LS   DSG P VVA+P+  ++  +Q L   VVQ
Sbjct  343   IFGKGHQQRLIEQYGITDSFSMPIDPELSEKSDSGIPYVVANPKSMLSDEYQRLASAVVQ  402

Query  1454  QCARIRQQVSTA--VSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQK  1627
             + A+I+        V +D +   I V++PN++    + PAT+RR  R A  V E +G QK
Sbjct  403   EVAKIQYGGLGIPDVQWDEASGNINVRMPNTETTQKIWPATLRRQCRCALCVDEMTGAQK  462

Query  1628  LQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  1747
             L  +DV +D+ P ++ P+GNYA+ + W DG   + PY + 
Sbjct  463   LDPADVSDDVRPMKLAPVGNYALDVLWSDGHPSLYPYSRF  502


 Score =   155 bits (393),  Expect(2) = 6e-111, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 106/157 (68%), Gaps = 8/157 (5%)
 Frame = +1

Query  382  VLKALAQIIDPDFGTDIVSCGFVKDLLVNEALG-----EVSFRLELTTPACPIKDMFEQK  546
            + KAL+ +IDPD G DIV+ GF+KD+  +E  G     +VSF++ELTTPACP+KD+F+  
Sbjct  64   LFKALSTVIDPDLGQDIVTLGFIKDVEFSEVPGLKGMYDVSFKVELTTPACPVKDIFKSD  123

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPG-LQTISNIVAVSSCKGGVGKSTVAVN  723
               +   + +V    V M+A P  P      P G L  I  IVAV+SCKGGVGKST AVN
Sbjct  124  CKRLAEDISFVGKANVIMTAAP--PSANVPTPTGALDNIGAIVAVASCKGGVGKSTTAVN  181

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            LA++LA  GARVGI DAD+YGPSLPT+V PE R ++ 
Sbjct  182  LAFSLASRGARVGIMDADIYGPSLPTLVEPEERAVQF  218



>ref|XP_002958167.1| hypothetical protein VOLCADRAFT_107985 [Volvox carteri f. nagariensis]
 gb|EFJ40792.1| hypothetical protein VOLCADRAFT_107985 [Volvox carteri f. nagariensis]
Length=483

 Score =   353 bits (905),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 176/309 (57%), Positives = 222/309 (72%), Gaps = 11/309 (4%)
 Frame = +2

Query  839   LPFLILKCIQLAEI*PLTNL*NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVI  1018
             LP ++   I++ E+       +P  K I PTEY GVK+VSFGFAGQG AIMRGPMVSG+I
Sbjct  162   LPLMVNPEIKVLEM-------DPATKAIFPTEYEGVKVVSFGFAGQGSAIMRGPMVSGLI  214

Query  1019  NQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMF  1198
              Q+LTT  WGELDYLV+D PPGTGDIQLTLCQ V  +AAVIVTTPQKLAFIDVAKG+RMF
Sbjct  215   QQMLTTAAWGELDYLVVDFPPGTGDIQLTLCQTVSFSAAVIVTTPQKLAFIDVAKGIRMF  274

Query  1199  SKLKVPCVAVVENMCHFDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSG  1378
             +KL VPCVAVVENM +F+ADGKR++PFG+GSG ++ + FG+P+L   PI P LSA+GD G
Sbjct  275   AKLVVPCVAVVENMSYFEADGKRFFPFGQGSGERIQRDFGLPNLVRFPIVPDLSAAGDGG  334

Query  1379  TPEVVADPRGEVASTFQELGVCVVQQCARIRQQ-VSTAVSYDRSIKAIKVKVPNSDEEFY  1555
              P VVADP    A+ F +LG  VV++ A++  +    AV YD     I V++P  + EF 
Sbjct  335   QPLVVADPTSATAAAFMDLGAAVVREVAKMAGRPARQAVYYDPQKDVISVQLPG-ETEFL  393

Query  1556  LHPATVRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAP  1735
             L P  VR ND SA S+ EW+G++K    +VP+D  P  I P+GNYAV I+W DGF+Q+A 
Sbjct  394   LPPVVVRENDTSATSIDEWTGQRK--RDEVPQDARPAAINPLGNYAVQISWSDGFNQVAS  451

Query  1736  YDQLQTIER  1762
             Y+ L  + R
Sbjct  452   YELLDELRR  460


 Score =   142 bits (359),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 102/156 (65%), Gaps = 19/156 (12%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            T E +VL  L  +IDPDFG DIV+CGFV+ L V+ ++G VSF LELTTPACP+K+MF+++
Sbjct  39   TPEEQVLAKLRNVIDPDFGEDIVACGFVRQLEVDASVGFVSFTLELTTPACPVKEMFQRQ  98

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            + + V  LPWV+ V + ++AQP KP               ++  S   GG+ K    ++ 
Sbjct  99   STQFVKELPWVRDVSIKLTAQPPKP---------------LLPESGRPGGLAKMGAKLH-  142

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            A+      +RVGIFDADVYGPSLP MV+PE ++LEM
Sbjct  143  AHVFV---SRVGIFDADVYGPSLPLMVNPEIKVLEM  175



>ref|WP_007280871.1| hypothetical protein [Lentisphaera araneosa]
 gb|EDM25315.1| hypothetical protein LNTAR_03519 [Lentisphaera araneosa HTCC2155]
Length=452

 Score =   249 bits (635),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 129/281 (46%), Positives = 183/281 (65%), Gaps = 6/281 (2%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAG--QGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             ++P EY GVKL+SFGF    Q  AIMRGPMVS VI Q+    +W ELDYL++D PPGTGD
Sbjct  166   LLPLEYEGVKLMSFGFLNTDQEAAIMRGPMVSQVIGQIGGGCDWEELDYLIVDFPPGTGD  225

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG--KR  1267
             IQLTL Q +P TAAVIVTTPQ L+FIDV KG++MF +L+VP VAVVENM +F      ++
Sbjct  226   IQLTLLQSLPFTAAVIVTTPQNLSFIDVIKGIKMFDQLQVPSVAVVENMSYFTCGNCDEK  285

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCV  1447
             + P+G+G+  ++V  +G  H F+LPI   LS +GD+G P V+A+P G++A  + ++   V
Sbjct  286   HRPYGQGALKKLVDMYGFRHAFELPIDVELSNAGDTGIPPVLAEPNGQLARYYSDIAASV  345

Query  1448  VQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQK  1627
              ++ +RI+       + +  I+   V +   ++E    P  +R +   A    E++GE+ 
Sbjct  346   AREISRIKFMAKDKPTVE-FIEERGVVLTQGEKELVFEPRELRLSCHCAACRHEFTGEKI  404

Query  1628  LQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQL  1747
             L    VP +++PE IRPMGNYAVS+ W DG  S +  YD+L
Sbjct  405   LDEKSVPANVKPESIRPMGNYAVSVIWSDGHSSSVYAYDKL  445


 Score =   177 bits (449),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 112/149 (75%), Gaps = 2/149 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E  VL+ L+ IIDPD G DIVS GF+KDL ++++ GEV F +ELTTPACP+K+ F  +A 
Sbjct  10   EEAVLEVLSVIIDPDLGKDIVSLGFIKDLKISDS-GEVDFSIELTTPACPVKEEFRSRAT  68

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
             +V +L WV  V +TM+AQP K + A +   G+  + NI+AV+SCKGGVGKST AVNLAY
Sbjct  69   ALVESLSWVTEVNITMTAQPQKEINANR-AKGVAKVQNIIAVTSCKGGVGKSTTAVNLAY  127

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPEN  819
            +L   GA+VGI DAD+YGPSLP MVSP++
Sbjct  128  SLKRTGAKVGILDADIYGPSLPVMVSPQD  156



>gb|KCW82562.1| hypothetical protein EUGRSUZ_C039601, partial [Eucalyptus grandis]
Length=224

 Score =   332 bits (851),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 183/226 (81%), Gaps = 24/226 (11%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLT  1105
             P   L   LVSFGFAGQGRAIM                  GELDYLVIDMPPGTGDIQLT
Sbjct  23    PDNRLLEMLVSFGFAGQGRAIM------------------GELDYLVIDMPPGTGDIQLT  64

Query  1106  LCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPFGK  1285
             LCQVVPLTAAVIVTTPQKLAFI+VAKG+RM+        AVVENMCHFDADGK YYP G+
Sbjct  65    LCQVVPLTAAVIVTTPQKLAFINVAKGIRMYHD------AVVENMCHFDADGKHYYPLGR  118

Query  1286  GSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQCAR  1465
             GSG+QV QQFGIPHLF+LPIRPTLSA GDSG PEVVADP GEVA TFQ+LGVCVVQQCA+
Sbjct  119   GSGSQVFQQFGIPHLFNLPIRPTLSAFGDSGMPEVVADPLGEVAKTFQDLGVCVVQQCAK  178

Query  1466  IRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESV  1603
             IRQQVSTAV++D+ IKAIK KVP+SDEEF+LHP T+RRN+RSA+ V
Sbjct  179   IRQQVSTAVTHDKVIKAIKAKVPDSDEEFFLHPTTMRRNNRSAQIV  224


 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/36 (83%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  745  MGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPY  852
            MGARVGIFDADVYGPSLPTMVSP+NRLLEM+ S  +
Sbjct  1    MGARVGIFDADVYGPSLPTMVSPDNRLLEMLVSFGF  36



>ref|XP_002186426.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65896.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=438

 Score =   246 bits (628),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 128/289 (44%), Positives = 185/289 (64%), Gaps = 8/289 (3%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             + + P +  GV+L+SFG+   G A+MRGPMV+ +++Q L+ T WG LDYL++DMPPGTGD
Sbjct  150   RQVAPLQRNGVRLMSFGYVNDGSAVMRGPMVTQLLDQFLSVTHWGALDYLILDMPPGTGD  209

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD-ADGKRY  1270
             IQLTL Q + +TAAVIVTTPQ+L+F DV +GV MF  + VPC+AVVENM +++ AD ++ 
Sbjct  210   IQLTLTQKLNITAAVIVTTPQELSFADVVRGVEMFDTVNVPCIAVVENMAYYESADPEKI  269

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
               FG G   ++ QQ+GI H F +P+   ++A+GD+GTP V+  P    A  +QEL   VV
Sbjct  270   QIFGAGHRDRLSQQWGIEHSFSIPLLNKIAANGDNGTPFVLEFPDSPPAKIYQELASAVV  329

Query  1451  QQCARIR--QQVSTAVSYDRSIKAIKVK---VPNSDEEFY--LHPATVRRNDRSAESVVE  1609
              + A+ +  + +  +V YD     ++V    V ++DEE    L PA +RR  R A  V E
Sbjct  330   SEVAKTKFAKSMRPSVQYDAESHLLQVSQNGVGSTDEEHVATLPPAELRRACRCAACVEE  389

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTI  1756
              +G Q L  S V + I P  + P GNYA+S+ W DG   + PY Q++ +
Sbjct  390   LTGRQILVPSSVSDKIAPRNMVPTGNYALSVDWSDGHRSLYPYRQIRAL  438


 Score =   164 bits (414),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 110/153 (72%), Gaps = 5/153 (3%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            EVL  L  +IDPD G+DIV+ GFV++L ++    +VSF +ELTTPACP+K+ F+    ++
Sbjct  1    EVLSTLKSVIDPDLGSDIVTLGFVQNLKLDGR--DVSFDVELTTPACPVKEQFQLDCQQL  58

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTL  738
            V  LPW   ++VTM+AQP+    A     G+  +  ++AVSSCKGGVGKST AVNLA++L
Sbjct  59   VQDLPWTNNIQVTMTAQPSVQETATL---GMSQVGAVIAVSSCKGGVGKSTTAVNLAFSL  115

Query  739  ADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
              +GA VGIFDADVYGPSLPTM++P++  +  V
Sbjct  116  QRLGATVGIFDADVYGPSLPTMITPQDDTVRFV  148



>ref|XP_002293925.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED88934.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=439

 Score =   234 bits (596),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 118/287 (41%), Positives = 184/287 (64%), Gaps = 8/287 (3%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             + I P     V L+SFG+  +G AIMRGPMV+ +++Q L+ T WG LDYL++DMPPGTGD
Sbjct  155   RQIAPLRRGDVSLMSFGYVNEGSAIMRGPMVTQLLDQFLSLTNWGALDYLIMDMPPGTGD  214

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYY  1273
             IQLTL Q + +TAAVIVTTPQ+L+F+DV +GV MF  + VPC+AVVENM + + +     
Sbjct  215   IQLTLSQRLNITAAVIVTTPQELSFVDVERGVEMFDTVNVPCIAVVENMAYLEREETEMI  274

Query  1274  P-FGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
               FG G   ++ +Q+GI H + +P+   ++ +GDSGTP ++ +P+   A  +++L   VV
Sbjct  275   RIFGPGHKRRLSEQWGIEHTYSVPLMGQIAQNGDSGTPFILDNPKSPQADIYRQLAKSVV  334

Query  1451  QQCARIR----QQVSTAVSYDRSIKAIKVKVPNSD-EEFYLHPATVRRNDRSAESVVEWS  1615
              + A+I+    +    +VSYD  ++   ++V + D +   + PA +RR  R A  V E +
Sbjct  335   SEVAKIKFCTGKGGRPSVSYD--VEKSILRVDDGDIQNATISPAELRRGCRCAACVEELT  392

Query  1616  GEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTI  1756
             G+Q L  + + E ++P  + P GNYA+S+ W DG   + PY Q++++
Sbjct  393   GKQILNPASISESVKPLNMSPTGNYALSVDWSDGHRSLYPYRQIRSM  439


 Score =   169 bits (428),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 113/156 (72%), Gaps = 4/156 (3%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            ++++L AL+ I DPD   DIVS GFV++L ++E+   VS  LELTTPACP+KD+F Q+  
Sbjct  1    QSQILAALSVINDPDLNADIVSLGFVQNLKIDESSNIVSLDLELTTPACPVKDLFVQQCQ  60

Query  553  EVVAALPWVKTVKVTMSAQP-AKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +++  L W +   VT+++QP A P  A   P G+  I  ++AVSSCKGGVGKST AVNLA
Sbjct  61   DIINGLAWTRGADVTLTSQPTAAPSDA---PLGMSQIGAVIAVSSCKGGVGKSTTAVNLA  117

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            + L  +GA+VGIFDADVYGPSLPTMV+PE+  +  V
Sbjct  118  FALESLGAKVGIFDADVYGPSLPTMVTPEDDNVRFV  153



>gb|KCW82749.1| hypothetical protein EUGRSUZ_C04130 [Eucalyptus grandis]
Length=381

 Score =   329 bits (843),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/198 (81%), Positives = 173/198 (87%), Gaps = 12/198 (6%)
 Frame = +2

Query  1046  GELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLK-----  1210
             GELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDV KGVRMFSKLK     
Sbjct  183   GELDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVVKGVRMFSKLKSHLLT  242

Query  1211  -------VPCVAVVENMCHFDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASG  1369
                    VPCVA VENMCHFDADGKRYYP  +GSG+QVVQQFGIPHLF+LPIRPTLSASG
Sbjct  243   IHCSCTRVPCVAAVENMCHFDADGKRYYPLDRGSGSQVVQQFGIPHLFNLPIRPTLSASG  302

Query  1370  DSGTPEVVADPRGEVASTFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEE  1549
             DSG PEVVADP GEVA TFQ+L VCVVQ CA+IRQQVSTAV++D+ I+AIK KVP+SDEE
Sbjct  303   DSGMPEVVADPLGEVAKTFQDLRVCVVQPCAKIRQQVSTAVTHDKVIEAIKAKVPDSDEE  362

Query  1550  FYLHPATVRRNDRSAESV  1603
              +LHP TVRRN+RSA+SV
Sbjct  363   CFLHPTTVRRNNRSAQSV  380


 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 89/135 (66%), Gaps = 31/135 (23%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            QTAE++VLKAL+Q++                             LE T     +   FEQ
Sbjct  76   QTAESDVLKALSQLL--------------------------ILTLERT-----LFHEFEQ  104

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +ANEVVA L WVK VK TMSAQPAKPVF G+LPPGLQ ISNI+AVSSCKGGVGKSTVAVN
Sbjct  105  QANEVVANLHWVKNVKATMSAQPAKPVFTGELPPGLQMISNIIAVSSCKGGVGKSTVAVN  164

Query  724  LAYTLADMGARVGIF  768
            LAYTLA MGARVGI 
Sbjct  165  LAYTLARMGARVGIL  179



>ref|XP_005704479.1| ATP-binding protein involved in chromosome partitioning [Galdieria 
sulphuraria]
 gb|EME27959.1| ATP-binding protein involved in chromosome partitioning [Galdieria 
sulphuraria]
Length=540

 Score =   236 bits (603),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 125/289 (43%), Positives = 172/289 (60%), Gaps = 15/289 (5%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQ  1099
             IIP EY  VKL+SFG+     AIMRGPM++ ++NQLLT T+WG LDYLVIDMPPGTGDIQ
Sbjct  236   IIPLEYENVKLMSFGYINPESAIMRGPMIANMMNQLLTETDWGSLDYLVIDMPPGTGDIQ  295

Query  1100  LTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---DADGKRY  1270
             LT+CQ V L AAVIVTTPQ+L+F DV KG++MF K+ VPCVA+VENM +F   D   KRY
Sbjct  296   LTICQTVSLDAAVIVTTPQQLSFQDVIKGIQMFGKVSVPCVALVENMAYFEPNDIPDKRY  355

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
             Y FG G   ++   +GIP +   P+ P L    D+G P V+A    +++  +Q L   VV
Sbjct  356   YLFGHGKSQKIANDYGIPFVESFPLDPDLCRWSDNGIPAVLALSESKISQLYQSLASAVV  415

Query  1451  QQCARI-----RQQVSTAVSYDRSIKAIKVK-----VPNSDEEFYLHPATVRRNDRSAES  1600
             QQ A+      ++        D+ I  I          N + +    P  +R     A  
Sbjct  416   QQIAKNAFGNGKRIPQVFFDSDKCIIVISCNDQQGIAWNENNKVEWSPWELRNACSCASC  475

Query  1601  VVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  1747
             V E++G  K  +  V  +++P +I+  GNYA S+ W DG   + P++++
Sbjct  476   VDEFTG--KRHWKSVDRNVKPLQIQTAGNYAFSVIWSDGHQSLYPFERV  522


 Score =   152 bits (385),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 106/156 (68%), Gaps = 5/156 (3%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDL---LVNEALGEVSFRLELTTPACPIKDMFEQ  543
            + +VL+ L  I DPD   +IV  GFV++L      +   +V F L+LTTPACPIK+ F+ 
Sbjct  77   QKQVLELLKNIEDPDLKQNIVELGFVQNLERVAKEDGKYDVRFTLQLTTPACPIKEKFQN  136

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
             A E V++L WV+ V++ + A       AG  P  L  + +I+AV+SCKGGVGKSTVAVN
Sbjct  137  DAKEWVSSLLWVRNVEIDLRANEINRAQAGDRP--LNKVKHIIAVASCKGGVGKSTVAVN  194

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            LA+TL  +G +VGI DAD+YGPSLP +V PEN++++
Sbjct  195  LAFTLTKLGGKVGIMDADIYGPSLPILVQPENKIVQ  230



>emb|CBJ25905.1| HCF101 (HIGH-CHLOROPHYLL-FLUORESCENCE 101); ATP binding [Ectocarpus 
siliculosus]
Length=586

 Score =   216 bits (550),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 188/354 (53%), Gaps = 69/354 (19%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQ  1099
             I P    GVKL+S+GF  QG AIMRGPMVS +++Q +T T WGELDYLVIDMPPGTGDIQ
Sbjct  237   IRPMTAHGVKLMSYGFVNQGAAIMRGPMVSQLLSQFVTLTSWGELDYLVIDMPPGTGDIQ  296

Query  1100  LTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYPF  1279
             LTLCQV+ +TAAVIVTTPQKL+F DV KG+ +F  + VP VAVVENM ++DA  +  +  
Sbjct  297   LTLCQVLNITAAVIVTTPQKLSFTDVVKGIDLFDTVNVPSVAVVENMAYYDAVDQTVFKT  356

Query  1280  GKGSG------------------------------------AQVVQQ----------FGI  1321
             G  S                                     A+V+++          FG 
Sbjct  357   GLESNIEDLLTLDGDELSAAAAREGLASPPQDETALRAAVIAEVMKKRASTKQREYIFGK  416

Query  1322  PHLFDL------------PIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQCAR  1465
              H   L            P+   +++SGDSG P VV+ P  + + ++ +L   VV++ A+
Sbjct  417   GHQMRLADMWGITNTIRMPLVADVASSGDSGIPFVVSKPDSDHSESYSQLAEAVVREVAK  476

Query  1466  IRQQVSTAVSYDRSIKAIK-----VKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQKL  1630
             ++         DR + + +     V +  S  +  +  A +RR  R A  V E+SG+  L
Sbjct  477   LKFS-----DNDRPMLSFQPAEGTVTIETSGGKQVMAAADLRRQCRCALCVEEFSGKPLL  531

Query  1631  QYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQT-IERLVEVPELTP  1789
               + VPE+I P E  P+GNYAVS+ W DG S + PY       +   + PEL+P
Sbjct  532   DPASVPENIVPTEFAPIGNYAVSVKWDDGHSSLYPYKNFAMGYKPRTKRPELSP  585


 Score =   172 bits (437),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 111/156 (71%), Gaps = 4/156 (3%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLV---NEALGEVSFRLELTTPACPIKDMFEQKA  549
            EVL  L+ ++DPD   DIVS GF+K+L +   +E    V+F +ELTTPACP+K  F+Q  
Sbjct  79   EVLAVLSAVMDPDLSMDIVSLGFIKELEISGEDEGRQVVTFDVELTTPACPVKAQFQQDC  138

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
             ++V ALPWV   +VTM+AQP + V +  +P GL  ++ I+AVSSCKGGVGKST AVNLA
Sbjct  139  RDLVEALPWVDRAEVTMTAQPVRDV-SDTVPTGLSKVATIIAVSSCKGGVGKSTTAVNLA  197

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            + L   GA+VGI DAD+YGPSLPTMV P+   +E V
Sbjct  198  FALDKQGAKVGILDADIYGPSLPTMVKPDREEVEFV  233



>ref|XP_005538557.1| probable multidrug resistance protein [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM82521.1| probable multidrug resistance protein [Cyanidioschyzon merolae 
strain 10D]
Length=545

 Score =   234 bits (596),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 120/281 (43%), Positives = 183/281 (65%), Gaps = 6/281 (2%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQ  1099
             ++P    GVKL+SFG+     A++RGPMVS ++ QL+  T+WG LDYL++D+PPGTGDIQ
Sbjct  242   MVPLTRAGVKLMSFGYINSDPAMLRGPMVSSLLTQLIQQTDWGSLDYLLVDLPPGTGDIQ  301

Query  1100  LTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA--DGKRYY  1273
             +TL QV+  TAAV+VTTPQ+LAF DV KG+++  K+ VP +AVVE+M +F A   GKRY 
Sbjct  302   ITLGQVLKATAAVVVTTPQRLAFADVVKGIQLLDKMAVPPIAVVESMAYFVAPDTGKRYD  361

Query  1274  PFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPR-GEVASTFQELGVCVV  1450
              FGKG  A++ ++FGI   F +P+ P ++A+GD+GTP  +  P   E+   ++ +   +V
Sbjct  362   LFGKGHSARISREFGIRSTFQVPLWPEINAAGDTGTPVTLTLPETSEIFQCYRRIAENIV  421

Query  1451  QQCARIRQQVS--TAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQ  1624
             Q+CAR+R          +D   + I V++ +  EE  + PA +RR  R A  V E +G+Q
Sbjct  422   QECARVRFGAVPIPQARWDADHREIVVQLQDHMEE-RIQPAALRRACRCAACVDECTGKQ  480

Query  1625  KLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQL  1747
              L  + V ++I P ++  +GNYA+++ W DG   I P+++ 
Sbjct  481   LLDPNSVDDNIYPMQMMNVGNYALAVNWSDGHQSIMPWERF  521


 Score =   152 bits (385),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 104/152 (68%), Gaps = 6/152 (4%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLV--NEALGEVSFRLELTTPACPIKDMFEQKAN  552
            ++L AL  ++DPD G DIV+ GFVK++    +E  G VSF +ELTTPACPIK+ F ++  
Sbjct  79   QLLSALKAVVDPDLGQDIVTLGFVKNIQFGGDEHYGTVSFDVELTTPACPIKERFREECT  138

Query  553  EVVAALPWVKTVKVTMSAQ---PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
             +  +LP+V    V ++AQ    A P   G   P L  +SNIV V+S KGGV KST AVN
Sbjct  139  RLAESLPFVTRANVRLTAQTPSAAAPEAGGSRDP-LSQVSNIVLVTSAKGGVAKSTTAVN  197

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            LA+ LA +GARVGI DAD+YGPSLP MV+PE+
Sbjct  198  LAFVLARLGARVGILDADIYGPSLPIMVNPEH  229



>gb|EWM28719.1| protein of unknown function, DUF971 [Nannochloropsis gaditana]
Length=636

 Score =   204 bits (518),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/343 (41%), Positives = 175/343 (51%), Gaps = 77/343 (22%)
 Frame = +2

Query  941   GVKLVSFGFAGQGRA-IMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQV  1117
             GVKL+SFG+   G A +MRGPMV  +INQLLT T WGELDYLVIDMPPGTGDI LTLCQ 
Sbjct  273   GVKLMSFGYVNPGAAAVMRGPMVIQLINQLLTLTSWGELDYLVIDMPPGTGDIPLTLCQS  332

Query  1118  VPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYYP-------  1276
             + +TAAVIVTTPQ+L+F DV KGV MF  + VPCVAVVENM + D     Y         
Sbjct  333   LNITAAVIVTTPQRLSFTDVVKGVDMFDTVNVPCVAVVENMAYADVSALDYVDSREDMNR  392

Query  1277  ------------------------FGKGSGA------QVVQQ-----------FGIPH--  1327
                                        G GA       VVQ+           FG  H  
Sbjct  393   NGGVAGAWQRLRQDIEDVLEDEDGIRTGKGAVVDDLITVVQRRLREDRIARPLFGQGHRQ  452

Query  1328  -LFDL---------PIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQCARI---  1468
              L D+         P+   +S SGDSGTP +V++P    A  F +L   VV++ A++   
Sbjct  453   RLADMWGLDNTVSLPVLEEVSKSGDSGTPLLVSEPDSSSAQIFMDLAGRVVREVAKLRYD  512

Query  1469  RQQVSTAVSYDRSIKAIKVKVPNS-----DEEF--------YLHPATVRRNDRSAESVVE  1609
             R ++  +V+Y      I V +  +     D            + PA +RR  R A  V E
Sbjct  513   RSRLRPSVTYLPVEHVIAVTLHGAAGLTDDGRMESDISPPQKIAPAALRRQCRCAMCVEE  572

Query  1610  WSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPY  1738
              +G Q LQ   + EDI+P EI  +GNYA+ ITW DG   + PY
Sbjct  573   MTGRQLLQPETIAEDIKPVEIGAVGNYAIGITWTDGHKSLFPY  615


 Score =   178 bits (451),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 124/181 (69%), Gaps = 7/181 (4%)
 Frame = +1

Query  376  AEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANE  555
            A+V+  L Q++DPD G+D+V+ GF+K+L ++ A G VSF LELTTPACP+KD  + +A +
Sbjct  96   AQVVTQLRQVMDPDLGSDVVTLGFIKNLTIDGATGRVSFVLELTTPACPVKDDLKAQAMQ  155

Query  556  VVAALPWVKTVKVTMSAQP--AKPVFAGQLPP-GLQTISNIVAVSSCKGGVGKSTVAVNL  726
            VV  LPWV    V +SA+P  A+    G +   GL  ++N++AVSSCKGGVGKST AVNL
Sbjct  156  VVETLPWVTKADVILSARPITAEKSAGGDMKATGLSLVNNVIAVSSCKGGVGKSTTAVNL  215

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPYTQMHTACRNITINEPLEP  906
            A+ L   GA+VGI DAD+YGPSLPTMV+P+  ++E V S    Q+    R   ++   +P
Sbjct  216  AFALDRQGAKVGILDADIYGPSLPTMVAPDTEMVEFVES----QIRPMIRQTGLDAEGQP  271

Query  907  R  909
            +
Sbjct  272  K  272



>gb|KFM22705.1| Mrp-like protein [Auxenochlorella protothecoides]
Length=1194

 Score =   327 bits (839),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 161/296 (54%), Positives = 209/296 (71%), Gaps = 2/296 (1%)
 Frame = +2

Query  887   LTNL*NPEKKTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLV  1066
             L  + +PE + I P ++ GVK VSFGFAGQG AIMRG MVSG+I QLLTTTEWG+LDYLV
Sbjct  170   LPTMISPESRAITPVDFEGVKAVSFGFAGQGSAIMRGAMVSGLIQQLLTTTEWGDLDYLV  229

Query  1067  IDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCH  1246
             ID PPGTGDIQLTLCQ   L+AAVIVTTPQ+LAFIDVAKG+RMF++L VPCVAVVENM +
Sbjct  230   IDFPPGTGDIQLTLCQTCALSAAVIVTTPQRLAFIDVAKGIRMFARLAVPCVAVVENMSY  289

Query  1247  FDADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTF  1426
             F+ DG R+ PFG+G+G ++V++FG+PH+F  PI P LS++GD G P VV DP    + T+
Sbjct  290   FEVDGVRHRPFGQGAGEKIVEEFGLPHIFRFPIDPGLSSAGDEGLPLVVVDPTCPTSQTY  349

Query  1427  QELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVV  1606
              ELG  VV++ A++ +    A+SYD +  +  V +P  +  F+L  A VRRND SA ++ 
Sbjct  350   AELGAAVVREVAKLERGSQAAISYDPASASFTVWLPG-EAVFHLDAAEVRRNDTSARAID  408

Query  1607  EWSGEQKLQYSDV-PEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVE  1771
             EWSG        + PE      +  +GNYA  I+W DG +Q+A YD L  + RL +
Sbjct  409   EWSGGTGSPAPGLGPEAGVALAVTTLGNYAAQISWKDGANQVAAYDLLLRLPRLSD  464


 Score =   193 bits (491),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 119/159 (75%), Gaps = 5/159 (3%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            +AE  VL+AL+ I+DPD G +IV CGFV DL ++ A G VS RL LTTPACP+KD F+++
Sbjct  23   SAEEGVLQALSVIMDPDLGKNIVDCGFVHDLAIDLASGAVSLRLNLTTPACPVKDEFKRQ  82

Query  547  ANEVVAALPWVKTVKVTMSAQP-----AKPVFAGQLPPGLQTISNIVAVSSCKGGVGKST  711
            A E V AL WV T +V ++A P      +   A   P GL+ + +I+AVSSCKGGVGKST
Sbjct  83   AEEAVRALDWVTTAEVAITASPPAQVPGQGAEAAGKPGGLRGVRHIIAVSSCKGGVGKST  142

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
             AVNLA+TLA MGARVGIFDADVYGPSLPTM+SPE+R +
Sbjct  143  TAVNLAFTLAQMGARVGIFDADVYGPSLPTMISPESRAI  181



>gb|ETI34745.1| hypothetical protein, variant 1 [Phytophthora parasitica P1569]
Length=493

 Score =   239 bits (610),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 186/297 (63%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  425   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  481


 Score =   128 bits (321),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETP32733.1| hypothetical protein, variant 1 [Phytophthora parasitica P10297]
Length=493

 Score =   239 bits (610),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 184/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  425   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  481


 Score =   127 bits (320),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETK75042.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETL28463.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETM34924.1| hypothetical protein, variant 1 [Phytophthora parasitica]
 gb|ETP04596.1| hypothetical protein, variant 1 [Phytophthora parasitica CJ01A1]
Length=493

 Score =   239 bits (610),  Expect(2) = 9e-92, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 186/297 (63%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  425   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  481


 Score =   127 bits (320),  Expect(2) = 9e-92, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETO63502.1| hypothetical protein F444_18800 [Phytophthora parasitica P1976]
Length=493

 Score =   239 bits (610),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 184/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  425   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  481


 Score =   126 bits (317),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 96/150 (64%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            + LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FGLAKRGARVGILDADIYGPSLPTMVSPED  176



>ref|XP_008913548.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
 gb|ETN01221.1| hypothetical protein, variant 1 [Phytophthora parasitica INRA-310]
Length=493

 Score =   237 bits (605),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 185/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  425   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  481


 Score =   127 bits (320),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETL81718.1| hypothetical protein, variant 1 [Phytophthora parasitica]
Length=493

 Score =   237 bits (605),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 185/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  425   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  481


 Score =   127 bits (320),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>ref|XP_008604920.1| hypothetical protein SDRG_01182, partial [Saprolegnia diclina 
VS20]
 gb|EQC41206.1| hypothetical protein SDRG_01182, partial [Saprolegnia diclina 
VS20]
Length=484

 Score =   236 bits (602),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 176/295 (60%), Gaps = 16/295 (5%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P  Y GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  191   PVRYHGVECMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGALDYLVIDMP  250

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD-A  1255
             PGTGDI ++L Q   +T AVIVTTPQKL+F+DV KG+ MF  LK+P  AVVENM +FD A
Sbjct  251   PGTGDIHMSLAQQTAITTAVIVTTPQKLSFVDVEKGISMFEDLKIPTSAVVENMSYFDCA  310

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R+YPFG G   Q+ Q F I H F  P+  + S S D+G P V+ D   EV++TF+ L
Sbjct  311   HGHRHYPFGHGHLKQLQQSFDIQHTFQFPMAESTSDSADAGRPLVLTDALPEVSATFESL  370

Query  1436  GVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESV  1603
              + V ++C +++     A  + YD  R I  ++     S  E  L P  +R   R A  +
Sbjct  371   AITVAEECVKLKHLAKLAPELLYDAKRGI-VLRFYTSESAHEVVLPPVELRAQCRCAACI  429

Query  1604  VEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTIERL  1765
              E++G+  L    +P+DI P  ++  GNYA ++ W DG  S +  ++ L+T+ ++
Sbjct  430   EEFTGKPLLDPEAIPDDIRPTAVQRKGNYAFAVVWSDGHSSSLYTFEHLRTLAQV  484


 Score =   121 bits (304),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 6/161 (4%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIK--DMFEQK  546
            EAEV++ L  + D     D+ + G +K+L++     +    L++ TP+  ++  D +   
Sbjct  30   EAEVMERLRSVKDDLLNADLPTLGRIKNLVIQP---DHCVTLDIETPSRVLRQNDQWIAA  86

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            A E + +LPWV    V++++   +   A +    L  +SNIVAVSSCKGGVGKSTVAVNL
Sbjct  87   ATEAIQSLPWVSRANVSLASASTRNAQAPR-HSALANVSNIVAVSSCKGGVGKSTVAVNL  145

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVP  849
            A+ L   GARVG+ DADVYGPSLPTM+SP++R +    + P
Sbjct  146  AFALQKRGARVGLLDADVYGPSLPTMISPDDRAIRKSKTNP  186



>gb|KDO35062.1| hypothetical protein SPRG_01126 [Saprolegnia parasitica CBS 223.65]
Length=484

 Score =   233 bits (595),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 128/300 (43%), Positives = 176/300 (59%), Gaps = 20/300 (7%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P  Y GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  191   PVRYHGVECMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGALDYLVIDMP  250

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD-A  1255
             PGTGDI ++L Q   +T AVIVTTPQKL+F+DV KG+ MF  LK+P  AVVENM +FD A
Sbjct  251   PGTGDIHMSLAQQTAITTAVIVTTPQKLSFVDVEKGISMFEDLKIPTSAVVENMSYFDCA  310

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R+YPFG G   Q+ Q F I H F  P+  + S S D+G P V+ D   EV+ TF+ L
Sbjct  311   HGHRHYPFGHGHLKQLQQSFDIQHTFQFPMAESTSDSADAGRPLVLTDALPEVSVTFESL  370

Query  1436  GVCVVQQCARIRQ--QVSTAVSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESV  1603
              + V ++C +++   +++  + YD  R I  ++     S  E  L P  +R   R A  +
Sbjct  371   AITVAEECVKLKHLSKLAPELLYDSKRGI-VLRFYTSESAHEVILPPVELRAQCRCAACI  429

Query  1604  VEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQLQTIERLVEVPEL  1783
              E++G+  L    +P+DI P  ++  GNYA ++ W DG S       L T E L ++ ++
Sbjct  430   EEFTGKPLLDPETIPDDIRPTAVQRKGNYAFAVVWSDGHSS-----SLYTFEHLRKLAQV  484


 Score =   121 bits (303),  Expect(2) = 5e-88, Method: Compositional matrix adjust.
 Identities = 71/155 (46%), Positives = 98/155 (63%), Gaps = 12/155 (8%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIK--DMFEQK  546
            EAEV++ L  + D     D+ + G +K+L++     +    L++ TP+  ++  D +  +
Sbjct  30   EAEVMERLRSVKDDLLNADLPTLGRIKNLVIQP---DHCVSLDIETPSRVLRQNDQWIAE  86

Query  547  ANEVVAALPWVKTVKVTM-SAQPAKPVFAGQLP--PGLQTISNIVAVSSCKGGVGKSTVA  717
            A E + +LPWV    V++ SA    P    Q P    L  +SNIVAVSSCKGGVGKSTVA
Sbjct  87   ATEAIQSLPWVSRANVSLASASTRNP----QAPRHSALANVSNIVAVSSCKGGVGKSTVA  142

Query  718  VNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            VNLA+ L   GARVG+ DADVYGPSLPTM+SP++R
Sbjct  143  VNLAFALQKRGARVGLLDADVYGPSLPTMISPDDR  177



>gb|ETP32732.1| hypothetical protein F442_18625 [Phytophthora parasitica P10297]
Length=520

 Score =   239 bits (610),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/297 (43%), Positives = 184/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  452   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  508


 Score =   114 bits (285),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVGYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETK75041.1| hypothetical protein L915_18282 [Phytophthora parasitica]
 gb|ETL28462.1| hypothetical protein L916_18191 [Phytophthora parasitica]
 gb|ETM34923.1| hypothetical protein L914_18089 [Phytophthora parasitica]
 gb|ETP04595.1| hypothetical protein F441_18666 [Phytophthora parasitica CJ01A1]
Length=520

 Score =   239 bits (610),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 186/297 (63%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  452   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  508


 Score =   113 bits (283),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETI34744.1| hypothetical protein F443_18814 [Phytophthora parasitica P1569]
Length=520

 Score =   239 bits (610),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 186/297 (63%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  452   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  508


 Score =   113 bits (283),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|XP_009838180.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 gb|ETV72498.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=494

 Score =   236 bits (601),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/296 (42%), Positives = 182/296 (61%), Gaps = 14/296 (5%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P EY GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  195   PVEYQGVQCMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGVLDYLVIDMP  254

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-  1255
             PGTGDI ++L Q V +T AVIVTTPQKL+F+DV KG+ MF  LKVP  AVVENM +FD  
Sbjct  255   PGTGDIHMSLAQQVAITTAVIVTTPQKLSFVDVEKGISMFEDLKVPTSAVVENMSYFDCV  314

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R+YPFG G    +  ++ IPH F LP+   ++ S D+G+P V++D    V + + +L
Sbjct  315   HGHRHYPFGHGYLTTLQSRYSIPHTFQLPMADAMNISVDTGSPVVLSDALPTVTAVYDDL  374

Query  1436  GVCVVQQCARIRQ--QVSTAVSYDRSI-KAIKVKVPNSDEEFYLHPATVRRNDRSAESVV  1606
                V Q+C +++   +V+  + +D++    ++    +S EE  L P  +R   R A+ + 
Sbjct  375   ATTVAQECVKLKHLARVAPELLFDKTRGMVLRFFSTDSAEEIVLSPVDLRARCRCAQCIE  434

Query  1607  EWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTIERLVE  1771
             E++G+Q L  + + EDI P  ++  GNYA ++ W DG  S +  ++ L+ + + V+
Sbjct  435   EFTGKQILDPTTIQEDIRPTAVQRKGNYAFAVVWSDGHSSSLYTFEHLRQLAKEVQ  490


 Score =   116 bits (290),  Expect(2) = 3e-87, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EAEVL+ L  + D   G D+++ G VK+L +++    VS  ++  +P       +  +A 
Sbjct  34   EAEVLQTLKLVKDDLVGQDLITLGRVKNLEISDEHA-VSCTIDSPSPVLLQNQEWITQAT  92

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + + AL WV    V +S  P            L  + NI+AVSSCKGGVGKSTVAVNLA+
Sbjct  93   DRIKALSWVTGANVALS-HPTPRNIQATRSSSLANVGNIIAVSSCKGGVGKSTVAVNLAF  151

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPY  852
             L   GARVGI DAD+YGPSLPTM+SP +  +   T  P+
Sbjct  152  ALKKRGARVGILDADIYGPSLPTMISPPDVAIRKSTVNPH  191



>ref|XP_008913547.1| hypothetical protein PPTG_17629 [Phytophthora parasitica INRA-310]
 gb|ETN01220.1| hypothetical protein PPTG_17629 [Phytophthora parasitica INRA-310]
Length=520

 Score =   237 bits (604),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 185/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  452   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  508


 Score =   114 bits (284),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|XP_008867789.1| hypothetical protein H310_04976 [Aphanomyces invadans]
 gb|ETW03560.1| hypothetical protein H310_04976 [Aphanomyces invadans]
Length=491

 Score =   225 bits (573),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 120/296 (41%), Positives = 180/296 (61%), Gaps = 14/296 (5%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P  + GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  194   PVLFEGVQCMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGVLDYLVIDMP  253

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-  1255
             PGTGDI ++L Q V +T AVIVTTPQKL+F+DV KG+ MF  LKVP  AVVENM +FD  
Sbjct  254   PGTGDIHMSLAQQVAITTAVIVTTPQKLSFVDVEKGISMFEDLKVPTSAVVENMSYFDCI  313

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R+YPFGKG    +  ++ IP+ F LP+   ++ S DSG+P V+ D    + + +  L
Sbjct  314   HGHRHYPFGKGYLDTLQSRYSIPYTFQLPMADAMNESVDSGSPLVLTDALPGMTAVYDGL  373

Query  1436  GVCVVQQCARIRQ--QVSTAVSYDRSI-KAIKVKVPNSDEEFYLHPATVRRNDRSAESVV  1606
                V ++C +++   +V+  + +D++    ++     S +E  L P  +R   R A+ + 
Sbjct  374   ATTVAEECVKLKHLARVAPELLFDKTRGMVLRFFTTESAQETVLSPVDLRARCRCAQCIE  433

Query  1607  EWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTIERLVE  1771
             E++G+Q L  + +P+DI P  ++  GNYA ++ W DG  S +  ++ L+ + + V+
Sbjct  434   EFTGKQILDPATIPDDIRPTAVQRKGNYAFAVVWSDGHSSSLYTFEHLRQLAKDVQ  489


 Score =   125 bits (315),  Expect(2) = 7e-87, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 97/159 (61%), Gaps = 2/159 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EAEVL++L Q+ D   G D+++ G VK+L + E    VS  ++  +P       +  +A 
Sbjct  33   EAEVLQSLKQVQDDLVGQDLITLGRVKNLQITEEHA-VSCTIDSPSPVLLQNQEWITQAT  91

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + + ALPWV+   VT+   P            L  + NI+AVSSCKGGVGKSTVAVNLA+
Sbjct  92   DRIKALPWVQNADVTL-LHPTPRNIQANRSSSLANVGNIIAVSSCKGGVGKSTVAVNLAF  150

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVP  849
             L   GARVGI DAD+YGPSLP+M+SP++  +   T+ P
Sbjct  151  ALKKRGARVGILDADIYGPSLPSMISPQDVAIRKSTANP  189



>gb|ETL81717.1| hypothetical protein L917_18006 [Phytophthora parasitica]
Length=520

 Score =   237 bits (604),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 130/297 (44%), Positives = 185/297 (62%), Gaps = 16/297 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
              A+ + E++GEQ L  + VP+DI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  452   CAQCIDEFTGEQILDPATVPDDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITAL  508


 Score =   113 bits (283),  Expect(2) = 8e-87, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>emb|CCA21133.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=697

 Score =   223 bits (568),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 119/292 (41%), Positives = 171/292 (59%), Gaps = 15/292 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  I+P E+ GVKL+SFGF  Q  A          MRGPMVS +I+QL+  T+WG LD+L
Sbjct  395   KGFILPLEFQGVKLMSFGFVNQKAAPGAGGVGAAVMRGPMVSKLIDQLILATQWGSLDFL  454

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             ++DMPPGTGDIQ++L Q +P++AAVIVTTPQ+L+ IDV KG+ MF  LKVP VAVVENM 
Sbjct  455   IVDMPPGTGDIQMSLTQQMPISAAVIVTTPQRLSTIDVEKGIVMFQNLKVPSVAVVENMA  514

Query  1244  HFDA-DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
              FD   G R+YPFG+    ++ +++ I H+F LPI    + S D G P V+         
Sbjct  515   FFDCIHGTRHYPFGRSHMQELAEKYSIEHMFQLPITQESAYSADHGKPFVLGGNDPNTVE  574

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSY----DRSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T++ L   + ++  ++R +   A  +     R I  ++       +E  +  A +R   R
Sbjct  575   TYKHLAEAIAREVVKLRHKALLAPEFLFNPARGI-LLRSYTSTHAKEITISAAQLRAQCR  633

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPYDQ  1744
              A+ V E++G+Q L  + +  +I P  I+  GNYA ++ W DG S     DQ
Sbjct  634   CAQCVDEFTGKQLLDITKISTEIVPTTIQRKGNYAYAVAWSDGHSASLYTDQ  685


 Score =   125 bits (313),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 7/160 (4%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDP-DFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMF  537
            N   E ++L  L Q+ D     +DIV+ G VK+  V  +L E S  L L  P   + D+ 
Sbjct  232  NALLEMDILSKLRQVPDQLGLKSDIVTLGRVKN--VQLSLQEKSVYLTLEAPNGALLDVA  289

Query  538  EQ---KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKS  708
            EQ    + E +  L W++++ +  +A+P       +    L+ +S IVAVSSCKGGVGKS
Sbjct  290  EQWKKDSMESLRELDWIQSLHIE-TARPKPKNLHAKRSSTLENVSEIVAVSSCKGGVGKS  348

Query  709  TVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
            TVAVNLAY+L   GARVGI DAD+YGPSLPTM++PE+R++
Sbjct  349  TVAVNLAYSLVQRGARVGILDADIYGPSLPTMINPEDRVV  388



>gb|EJY74228.1| ParA multi-domain protein [Oxytricha trifallax]
Length=501

 Score =   221 bits (564),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 178/284 (63%), Gaps = 7/284 (2%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFAGQGR-AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTG  1090
             + I+P  + GVK +S+GFA QG+ AIMRGP+ S +++QL+  T WGELDYLVID PPGTG
Sbjct  213   QMIVPVMFNGVKAMSYGFASQGKTAIMRGPIASNLVSQLIGNTNWGELDYLVIDFPPGTG  272

Query  1091  DIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG--K  1264
             DIQ+TL Q V L  AVIVTTPQKLA++DV KG+ MF  LKVP ++VVENM ++       
Sbjct  273   DIQITLGQEVTLKGAVIVTTPQKLAYVDVVKGIEMFDSLKVPTISVVENMSYYKCTSCET  332

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRG-EVASTFQELGV  1441
             ++  +G G   Q+ + FGI + F++PI   +S   D GTP V+  P   ++  T+Q++ +
Sbjct  333   KHKIYGAGYTNQLKENFGIKNSFEIPIMEEISQMSDQGTPFVLTLPESLDIVQTYQKMAL  392

Query  1442  CVVQQCARIRQ-QVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSG  1618
              V ++  R+ +     +V Y+    +I ++    D+   + P T+R   + A  + E++G
Sbjct  393   QVTEEVERLNKGSRPPSVRYEPKETSIIIEY-GEDKVKKIDPYTLRLKCKCAACIDEFNG  451

Query  1619  EQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQL  1747
              Q L+   VP+D+ P  I   GNYAV++ W DG  S I P+++L
Sbjct  452   MQILKVDKVPKDVYPTNIVQKGNYAVAVVWSDGHKSSIYPFERL  495


 Score =   123 bits (308),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 93/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
             + E+L+ L ++ D   G  I     +  L +    G V+ +L LT      K + + K 
Sbjct  58   GQEEILRCLRELKDEQ-GKQIDDKKLIHSLEIEPQSGTVNIKLNLTQDYRKAKSLIQDK-  115

Query  550  NEVVAALPWVKTVKVTMS--AQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
               + ++ WV  V V+M+  +Q AKP   G+   GL  + NI+AVSSCKGGVGKSTVAVN
Sbjct  116  ---LKSIDWVTKVNVSMAPQSQTAKPTHQGK--KGLTQVKNIIAVSSCKGGVGKSTVAVN  170

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPE  816
            LA+++  MG RVGIFDAD+YGPSLPTM+SPE
Sbjct  171  LAFSIYKMGYRVGIFDADLYGPSLPTMISPE  201



>emb|CCI45349.1| unnamed protein product [Albugo candida]
Length=463

 Score =   222 bits (566),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 171/285 (60%), Gaps = 13/285 (5%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDY  1060
              K  ++P E+ GVKL+SFGF  Q  A          MRGPMVS +I+QL+  T+WG LD+
Sbjct  160   NKGFVLPLEFHGVKLMSFGFVNQKAAPGAGGVGAAVMRGPMVSKLIDQLILATQWGSLDF  219

Query  1061  LVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM  1240
             L++DMPPGTGDIQ++L Q + ++AAVIVTTPQ+L+ IDV KG+ MF  LKVP VAVVENM
Sbjct  220   LIVDMPPGTGDIQMSLTQQMAISAAVIVTTPQRLSTIDVEKGIVMFQNLKVPSVAVVENM  279

Query  1241  CHFDA-DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVA  1417
               FD   G R+YPFG+     + +++ I H F LP+    + + D G P V+     +  
Sbjct  280   AFFDCIHGTRHYPFGESHMQDLAEKYLIEHAFQLPMTQESAFAADHGRPLVLGGKCSKTV  339

Query  1418  STFQELGVCVVQQCARIRQQVSTAVSYD-RSIKAIKVKVPNSDE--EFYLHPATVRRNDR  1588
              T++E+   + ++  R+R +   A      S + I ++   S E  E  L  A +R   R
Sbjct  340   ETYKEIAAAIAREVVRLRHKALLAPDLLFNSARGILLRSYTSTEAKEVTLSAAHLRAQCR  399

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFS  1723
              A+ + E++G+Q L  + +P DI P  I+  GNYA ++TW DG +
Sbjct  400   CAQCIDEFTGKQLLDGTKIPTDIVPTTIQRKGNYAYAVTWSDGHA  444


 Score =   119 bits (297),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  373  EAEVLKALAQIIDPD---FGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            E ++L  L Q+  PD     +DIV+ G VK++ V  +L E S  L L  P   + D+ EQ
Sbjct  2    EMDILSKLRQV--PDMLGLKSDIVTLGRVKNVKV--SLQEKSVMLTLEAPNGALLDVAEQ  57

Query  544  ---KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTV  714
                + + +  L W++++ +  + +P       +    L+ +S I+AVSSCKGGVGKSTV
Sbjct  58   WKTDSMKRLEELDWIQSLHID-AVRPKPKNLHAKRYSALENVSEIIAVSSCKGGVGKSTV  116

Query  715  AVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            AVNLAY+L   GARVGI DAD+YGPSLPTMV PE+R++ 
Sbjct  117  AVNLAYSLVQRGARVGILDADIYGPSLPTMVYPEDRVVR  155



>ref|XP_009838179.1| hypothetical protein H257_12605 [Aphanomyces astaci]
 gb|ETV72497.1| hypothetical protein H257_12605 [Aphanomyces astaci]
Length=514

 Score =   224 bits (571),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/316 (39%), Positives = 182/316 (58%), Gaps = 34/316 (11%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P EY GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  195   PVEYQGVQCMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGVLDYLVIDMP  254

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-  1255
             PGTGDI ++L Q V +T AVIVTTPQKL+F+DV KG+ MF  LKVP  AVVENM +FD  
Sbjct  255   PGTGDIHMSLAQQVAITTAVIVTTPQKLSFVDVEKGISMFEDLKVPTSAVVENMSYFDCV  314

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R+YPFG G    +  ++ IPH F LP+   ++ S D+G+P V++D    V + + +L
Sbjct  315   HGHRHYPFGHGYLTTLQSRYSIPHTFQLPMADAMNISVDTGSPVVLSDALPTVTAVYDDL  374

Query  1436  GVCVVQQCARIRQ--QVSTAVSYDRSI-KAIKVKVPNSDEEFYLHPATVRRNDRSAESVV  1606
                V Q+C +++   +V+  + +D++    ++    +S EE  L P  +R   R A+ + 
Sbjct  375   ATTVAQECVKLKHLARVAPELLFDKTRGMVLRFFSTDSAEEIVLSPVDLRARCRCAQCIE  434

Query  1607  EWSGEQKLQYSDVPEDIEPEEIRP--------------------MGNYAVSITWPDGF-S  1723
             E++G+Q L  + + EDI P  ++                      GNYA ++ W DG  S
Sbjct  435   EFTGKQILDPTTIQEDIRPTAVQRKVYKMDVACSCADDVGLFMLKGNYAFAVVWSDGHSS  494

Query  1724  QIAPYDQLQTIERLVE  1771
              +  ++ L+ + + V+
Sbjct  495   SLYTFEHLRQLAKEVQ  510


 Score =   116 bits (290),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EAEVL+ L  + D   G D+++ G VK+L +++    VS  ++  +P       +  +A 
Sbjct  34   EAEVLQTLKLVKDDLVGQDLITLGRVKNLEISDEHA-VSCTIDSPSPVLLQNQEWITQAT  92

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + + AL WV    V +S  P            L  + NI+AVSSCKGGVGKSTVAVNLA+
Sbjct  93   DRIKALSWVTGANVALS-HPTPRNIQATRSSSLANVGNIIAVSSCKGGVGKSTVAVNLAF  151

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPY  852
             L   GARVGI DAD+YGPSLPTM+SP +  +   T  P+
Sbjct  152  ALKKRGARVGILDADIYGPSLPTMISPPDVAIRKSTVNPH  191



>gb|ETP32735.1| hypothetical protein, variant 3 [Phytophthora parasitica P10297]
Length=450

 Score =   208 bits (530),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 166/272 (61%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  425   CAQCIDEFTGEQVLLR---------DEIKPFG  447


 Score =   127 bits (320),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETI34747.1| hypothetical protein, variant 3 [Phytophthora parasitica P1569]
Length=450

 Score =   208 bits (530),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 168/272 (62%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  425   CAQCIDEFTGEQVLLR---------DEIKPFG  447


 Score =   127 bits (320),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETK75044.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETL28465.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETM34926.1| hypothetical protein, variant 3 [Phytophthora parasitica]
 gb|ETP04598.1| hypothetical protein, variant 3 [Phytophthora parasitica CJ01A1]
Length=450

 Score =   208 bits (530),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 168/272 (62%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  425   CAQCIDEFTGEQVLLR---------DEIKPFG  447


 Score =   127 bits (320),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETL81720.1| hypothetical protein, variant 3 [Phytophthora parasitica]
Length=450

 Score =   206 bits (525),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 167/272 (61%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  425   CAQCIDEFTGEQVLLR---------DEIKPFG  447


 Score =   127 bits (320),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>ref|XP_008913550.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
 gb|ETN01223.1| hypothetical protein, variant 3 [Phytophthora parasitica INRA-310]
Length=450

 Score =   206 bits (524),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 167/272 (61%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  366   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  424

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  425   CAQCIDEFTGEQVLLR---------DEIKPFG  447


 Score =   127 bits (320),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>tpg|DAA38717.1| TPA: hypothetical protein ZEAMMB73_922984 [Zea mays]
Length=233

 Score =   271 bits (692),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            A+ +VL AL+QIIDPDFGTDIVSCGF+KDL V+EAL EVSFRLELTTPACPIKD FEQKA
Sbjct  75   AKKDVLIALSQIIDPDFGTDIVSCGFIKDLEVSEALEEVSFRLELTTPACPIKDEFEQKA  134

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            NEVVAALPWVK V VTMSAQPA+PV+ G+LP GLQ ISNI+AVSSCKGGVGKSTVAVNLA
Sbjct  135  NEVVAALPWVKKVDVTMSAQPAQPVYGGELPEGLQKISNIIAVSSCKGGVGKSTVAVNLA  194

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            YTLA MGARVGIFDADV+GPSLPTMVSPENRLL MV
Sbjct  195  YTLAGMGARVGIFDADVFGPSLPTMVSPENRLLVMV  230



>ref|XP_001007903.1| hypothetical protein TTHERM_00538790 [Tetrahymena thermophila]
 gb|EAR87658.1| CobQ/CobB/MinD/ParA nucleotide-binding domain protein [Tetrahymena 
thermophila SB210]
Length=508

 Score =   218 bits (556),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 171/284 (60%), Gaps = 8/284 (3%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             K I+P EY G+K +S+GFA + +AI+RGPMVS ++ QL   T+WG+LDYL++DMPPGTGD
Sbjct  205   KEILPIEYEGLKTMSYGFA-RKKAIIRGPMVSAIVTQLAMQTQWGDLDYLIVDMPPGTGD  263

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF--DADGKR  1267
             IQ+TLCQ +    AV+VTTPQKLAF+DV KG+ MF +LKVP +AVVENMC F  D  GK 
Sbjct  264   IQITLCQEIKFDGAVVVTTPQKLAFVDVIKGIEMFDELKVPTLAVVENMCLFVCDGCGKE  323

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADP-RGEVASTFQELGVC  1444
             ++PFG G    +  QFGI     +PI   ++   D G P  +  P    +   +  L   
Sbjct  324   HHPFGPGYMNMLKNQFGIQSSVQIPIYDMIAKYSDYGRPVSITLPDEHTITKIYSSLAEN  383

Query  1445  VVQQCARIRQQVST--AVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSG  1618
             V Q+  +++   +    V Y      + V+  N+ E   +    +R++   A  V E++G
Sbjct  384   VHQEILKLQNGNNEPPIVRYQTGNSLVIVE-KNNGEIKKMKADVLRKHCNCALCVDEFTG  442

Query  1619  EQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQL  1747
             ++ ++   +  ++ P +I P GNYAV+I W DG  S I PYD L
Sbjct  443   KRLIKDDTIDNEVYPYKIEPKGNYAVAIIWSDGHRSSIYPYDTL  486


 Score =   114 bits (285),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 100/158 (63%), Gaps = 12/158 (8%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            Q  +AE+ K L +I   D G++I+  G +  + + E+ G+V+ +L+L      +K +   
Sbjct  51   QEGKAEITKKLKEITFED-GSNIIDNGSILTIDI-ESSGKVTVQLKLDQNYRKLKGLCNA  108

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFA--GQLPPGLQTISNIVAVSSCKGGVGKSTVA  717
            K  E+    PW+K  ++ M+ +  +  F   GQL    + +  I+AVSSCKGGVGKSTVA
Sbjct  109  KLQEI----PWIKEFEIKMAPKDQETSFKKRGQL----ENVKKIIAVSSCKGGVGKSTVA  160

Query  718  VNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLE  831
            +NLA++L   G +VGIFDAD+YGPS+PT+++ EN +L+
Sbjct  161  INLAFSLLKQGHKVGIFDADIYGPSIPTLINKENAILQ  198



>emb|CBN74480.1| conserved unknown protein [Ectocarpus siliculosus]
Length=650

 Score =   210 bits (534),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 182/302 (60%), Gaps = 24/302 (8%)
 Frame = +2

Query  905   PEKKTIIPTEYLGVKLVSFGF----------AGQGRAIMRGPMVSGVINQLLTTTEWGEL  1054
             P+   + P  + GV  +SFG+           G G A+MRGPMVS VINQLL  T+WGEL
Sbjct  349   PDLNLLSPIIHRGVACMSFGWVNAKAGVPGAGGHGAAVMRGPMVSKVINQLLLGTDWGEL  408

Query  1055  DYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVE  1234
             +YL+IDMPPGTGDIQ+TL Q + ++ AV+VTTPQKL+++DV KG+ MF+++KVP ++VVE
Sbjct  409   EYLIIDMPPGTGDIQITLGQALQMSGAVVVTTPQKLSYVDVVKGIDMFAEIKVPVLSVVE  468

Query  1235  NMCHFD-ADGKRYYPFGKGSGAQVVQQFGIPH--LFDLPIRPTLSASGDSGTPEVVADPR  1405
             NM +FD ++G+R+ PFG G   ++V++ G+    +F LP+ P ++   D G P  ++ P 
Sbjct  469   NMAYFDCSNGERHRPFGPGHARELVEECGLASGCVFSLPLSPAVARGSDCGDPVSLSSPD  528

Query  1406  GEVASTFQELGVCVVQQCARIRQQVSTA--VSYDRSIKAIKVKVPNSDE--EFYLHPATV  1573
             GE A  +  L   VV++  R  +  +    VS+ +S + I ++  +  E  EF + P  +
Sbjct  529   GEEAKVYLSLADGVVRETFRAGKTAADVPEVSF-KSGRGIVLRYISEAEAAEFVIPPFEL  587

Query  1574  RRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQ  1750
             R  D +    +  + EQ    SD   D+EP  I   GNYAVSI+W DG    I  Y  L+
Sbjct  588   RTRDPATGEPL--ASEQAAAVSD---DVEPVNISVRGNYAVSISWSDGHRGAIYSYQVLR  642

Query  1751  TI  1756
              I
Sbjct  643   KI  644


 Score =   120 bits (302),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 77/210 (37%), Positives = 109/210 (52%), Gaps = 47/210 (22%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEAL---------GE--------VS  489
             Q  E EVL  L+ +++P  G D+V  GFV+D+ ++E +         GE        +S
Sbjct  140  RQEKEEEVLAILSGVVEPCTGKDVVELGFVQDVRIDEVVHGEQPQDNTGEDSAEAPLAIS  199

Query  490  FRLELTTPACPIKDMFEQKANEVVAALPWVKTVK-------------VTMSAQPA----K  618
            F L + T A P +D    +    + ALPWV +               V   + P     +
Sbjct  200  FTLRVPTLALPGRDTLASECEAALLALPWVASANALTKVRRPRWRRTVQRRSTPGSILNR  259

Query  619  PVFAGQLP-------------PGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARV  759
             V     P             PGL+++ ++V VSSCKGGVGKSTVAVNLAY+LA  GA+V
Sbjct  260  SVGTETTPGGGGGGGGGGAPSPGLESVQDVVCVSSCKGGVGKSTVAVNLAYSLASRGAKV  319

Query  760  GIFDADVYGPSLPTMVSPENRLLEMVTSVP  849
            G+ DADVYGPSLPT+V+P++  L +  + P
Sbjct  320  GLLDADVYGPSLPTLVNPDDVALRVSPAFP  349



>emb|CDW89606.1| protein mrp homolog [Stylonychia lemnae]
Length=497

 Score =   208 bits (530),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/282 (41%), Positives = 171/282 (61%), Gaps = 7/282 (2%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGR-AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI  1096
             I P E+ GVK +S+GFA QG+ AIMRGP+ S +++QL+  T WG++DYLVID PPGTGDI
Sbjct  207   IAPIEFNGVKAMSYGFASQGKSAIMRGPIASNLVSQLIGNTNWGDMDYLVIDFPPGTGDI  266

Query  1097  QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG--KRY  1270
             Q+TL Q + +  AVIVTTPQKL+++DV KG+ MF  LKVP ++VVENM ++       ++
Sbjct  267   QITLGQEITIKGAVIVTTPQKLSYVDVVKGIEMFDSLKVPTISVVENMSYYKCTNCETKH  326

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRG-EVASTFQELGVCV  1447
               +G G   Q+   FGI + F++PI   +S   D GTP V+  P   E+  T+ ++   V
Sbjct  327   KIYGLGYTNQLKTNFGIKNSFEIPIMEEISQMSDQGTPFVLTLPDSLELVQTYNQIARQV  386

Query  1448  VQQCARIRQQVST-AVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQ  1624
             V +   + +      V YD +  +I V   + D+  ++ P  +R   + A  + E  G Q
Sbjct  387   VNEVDTLNKGYQAPNVVYDPTKGSIIVN-HSGDKVKHVDPYELRIKCKCAGCIDEIDGRQ  445

Query  1625  KLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQL  1747
              L+   VP+D+ P  I   GNYAV++ W DG  S I P++++
Sbjct  446   ILKIDKVPKDVYPTNIVQKGNYAVAMVWSDGHKSSIYPFERI  487


 Score =   117 bits (294),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 9/151 (6%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
             + E+++ L ++ D   G  I        L +    G V+ +L LT      K + + K 
Sbjct  50   GKDEIMRVLRELKDEQ-GKPIEEFKVFHSLEIGPEPGVVNIKLNLTQDYRKAKQLIQDK-  107

Query  550  NEVVAALPWVKTVKVTMS--AQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
               + ++ WV  V V M+  AQ AKP   G+   GLQ + NI+AVSSCKGGVGKSTVAVN
Sbjct  108  ---LKSVDWVTKVNVQMAPQAQTAKPTHQGK--KGLQGVKNIIAVSSCKGGVGKSTVAVN  162

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPE  816
            LA+++  +G RVGIFDAD+YGPSLPTM+SP+
Sbjct  163  LAFSMYKLGLRVGIFDADLYGPSLPTMISPD  193



>gb|ETP32734.1| hypothetical protein, variant 2 [Phytophthora parasitica P10297]
Length=477

 Score =   209 bits (531),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 166/272 (61%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  452   CAQCIDEFTGEQVLLR---------DEIKPFG  474


 Score =   114 bits (285),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVGYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETI34746.1| hypothetical protein, variant 2 [Phytophthora parasitica P1569]
Length=477

 Score =   209 bits (531),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 168/272 (62%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  452   CAQCIDEFTGEQVLLR---------DEIKPFG  474


 Score =   113 bits (283),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETK75043.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETL28464.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETM34925.1| hypothetical protein, variant 2 [Phytophthora parasitica]
 gb|ETP04597.1| hypothetical protein, variant 2 [Phytophthora parasitica CJ01A1]
Length=477

 Score =   208 bits (530),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 168/272 (62%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  452   CAQCIDEFTGEQVLLR---------DEIKPFG  474


 Score =   113 bits (283),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|XP_008913549.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
 gb|ETN01222.1| hypothetical protein, variant 2 [Phytophthora parasitica INRA-310]
Length=477

 Score =   206 bits (525),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 167/272 (61%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  452   CAQCIDEFTGEQVLLR---------DEIKPFG  474


 Score =   113 bits (283),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETL81719.1| hypothetical protein, variant 2 [Phytophthora parasitica]
Length=477

 Score =   206 bits (525),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/272 (43%), Positives = 167/272 (61%), Gaps = 24/272 (9%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
             T+  L   V ++   ++  V  A  + YD  R I  +++   N  +E  LHPA +R   R
Sbjct  393   TYDSLATTVAKELVVLKHNVRLAPELLYDTNRGI-VLRLYSLNEAKEAVLHPADLRAQCR  451

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMG  1684
              A+ + E++GEQ L           +EI+P G
Sbjct  452   CAQCIDEFTGEQVLLR---------DEIKPFG  474


 Score =   113 bits (282),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|XP_626042.1| MRP like MinD family ATpase [Cryptosporidium parvum Iowa II]
 gb|EAK88253.1| MRP like MinD family ATpase [Cryptosporidium parvum Iowa II]
Length=611

 Score =   164 bits (414),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 97/318 (31%), Positives = 165/318 (52%), Gaps = 35/318 (11%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFAGQGRA----------IMRGPMVSGVINQLLTTTEWGE  1051
             N  ++  IP  Y GV+L+S+ +    ++          I+RGP+   ++ QL+T T W +
Sbjct  278   NNLREGFIPLIYKGVQLISYSYLLNTKSDSNSSSKVSSILRGPIAGSIVTQLITGTVWED  337

Query  1052  LDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVV  1231
             LDYLV+D PPGTGDIQL++ Q + +  A+IVTTPQ L+  DV +G+ +F+KL +P + VV
Sbjct  338   LDYLVLDFPPGTGDIQLSIAQSIAIDGAIIVTTPQDLSIADVERGIHLFNKLNIPILTVV  397

Query  1232  ENMCHFDADG--KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSA------SGDSGTPE  1387
             ENM +F  DG  KR+  F KG  + + +++G+   F+ P+   LS       S +   P 
Sbjct  398   ENMSYFICDGCEKRHEIFSKGDFSLITEKYGLEPNFNFPLFSNLSKCKFHSNSNEVDFPY  457

Query  1388  VVADPRGE-VASTFQELGVCVVQQCARIR-QQVSTAVSYDRSIKAIKVKVPNSDEEFYLH  1561
             V+A  + + V   F +L   + ++ ++ R         +D + K +  ++P   +E ++ 
Sbjct  458   VIAANKNDSVYLEFVKLSEFIARKLSKNRYSDYKPNFEFDNNRKIVICQIPKDIKEIFVQ  517

Query  1562  PAT-------------VRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSI  1702
               T             +R+  R A  +    G+ +   +  P  +  ++I  MG+YA+ I
Sbjct  518   ENTIDPLVKFNVSYIDIRKLCRCA--ICYDPGKARFNETYEPSTLLIDQIETMGSYAIMI  575

Query  1703  TWPDGFSQIAPYDQLQTI  1756
              W DG + I  Y+ L  I
Sbjct  576   NWSDGHTSIISYNNLIKI  593


 Score =   154 bits (390),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 107/155 (69%), Gaps = 4/155 (3%)
 Frame = +1

Query  364  QTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQ  543
            +    E+L +L+++IDPD   DIVSCGFVKDL  +    EVSF LELTTP CP+KD+FE+
Sbjct  88   EDKRNEILLSLSKVIDPDLNKDIVSCGFVKDLYFDPESSEVSFTLELTTPICPLKDLFEK  147

Query  544  KANEVVA-ALPWVKTVKVTMSAQPAKP---VFAGQLPPGLQTISNIVAVSSCKGGVGKST  711
               E++     +VK V +  +++ +K    +   +    L+ +SNI+A+SSCKGGVGKST
Sbjct  148  SCTEIIKNDRIYVKEVNIKFTSKSSKKNQIISKEKTHKNLEAVSNIIAISSCKGGVGKST  207

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPE  816
            +AVN+A+TL+ +GA+VGI D D+YGP+L  +V  E
Sbjct  208  LAVNIAFTLSQLGAKVGIVDCDLYGPNLEQLVPME  242



>ref|XP_001429812.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK62414.1| unnamed protein product [Paramecium tetraurelia]
Length=473

 Score =   206 bits (524),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 173/288 (60%), Gaps = 8/288 (3%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFA-GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTG  1090
             K I+P E+ GVK +S+G+A G  +AI+RGPMVS ++ QL+  T+W  LDYLV+DMPPGTG
Sbjct  182   KEILPIEFNGVKTMSYGYASGNQKAIIRGPMVSSIVVQLVQQTQWQNLDYLVVDMPPGTG  241

Query  1091  DIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---DADG  1261
             DIQ++LCQ +    AVIVTTPQ+L+FIDV KG+ MF  LKVP ++VVENM  +   D + 
Sbjct  242   DIQISLCQELNFDGAVIVTTPQRLSFIDVVKGIEMFDVLKVPTLSVVENMAEYVCPDCN-  300

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGE-VASTFQELG  1438
               + PFG+G    + +QFGI     +P+   +S   D G+P V+  P    + + +++L 
Sbjct  301   HVHRPFGQGYMNMLQKQFGIATAVSIPLYGDISKYSDLGSPVVLTLPEDHTINNIYRQLA  360

Query  1439  VCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSG  1618
               VV + +R     +  V YD   + I ++  +  E+  +    +R     A  V E++G
Sbjct  361   NNVVHELSRSDLTKTPTVRYDTGKRVIIIRDFDGKEK-PIKSVELRSKCNCALCVDEFTG  419

Query  1619  EQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTIE  1759
              +  Q   + +++ P +I P GNYAV+I W DG  S I PY +L + E
Sbjct  420   RRLNQNQQLDQEVYPYKIEPKGNYAVAIVWSDGHRSSIYPYKRLWSDE  467


 Score =   110 bits (276),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 93/159 (58%), Gaps = 9/159 (6%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            N+  + ++L  L QI   D   DIVS G+V++L +++  G V   L+L      +K +  
Sbjct  22   NEEYKIQILNRLKQIKHSDSHKDIVSNGYVENLSIDQD-GRVIIDLKLDQDYRKMKAL--  78

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAG---QLPPGLQTISNIVAVSSCKGGVGKST  711
               ++ +    W+K + + M A   + VF     Q    LQ +  I+AVSSCKGGVGKST
Sbjct  79   --CSDALKQFEWIKNLDIRM-APKKENVFTQANTQKRGNLQNVKKIIAVSSCKGGVGKST  135

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
            +A+NL ++L  +G  VGIFDADVYGPSLPT++  E + L
Sbjct  136  IALNLTFSLQKLGFNVGIFDADVYGPSLPTLIGKEKQQL  174



>gb|ETI34749.1| hypothetical protein, variant 5 [Phytophthora parasitica P1569]
Length=402

 Score =   185 bits (470),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  366   TYDSLAT-TVSPCATGR------VKYNRA  387


 Score =   128 bits (321),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETK75046.1| hypothetical protein, variant 5 [Phytophthora parasitica]
 gb|ETL28467.1| hypothetical protein, variant 5 [Phytophthora parasitica]
 gb|ETM34928.1| hypothetical protein, variant 5 [Phytophthora parasitica]
 gb|ETP04600.1| hypothetical protein, variant 5 [Phytophthora parasitica CJ01A1]
Length=402

 Score =   186 bits (471),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  366   TYDSLAT-TVSPCATGR------VKYNRA  387


 Score =   128 bits (321),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETP32737.1| hypothetical protein, variant 5 [Phytophthora parasitica P10297]
Length=402

 Score =   185 bits (470),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 134/209 (64%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  366   TYDSLAT-TVSPCATGR------VKYNRA  387


 Score =   128 bits (321),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>ref|XP_009838182.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 ref|XP_009838183.1| hypothetical protein, variant 3 [Aphanomyces astaci]
 ref|XP_009838184.1| hypothetical protein, variant 4 [Aphanomyces astaci]
 ref|XP_009838185.1| hypothetical protein, variant 5 [Aphanomyces astaci]
 gb|ETV72499.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV72500.1| hypothetical protein, variant 3 [Aphanomyces astaci]
 gb|ETV72501.1| hypothetical protein, variant 4 [Aphanomyces astaci]
 gb|ETV72502.1| hypothetical protein, variant 5 [Aphanomyces astaci]
Length=426

 Score =   197 bits (500),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 144/230 (63%), Gaps = 13/230 (6%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P EY GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  195   PVEYQGVQCMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGVLDYLVIDMP  254

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-  1255
             PGTGDI ++L Q V +T AVIVTTPQKL+F+DV KG+ MF  LKVP  AVVENM +FD  
Sbjct  255   PGTGDIHMSLAQQVAITTAVIVTTPQKLSFVDVEKGISMFEDLKVPTSAVVENMSYFDCV  314

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R+YPFG G    +  ++ IPH F LP+   ++ S D+G+P V++D    V + + +L
Sbjct  315   HGHRHYPFGHGYLTTLQSRYSIPHTFQLPMADAMNISVDTGSPVVLSDALPTVTAVYDDL  374

Query  1436  GVCVVQQCARIRQ--QVSTAVSYDRSI-KAIKVKVPNSDEEFYLHPATVR  1576
                V Q+C +++   +V+  + +D++    ++    +S EE  L P  +R
Sbjct  375   ATTVAQECVKLKHLARVAPELLFDKTRGMVLRFFSTDSAEEIVLSPVDLR  424


 Score =   116 bits (290),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EAEVL+ L  + D   G D+++ G VK+L +++    VS  ++  +P       +  +A 
Sbjct  34   EAEVLQTLKLVKDDLVGQDLITLGRVKNLEISDE-HAVSCTIDSPSPVLLQNQEWITQAT  92

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + + AL WV    V +S  P            L  + NI+AVSSCKGGVGKSTVAVNLA+
Sbjct  93   DRIKALSWVTGANVALS-HPTPRNIQATRSSSLANVGNIIAVSSCKGGVGKSTVAVNLAF  151

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPY  852
             L   GARVGI DAD+YGPSLPTM+SP +  +   T  P+
Sbjct  152  ALKKRGARVGILDADIYGPSLPTMISPPDVAIRKSTVNPH  191



>ref|WP_018287819.1| mrp [zeta proteobacterium SCGC AB-133-G06]
Length=356

 Score =   159 bits (403),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 110/146 (75%), Gaps = 6/146 (4%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            AEA++LKAL+ IIDPDF  DIV+ GFVK++ +N+  G V+F +ELTTPACPIK+ F ++A
Sbjct  3    AEADILKALSGIIDPDFNKDIVTLGFVKNIAIND--GVVAFTIELTTPACPIKEEFRRQA  60

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +E V+ALP V  V +TM+A+    +  G+    +  ++NI+AV+S KGGVGKST AVNLA
Sbjct  61   DEAVSALPGVNEVNITMTAK----MTPGRSKEAISGVANIIAVASGKGGVGKSTTAVNLA  116

Query  730  YTLADMGARVGIFDADVYGPSLPTMV  807
              +A  GARVG+ DAD+YGPS+P M+
Sbjct  117  VAMAQTGARVGLLDADIYGPSVPRMM  142


 Score =   152 bits (385),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 114/194 (59%), Gaps = 4/194 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +KKT  P E  GVK +S G+  +    M  RGPMVSG ++QLLT   WGELDYL +DMPP
Sbjct  154   DKKTFYPLENYGVKTISIGYLVEENQAMIWRGPMVSGALSQLLTDVLWGELDYLFVDMPP  213

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD+QLTL Q VP+T AV+VTTPQ +A +D  KG+ MF K  V  + +VENM  F    
Sbjct  214   GTGDVQLTLTQKVPVTGAVMVTTPQDIALLDCRKGIEMFKKAGVTTLGIVENMSQFICPH  273

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G+    F +G   ++ Q++    L  +P+  ++    D GTP V A P  E A+ +  L
Sbjct  274   CGESSPIFAEGGADRLSQEYNTSVLAHIPLDISIREKSDEGTPIVAAAPDSEQANVYHAL  333

Query  1436  GVCVVQQCARIRQQ  1477
                V ++ + +  +
Sbjct  334   AGEVARKISILNSR  347



>ref|XP_008913552.1| hypothetical protein, variant 5 [Phytophthora parasitica INRA-310]
 gb|ETN01225.1| hypothetical protein, variant 5 [Phytophthora parasitica INRA-310]
Length=402

 Score =   183 bits (465),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 135/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  366   TYDSLAT-TVSPCATGR------VKYNRA  387


 Score =   127 bits (320),  Expect(2) = 5e-75, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|ETL81722.1| hypothetical protein, variant 5 [Phytophthora parasitica]
Length=402

 Score =   183 bits (465),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 135/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  186   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  245

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  246   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  305

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  306   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  365

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  366   TYDSLAT-TVSPCATGR------VKYNRA  387


 Score =   127 bits (320),  Expect(2) = 6e-75, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKA  549
            E +VL+ L  + D     DIVS G VK+L V    G+VS ++E  +PA   +   ++++A
Sbjct  28   ETQVLEKLRGVSDGLGLGDIVSLGRVKELRVVPEAGKVSCKIETPSPALMELAQQWQKEA  87

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
               V  L WVK     +S    +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA
Sbjct  88   ELAVNKLDWVKDTDFEISKSRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLA  146

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            ++LA  GARVGI DAD+YGPSLPTMVSPE+
Sbjct  147  FSLAKRGARVGILDADIYGPSLPTMVSPED  176



>gb|EJK67207.1| hypothetical protein THAOC_11789, partial [Thalassiosira oceanica]
Length=605

 Score =   170 bits (431),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 106/297 (36%), Positives = 151/297 (51%), Gaps = 64/297 (22%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFAGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             + I P +   V L+SFG+  +G A+MRGPMV+ +++Q L+ T WG LDYL++DMPPGTGD
Sbjct  312   RQIQPLKRNDVALMSFGYVNEGSAVMRGPMVTQLLDQFLSLTNWGALDYLILDMPPGTGD  371

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRYY  1273
             IQLTL Q + + AAVIVTTPQ+L+F+DV +GV MF  + VPCVAVVENM + +A+     
Sbjct  372   IQLTLTQKLNIDAAVIVTTPQELSFVDVERGVEMFDTVNVPCVAVVENMAYLEAETSTEV  431

Query  1274  PF--------------GKGSGAQVVQQ---------------------------------  1312
                             G+ S AQ   Q                                 
Sbjct  432   ELDETLLEEKFVEALDGRVSDAQNSSQVQTLAKDLVKLVQANISKENRKGTEEIRIFGKG  491

Query  1313  --------FGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQCARI  1468
                     +GI H + +P+   ++ +GDSGTP ++ +P    A  + +L   VV + A+ 
Sbjct  492   HKRRLSEQWGIEHTYSVPLLGKIAENGDSGTPFILQNPESPQAEIYAQLAKSVVSEVAKT  551

Query  1469  RQQVST--AVSYDRSIKAIKVKVPNSDEE---FYLHPATVRRNDRSAESVVEWSGEQ  1624
             +   +   AVSYD    +I +     D E     + PA +RR  R A  V E +GEQ
Sbjct  552   KYMNTGRPAVSYDEEKHSIVI----DDGEKGVSNISPANLRRACRCASCVEELTGEQ  604


 Score =   140 bits (353),  Expect(2) = 8e-75, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 100/144 (69%), Gaps = 3/144 (2%)
 Frame = +1

Query  412  PDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVK  591
            PD   + +    V +L V+++   VSF LELTTPACP+K+ F +   +V+ +L W +  +
Sbjct  168  PDDWQNQILVRVVTNLRVDDSF-IVSFDLELTTPACPVKEEFVKACQDVINSLEWSRGAE  226

Query  592  VTMSAQPAKPV--FAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGI  765
            VT++AQ A P   FA  +P G+  I +++AVSSCKGGVGKST +VNLA+ L  +GARVGI
Sbjct  227  VTLTAQEAAPTSPFATNVPLGMSQIGSVIAVSSCKGGVGKSTTSVNLAFALQSLGARVGI  286

Query  766  FDADVYGPSLPTMVSPENRLLEMV  837
            FD D+YGPSLPTMV+P++  +  V
Sbjct  287  FDVDLYGPSLPTMVTPDDDDVRFV  310



>emb|CDM64485.1| ATPase involved in chromosome partitioning [Pyrinomonas methylaliphatogenes]
Length=360

 Score =   166 bits (420),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 122/189 (65%), Gaps = 4/189 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             ++  ++P E  GV+++S      G    I+RGP++ G++ Q L    WGELDYL++DMPP
Sbjct  157   DRNKLLPIEAYGVRMISMALIKPGDEPMIVRGPILHGLVRQFLQDVAWGELDYLIVDMPP  216

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA--  1255
             GTGD+QL+L Q+VP+  AV+VTTPQ+++  DV++ +RMF  + VP + +VENM +F A  
Sbjct  217   GTGDVQLSLAQLVPVQGAVLVTTPQEVSLADVSRALRMFETVAVPILGIVENMSYFIAPD  276

Query  1256  DGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G RY  FG+G G ++ +++G+P L ++P+   +  SGD G P V+A P    A  F+ +
Sbjct  277   TGARYQIFGEGGGRRLAERYGVPFLGEIPLGIEVRESGDRGVPVVIAHPNSPQAQAFKRV  336

Query  1436  GVCVVQQCA  1462
                V +Q +
Sbjct  337   AEEVARQVS  345


 Score =   143 bits (360),  Expect(2) = 2e-74, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 99/150 (66%), Gaps = 3/150 (2%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            N  +E  VL AL QI DPD   DIV+ GF++DL +    GEVSFR+ LTTPACP+K+   
Sbjct  2    NLLSEESVLNALRQIKDPDLHKDIVTLGFIRDLRIEG--GEVSFRIVLTTPACPVKEQMR  59

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
            + A E V+ LP V+ V VTM A+  +    G     L  + NI+AVSS KGGVGKSTVAV
Sbjct  60   EAAIEAVSKLPGVERVNVTMDAEVPRGRGIGNRAT-LPGVRNIIAVSSGKGGVGKSTVAV  118

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVS  810
            NLA  LA   ARVG+ DAD+YGP++P M+ 
Sbjct  119  NLAVALALRQARVGLLDADIYGPNVPLMLG  148



>gb|EQB62938.1| Protein mrp-like protein [candidate division ZIXI bacterium RBG-1]
Length=462

 Score =   166 bits (421),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 103/294 (35%), Positives = 149/294 (51%), Gaps = 12/294 (4%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF--AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             E   IIP E  GVK++S GF        + RGPM+   + Q L   EWGELDYL++D+PP
Sbjct  155   EGNRIIPAEEHGVKIMSMGFFIHPNEAVVWRGPMLHKTVEQFLGNVEWGELDYLIVDLPP  214

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD+QL+LCQ++PLT A IV+TPQ +A     K + MF+KL  P + ++ENM  F    
Sbjct  215   GTGDVQLSLCQIIPLTGAAIVSTPQDVALQVAEKAIVMFNKLNTPILGLIENMSGFVCRH  274

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G+R   FG G   +   +  IP L  +P+   +  + DSG P V+ADP    A  F  +
Sbjct  275   CGEREEIFGAGGVREYSLRHEIPFLGAIPLDTRVRENSDSGEPTVIADPDSPSAQAFMLV  334

Query  1436  GVCVVQQCARIRQQVSTAVS------YDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAE  1597
                +  Q +      ST             I  +++   +  E  Y     +R   + A 
Sbjct  335   AQNLAAQVSIRNMGGSTGGRPAPKEITQPEIGKVRILWKDGHESVY-SGQQLRLACQCAV  393

Query  1598  SVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQ-IAPYDQLQTI  1756
              V E +G+QKL    +  +I P   +P+G YA+   W DG S  I  +D L+ +
Sbjct  394   CVDEATGKQKLNPEKIQPNIFPVSTQPVGQYAIRFHWSDGHSTGIYAFDYLRAL  447


 Score =   139 bits (350),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLV-NEALGEVSFRLELTTPACPIKDMFEQ  543
            T EA++L+AL ++ DPD G +IV  GFVK+L + NE    VSF +ELTTPACP+KD  ++
Sbjct  2    TTEAQILEALKKVHDPDLGKNIVELGFVKNLKIENET---VSFTIELTTPACPVKDKLKE  58

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +A + V A+  +K V V M+A+  +P  + Q    L  + NI+ V+S KGGVGKSTV+ N
Sbjct  59   EAKQAVLAVDGIKNVNVEMTAK-VRPTLSQQKTNLLPQVKNIIPVASGKGGVGKSTVSAN  117

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVS  810
            LA  L  MGA+VG+ D DVYGPS+P ++ 
Sbjct  118  LALVLVKMGAKVGLLDVDVYGPSIPLIMG  146



>ref|WP_009850360.1| mrp [Mariprofundus ferrooxydans]
 gb|EAU54750.1| mrP protein [Mariprofundus ferrooxydans PV-1]
Length=358

 Score =   155 bits (392),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 107/148 (72%), Gaps = 5/148 (3%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK  546
            T EA VLKAL+QIIDPDFG DIVS GFVKD+ ++ +   VSF +ELTTPACP+K+ F ++
Sbjct  2    TTEAAVLKALSQIIDPDFGKDIVSLGFVKDVKIDGS--SVSFTIELTTPACPVKEEFRRQ  59

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
            A+E V AL  ++ V V M+++    +      PG   I+NI+A++S KGGVGKST +VNL
Sbjct  60   ADEAVMALTGIERVHVNMTSRVTAGISDKLAIPG---IANIIAIASGKGGVGKSTTSVNL  116

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVS  810
            A  +A  GARVG+ DAD+YGPS+P M+ 
Sbjct  117  AVAMAQTGARVGLLDADIYGPSVPRMMG  144


 Score =   150 bits (378),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 82/194 (42%), Positives = 116/194 (60%), Gaps = 4/194 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             E KTI P E  GVK +S G+  +    M  RGPMV+G + QLL    WGELDYL +DMPP
Sbjct  155   EGKTIYPLENYGVKTMSIGYLVEENKAMIWRGPMVAGALGQLLGDVAWGELDYLFVDMPP  214

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD QLTL Q VP+T AV+VTTPQ +A +D  KG+ MF+++ VP + +VENM  F    
Sbjct  215   GTGDAQLTLTQKVPVTGAVMVTTPQDIALLDCRKGIDMFNEVHVPTLGIVENMSQFICPH  274

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G+    F +G   ++ Q++    L  +P+   +    DSGTP V A P  E A  +++L
Sbjct  275   CGESSPIFAEGGADRLAQEYKTGVLAHIPLDMRIRELSDSGTPVVAALPDSEQAVAYRQL  334

Query  1436  GVCVVQQCARIRQQ  1477
                + ++ + I ++
Sbjct  335   AGEIARKISIINRR  348



>ref|WP_018048831.1| hypothetical protein [Nitrospina sp. AB-629-B18]
Length=364

 Score =   174 bits (440),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = +2

Query  926   PTEYLGVKLVSFGF-AGQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQ  1099
             P E  G+K+VS  F   +G  +M RGPM+ G+I Q L   EWGELDYLVID+PPGTGD+Q
Sbjct  163   PHEQYGLKVVSAAFLQKEGVPLMLRGPMLGGIIQQFLQNVEWGELDYLVIDLPPGTGDVQ  222

Query  1100  LTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG--KRYY  1273
             LTL Q  P++ AV+VTTPQ+++ ID AKGVRMF  +KVP + +VENM HF  DG  K+++
Sbjct  223   LTLTQRAPISGAVVVTTPQEVSLIDAAKGVRMFETVKVPLLGIVENMSHFICDGCDKKHH  282

Query  1274  PFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQ  1453
              F  G G  +  +F IP L ++P+   +   GD G P ++ADP       ++EL   V  
Sbjct  283   IFKSGGGNTLAGKFKIPFLTEIPLMGGVVEGGDKGVPIIMADPTSPATKAYKELAGQVAA  342

Query  1454  QCARIR  1471
             Q + I 
Sbjct  343   QLSIIH  348


 Score =   129 bits (325),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 98/150 (65%), Gaps = 5/150 (3%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            +Q  +  V+  L  +IDPD   DIVS GFVK++ + +  G+V F++ELTTPACP+K+  +
Sbjct  3    DQDLQVSVIAQLKTVIDPDLHKDIVSLGFVKNMNIKD--GKVKFQVELTTPACPVKEQLK  60

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAV  720
             +    V+A+  VK+V V M+A+      A    P L  + NI+AV+S KGGVGKSTV+ 
Sbjct  61   TECETKVSAIKGVKSVDVEMTAEVRA---AEHSQPILTDVKNIIAVASGKGGVGKSTVSA  117

Query  721  NLAYTLADMGARVGIFDADVYGPSLPTMVS  810
            NLA  L   GA+VG+ DAD+YGPS+P M+ 
Sbjct  118  NLAMALQMSGAKVGLMDADIYGPSIPQMLG  147



>ref|XP_005841455.1| hypothetical protein GUITHDRAFT_156868 [Guillardia theta CCMP2712]
 gb|EKX54475.1| hypothetical protein GUITHDRAFT_156868 [Guillardia theta CCMP2712]
Length=461

 Score =   182 bits (462),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/307 (36%), Positives = 161/307 (52%), Gaps = 49/307 (16%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGRA-IMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI  1096
             I+P    GVKL+S GF     + +MRG  V+ ++ QL++TT WGELDYL+IDMPPGTGDI
Sbjct  162   IMPVNGFGVKLMSMGFINPVDSFVMRGSRVTPLVQQLVSTTAWGELDYLIIDMPPGTGDI  221

Query  1097  QLTLCQV--VPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG---  1261
             QLTL Q+  + + AAVIVTTPQ+L+F+DV KG+ MF K+ +P VAVVENM  F  DG   
Sbjct  222   QLTLSQMETLRIDAAVIVTTPQRLSFVDVVKGIEMFDKVGIPSVAVVENMAFFQNDGMQD  281

Query  1262  ------------------------KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASG  1369
                                      + + FG+G   +++  +GI +   +P+ P L+   
Sbjct  282   NIQAFANKYSLPQEAVSELEEILKAKQFLFGQGHKQRLLDMWGIQNSISIPLFPDLAKQS  341

Query  1370  DSGTPEVVADPRGEVASTFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNS---  1540
             DSG P V+A P  +V+  +  L   V+ + +  + +    V     +  I+   PN    
Sbjct  342   DSGMPYVLAFPDTDVSRAYSALAESVISEVSVAKMESGKNV-----MPEIEYDAPNKQFV  396

Query  1541  -DEEFYLHPATVRRNDRSAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDG  1717
              D    +    +RR  RS  +            ++V E +EP +  P+G YA+SI W DG
Sbjct  397   IDGNQRISAKEMRRLCRSPAN----------DPNNVKESVEPVDFVPLGRYAISIQWNDG  446

Query  1718  FSQIAPY  1738
                + PY
Sbjct  447   HQSLMPY  453


 Score =   119 bits (298),  Expect(2) = 4e-72, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 96/150 (64%), Gaps = 6/150 (4%)
 Frame = +1

Query  376  AEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANE  555
            +EVL +LA+I DP  G  IVS   VK+L V E  G+VSF ++L+ P   ++ + +Q    
Sbjct  2    SEVLASLAEIDDPVLGESIVSLSAVKNLEV-EPSGDVSFTVQLSAPD--LQGVVKQACQS  58

Query  556  VVAALPWVKTVKVTMSAQPAKPVF---AGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
             ++ LPWVK +++T+++ P        +     GL+ + +++  +SCKGGVGKST AVNL
Sbjct  59   ALSQLPWVKDIEITVTSLPPNDSLREASRNQATGLKGVKHVILCASCKGGVGKSTTAVNL  118

Query  727  AYTLADMGARVGIFDADVYGPSLPTMVSPE  816
            AY++   G + GI D D+YGPSLPTMV PE
Sbjct  119  AYSMHKRGFKTGILDVDIYGPSLPTMVKPE  148



>ref|WP_037571278.1| hypothetical protein, partial [Spirochaeta cellobiosiphila]
Length=302

 Score =   158 bits (399),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 109/161 (68%), Gaps = 8/161 (5%)
 Frame = +2

Query  887   LTNL*NPE----KKTIIPTEYLGVKLVSFGFA-GQGRAIMRGPMVSGVINQLLTTTEWGE  1051
             L N+ NP+    +K I+P E  G+K +SFGF  G   AIMRGPMVSG + Q+LT  +WGE
Sbjct  142   LFNIHNPQIYQREKWIMPIEKDGMKFLSFGFLFGDSPAIMRGPMVSGYLQQILTQVDWGE  201

Query  1052  LDYLVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVV  1231
             LDYL+IDMPPGTGDIQLTL Q + L  AVIVTT   L+ +DV KG+ MF K+ VP +  V
Sbjct  202   LDYLLIDMPPGTGDIQLTLSQTLQLDGAVIVTTRANLSLVDVTKGILMFEKVGVPMLGAV  261

Query  1232  ENMCHFDADG--KRYYPFGKGSGAQVVQQFGIPHLFDLPIR  1348
             ENM +F  D   K++Y FG  S   + ++FG+P L ++PI 
Sbjct  262   ENMSYFICDNCDKKHYLFGN-SRVNLTERFGLPLLAEIPIE  301


 Score =   143 bits (360),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 107/149 (72%), Gaps = 5/149 (3%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            + +VL+AL+ IIDPD   DIVS GFVK+L++++ +  VSF + LTTPACP+K+ F+Q+A 
Sbjct  4    KEDVLQALSVIIDPDLNKDIVSLGFVKELVIDKDI--VSFSVNLTTPACPMKNHFKQQAE  61

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            E+V AL  V  V V M+AQ +  V  G+L  GL  ++ I+A++S KGGVGKST++  +A 
Sbjct  62   ELVLALDGVSKVHVNMTAQGS--VNGGKLE-GLAKVNAIIAIASAKGGVGKSTISATIAS  118

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPEN  819
             LAD G +VG+ D D+YGPSLPT+ +  N
Sbjct  119  ELADQGFKVGLLDVDLYGPSLPTLFNIHN  147



>ref|WP_018284401.1| mrp [zeta proteobacterium SCGC AB-137-J06]
Length=357

 Score =   154 bits (389),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 118/197 (60%), Gaps = 5/197 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + K IIP E  G+K +S G+  +    M  RG MV+G + QLLT  EWGELDYL IDMPP
Sbjct  154   QTKNIIPLENYGLKTMSIGYLVEEEKAMIWRGAMVAGALKQLLTEVEWGELDYLFIDMPP  213

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD QLTL Q VP+T AV+VTTPQ +A ID  +G+ MF K+ VP + +VENM  F    
Sbjct  214   GTGDAQLTLTQSVPVTGAVLVTTPQDIALIDCRRGIDMFQKVHVPTLGIVENMSQFICPH  273

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G+    F +G   ++ Q+     L  +P+   +  + D GTP V A P  + A  +Q+L
Sbjct  274   CGESSAIFSEGGAERLSQEQNSEVLAQIPLDIKIRQNADEGTPIVAAMPDSDQAKIYQDL  333

Query  1436  GVCVVQQCARI-RQQVS  1483
                V ++ + + R+QV+
Sbjct  334   AGAVARKISILNRRQVN  350


 Score =   145 bits (367),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 116/178 (65%), Gaps = 18/178 (10%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKA  549
            +EA+VLKALA IIDPDF  +IVS GFVK++ ++ +   VS  +ELTTPACP+K+ F+++A
Sbjct  3    SEADVLKALAVIIDPDFNQNIVSLGFVKNIAISAS--SVSLTIELTTPACPVKEEFQRQA  60

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +  + ALP +    +TMS++ A P  +    PG   ++NI+AV+S KGGVGKST  VNLA
Sbjct  61   DAALLALPGITESNITMSSKVA-PAKSNNGIPG---VANIIAVASGKGGVGKSTTTVNLA  116

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPYTQMHTACRNITINEPLE  903
              +A  GARVG+ DAD+YGPS+P M         M  S    Q+ T  +NI    PLE
Sbjct  117  VAMAQTGARVGLLDADIYGPSIPRM---------MGLSGKKPQVDTQTKNII---PLE  162



>gb|ETP32736.1| hypothetical protein, variant 4 [Phytophthora parasitica P10297]
Length=429

 Score =   185 bits (470),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 99/209 (47%), Positives = 134/209 (64%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAI---------MRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q  A          MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQHAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  393   TYDSLAT-TVSPCATGR------VKYNRA  414


 Score =   114 bits (285),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVGYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETI34748.1| hypothetical protein, variant 4 [Phytophthora parasitica P1569]
Length=429

 Score =   185 bits (470),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  393   TYDSLAT-TVSPCATGR------VKYNRA  414


 Score =   113 bits (283),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>gb|ETK75045.1| hypothetical protein, variant 4 [Phytophthora parasitica]
 gb|ETL28466.1| hypothetical protein, variant 4 [Phytophthora parasitica]
 gb|ETM34927.1| hypothetical protein, variant 4 [Phytophthora parasitica]
 gb|ETP04599.1| hypothetical protein, variant 4 [Phytophthora parasitica CJ01A1]
Length=429

 Score =   185 bits (470),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 136/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V ++ + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKYNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  393   TYDSLAT-TVSPCATGR------VKYNRA  414


 Score =   113 bits (283),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|WP_018002338.1| hypothetical protein [zeta proteobacterium SCGC AB-604-O16]
Length=359

 Score =   152 bits (384),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 109/153 (71%), Gaps = 10/153 (7%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E +VL++L++IIDPDFG DIV+ GFVK++ ++   G+VSF +ELTTPACP+K+ F ++A 
Sbjct  6    EKQVLESLSRIIDPDFGKDIVTLGFVKNVAIDS--GKVSFTIELTTPACPVKEEFRRQAT  63

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTIS---NIVAVSSCKGGVGKSTVAVN  723
            E+V++L  V  V+V +++         Q  PG+Q IS   NI+AV+S KGGVGKST AVN
Sbjct  64   ELVSSLDGVTDVQVNITSN-----VQAQKRPGMQAISGIRNIIAVASGKGGVGKSTTAVN  118

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            LA  LA  GAR G+ DAD+YGPS+P M+    R
Sbjct  119  LAVALARTGARTGLLDADIYGPSIPRMMGLGGR  151


 Score =   144 bits (364),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 109/180 (61%), Gaps = 4/180 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + KT++P    GV  +S GF   + +A++ RGPMV+G + QLL    WGELDYLVID+PP
Sbjct  156   KDKTMLPLGNFGVTTMSIGFLVPEDQAVIWRGPMVAGALTQLLNDVAWGELDYLVIDLPP  215

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD QLTL Q VP+TA+VIVTTPQ +A  D  KG+ MF K+ VP + +VENM  F    
Sbjct  216   GTGDAQLTLTQNVPVTASVIVTTPQDIALSDARKGIAMFRKVNVPVLGIVENMSVFICPH  275

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G+  + F +G    + +++    L  +P+   +    D GTP V A P    + +++ L
Sbjct  276   CGEESHIFSQGGAENLAEEYDTHVLAHIPLDMQIREDSDRGTPIVAAHPDSAQSDSYRTL  335



>ref|XP_008913551.1| hypothetical protein, variant 4 [Phytophthora parasitica INRA-310]
 gb|ETN01224.1| hypothetical protein, variant 4 [Phytophthora parasitica INRA-310]
Length=429

 Score =   183 bits (464),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 135/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  393   TYDSLAT-TVSPCATGR------VKYNRA  414


 Score =   113 bits (283),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|XP_002785765.1| polysaccharide export protein, putative [Perkinsus marinus ATCC 
50983]
 gb|EER17561.1| polysaccharide export protein, putative [Perkinsus marinus ATCC 
50983]
Length=366

 Score =   150 bits (379),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 108/163 (66%), Gaps = 14/163 (9%)
 Frame = +1

Query  361  NQTA-----EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPI  525
            N+TA     E E+L+ L+ IIDPD   DIV+ GFV++L +++  G V F L+LTTPACP+
Sbjct  11   NETAAATEREKEILQQLSLIIDPDLHKDIVTLGFVQNLTISDE-GVVVFDLKLTTPACPV  69

Query  526  KDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPP----GLQTISNIVAVSSCKG  693
            +D F        +ALPWV  VKVT+SA+      AG  P      L  + NIVAV+SCKG
Sbjct  70   RDQFIDACTRACSALPWVTDVKVTLSAKSR----AGGAPEVKSENLSNVQNIVAVTSCKG  125

Query  694  GVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            GVGKS+VAVNLAY++A  G +VGI DAD++GPSLP ++    R
Sbjct  126  GVGKSSVAVNLAYSIAKHGVKVGILDADIFGPSLPYLIPSTER  168


 Score =   146 bits (368),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 107/153 (70%), Gaps = 4/153 (3%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRAI-MRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQL  1102
             P  + GVKL+S G+   G ++ +RGPMVSG+I Q+LT T+WG LDYL+ID PPGTGD+QL
Sbjct  175   PYYHNGVKLMSMGYIRPGESVAVRGPMVSGMIQQMLTMTDWGHLDYLIIDYPPGTGDVQL  234

Query  1103  TLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD--GKRYYP  1276
             T+ Q   + AAV+VTTPQ+L+ +DV KG+ +F KL +P +AVVENM +F       ++  
Sbjct  235   TIGQQAKVDAAVVVTTPQQLSLVDVEKGIELFDKLNIPSIAVVENMAYFKCPTCSDKHQV  294

Query  1277  FGKGSGAQ-VVQQFGIPHLFDLPIRPTLSASGD  1372
             FG+ + ++ + +++GI    +LPI P ++ + D
Sbjct  295   FGRAADSKHLAEKYGIQSHVELPIDPDMARNVD  327



>gb|ETL81721.1| hypothetical protein, variant 4 [Phytophthora parasitica]
Length=429

 Score =   183 bits (464),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 100/209 (48%), Positives = 135/209 (65%), Gaps = 17/209 (8%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQ---------GRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             K  + P +Y GVK +SFGF  Q         G A+MRGPMVS +++QL+  TEWG+LDYL
Sbjct  213   KNFVEPVDYEGVKCMSFGFVNQRAAPGAGGVGAAVMRGPMVSKLVDQLILGTEWGDLDYL  272

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             V+DMPPGTGDIQ++L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM 
Sbjct  273   VVDMPPGTGDIQISLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMS  332

Query  1244  HFD-ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
             +FD + G+R+YPFG G   ++V +  + ++F LPI    SAS DSG P V++    E   
Sbjct  333   YFDCSHGQRHYPFGPGHTQELVDKCNMKNVFKLPISEQFSASADSGRPFVLSGLSPEEEK  392

Query  1421  TFQELGVCVVQQCARIRQQVSTAVSYDRS  1507
             T+  L    V  CA  R      V Y+R+
Sbjct  393   TYDSLAT-TVSPCATGR------VKYNRA  414


 Score =   113 bits (283),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 84/131 (64%), Gaps = 2/131 (2%)
 Frame = +1

Query  430  IVSCGFVKDLLVNEALGEVSFRLELTTPAC-PIKDMFEQKANEVVAALPWVKTVKVTMSA  606
             V     ++L V    G+VS ++E  +PA   +   ++++A   V  L WVK     +S 
Sbjct  74   FVCYSLFQELRVVPEAGKVSCKIETPSPALMELAQQWQKEAELAVNKLDWVKDTDFEISK  133

Query  607  QPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYG  786
               +   AG+    L  +S+I+AVSSCKGGVGKSTVAVNLA++LA  GARVGI DAD+YG
Sbjct  134  SRPRNARAGRFS-SLAHVSDIIAVSSCKGGVGKSTVAVNLAFSLAKRGARVGILDADIYG  192

Query  787  PSLPTMVSPEN  819
            PSLPTMVSPE+
Sbjct  193  PSLPTMVSPED  203



>ref|XP_001443600.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK76203.1| unnamed protein product [Paramecium tetraurelia]
Length=427

 Score =   206 bits (523),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/287 (40%), Positives = 170/287 (59%), Gaps = 6/287 (2%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFA-GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTG  1090
             K I+P E+ GVK +S+G+A G  +AI+RGPMVS ++ QL+  T+W +LDYLV+DMPPGTG
Sbjct  136   KEILPIEFNGVKTMSYGYASGNQKAIIRGPMVSSIVVQLVQQTQWQDLDYLVVDMPPGTG  195

Query  1091  DIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADGKRY  1270
             DIQ++LCQ +    A+IVTTPQ+L+FIDV KG+ MF  LKVP ++VVENM  +      +
Sbjct  196   DIQISLCQELNFNGAIIVTTPQRLSFIDVVKGIEMFDVLKVPTLSVVENMAEYVCPNCNH  255

Query  1271  Y--PFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGE-VASTFQELGV  1441
                PFG G    + +QFGI     +P+   +S   D G+P V+  P    +   +++L  
Sbjct  256   LHRPFGPGYINLLQKQFGIATALSIPLYGDISKYSDLGSPVVLTLPEDHTINYIYRKLAN  315

Query  1442  CVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGE  1621
              VV +  R     S  V YD + + I +K     E+  +    +R     A  V E++G+
Sbjct  316   NVVNELNRTDLNKSPTVRYDTTKRVIIIKDFEGKEK-SIKSLELRSKCNCALCVDEFTGK  374

Query  1622  QKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTIE  1759
             +  Q     +++ P++I P GNYAV+I W DG  S I PY ++ + E
Sbjct  375   RLNQNQKFDQEVFPQKIEPKGNYAVAIVWSDGHRSSIYPYKRMWSEE  421


 Score = 89.0 bits (219),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  649  LQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLL  828
            LQ +S I+AVSSCKGGVGKST+A+NL ++L  +G +VGIFDADVYGPSLPT++  E + L
Sbjct  69   LQNVSKIIAVSSCKGGVGKSTIALNLTFSLQKLGFKVGIFDADVYGPSLPTLIGKEKQQL  128



>ref|WP_035403775.1| ATP-binding protein [Chlorobium sp. GBChlB]
 gb|KER09317.1| ATP-binding protein [Chlorobium sp. GBChlB]
Length=363

 Score =   174 bits (442),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 118/186 (63%), Gaps = 3/186 (2%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGF-AGQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             KT++P E  GVKL+S GF   Q  A++ RGPMVS  + Q +T   W +LDYL+ D+PPGT
Sbjct  163   KTLVPIEKYGVKLISIGFLVDQKTAVVWRGPMVSSALRQFMTDVVWNDLDYLLFDLPPGT  222

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DGK  1264
             GDIQLTL Q VPLT AV+VTTPQ +A  DV K V MF +LKVP + VVENM ++   DG 
Sbjct  223   GDIQLTLSQAVPLTGAVVVTTPQDVALADVIKAVAMFEQLKVPILGVVENMSYYQLPDGG  282

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVC  1444
             + Y FG G GA++  ++ IP L ++P+   +   GD G P V+ +P    A  F E    
Sbjct  283   KEYIFGDGGGARMAAEYKIPFLGEMPLSKDVRLGGDEGVPIVIRNPESVQAKLFMETAEK  342

Query  1445  VVQQCA  1462
             + QQ A
Sbjct  343   LAQQIA  348


 Score =   120 bits (300),  Expect(2) = 5e-70, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 5/158 (3%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-A  549
            E +++ AL  +I+PD   D++S   VKD+ +N A  +V+F + LTTPACP+KD+ +    
Sbjct  6    ERQIIDALRNVIEPDLQRDLISLNMVKDIKINGA--DVAFTVVLTTPACPLKDLIKNACV  63

Query  550  NEVVAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            N +   +   K ++V M+A      P+ A      L  + N +AV+S KGGVGKSTVA N
Sbjct  64   NAIKHFVKEAKNIEVNMTATVTTTNPLAAQASNNPLGRVKNTIAVASGKGGVGKSTVATN  123

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            LA  LA  GA+VG+ DAD+YGPS+PTM   +N   +M+
Sbjct  124  LAVALAKTGAKVGLIDADIYGPSIPTMFGLKNEKPDMI  161



>ref|WP_011889704.1| ATP-binding protein [Chlorobium phaeovibrioides]
 ref|YP_001129978.1| hypothetical protein Cvib_0454 [Chlorobium phaeovibrioides DSM 
265]
 gb|ABP36476.1| protein of unknown function DUF59 [Chlorobium phaeovibrioides 
DSM 265]
Length=379

 Score =   168 bits (425),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 114/187 (61%), Gaps = 3/187 (2%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRA--IMRGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
             +K + P E  GVKL+S GF  +     I RGPM S  I Q +T   WGELDYL+ D+PPG
Sbjct  180   EKMLQPLEKYGVKLMSIGFLVETDTALIWRGPMASSAIKQFITEVAWGELDYLIFDLPPG  239

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DG  1261
             TGDIQLTL Q +PLT AVIVTTPQ +A  DV+K V MF+K+ VP + V+ENM  ++  DG
Sbjct  240   TGDIQLTLAQTIPLTGAVIVTTPQDVALADVSKAVNMFAKVNVPILGVIENMSWYELPDG  299

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
              R Y FG+  G +  +  G+  L  +PI  ++   GDSGTP V+  P    A  F+    
Sbjct  300   SRDYLFGQKGGERFAKARGLAFLGSVPINRSVGEGGDSGTPAVIGTPDSSAAEAFKSASK  359

Query  1442  CVVQQCA  1462
              V +Q +
Sbjct  360   EVARQIS  366


 Score =   124 bits (312),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 100/164 (61%), Gaps = 21/164 (13%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-A  549
            E ++LKAL+ ++DPD   D+VS G ++ + V E  G++SF++ LTTPACP+KD   Q   
Sbjct  6    EHQILKALSTVLDPDLKKDLVSLGMIRGISVTEG-GDISFQVVLTTPACPLKDEIRQSCI  64

Query  550  NEVVAALPWVKTVKVTMSA-------------------QPAKPVFAGQLPPGLQTISNIV  672
            + + A LP  + + V M+A                   Q +     GQ    L+ + NI+
Sbjct  65   DAIRAELPAAERIDVEMTAEVTSGCSHGHDDHHHEGGHQCSGGQCGGQEERPLKEVKNII  124

Query  673  AVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTM  804
            AV+S KGGVGKSTVAVNLA +LA  GA VG+ DAD+YGPS+PTM
Sbjct  125  AVASGKGGVGKSTVAVNLAVSLAATGASVGLVDADLYGPSIPTM  168



>ref|WP_008297498.1| mrp [Candidatus Nitrosopumilus salaria]
 gb|EIJ66693.1| CobQ/CobB/MinD/ParA nucleotide binding domain family protein 
[Candidatus Nitrosopumilus salaria BD31]
Length=367

 Score =   161 bits (408),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 123/205 (60%), Gaps = 5/205 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P +  G+K+VSFGF A Q    AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  155   EDNKLQPADSHGLKVVSFGFFADQSNQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K V MF KL VP + VVENM HF   
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAVSMFEKLNVPIIGVVENMSHFICP  274

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FG+G   ++ +QF +P L ++P+   + A  D G P ++ +P    A  F++
Sbjct  275   NCNEKHYIFGEGGAKKISEQFNMPFLGEIPLNSGIMAGSDLGKPIMITNPDSPSAVAFRK  334

Query  1433  LGVCVVQQCARIRQQVSTAVSYDRS  1507
                 +  QC+ +  ++   ++ + S
Sbjct  335   SAKNIAAQCSILAAKLQDEMAAESS  359


 Score =   126 bits (316),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 97/154 (63%), Gaps = 7/154 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+  G + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--GNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  +  +K   +KVT      + + A     G+ ++ NI+ V+S KGGVGKSTV++NLA 
Sbjct  64   IGEISELKNFDMKVTAKVMEGRSLEADT---GMASVKNIIGVASGKGGVGKSTVSLNLAL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             LA  GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  121  ALAQTGAKVGLLDADIYGPSIPLMLGMKDGFMEV  154



>ref|WP_013482223.1| mrp [Cenarchaeum symbiosum]
 ref|YP_875901.1| ATPases involved in chromosome partitioning [Cenarchaeum symbiosum 
A]
 gb|ABK77597.1| ATPases involved in chromosome partitioning [Cenarchaeum symbiosum 
A]
Length=437

 Score =   156 bits (395),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 117/196 (60%), Gaps = 5/196 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF---AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P E  G+K+VSFGF        AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  199   EANKLQPAEASGIKVVSFGFFAEQAHKAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLP  258

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K V MF KL VP + VVENM  F  +
Sbjct  259   PGTGDIPLTLAQTIPITGILVVTTPQNVASNVAVKAVGMFEKLNVPIIGVVENMSGFVCN  318

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
               G+++  FG+G   ++ +QF IP + ++P+   + A  + G P ++ DP    ++ F+ 
Sbjct  319   KCGEKHNVFGEGGAKRISEQFKIPLIGEIPLTAGIMAGSEEGRPIILTDPDSPSSNAFRS  378

Query  1433  LGVCVVQQCARIRQQV  1480
                 +  QC+ I  ++
Sbjct  379   SAKNIAAQCSIIAAKL  394


 Score =   130 bits (328),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 100/161 (62%), Gaps = 9/161 (6%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            N     +VL++L ++IDPD   DIVS G +KDL +++  G + F LELTTPACP     E
Sbjct  44   NMVGVDQVLESLGKVIDPDLKKDIVSMGMIKDLELDD--GNLKFTLELTTPACPFNVEIE  101

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQL---PPGLQTISNIVAVSSCKGGVGKST  711
                +V+  L  +K + + ++A+    V  G+      G+ T+ NI+ V+S KGGVGKST
Sbjct  102  DDVRKVIGELDGIKNLNLNVTAK----VMEGRSLDEDAGMTTVKNIIGVASGKGGVGKST  157

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            VA+NLA  L   GA+VG+ DAD+YGPS+P M+  +   +E+
Sbjct  158  VALNLALALGQTGAKVGLLDADIYGPSIPLMLGMKEAFMEV  198



>ref|WP_014965552.1| MULTISPECIES: mrp [Nitrosopumilus]
 ref|YP_006776124.1| hypothetical protein NSED_06920 [Candidatus Nitrosopumilus sp. 
AR2]
 gb|AFS83182.1| hypothetical protein NSED_06920 [Candidatus Nitrosopumilus sp. 
AR2]
Length=372

 Score =   159 bits (403),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 79/202 (39%), Positives = 123/202 (61%), Gaps = 9/202 (4%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P +  G+K+VSFGF A Q    AI RGP++SG++ Q L  T W ELDYL++D+P
Sbjct  155   EDNKLQPADSHGLKVVSFGFFADQSNQAAIYRGPIISGILKQFLVDTNWSELDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K V MF KL VP + VVENM HF   
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASDVAVKAVSMFEKLNVPIIGVVENMSHFICP  274

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                 ++Y FG+G   ++ ++F +P L ++P+   + +  D G P ++ +P    A  F++
Sbjct  275   NCNDKHYIFGEGGAKKISERFNMPFLGEIPLNSGIMSGSDLGKPIMITNPDSPSAEAFRK  334

Query  1433  LGVCVVQQC----ARIRQQVST  1486
                 +  QC    A++++++++
Sbjct  335   SAKNIAAQCSILAAKLQEEMAS  356


 Score =   127 bits (319),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+  G + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--GNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKTVKVTMSAQPAKPVFAG---QLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +A L  +K   + ++A+    V  G   +   G+ T+ NI+ V+S KGGVGKSTV++NLA
Sbjct  64   IAELSDLKDFDMKVTAK----VMEGRSLEDDTGMATVKNIIGVASGKGGVGKSTVSLNLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
              L+  GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  120  LALSQSGAKVGLLDADIYGPSIPLMLGMKDGFMEV  154



>ref|WP_038321364.1| mrp, partial [candidate division ZIXI]
Length=344

 Score =   146 bits (368),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 103/177 (58%), Gaps = 4/177 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF--AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             E   IIP E  GVK++S GF        + RGPM+   + Q L   EWGELDYL++D+PP
Sbjct  155   EGNRIIPAEEHGVKIMSMGFFIHPNEAVVWRGPMLHKTVEQFLGNVEWGELDYLIVDLPP  214

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD+QL+LCQ++PLT A IV+TPQ +A     K + MF+KL  P + ++ENM  F    
Sbjct  215   GTGDVQLSLCQIIPLTGAAIVSTPQDVALQVAEKAIVMFNKLNTPILGLIENMSGFVCRH  274

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTF  1426
              G+R   FG G   +   +  IP L  +P+   +  + DSG P V+ADP    A  F
Sbjct  275   CGEREEIFGAGGVREYSLRHEIPFLGAIPLDTRVRENSDSGEPTVIADPDSPSAQAF  331


 Score =   139 bits (351),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 102/149 (68%), Gaps = 5/149 (3%)
 Frame = +1

Query  367  TAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLV-NEALGEVSFRLELTTPACPIKDMFEQ  543
            T EA++L+AL ++ DPD G +IV  GFVK+L + NE    VSF +ELTTPACP+KD  ++
Sbjct  2    TTEAQILEALKKVHDPDLGKNIVELGFVKNLKIENET---VSFTIELTTPACPVKDKLKE  58

Query  544  KANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +A + V A+  +K V V M+A+  +P  + Q    L  + NI+ V+S KGGVGKSTV+ N
Sbjct  59   EAKQAVLAVDGIKNVNVEMTAK-VRPTLSQQKTNLLPQVKNIIPVASGKGGVGKSTVSAN  117

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVS  810
            LA  L  MGA+VG+ D DVYGPS+P ++ 
Sbjct  118  LALVLVKMGAKVGLLDVDVYGPSIPLIMG  146



>ref|XP_005821070.1| hypothetical protein GUITHDRAFT_147485, partial [Guillardia theta 
CCMP2712]
 gb|EKX34090.1| hypothetical protein GUITHDRAFT_147485, partial [Guillardia theta 
CCMP2712]
Length=290

 Score =   174 bits (440),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 109/155 (70%), Gaps = 5/155 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR----AIMRGPMVSGVINQLLTTTEWGELDYLVIDM  1075
              ++ I P  Y  VKL+S+GF  + R    +IMRGPMV+  ++QLL  T+WGELDYLV+D 
Sbjct  136   NEERIAPLHYQDVKLMSYGFTAKARGGQASIMRGPMVASTVHQLLAFTDWGELDYLVLDF  195

Query  1076  PPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA  1255
             PPGTGDIQLT+CQ V +  AVIVTTPQKL+F+DV +G+ MF  L VP VA+VENM +FD 
Sbjct  196   PPGTGDIQLTICQQVNIDGAVIVTTPQKLSFVDVVRGIEMFDTLNVPIVALVENMSYFDC  255

Query  1256  D-GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTL  1357
               G R++PFG+G   ++  Q+G P    LPI  +L
Sbjct  256   SCGTRHFPFGEGHSQKISDQYGTPSAVVLPIHSSL  290


 Score =   112 bits (279),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 13/118 (11%)
 Frame = +1

Query  478  GEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPVFAGQL----PP  645
            G VSF L LTTPACP+KD F++   +++  LPWVK VK+T+S+Q  +P   GQ       
Sbjct  19   GVVSFDLVLTTPACPVKDKFKKDCTDLIKQLPWVKDVKLTLSSQ-HRPAGGGQKVENSQT  77

Query  646  GLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPEN  819
            GL+ +  I+AVSS KGG G   +        A +G +VGIFDAD+YGPSLPTMV  EN
Sbjct  78   GLKDVKRIIAVSSAKGGSGSQRI--------AKLGGKVGIFDADIYGPSLPTMVGVEN  127



>ref|WP_012499874.1| ATP-binding protein [Chloroherpeton thalassium]
 ref|YP_001996237.1| hypothetical protein Ctha_1327 [Chloroherpeton thalassium ATCC 
35110]
 gb|ACF13790.1| protein of unknown function DUF59 [Chloroherpeton thalassium 
ATCC 35110]
Length=364

 Score =   169 bits (427),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 115/186 (62%), Gaps = 3/186 (2%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGF-AGQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             KT+IP E  GVKL+S GF   Q  A++ RGPMVS  + Q +    W ELDYL+ D+PPGT
Sbjct  164   KTLIPLEKYGVKLMSIGFLVDQKTAVVWRGPMVSSALRQFMNDVAWNELDYLLFDLPPGT  223

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DGK  1264
             GDIQLTL Q VPLT +V+VTTPQ +A  DV K + MF  +KVP + ++ENM ++   DG 
Sbjct  224   GDIQLTLVQTVPLTGSVVVTTPQDVAVADVEKAISMFKSVKVPVLGIIENMSYYSLPDGH  283

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVC  1444
             R Y FG+G G ++ +   +P L ++P+   +   GD G P V+ +P  E A  F      
Sbjct  284   REYIFGQGGGKKLAESHSMPFLGEVPLGADVRMGGDEGVPVVIRNPESEQAKLFTTAAEK  343

Query  1445  VVQQCA  1462
             + QQ A
Sbjct  344   LAQQIA  349


 Score =   117 bits (293),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 95/158 (60%), Gaps = 6/158 (4%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            +Q  E +V+ AL  +I+PD   D++S   VKD+ + +A   VSF + LTTPACP+K+M +
Sbjct  2    SQITEKQVIDALRNVIEPDLQRDLISLNMVKDVAI-DADNNVSFTVVLTTPACPLKEMIK  60

Query  541  QK-ANEVVAALPWVKTVKVTMSAQ---PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKS  708
                N V   +   K VKV M+A      K        P L  + N +AV+S KGGVGKS
Sbjct  61   TACINAVRHFVQGAKEVKVNMTANVTGGGKTKTKDAANP-LVKVRNTIAVASGKGGVGKS  119

Query  709  TVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            TVA NLA  LA  GARVG+ DAD++GPS+PTM   +N 
Sbjct  120  TVATNLAVALAKTGARVGLIDADIHGPSIPTMFGLKNE  157



>gb|AIF15206.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_70_B03]
Length=367

 Score =   164 bits (414),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 118/190 (62%), Gaps = 5/190 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             EK+ ++P EY G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  159   EKRKLVPPEYEGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTLWTDLDYLIVDLP  218

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF KL VP + VVENM +F+  
Sbjct  219   PGTGDIPLTLAQTIPITGILVVTTPQEVASSVASKAIGMFDKLNVPMLGVVENMSYFECS  278

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FGKG   ++ ++  +P L  +P+   + A  D G P ++ DP    A  F  
Sbjct  279   KCNEKHYIFGKGGAEKISEKHNMPLLGAIPLNSGIMAGSDVGKPVMITDPDSPSAEAFTV  338

Query  1433  LGVCVVQQCA  1462
                 +  QC+
Sbjct  339   AAKNIAAQCS  348


 Score =   122 bits (305),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 94/145 (65%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +V+  L+ +IDPD   DIVS G +KD+ +N   G + F LELTTPACP  +  E+   + 
Sbjct  6    DVINKLSTVIDPDLNKDIVSMGMIKDVDLNS--GNLKFTLELTTPACPFNEQIEEDVRKA  63

Query  559  VAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +  + + ++A+    + + A +    ++ + NIVAV+S KGGVGKSTVA+NL+ 
Sbjct  64   IDELDGINNLDMNVTAKVMEGRSLDADEF---MKGVKNIVAVASGKGGVGKSTVALNLSL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             LA  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALAKTGAKVGLLDADIYGPSIPLML  145



>ref|WP_014100437.1| mrp [Candidatus Chloracidobacterium thermophilum]
 ref|YP_004863216.1| chromosome partitioning ATPase [Candidatus Chloracidobacterium 
thermophilum B]
 gb|AEP12700.1| ATPases involved in chromosome partitioning [Candidatus Chloracidobacterium 
thermophilum B]
Length=331

 Score =   162 bits (411),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 117/194 (60%), Gaps = 11/194 (6%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFAGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             IIP E  GVK +S G   +G    IMRGPM+ GV+ Q L   EWGELDYLV+DMPPGTGD
Sbjct  131   IIPREAHGVKFMSIGLINRGDKPVIMRGPMLHGVVQQFLRDVEWGELDYLVVDMPPGTGD  190

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDADG--KR  1267
             +QL+L Q+VP++ AV+VTTPQ++A  DV K   MF ++ +P   +VENM +F      + 
Sbjct  191   VQLSLAQLVPVSGAVLVTTPQEVALADVRKAFNMFKQVGIPVFGIVENMSYFTHPNIPEP  250

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCV  1447
              Y FG+G G ++ +QF    L ++P+   +   GDSG P VV  P+   A  FQ +    
Sbjct  251   IYIFGQGGGEKMAKQFETVFLGEIPLSIEVREGGDSGVPVVVGYPQSTQAKAFQAI----  306

Query  1448  VQQCARIRQQVSTA  1489
                  R+  QVS A
Sbjct  307   ---AERLAAQVSVA  317


 Score =   123 bits (308),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 9/125 (7%)
 Frame = +1

Query  445  FVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVVAALPWVKTVKVTMSAQPAKPV  624
             ++D+ ++   G VSFR  LTTPACP+K+  E +A EVVAA+P VK V V M AQ    V
Sbjct  1    MIRDVTIDN--GAVSFRFVLTTPACPVKEQLEHQAREVVAAIPGVKQVTVKMEAQ----V  54

Query  625  FAGQLPP---GLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSL  795
              G+  P   G+  + NI+AVSS KGGVGKSTVAVNLA  LA  GARVG+ D DVYGP++
Sbjct  55   PQGRGIPEKAGIPGVRNIIAVSSGKGGVGKSTVAVNLAVALAQTGARVGLLDTDVYGPNV  114

Query  796  PTMVS  810
            P M+ 
Sbjct  115  PIMMG  119



>gb|KFM20347.1| Protein mrp [Marine Group I thaumarchaeote SCGC AAA799-P11]
Length=370

 Score =   160 bits (406),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 125/210 (60%), Gaps = 11/210 (5%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P E  G+K+VSFGF A Q    AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  155   EDNKLQPAESNGLKVVSFGFFAEQAHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---  1249
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM HF   
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAIGMFEKLNVPIIGVVENMSHFICP  274

Query  1250  DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             + D +R+Y FG G   ++ +QF +P L ++P+   + +  D G P ++  P    A  F+
Sbjct  275   NCD-ERHYIFGDGGAKKISEQFNMPFLGEIPLNSGIMSGSDVGKPIMITKPDSPSADAFR  333

Query  1430  ELGVCVVQQC----ARIRQQVSTAVSYDRS  1507
                  +  QC    A++++++ +  S + S
Sbjct  334   IAAKNIAAQCSILAAKLQEEMESEGSNEES  363


 Score =   124 bits (312),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 97/155 (63%), Gaps = 9/155 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+  G + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--GNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQ---LPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +  L  +K   + ++A+    V  G+      G+ ++ NI+ V+S KGGVGKSTV++NLA
Sbjct  64   IGELTELKNFDMNVTAK----VMEGRSLDADTGMASVKNIIGVASGKGGVGKSTVSLNLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
              L   GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  120  LALQQTGAKVGLLDADIYGPSIPLMLGMKDGFMEV  154



>gb|AIF17124.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_76_B07]
Length=365

 Score =   159 bits (401),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 117/198 (59%), Gaps = 7/198 (4%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR----AIMRGPMVSGVINQLLTTTEWGELDYLVID  1072
             E   + P E  G+K+VSFGF A  G+    AI RGP++SG++ Q L  T W  LDYL++D
Sbjct  155   EDNKLQPAESNGIKVVSFGFFADSGKEHQAAIYRGPIISGIVKQFLVDTNWSNLDYLIVD  214

Query  1073  MPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD  1252
             +PPGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF KL VP + VVENM HF 
Sbjct  215   LPPGTGDIPLTLAQTIPITGILVVTTPQEVASNVASKAIGMFDKLNVPLLGVVENMSHFV  274

Query  1253  AD--GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTF  1426
                  +++Y FGKG   ++ ++  IP L ++P+   +    DSG P ++  P    A  F
Sbjct  275   CTKCSEKHYIFGKGGAQKISEKHNIPFLGEIPLNSGIMEGSDSGKPVMITQPDSSSAIAF  334

Query  1427  QELGVCVVQQCARIRQQV  1480
                   +  QC+ +  ++
Sbjct  335   MVSAKNIAAQCSIVAAKL  352


 Score =   126 bits (317),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL  L  +IDPD   DIVS G +KDL +N   G + F LELTTPACP  D  E+     
Sbjct  6    DVLSKLTTVIDPDLKKDIVSMGMIKDLELNS--GNLKFTLELTTPACPFNDDIERDVRTA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + +L  +++  +KVT      + + A +    + T+ NI+AV+S KGGVGKSTV++NLA 
Sbjct  64   IDSLDGIESFDLKVTAKVMEGRDLAADE---AMATVKNIIAVASGKGGVGKSTVSLNLAI  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             L+  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALSQTGAKVGLLDADIYGPSIPLML  145



>gb|AIF14615.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_67_E09]
Length=367

 Score =   162 bits (409),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 120/196 (61%), Gaps = 5/196 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             EK+ ++P EY G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  159   EKRKLVPPEYEGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTLWTDLDYLIVDLP  218

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF KL VP + VVENM +F+  
Sbjct  219   PGTGDIPLTLAQTIPITGILVVTTPQEVASSVASKAIGMFDKLNVPMLGVVENMSYFECS  278

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FGKG   ++ ++  +P L  +P+   + A  D G P ++  P    A  F  
Sbjct  279   KCNEKHYIFGKGGAEKISEKHNMPFLGAIPLNSGIMAGSDLGKPVMITHPDSPSAEAFTV  338

Query  1433  LGVCVVQQCARIRQQV  1480
                 +  QC+ +  ++
Sbjct  339   AAKNIAAQCSIVAAKL  354


 Score =   123 bits (308),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 94/145 (65%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +V+  L+ +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  E+   + 
Sbjct  6    DVINKLSTVIDPDLNKDIVSMGMIKDLDLNS--GNLKFTLELTTPACPFNEQIEEDVRKA  63

Query  559  VAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +  + + ++A+    + + A +    ++ + NIVAV+S KGGVGKSTVA+NL+ 
Sbjct  64   IDELDGIDNLDMNVTAKVMEGRSLDADEF---MKGVKNIVAVASGKGGVGKSTVALNLSL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             LA  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALAKTGAKVGLLDADIYGPSIPLML  145



>emb|CDI05966.1| putative ATPases involved in chromosome partitioning [Thaumarchaeota 
archaeon N4]
Length=360

 Score =   153 bits (386),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 72/199 (36%), Positives = 116/199 (58%), Gaps = 5/199 (3%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI  1096
             P +  G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+PPGTGDI
Sbjct  161   PADSHGIKVVSFGFFAEQEHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLPPGTGDI  220

Query  1097  QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD--GKRY  1270
              LTL Q +P+T  ++VTTPQ +A     K + MF+KL VP + V+ENM +F       ++
Sbjct  221   PLTLAQTIPITGILVVTTPQDVASNVAVKAIGMFNKLNVPIIGVIENMSYFVCPKCSDKH  280

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
             Y FG+G   ++ +++ IP + ++P+   +    D G P ++ DP    A   +     V 
Sbjct  281   YVFGEGGAKRISEKYNIPFIGEIPLNSGIMQGSDKGKPVIITDPNSPSAEAIRAAAKNVA  340

Query  1451  QQCARIRQQVSTAVSYDRS  1507
              QC+ +  ++   +  D +
Sbjct  341   AQCSILAAKLKEEMQGDAA  359


 Score =   132 bits (332),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 97/155 (63%), Gaps = 9/155 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL  LA +IDPD   DIVS G +KDL +N+  G + F LELTTPACP  D  EQ   + 
Sbjct  6    QVLTKLATVIDPDLKKDIVSMGMIKDLELND--GNLKFTLELTTPACPFNDQIEQDVRKA  63

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQ---LPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            V  +  ++   + ++A+    V  G+       + T+ NI+ V+S KGGVGKSTV++NLA
Sbjct  64   VGEIEGIRNFDLNVTAK----VMEGRSLAADEAMSTVKNIIGVASGKGGVGKSTVSLNLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
              LA  GA+VG+ DAD+YGPS+P M+  +   +E+
Sbjct  120  LALAQSGAKVGLLDADIYGPSIPLMLGMQKAFMEV  154



>gb|ETO22470.1| hypothetical protein RFI_14729 [Reticulomyxa filosa]
Length=517

 Score =   192 bits (488),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/290 (39%), Positives = 159/290 (55%), Gaps = 44/290 (15%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-----AGQ----GRAIMRGPMVSGVINQLLTTTEWGELDY  1060
             ++  ++P  Y GV  +SFGF     AG     G A MRGPMV+ V+++LLT T+WG+LDY
Sbjct  249   QQNMLLPLRYEGVDCMSFGFVKTGAAGSHPHTGLAAMRGPMVTQVVHELLTFTKWGDLDY  308

Query  1061  LVIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENM  1240
             LVIDMPPGT DI LTLCQ + + AAV+VTTPQKL+F+DV KG++MF  + VP +AVVENM
Sbjct  309   LVIDMPPGTSDIHLTLCQNIQIQAAVVVTTPQKLSFVDVIKGIQMFDTMNVPTIAVVENM  368

Query  1241  CHFDAD--GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVV-ADPRGE  1411
                  +  G+  YPFG G    +VQQFGI  ++ LPI P +S+  D G P V+   P+ +
Sbjct  369   SKIICNKCGEETYPFGPGYRQSIVQQFGIQQVYQLPIVPLISSRSDCGDPVVLDQSPQSQ  428

Query  1412  -VASTFQELGVCVVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDEEFYLHPATVRRNDR  1588
              +   F  +   VV +  R+                              HP+       
Sbjct  429   PIRDVFDLMAKSVVVEIDRL-------------------------HTLTQHPSWAL---D  460

Query  1589  SAESVVEWSGEQKLQYSDVPEDIEPEEIRPMGNYAVSITWPDGFSQIAPY  1738
             S  S+++ +   KL  + V  +I+   ++P GNYA  + W DG   I P+
Sbjct  461   SHSSILKLT---KLNPTSVDTNIQALFVQPKGNYAFYVKWSDGHHSIYPF  507


 Score = 93.2 bits (230),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = +1

Query  646  GLQTISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRL  825
            GL  + +++AVSSCKGGVGKST+AVNLAY+L+ +  RVGI+DAD++GPSLPTM+SP++ +
Sbjct  185  GLSQVKHVIAVSSCKGGVGKSTIAVNLAYSLSKLNHRVGIYDADIFGPSLPTMISPKDTI  244

Query  826  LE  831
            + 
Sbjct  245  IR  246



>gb|AIE86198.1| mrP protein [Fimbriimonas ginsengisoli Gsoil 348]
Length=367

 Score =   144 bits (364),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 114/189 (60%), Gaps = 4/189 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFA-GQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             +   IIP +  G+ ++S GF   +G+A++ RGPMV+G + QLL    WG+LDYL++D+PP
Sbjct  155   QGNKIIPIQRYGIHMMSLGFLLEEGQAVLWRGPMVAGTVRQLLADVAWGDLDYLLVDLPP  214

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD  ++L Q+ PLT  VIVTTP  +A     K V++F +L  P + VVENM  F    
Sbjct  215   GTGDAPMSLAQLAPLTGVVIVTTPHHVAANIAGKSVQLFRRLNAPIMGVVENMAGFVCPH  274

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G+    F   SG ++  Q  +P+L  +P+ P +S +GD G P ++A+P    A  F+++
Sbjct  275   CGEVSNIFAGTSGEELSTQLKVPYLGSVPLDPGVSDAGDRGVPAIIANPERPQAQAFKDI  334

Query  1436  GVCVVQQCA  1462
                + QQ +
Sbjct  335   AGKLAQQAS  343


 Score =   140 bits (353),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 107/163 (66%), Gaps = 13/163 (8%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E++VL+AL  ++DPD   DI + GFVKDL++    G VSF +ELTTPACP+++  + +A 
Sbjct  5    ESQVLEALRNVVDPDLHRDIATLGFVKDLVIEG--GNVSFTIELTTPACPVREELQAQAE  62

Query  553  EVVAALPWVKTVKVTMSAQ-PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            E V A+P V +V+VTM+AQ   +      L PG   + + +A++S KGGVGKSTV VNLA
Sbjct  63   EHVRAVPEVTSVRVTMTAQVRQRQTPQDDLIPG---VKHCIAIASGKGGVGKSTVTVNLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPYTQ  858
              LA  GA+VG+ DADVYGPS+P M+         V   P+TQ
Sbjct  120  IALAQTGAKVGLMDADVYGPSIPLMMG-------AVNEKPFTQ  155



>ref|WP_012465394.1| ATP-binding protein [Chlorobium limicola]
 ref|YP_001942492.1| hypothetical protein Clim_0420 [Chlorobium limicola DSM 245]
 gb|ACD89513.1| protein of unknown function DUF59 [Chlorobium limicola DSM 245]
Length=360

 Score =   169 bits (429),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 111/174 (64%), Gaps = 4/174 (2%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGF--AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
              K ++P E  GVKL+S GF        I RGPM S  I Q +T  EWGELDYL+ D+PPG
Sbjct  163   NKNLVPVEKYGVKLMSIGFLIETDTAVIWRGPMASSAIKQFITEVEWGELDYLIFDLPPG  222

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DG  1261
             TGDIQLTL Q +PLT AVIVTTPQ +A  DV+K V MF K+ VP + +VENM +++  DG
Sbjct  223   TGDIQLTLVQTIPLTGAVIVTTPQDVALADVSKAVSMFRKVHVPILGLVENMSYYELPDG  282

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAST  1423
              + Y FGK  G +  +  GI  L  +PI   +   GDSG P V+ DP G V+ST
Sbjct  283   TKDYIFGKAGGEKFARAQGIAFLGSIPIGREVREGGDSGKPFVLTDP-GSVSST  335


 Score =   115 bits (288),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            +   E++V+ AL  +++PD   D+VS   ++D+ ++E    VSF + LTTPACP+K+   
Sbjct  2    HNVEESQVIAALRTVMEPDLKKDLVSLDMIRDIHIDER-NRVSFSVVLTTPACPMKNQIR  60

Query  541  QK-ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPG--LQTISNIVAVSSCKGGVGKST  711
            Q   + V   +P    ++V M+A+        Q      L+ + NI+AV+S KGGVGKST
Sbjct  61   QACIDAVRTYVPLADEIEVHMTAKVTSSCGHHQDEEDRPLKKVKNIIAVASGKGGVGKST  120

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTM  804
             AVNLA +LA  GA+VG+ DAD+YGPS+PTM
Sbjct  121  FAVNLAVSLAASGAKVGLIDADLYGPSIPTM  151



>gb|ABZ07104.1| putative domain of unknown function DUF59 [uncultured marine 
crenarchaeote HF4000_ANIW97M7]
Length=420

 Score =   157 bits (397),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 77/207 (37%), Positives = 119/207 (57%), Gaps = 9/207 (4%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E K + P E  G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  155   EDKKLQPPESNGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTNWTDLDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ +A    +K + MF KL VP + VVENM +F+  
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASSVASKAIGMFDKLNVPMLGVVENMSYFECS  274

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FGKG   ++ ++  +P L  +P+   +    D G P ++  P    A  F  
Sbjct  275   KCNEKHYIFGKGGAEKISKKHNMPFLGSIPLNSGIMEGSDLGKPVMITQPDSPSAEAFTA  334

Query  1433  LGVCVVQQCA----RIRQQVSTAVSYD  1501
                 V  QC+    ++R++      ++
Sbjct  335   AAKNVAAQCSIQHYKMREEAEAEAKWN  361


 Score =   127 bits (320),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 99/155 (64%), Gaps = 9/155 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +V+  L+ +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  E    + 
Sbjct  6    DVINKLSTVIDPDLNKDIVSMGMIKDLDLNS--GNLKFTLELTTPACPFNEEIEADVRKA  63

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQ---LPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +  L  +K + + ++A+    V  G+       ++T+ NI+AV+S KGGVGKSTVA+NLA
Sbjct  64   IDELDGIKNLDMNVTAK----VMEGRSLDADESMKTVKNIIAVASGKGGVGKSTVALNLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
              L+  GA+VG+ DAD+YGPS+P M+  +N  +++
Sbjct  120  LALSRTGAKVGLLDADIYGPSIPLMLGMKNAAMQV  154



>gb|AIF05278.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_181_G03]
Length=367

 Score =   161 bits (407),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 117/190 (62%), Gaps = 5/190 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             EK+ ++P EY G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  159   EKRKLVPPEYEGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTLWTDLDYLIVDLP  218

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF KL VP + VVENM +F+  
Sbjct  219   PGTGDIPLTLAQTIPITGILVVTTPQEVASSVASKAIGMFDKLNVPMLGVVENMSYFECS  278

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FGKG   ++ ++  +P L  +P+   + A  D G P ++  P    A  F  
Sbjct  279   KCNEKHYIFGKGGAEKISEKHNMPLLGAIPLNSGIMAGSDVGKPVMITHPDSPSAEAFTV  338

Query  1433  LGVCVVQQCA  1462
                 +  QC+
Sbjct  339   AAKNIAAQCS  348


 Score =   123 bits (309),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 94/145 (65%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +V+  L+ +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  E+   + 
Sbjct  6    DVINKLSTVIDPDLNKDIVSMGMIKDLDLNS--GNLKFTLELTTPACPFNEQIEEDVRKA  63

Query  559  VAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +  + + ++A+    + + A +    ++ + NIVAV+S KGGVGKSTVA+NL+ 
Sbjct  64   IDELDGINNLDMNVTAKVMEGRSLDADEF---MKGVKNIVAVASGKGGVGKSTVALNLSL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             LA  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALAKTGAKVGLLDADIYGPSIPLML  145



>gb|AIF03243.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_162_H04]
Length=367

 Score =   161 bits (408),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 117/190 (62%), Gaps = 5/190 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             EK+ ++P EY G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  159   EKRKLVPPEYEGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTLWTDLDYLIVDLP  218

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF KL VP + VVENM +F+  
Sbjct  219   PGTGDIPLTLAQTIPITGILVVTTPQEVASSVASKAIGMFDKLNVPMLGVVENMSYFECS  278

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FGKG   ++ ++  +P L  +P+   + A  D G P ++  P    A  F  
Sbjct  279   KCNEKHYIFGKGGAEKISEKHNMPLLGAIPLNSGIMAGSDVGKPVMITHPDSPSAEAFTV  338

Query  1433  LGVCVVQQCA  1462
                 +  QC+
Sbjct  339   AAKNIAAQCS  348


 Score =   123 bits (309),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 94/145 (65%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +V+  L+ +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  E+   + 
Sbjct  6    DVINKLSTVIDPDLNKDIVSMGMIKDLDLNS--GNLKFTLELTTPACPFNEQIEEDVRKA  63

Query  559  VAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +  + + ++A+    + + A +    ++ + NIVAV+S KGGVGKSTVA+NL+ 
Sbjct  64   IDELDGISNLDMNVTAKVMEGRSLDADEF---MKGVKNIVAVASGKGGVGKSTVALNLSL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             LA  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALAKTGAKVGLLDADIYGPSIPLML  145



>gb|AIF00030.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_128_G11]
 gb|AIF01333.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_146_F08]
Length=365

 Score =   159 bits (401),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 117/198 (59%), Gaps = 7/198 (4%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR----AIMRGPMVSGVINQLLTTTEWGELDYLVID  1072
             E   + P E  G+K+VSFGF A  G+    AI RGP++SG++ Q L  T W  LDYL++D
Sbjct  155   EDNKLQPAESNGIKVVSFGFFADSGKEHQAAIYRGPIISGIVKQFLVDTNWSNLDYLIVD  214

Query  1073  MPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD  1252
             +PPGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF KL VP + VVENM HF 
Sbjct  215   LPPGTGDIPLTLAQTIPITGILVVTTPQEVASNVASKAIGMFDKLNVPLLGVVENMSHFV  274

Query  1253  AD--GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTF  1426
                  +++Y FGKG   ++ ++  IP L ++P+   +    DSG P ++  P    A  F
Sbjct  275   CTKCSEKHYIFGKGGAQKISEKHNIPFLGEIPLNSGIMEGSDSGKPVMITQPDSSSAIAF  334

Query  1427  QELGVCVVQQCARIRQQV  1480
                   +  QC+ +  ++
Sbjct  335   MVSAKNIAAQCSIVAAKL  352


 Score =   125 bits (314),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL  L  +IDPD   DIVS G +KDL +N   G + F LELTTPACP  D  E+     
Sbjct  6    DVLSKLTTVIDPDLKKDIVSMGMIKDLELNS--GNLKFTLELTTPACPFNDDIERDVRTA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + +L  +++  +KVT      + + A +    + T+ NI+AV+S KGGVGKSTV++NL+ 
Sbjct  64   IDSLDGIESFDLKVTAKVMEGRDLAADE---AMATVKNIIAVASGKGGVGKSTVSLNLSL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             L+  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALSQTGAKVGLLDADIYGPSIPLML  145



>gb|AIF83767.1| ATPase involved in chromosome partitioning [Candidatus Nitrososphaera 
evergladensis SR1]
Length=370

 Score =   158 bits (399),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 110/180 (61%), Gaps = 5/180 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF---AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   I P E  GVK++S GF     Q   I RGP+VSG++ Q LT   WGELDYL+ID+P
Sbjct  153   ENNKIQPPEVAGVKVISMGFFYEQSQQAGIYRGPIVSGIVKQFLTDVNWGELDYLIIDLP  212

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGD  LT+ Q +P+T  +IVTTPQ +A     K V MF KL VP + VVENM   +  
Sbjct  213   PGTGDAPLTIAQTIPITGILIVTTPQDVAMNVAVKAVGMFHKLNVPIIGVVENMSFLNCP  272

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                ++ Y FGKG G ++   F IP + ++P+   +S   D+G P V+++P+   A +F++
Sbjct  273   HCNEQIYLFGKGGGKRISDDFNIPFIGEIPLHQHISQGSDTGKPTVLSEPQSFQAQSFEK  332


 Score =   126 bits (316),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 97/146 (66%), Gaps = 8/146 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL +L +++DP+   DIVS G +KDL +N+  G+VSF LELTTPACP     E+     
Sbjct  6    QVLGSLKKVVDPELHKDIVSMGMIKDLSIND--GKVSFTLELTTPACPFNSDIERDVRAA  63

Query  559  VAALPWVKTV--KVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +A +  VK +  +VT      + +   +L PG   + NIVAV+S KGGVGK+TV+VNLA 
Sbjct  64   IAGI-GVKDLQMRVTARVMEGRALNLDELLPG---VKNIVAVASGKGGVGKTTVSVNLAL  119

Query  733  TLADMGARVGIFDADVYGPSLPTMVS  810
            +LA  GA+VG+ DAD+YGPS+P M+ 
Sbjct  120  SLAKTGAKVGLLDADIYGPSVPLMLG  145



>ref|WP_011357162.1| ATP-binding protein [Pelodictyon luteolum]
 ref|YP_374330.1| ATP-binding Mrp/Nbp35 family protein [Chlorobium luteolum DSM 
273]
 gb|ABB23287.1| ATP-binding protein, Mrp/Nbp35 family [Chlorobium luteolum DSM 
273]
Length=395

 Score =   158 bits (400),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 117/214 (55%), Gaps = 8/214 (4%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGF--AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             K I P E  GVKL+S GF        I RGPM S  I Q +T  +WGELDYLV D+PPGT
Sbjct  185   KKIQPLEKYGVKLMSIGFLIETDTAVIWRGPMASSAIKQFITDVDWGELDYLVFDLPPGT  244

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DGK  1264
             GDIQLTL Q VP+T A+IVTTPQ +A  DV+K V MF K+ VP + +VENM  ++  DG 
Sbjct  245   GDIQLTLVQTVPVTGALIVTTPQDVALADVSKAVSMFHKVNVPILGLVENMSWYELPDGS  304

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVC  1444
             R Y FG+  G +  +  G+  L  +PI   +    DSG P V+  P    A   +     
Sbjct  305   RDYIFGQKGGERFAKAQGLSFLGAIPIERGVGEGSDSGVPYVIGKPNSTSAKALK----A  360

Query  1445  VVQQCARIRQQVSTAVSYDRSIKAIKVKVPNSDE  1546
                + AR R  ++ A S D +          +DE
Sbjct  361   TAMETAR-RISITNASSRDENTGCGSGCGCGNDE  393


 Score =   125 bits (314),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 107/179 (60%), Gaps = 27/179 (15%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-A  549
            + ++L AL+ + +PD   D+V+ G ++D+ V++A G+VSF + LTTPACP+K+  +    
Sbjct  6    QQQILHALSTVQEPDLKKDLVTLGMIRDVAVSDA-GDVSFSVVLTTPACPLKEEIKTACV  64

Query  550  NEVVAALPWVKTVKVTMSA------------QPAKPVF------------AGQLPPGLQT  657
              V AA+P V TVKV+M A            QP                  G   P LQ 
Sbjct  65   KAVKAAVPGVGTVKVSMEATVTSASSCSHGHQPGDGHSHENGHQCSSGQCGGHDQP-LQG  123

Query  658  ISNIVAVSSCKGGVGKSTVAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
            + NI+AV+S KGGVGKST+AVNLA +LA+ GA+VG+ DAD+YGPS+PTM    +   EM
Sbjct  124  VKNIIAVASGKGGVGKSTIAVNLAVSLAESGAKVGLIDADLYGPSIPTMFGLHSEKPEM  182



>gb|AIF25328.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote SAT1000_50_F07]
Length=363

 Score =   157 bits (397),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 76/196 (39%), Positives = 115/196 (59%), Gaps = 5/196 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P E  G+K+VSFGF G+ +   AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  155   EDNKLQPAESNGIKVVSFGFFGEQQHQAAIYRGPIISGIVKQFLVDTNWSDLDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM +F+  
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASSVAVKAIGMFDKLNVPLLGVVENMSYFECS  274

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                + +Y FGKG   ++ ++  IP L ++P+   +    D G P ++  P    A  F  
Sbjct  275   KCSETHYIFGKGGAQKISEKHNIPFLGEIPLNSGIMEGSDLGKPVMITQPNSPSAKAFTV  334

Query  1433  LGVCVVQQCARIRQQV  1480
                 +  QC+ +  ++
Sbjct  335   AAKNIAAQCSIVAAKL  350


 Score =   126 bits (317),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 92/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL  L  +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  EQ   + 
Sbjct  6    DVLNKLTTVIDPDLKKDIVSMGMIKDLELNS--GNLKFTLELTTPACPFNEEIEQDVRKA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +    +KVT      + +   +    ++T+ NI+AV+S KGGVGKSTVA+NLA 
Sbjct  64   IDELDGIDKFDMKVTAKVMEGRSLDEDE---SMKTVKNIIAVASGKGGVGKSTVALNLAL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             L++ GA+VG+ DADVYGPS+P M+
Sbjct  121  ALSNAGAKVGLLDADVYGPSIPLML  145



>ref|WP_012506359.1| ATP-binding protein [Prosthecochloris aestuarii]
 ref|YP_002016473.1| hypothetical protein Paes_1814 [Prosthecochloris aestuarii DSM 
271]
 gb|ACF46826.1| protein of unknown function DUF59 [Prosthecochloris aestuarii 
DSM 271]
Length=363

 Score =   162 bits (409),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 112/187 (60%), Gaps = 3/187 (2%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRA--IMRGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
              K+IIP E  GVKL+S GF  +     I RGPM S  I Q +T   WGELDYL+ D+PPG
Sbjct  164   NKSIIPLEKYGVKLMSIGFLVESDTPVIWRGPMASTAIKQFITDVAWGELDYLIFDLPPG  223

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DG  1261
             TGDIQLTL Q VP+  AVIVTTPQ +A  DV+K V MF K+ VP + +VENM ++   DG
Sbjct  224   TGDIQLTLVQTVPVNGAVIVTTPQDVALADVSKAVTMFRKVDVPLLGLVENMSYYLLPDG  283

Query  1262  KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGV  1441
              + Y FG+  G +  +   IP L  +PI   +   GDSG P  +  P  E A+ F +   
Sbjct  284   SKDYIFGRSGGERFAKAQAIPLLGSVPIGGVVREGGDSGKPVAIEHPESEPAAAFLQAAR  343

Query  1442  CVVQQCA  1462
              V +Q +
Sbjct  344   EVARQIS  350


 Score =   122 bits (305),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 102/162 (63%), Gaps = 11/162 (7%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-A  549
            E++V++AL+ +++PD   D+VS G V+D+ ++E+   +SF + LTTPACP+KD   Q   
Sbjct  6    ESQVIEALSTVMEPDLKKDLVSLGMVQDITIDES-NNISFSVVLTTPACPMKDRIRQSCI  64

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAG------QLPPGLQTISNIVAVSSCKGGVGKST  711
            + V   +P    + V +   PAK    G      +    L  + NI+AV+S KGGVGKST
Sbjct  65   SAVKNHIPEAAAITVNL---PAKVTSGGSCGHHGERDNPLPGVRNIIAVASGKGGVGKST  121

Query  712  VAVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENRLLEMV  837
            VAVNLA +LA  GA VG+ DAD+YGPS+PTM   EN   E++
Sbjct  122  VAVNLAVSLAKTGASVGLIDADLYGPSIPTMFGLENARPEVI  163



>gb|AIC14569.1| Mrp family signature-containing protein and domain of unknown 
function DUF59 [Nitrososphaera viennensis EN76]
Length=372

 Score =   158 bits (400),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 110/180 (61%), Gaps = 5/180 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF---AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   I P E  GVK++S GF     Q   I RGP+VSG++ Q LT   WGELDYL+ID+P
Sbjct  153   ENNKIQPPEVAGVKVISMGFFYEQSQQAGIYRGPIVSGIVKQFLTDVNWGELDYLIIDLP  212

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGD  LT+ Q +P+T  +IVTTPQ +A     K V MF KL VP + VVENM   +  
Sbjct  213   PGTGDAPLTIAQTIPITGILIVTTPQDVAMNVAVKAVGMFHKLNVPIIGVVENMSFLNCP  272

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                ++ Y FGKG G ++   F IP + ++P+   +S   D+G P V+++P+   A +F++
Sbjct  273   HCNEQIYLFGKGGGKKISDDFNIPFIGEIPLHQHISQGSDTGKPTVLSEPQSFQAQSFEK  332


 Score =   125 bits (314),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 97/146 (66%), Gaps = 8/146 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL +L +++DP+   DIVS G +KDL +N+  G+V+F LELTTPACP     E+     
Sbjct  6    QVLGSLKKVVDPELHKDIVSMGMIKDLSIND--GKVAFTLELTTPACPFNSDIERDVRAA  63

Query  559  VAALPWVKTV--KVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +A +  VK +  +VT      + +   +L PG   + NIVAV+S KGGVGK+TV+VNLA 
Sbjct  64   IAGI-GVKDLQMRVTARVMEGRALNLDELLPG---VKNIVAVASGKGGVGKTTVSVNLAL  119

Query  733  TLADMGARVGIFDADVYGPSLPTMVS  810
            +LA  GA+VG+ DAD+YGPS+P M+ 
Sbjct  120  SLAKTGAKVGLLDADIYGPSVPLMLG  145



>ref|WP_014963653.1| MULTISPECIES: mrp [Nitrosopumilus]
 ref|YP_006774213.1| hypothetical protein NKOR_07000 [Candidatus Nitrosopumilus koreensis 
AR1]
 gb|AFS81271.1| hypothetical protein NKOR_07000 [Candidatus Nitrosopumilus koreensis 
AR1]
Length=369

 Score =   159 bits (403),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 126/210 (60%), Gaps = 11/210 (5%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P E  G+K+VSFGF A Q    AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  154   EDNKLQPAESNGLKVVSFGFFAEQAHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLP  213

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---  1249
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM HF   
Sbjct  214   PGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAIGMFEKLNVPIIGVVENMSHFICP  273

Query  1250  DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             + D +++Y FG G   ++ +QF +P L ++P+   + +  D G P ++ +P    +  F+
Sbjct  274   NCD-EKHYIFGDGGAKKISEQFNMPFLGEIPLNSGIMSGSDVGKPIMITNPDSPSSVAFR  332

Query  1430  ELGVCVVQQC----ARIRQQVSTAVSYDRS  1507
                  +  QC    A+++++V +  S + S
Sbjct  333   IAAKNIAAQCSILAAKLQEEVESEGSNEES  362


 Score =   124 bits (310),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 98/155 (63%), Gaps = 10/155 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+  G + F LELTTPACP     E+   + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--GNLKFTLELTTPACPFNAEIEEDVRKA  63

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQ---LPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +  L  VK   + ++A+    V  G+      G+ T+ NI+ V+S KGGVGKSTV++NLA
Sbjct  64   IDEL-GVKNFDMNVTAK----VMEGRSLDADTGMATVKNIIGVASGKGGVGKSTVSLNLA  118

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
              L   GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  119  LALQQTGAKVGLLDADIYGPSIPLMLGMKDGFMEV  153



>ref|WP_020248166.1| hypothetical protein [Marine Group I thaumarchaeote SCGC AB-629-I23]
Length=428

 Score =   159 bits (401),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 117/190 (62%), Gaps = 5/190 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             EK+ ++P EY G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  159   EKRKLVPPEYEGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTLWTDLDYLIVDLP  218

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MFSKL VP + VVENM HF+  
Sbjct  219   PGTGDIPLTLAQTIPITGILVVTTPQEVASSVASKAIGMFSKLNVPMLGVVENMSHFECS  278

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FG+G   ++ ++  +P +  +P+   +    + G P ++  P    A  F  
Sbjct  279   KCNEKHYIFGQGGAERISEKHNMPLVGAIPLNSGIMEGSELGKPVMITQPDSPSAEAFTV  338

Query  1433  LGVCVVQQCA  1462
                 +  QC+
Sbjct  339   AAKNIAAQCS  348


 Score =   124 bits (312),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +V+  L+ +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  E    +V
Sbjct  6    DVINKLSTVIDPDLNKDIVSMGMIKDLDLNS--GNLKFTLELTTPACPFNEQIESDVRKV  63

Query  559  VAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +  + + ++A+    + + A +   G   + NIVAV+S KGGVGKSTVA+NL+ 
Sbjct  64   IDELDGINNLDMNVTAKVMEGRSLDADEFMKG---VKNIVAVASGKGGVGKSTVALNLSL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMV  807
             LA  GA+VG+ DAD+YGPS+P M+
Sbjct  121  ALAKTGAKVGLLDADIYGPSIPLML  145



>ref|WP_012215617.1| mrp [Nitrosopumilus maritimus]
 ref|YP_001582568.1| hypothetical protein Nmar_1234 [Nitrosopumilus maritimus SCM1]
 gb|ABX13130.1| protein of unknown function DUF59 [Nitrosopumilus maritimus SCM1]
Length=370

 Score =   159 bits (401),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 82/210 (39%), Positives = 125/210 (60%), Gaps = 11/210 (5%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGR--AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P E  G+K+VSFGF A Q    AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  155   EDNKLQPAESNGLKVVSFGFFAEQAHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---  1249
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM HF   
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAIGMFEKLNVPIIGVVENMSHFICP  274

Query  1250  DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             + D +R+Y FG G   ++ +Q  +P L ++P+   + +  D G P ++ +P    A  F+
Sbjct  275   NCD-ERHYIFGDGGAKKISEQHNMPFLGEIPLNSGIMSGSDIGKPIMITNPDSPSADAFR  333

Query  1430  ELGVCVVQQC----ARIRQQVSTAVSYDRS  1507
                  +  QC    A++++++ +  S + S
Sbjct  334   IAAKNIAAQCSILAAKLQEEMESEGSNEES  363


 Score =   123 bits (309),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 96/155 (62%), Gaps = 9/155 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+    + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--NNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKTVKVTMSAQPAKPVFAGQ---LPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            +  L  +K   + ++A+    V  G+      G+ T+ NI+ V+S KGGVGKSTV++NLA
Sbjct  64   IGELTELKNFDMNVTAK----VMEGRSLDADTGMATVKNIIGVASGKGGVGKSTVSLNLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
              L   GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  120  LALQQTGAKVGLLDADIYGPSIPLMLGMKDGFMEV  154



>ref|WP_012780225.1| mrp [Pedobacter heparinus]
 ref|YP_003090334.1| hypothetical protein Phep_0046 [Pedobacter heparinus DSM 2366]
 gb|ACU02272.1| protein of unknown function DUF59 [Pedobacter heparinus DSM 2366]
Length=368

 Score =   164 bits (414),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 87/202 (43%), Positives = 119/202 (59%), Gaps = 8/202 (4%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
             K  IIP E  G+KL+S GF       +  RGPM S  + QL    +WGELDYL++D+PPG
Sbjct  160   KTLIIPIEKYGIKLLSLGFFADPDQPVPWRGPMASNAVKQLFNDADWGELDYLIVDLPPG  219

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFS--KLKVPCVAVVENMCHF---  1249
             TGDI +T+ Q  P+  AVIVTTPQ++A  D  KG+ MF    + +P + VVENM +F   
Sbjct  220   TGDIHITITQSFPIAGAVIVTTPQQVALADTRKGLAMFKMPSINIPVLGVVENMAYFTPA  279

Query  1250  DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             +    +YY FGK  G ++ + FG+P L ++PI  +++  GDSG P V  D    VA +F 
Sbjct  280   ELPENKYYIFGKDGGKELAKSFGVPFLGEIPIVQSITEGGDSGVP-VAMDTHNSVARSFA  338

Query  1430  ELGVCVVQQCARIRQQVSTAVS  1495
             E+   V QQ A    Q +  VS
Sbjct  339   EIAGKVAQQIAINNAQSAGNVS  360


 Score =   118 bits (296),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-  546
            ++ +VL AL  + DPD   D+V+   +KDL + +    +SF LELTTPACP+KDM +   
Sbjct  4    SQEQVLAALRNVEDPDLKKDLVTLNMIKDLKIEDK--HISFTLELTTPACPMKDMLKNAC  61

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
             N +   +     +++ ++++  +P+   QL    + I NI+ VSS KGGVGKSTVA NL
Sbjct  62   LNAIKHFVSREAEIEINITSRVTRPMDTTQL----KAIRNIILVSSGKGGVGKSTVASNL  117

Query  727  AYTLADMGARVGIFDADVYGPSLPTM  804
            A  L   GA+VG+ DAD+YGPS+PTM
Sbjct  118  AIALGADGAKVGLIDADIYGPSVPTM  143



>ref|XP_009516755.1| hypothetical protein PHYSODRAFT_471037 [Phytophthora sojae]
 gb|EGZ29480.1| hypothetical protein PHYSODRAFT_471037 [Phytophthora sojae]
Length=299

 Score =   232 bits (591),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 127/284 (45%), Positives = 179/284 (63%), Gaps = 17/284 (6%)
 Frame = +2

Query  953   VSFGFAGQ----------GRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQL  1102
             +SFGF  Q          G A+MRGPMVS +I+QL+  TEWG+LDYLV+DMPPGTGDIQ+
Sbjct  1     MSFGFVNQRAAPGAGVGVGAAVMRGPMVSKLIDQLVLGTEWGDLDYLVVDMPPGTGDIQM  60

Query  1103  TLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD-ADGKRYYPF  1279
             +L Q + ++AAV+VTTPQKL+F+DV KG+ MF  LKV   AVVENM +FD + G R+YPF
Sbjct  61    SLSQQMAISAAVVVTTPQKLSFVDVEKGIAMFEDLKVRTAAVVENMSYFDCSHGHRHYPF  120

Query  1280  GKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQC  1459
             G G   ++V ++ + ++F LPI    S+SGDSG P V++    E   T+  L   V ++ 
Sbjct  121   GPGHTQELVDKYNMKNVFKLPISEQFSSSGDSGRPFVLSGLSPEQEKTYDSLATTVAKEL  180

Query  1460  ARIRQQVSTA--VSYD--RSIKAIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQK  1627
               ++  V  A  + YD  R I  +++   N+ +E  LHPA +R   R A+ + E++GEQ 
Sbjct  181   VVLKHNVRLAPELLYDSNRGI-VLRLYSLNAAKEAVLHPADLRAKCRCAQCIDEFTGEQI  239

Query  1628  LQYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
             L  + +P+DI P  +   GNYA ++TW DG  S +  YD L  I
Sbjct  240   LDPATIPDDIRPTAVERKGNYAFAVTWSDGHSSSLYTYDALTAI  283



>gb|AIF12615.1| ATP-binding protein involved in chromosome partitioning (mrp) 
[uncultured marine thaumarchaeote KM3_56_D04]
Length=365

 Score =   152 bits (385),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 114/190 (60%), Gaps = 5/190 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             EKK +IP E  G+K+VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  157   EKKKLIPPESNGIKVVSFGFFAEQEHQAAIYRGPIISGIVKQFLVDTLWTDLDYLIVDLP  216

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD  1258
             PGTGDI LTL Q +P+T  ++VTTPQ++A    +K + MF+KL VP + V+ENM HF   
Sbjct  217   PGTGDIPLTLAQTIPITGILVVTTPQEVASSVASKAIGMFAKLNVPMLGVLENMSHFVCS  276

Query  1259  --GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
                +++Y FG G   ++ ++  +P +  +P+   +    + G P ++  P    A  F  
Sbjct  277   KCNEKHYIFGSGGAEKISEKHNMPFVGAIPLNSGIMEGSELGKPVMITQPDSPSAEAFTI  336

Query  1433  LGVCVVQQCA  1462
                 +  QC+
Sbjct  337   AAKNIAAQCS  346


 Score =   129 bits (324),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 7/154 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL  L  +IDPD   DIVS G +KDL +N   G + F LELTTPACP  +  EQ   + 
Sbjct  6    DVLNKLTTVIDPDLKKDIVSMGMIKDLELNS--GNLKFTLELTTPACPFNEEIEQDVRKA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +    +KVT      + + A +    L+ + NIVAV+S KGGVGKSTVA+NLA 
Sbjct  64   IDELDGIDKFDMKVTAKVMEGRSLDADEF---LKGVKNIVAVASGKGGVGKSTVALNLAL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             L+  GA+VG+ DAD+YGPS+P M+  +  ++E+
Sbjct  121  ALSKTGAKVGLLDADIYGPSIPLMLGMKGTMMEV  154



>ref|WP_015744925.1| mrp [Candidatus Methylomirabilis oxyfera]
 ref|YP_003207262.1| protein mrp [Candidatus Methylomirabilis oxyfera]
 emb|CBE69433.1| Protein mrp homolog [Candidatus Methylomirabilis oxyfera]
Length=360

 Score =   144 bits (362),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 104/180 (58%), Gaps = 4/180 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF--AGQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             E   +IP    GVK++S GF        + RGPM+  ++ + L   EWGELDYLVID+PP
Sbjct  154   EAGRMIPPLMHGVKIMSMGFFLPKNEAVVWRGPMLHKMVQEFLGHVEWGELDYLVIDLPP  213

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGDIQL+LCQ +PLT AVIV+TPQ +A    +K + MF+KLK P + +VENM ++    
Sbjct  214   GTGDIQLSLCQTIPLTGAVIVSTPQDVALEVASKAILMFNKLKTPILGIVENMSYYACSQ  273

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G R   FG G      ++  IP L ++P+   +  S D G P  +      VA  F E+
Sbjct  274   CGHREDIFGHGGAKAASEKAEIPFLGEIPLDSYIRRSSDEGRPVAMESADTSVARAFHEV  333


 Score =   137 bits (345),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 10/149 (7%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E  VL+ALA+I DPD   DIVS GF++D+ ++   G+V F +ELTTPACP++   E+ A 
Sbjct  4    ERAVLEALAKIPDPDLHRDIVSLGFIRDVQIDG--GKVRFAIELTTPACPVRKQMEEGAR  61

Query  553  EVVAALPWVKTVKVTMSAQ---PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVN  723
            +VVAALP V+ V+VTM+++     +P      P  L  + N VAV+S KGGVGKSTVA N
Sbjct  62   QVVAALPGVEQVEVTMTSRVTTSREP-----QPSYLSGVLNTVAVASGKGGVGKSTVAAN  116

Query  724  LAYTLADMGARVGIFDADVYGPSLPTMVS  810
            LA  L   GARVG+ DADVYGP +P ++ 
Sbjct  117  LAVALMRTGARVGLMDADVYGPCIPKLMG  145



>ref|WP_007402098.1| mrp [Candidatus Nitrosoarchaeum limnia]
 gb|EGG42153.1| hypothetical protein Nlim_0968 [Candidatus Nitrosoarchaeum limnia 
SFB1]
Length=367

 Score =   157 bits (397),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 116/190 (61%), Gaps = 5/190 (3%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI  1096
             P +  G+++VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+PPGTGDI
Sbjct  161   PAKSNGLQVVSFGFFAEQSHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLPPGTGDI  220

Query  1097  QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF--DADGKRY  1270
              LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM HF   +  +++
Sbjct  221   PLTLAQTIPITGILVVTTPQDVASNVAVKAIGMFEKLNVPIIGVVENMSHFICPSCNEKH  280

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
             Y FG G   ++ +QF IP L ++P+   + +  D G P ++ +P    A+ F+     + 
Sbjct  281   YIFGDGGAKKISEQFKIPFLGEIPLNSGIMSGSDLGKPIMITNPDSPSATAFRSTAKNIA  340

Query  1451  QQCARIRQQV  1480
              QC+ +  ++
Sbjct  341   AQCSILAAKM  350


 Score =   124 bits (310),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 97/154 (63%), Gaps = 7/154 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+    + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--NNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +A +  +K   +KVT      + + A     G+ T+ NI+ V+S KGGVGKSTV++NLA 
Sbjct  64   IAEIKELKNFDMKVTAKVMEGRSLDADS---GMATVKNIIGVASGKGGVGKSTVSLNLAL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             L+  GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  121  ALSQTGAKVGLLDADIYGPSIPLMLGMKSAHMEV  154



>ref|WP_036675354.1| ATP-binding protein, partial [Pedobacter heparinus]
Length=353

 Score =   162 bits (411),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 115/191 (60%), Gaps = 8/191 (4%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
             K  IIP E  G+KL+S GF       +  RGPM S  + QL    +WGELDYL++D+PPG
Sbjct  159   KTLIIPIEKYGIKLLSLGFFADPDQPVPWRGPMASNAVKQLFNDADWGELDYLIVDLPPG  218

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFS--KLKVPCVAVVENMCHF---  1249
             TGDI +T+ Q  P+  AVIVTTPQ++A  D  KG+ MF    + +P + VVENM +F   
Sbjct  219   TGDIHITITQSFPIAGAVIVTTPQQVALADTRKGLAMFKMPSINIPVLGVVENMAYFTPA  278

Query  1250  DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
             +    +YY FGK  G ++ + FG+P L ++PI  +++  GDSG P V  D    VA +F 
Sbjct  279   ELPENKYYIFGKDGGKELAKSFGVPFLGEIPIVQSITEGGDSGVP-VAMDTHNSVARSFA  337

Query  1430  ELGVCVVQQCA  1462
             E+   V QQ A
Sbjct  338   EIAGKVAQQIA  348


 Score =   118 bits (295),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 93/146 (64%), Gaps = 7/146 (5%)
 Frame = +1

Query  370  AEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-  546
            ++ +VL AL  + DPD   D+V+   +KDL + +    +SF LELTTPACP+KDM +   
Sbjct  3    SQEQVLAALRNVEDPDLKKDLVTLNMIKDLKIEDK--HISFTLELTTPACPMKDMLKNAC  60

Query  547  ANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNL  726
             N +   +     +++ ++++  +P+   QL    + I NI+ VSS KGGVGKSTVA NL
Sbjct  61   LNAIKHFVSREAEIEINITSRVTRPMDTTQL----KAIRNIILVSSGKGGVGKSTVASNL  116

Query  727  AYTLADMGARVGIFDADVYGPSLPTM  804
            A  L   GA+VG+ DAD+YGPS+PTM
Sbjct  117  AIALGADGAKVGLIDADIYGPSVPTM  142



>ref|WP_011745830.1| ATP-binding protein [Chlorobium phaeobacteroides]
 ref|YP_912450.1| hypothetical protein Cpha266_2014 [Chlorobium phaeobacteroides 
DSM 266]
 gb|ABL66026.1| protein of unknown function DUF59 [Chlorobium phaeobacteroides 
DSM 266]
Length=357

 Score =   161 bits (407),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 112/193 (58%), Gaps = 3/193 (2%)
 Frame = +2

Query  914   KTIIPTEYLGVKLVSFGFAGQGRA--IMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGT  1087
             K +IP E  G+KL+S GF  +     I RGPM S  I Q +   EW ELDYL+ D+PPGT
Sbjct  162   KKLIPLEKYGIKLMSIGFLVETDTALIWRGPMASSAIKQFINDVEWPELDYLIFDLPPGT  221

Query  1088  GDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-DGK  1264
             GDIQLTL Q +P+T AVIVTTPQ +A  DV+K V MF K++VP + ++ENM H++  DG 
Sbjct  222   GDIQLTLVQTIPVTGAVIVTTPQDVALADVSKAVNMFRKMQVPILGLIENMSHYELPDGT  281

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVC  1444
             + Y FG   G    +   I  L  +PI   +   GD G P V++ PR   A  F +    
Sbjct  282   KDYIFGMHGGENFAKAQAIAFLGSIPIDREIREGGDKGKPVVLSQPRSVSAQAFSQATKE  341

Query  1445  VVQQCARIRQQVS  1483
             V +Q +     ++
Sbjct  342   VARQISLFNAHMN  354


 Score =   119 bits (297),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 97/147 (66%), Gaps = 4/147 (3%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-A  549
            E +VL AL  + +PD   D+V+ G +KD+ ++EA   ++  + LTTPACP+K+   Q   
Sbjct  4    EEQVLAALKTVAEPDLKKDLVTLGMIKDIHIDEA-NNIACTVVLTTPACPMKNQIRQSCI  62

Query  550  NEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPG--LQTISNIVAVSSCKGGVGKSTVAVN  723
            + +  +LP   T+++TMS++        +      L+ + NI+AV+S KGGVGKSTVAVN
Sbjct  63   DAIKTSLPEAGTIEITMSSKVTSSCDHHECDHERPLKEVKNIIAVASGKGGVGKSTVAVN  122

Query  724  LAYTLADMGARVGIFDADVYGPSLPTM  804
            LA +LA  GA+VG+ DAD+YGPS+PTM
Sbjct  123  LAISLAREGAKVGLIDADLYGPSIPTM  149



>ref|WP_011242756.1| mrp [Synechococcus elongatus]
 ref|YP_171154.1| chromosome partitioning ATPase [Synechococcus elongatus PCC 6301]
 ref|YP_400122.1| MRP protein-like protein [Synechococcus elongatus PCC 7942]
 dbj|BAD78634.1| ATP-binding protein involved in chromosome partitioning [Synechococcus 
elongatus PCC 6301]
 gb|ABB57135.1| MRP protein-like [Synechococcus elongatus PCC 7942]
 gb|AJD58349.1| sodium:proton antiporter [Synechococcus sp. UTEX 2973]
Length=361

 Score =   166 bits (419),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 90/203 (44%), Positives = 121/203 (60%), Gaps = 16/203 (8%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFA-GQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDM  1075
             +P+   ++P E  G+KLVS  F     + +M RGPM++G+I Q L  TEWGELDYL++DM
Sbjct  158   SPQGDILVPIETHGIKLVSMAFLIDPDQPVMWRGPMLNGIIRQFLYQTEWGELDYLIVDM  217

Query  1076  PPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF--  1249
             PPGTGD QLTL Q VPL  AVIVTTPQ ++ +D  KG+RMF +LKVP + +VENM +F  
Sbjct  218   PPGTGDAQLTLAQAVPLAGAVIVTTPQTVSLLDSRKGLRMFQQLKVPVLGIVENMSYFIP  277

Query  1250  -DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTF  1426
              D   +RY  FG G G +  ++  +  L  +P+   L   GD G P VV+ P    A   
Sbjct  278   PDLPDRRYDIFGSGGGEKTAKELEVSLLGGIPLEIPLREGGDRGVPIVVSQPESASA---  334

Query  1427  QELGVCVVQQCARIRQQVSTAVS  1495
                     Q    I Q+++ AVS
Sbjct  335   --------QALTAIAQKIAAAVS  349


 Score =   113 bits (283),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 92/146 (63%), Gaps = 5/146 (3%)
 Frame = +1

Query  376  AEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANE  555
            A VL AL  + DP+    +V    ++D+ +  A  +VSFRL LTTPACP++++      +
Sbjct  6    AAVLDALRPVEDPELRRSLVELNMIRDVAI--AGDQVSFRLVLTTPACPLRELIVADCEK  63

Query  556  VVAALPWVKTVKVTMSAQ-PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
             V ALP V +V + + A+ P +     +   G+  + NI+A+SS KGGVGKSTV+VN A 
Sbjct  64   AVKALPGVASVAIEVGAEIPQQRSLPDR--QGIGGVRNILAISSGKGGVGKSTVSVNTAV  121

Query  733  TLADMGARVGIFDADVYGPSLPTMVS  810
             LA  GARVG+ DAD+YGP+ PTM+ 
Sbjct  122  ALAKAGARVGLLDADIYGPNTPTMLG  147



>ref|WP_010191223.1| mrp [Candidatus Nitrosoarchaeum limnia]
 gb|EPA05954.1| ATP-binding protein, Mrp/Nbp35 family [Candidatus Nitrosoarchaeum 
limnia BG20]
Length=367

 Score =   155 bits (392),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 74/190 (39%), Positives = 115/190 (61%), Gaps = 5/190 (3%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDI  1096
             P +  G+++VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+PPGTGDI
Sbjct  161   PAKSNGLQVVSFGFFAEQSHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLPPGTGDI  220

Query  1097  QLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF--DADGKRY  1270
              LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM HF   +  +++
Sbjct  221   PLTLAQTIPITGILVVTTPQDVASNVAVKAIGMFEKLNVPIIGVVENMSHFICPSCSEKH  280

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
             Y FG G   ++ +QF IP L ++P+   + +  D G P ++ +P    A  F+     + 
Sbjct  281   YIFGDGGAKKISEQFKIPFLGEIPLNSGIMSGSDLGKPIMITNPDSPSAIAFRSTAKNIA  340

Query  1451  QQCARIRQQV  1480
              QC+ +  ++
Sbjct  341   AQCSILAAKM  350


 Score =   124 bits (310),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 97/154 (63%), Gaps = 7/154 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+    + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--NNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +A +  +K   +KVT      + + A     G+ T+ NI+ V+S KGGVGKSTV++NLA 
Sbjct  64   IAEIKELKNFDMKVTAKVMEGRSLDADS---GMATVKNIIGVASGKGGVGKSTVSLNLAL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             L+  GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  121  ALSQTGAKVGLLDADIYGPSIPLMLGMKSAHMEV  154



>ref|WP_013457638.1| mrp [Oceanithermus profundus]
 ref|YP_004057641.1| atpase-like, para/mind [Oceanithermus profundus DSM 14977]
 gb|ADR36468.1| ATPase-like, ParA/MinD [Oceanithermus profundus DSM 14977]
Length=368

 Score =   153 bits (387),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 102/145 (70%), Gaps = 7/145 (5%)
 Frame = +1

Query  376  AEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANE  555
            A VL+AL+ I+DPDF  DIV  GFV+DL + +  G VSF + LTTPACPIKD F+++A E
Sbjct  5    ATVLQALSTIVDPDFKKDIVELGFVRDLKIED--GVVSFTIRLTTPACPIKDQFKRQAEE  62

Query  556  VVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYT  735
             V ALP V+ V+VTM A PA  V  G     L  +++IVAV + KGGVGKST AVNLA  
Sbjct  63   AVGALPGVREVRVTMDAAPAMEVSTG-----LPGVAHIVAVIAGKGGVGKSTTAVNLAVA  117

Query  736  LADMGARVGIFDADVYGPSLPTMVS  810
            L  MGA+VG+FDAD +GP+ P M+ 
Sbjct  118  LMQMGAKVGLFDADAFGPNTPRMLG  142


 Score =   125 bits (313),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 100/176 (57%), Gaps = 6/176 (3%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFA--GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             I+P E  G+KLVS G A       + RG +  G +      TEWGELDYLV+DMPPGTGD
Sbjct  155   IVPIEAQGIKLVSIGSAIPEDQPVVWRGSLQHGFVRDFTQKTEWGELDYLVVDMPPGTGD  214

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD--GKR  1267
             I L++ Q++PL+ A++V TPQ++A  DV +GV M +K+ V  +  VENM +      G+ 
Sbjct  215   IPLSVMQLLPLSGALVVGTPQEVALEDVRRGVTMLNKMNVNLLGFVENMSYLVCPNCGEE  274

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
                FGKG      + FG P L  +P+   +    D+G P    +  G VA  ++EL
Sbjct  275   IDVFGKGGMDAFAETFGAPVLARIPMDVNIRKGSDAGLPAAFQE--GPVAEAYKEL  328



>ref|WP_039728291.1| sodium:proton antiporter [Lyngbya confervoides]
 gb|KIF15985.1| sodium:proton antiporter [Aphanocapsa montana BDHKU210001]
 gb|KIF40910.1| sodium:proton antiporter [Lyngbya confervoides BDU141951]
Length=357

 Score =   157 bits (397),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 105/174 (60%), Gaps = 5/174 (3%)
 Frame = +2

Query  941   GVKLVSFGFA--GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQLTLCQ  1114
             GVK+VS GF        I RGPM++GVI Q L    WGELDYLV+D+PPGTGD QLTL Q
Sbjct  173   GVKMVSMGFLIDRDQPVIWRGPMLNGVIRQFLYQVTWGELDYLVVDLPPGTGDAQLTLAQ  232

Query  1115  VVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---DADGKRYYPFGK  1285
              VP+  AVIVTTPQ +A  D  +G++MF +LKVP + +VENM +F   D   K+Y  FG 
Sbjct  233   AVPMAGAVIVTTPQNVALSDARRGLKMFQQLKVPVIGIVENMSYFIPPDMPDKQYDIFGS  292

Query  1286  GSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCV  1447
             G G +  Q+ G+P +  +P+   +   GD G P VV  P    A    E+   V
Sbjct  293   GGGEKAAQELGVPLIGCVPLEMDVREGGDRGIPIVVQSPESASAKALVEIAKSV  346


 Score =   120 bits (302),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 98/148 (66%), Gaps = 7/148 (5%)
 Frame = +1

Query  382  VLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVV  561
            +L+ L  + DP+    +V    ++++ VN+  G+VSF L LTTPACP+++   +   + V
Sbjct  10   ILQVLRPVQDPELQKSLVELNMIRNVAVND--GDVSFTLVLTTPACPLREFIVEDCEKAV  67

Query  562  AALPWVKTVKVTMSAQPAKPVFAGQLPP--GLQTISNIVAVSSCKGGVGKSTVAVNLAYT  735
              LP VK+V V ++A+  +      LP   G++ + NI+AVSS KGGVGKSTVAVNLA  
Sbjct  68   RTLPGVKSVNVEVTAETPQ---QKSLPDRQGIEGVKNIIAVSSGKGGVGKSTVAVNLAVA  124

Query  736  LADMGARVGIFDADVYGPSLPTMVSPEN  819
            LA +GA+VG+ DAD+YGP+ PTM+  E+
Sbjct  125  LAQVGAKVGLIDADIYGPNAPTMLGLES  152



>ref|WP_026369263.1| mrp [bacterium JKG1]
Length=358

 Score =   157 bits (396),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 78/182 (43%), Positives = 112/182 (62%), Gaps = 5/182 (3%)
 Frame = +2

Query  902   NPEKKTIIPTEYLGVKLVSFGFA--GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDM  1075
              PE+K ++P E  G++ +S G+        I RGP++S ++ Q L    WGELDYLV+D+
Sbjct  164   TPERK-MVPLEAFGIRTISVGYLVPEDQPLIFRGPIISSMLRQFLYDVAWGELDYLVVDL  222

Query  1076  PPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA  1255
             PPGTGDIQLTL Q +PL+ AVIVTTPQ +A  DV +G+ MF KL VP + ++ENM +F  
Sbjct  223   PPGTGDIQLTLAQAIPLSGAVIVTTPQDVAMADVTRGIEMFRKLNVPILGLIENMSYFRC  282

Query  1256  D--GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
                G+R   F  G      ++FG+P L ++P+   +   GD+G P V +D     A  F+
Sbjct  283   PHCGERAEIFAHGGAQAASRKFGVPFLGEIPLSLAIREGGDTGRPAVTSDQPEAYAEAFR  342

Query  1430  EL  1435
             E+
Sbjct  343   EV  344


 Score =   120 bits (302),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 99/156 (63%), Gaps = 7/156 (4%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            N+ +E  VL ALA + +P+ G D+VS   +K L ++++   V+  ++LTTPACP+KD  E
Sbjct  9    NELSEEAVLAALATVQEPELGGDLVSRRMIKHLQIDDS--RVAVTIDLTTPACPLKDQIE  66

Query  541  QKANEVVAALPWVKTVKVTMSAQPAK--PVFAGQLPPGLQTISNIVAVSSCKGGVGKSTV  714
            Q+    V  +P V+ V V  +A   +   +F     PG   +++++AV+S KGGVGKSTV
Sbjct  67   QEVRAAVLRVPGVREVAVEFTATVRQNPGLFNKASIPG---VAHVIAVASGKGGVGKSTV  123

Query  715  AVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            A NLA  LA  GAR G+ DADVYGPS P M++ + R
Sbjct  124  ATNLAIALAQEGARAGLLDADVYGPSAPIMLNLKGR  159



>ref|WP_007551075.1| mrp [Candidatus Nitrosoarchaeum koreensis]
 gb|EGP94156.1| MRP protein-like protein [Candidatus Nitrosoarchaeum koreensis 
MY1]
Length=367

 Score =   158 bits (400),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 78/203 (38%), Positives = 120/203 (59%), Gaps = 9/203 (4%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGR---AIMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             E   + P +Y G+++VSFGF  +     AI RGP++SG++ Q L  T W +LDYL++D+P
Sbjct  155   EDNKLQPAKYNGLQVVSFGFFAEQSHQAAIYRGPIISGILKQFLVDTNWSDLDYLIVDLP  214

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF--D  1252
             PGTGDI LTL Q +P+T  ++VTTPQ +A     K + MF KL VP + VVENM HF   
Sbjct  215   PGTGDIPLTLAQTIPITGILVVTTPQDVASNVAVKAISMFEKLNVPIIGVVENMSHFICP  274

Query  1253  ADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQE  1432
             +   ++Y FG G   ++ +QF IP L ++P+   + +  D G P ++  P    A  F+ 
Sbjct  275   SCNDKHYIFGDGGAQKISEQFKIPFLGEIPLNSGIMSGSDLGKPIMITSPDSPSAIAFRT  334

Query  1433  LGVCVVQQC----ARIRQQVSTA  1489
                 +  QC    A+++ ++ +A
Sbjct  335   SAKNIAAQCSILAAKMQDEMKSA  357


 Score =   119 bits (299),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEV  558
            +VL+ L+ +IDPD   DIVS G +KDL +N+    + F LELTTPACP     E    + 
Sbjct  6    QVLEKLSTVIDPDLKKDIVSMGMIKDLELND--NNLKFTLELTTPACPFNVEIEDDVRKA  63

Query  559  VAALPWVKT--VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            +  L  +K   +KVT      + + A      + T+ NI+ V+S KGGVGKSTV++NLA 
Sbjct  64   IGELKELKNFDMKVTAKVMEGRSLDADT---SMATVKNIIGVASGKGGVGKSTVSLNLAL  120

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEM  834
             L   GA+VG+ DAD+YGPS+P M+  ++  +E+
Sbjct  121  ALQQTGAKVGLLDADIYGPSIPLMLGMKSGHMEV  154



>ref|XP_009838186.1| hypothetical protein, variant 6 [Aphanomyces astaci]
 gb|ETV72503.1| hypothetical protein, variant 6 [Aphanomyces astaci]
Length=403

 Score =   161 bits (407),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 108/178 (61%), Gaps = 27/178 (15%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFAGQGRA---------IMRGPMVSGVINQLLTTTEWGELDYLVIDMP  1078
             P EY GV+ +SFGF     A         +MRG MVS VI+QL+  TEWG LDYLVIDMP
Sbjct  195   PVEYQGVQCMSFGFVNSKAAPGAGGKGAAVMRGAMVSKVIDQLVLGTEWGVLDYLVIDMP  254

Query  1079  PGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDA-  1255
             PGTGDI ++L Q V +T AVIVTTPQKL+F+DV KG+ MF  LKVP  AVVENM +FD  
Sbjct  255   PGTGDIHMSLAQQVAITTAVIVTTPQKLSFVDVEKGISMFEDLKVPTSAVVENMSYFDCV  314

Query  1256  DGKRYYPF-----------------GKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSG  1378
              G R+YPF                 G G    +  ++ IPH F LP+   ++ S D+G
Sbjct  315   HGHRHYPFGLFVIYRSFICSTLTGLGHGYLTTLQSRYSIPHTFQLPMADAMNISVDTG  372


 Score =   116 bits (291),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 93/160 (58%), Gaps = 2/160 (1%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EAEVL+ L  + D   G D+++ G VK+L +++    VS  ++  +P       +  +A 
Sbjct  34   EAEVLQTLKLVKDDLVGQDLITLGRVKNLEISDE-HAVSCTIDSPSPVLLQNQEWITQAT  92

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAY  732
            + + AL WV    V +S  P            L  + NI+AVSSCKGGVGKSTVAVNLA+
Sbjct  93   DRIKALSWVTGANVALS-HPTPRNIQATRSSSLANVGNIIAVSSCKGGVGKSTVAVNLAF  151

Query  733  TLADMGARVGIFDADVYGPSLPTMVSPENRLLEMVTSVPY  852
             L   GARVGI DAD+YGPSLPTM+SP +  +   T  P+
Sbjct  152  ALKKRGARVGILDADIYGPSLPTMISPPDVAIRKSTVNPH  191



>ref|WP_017717311.1| mrp [Oscillatoria sp. PCC 10802]
Length=356

 Score =   169 bits (427),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 116/193 (60%), Gaps = 12/193 (6%)
 Frame = +2

Query  926   PTEYLGVKLVSFGFA--GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQ  1099
             P    GVKLVS GF        I RGPM++G+I Q L   EWGELDYL++DMPPGTGD Q
Sbjct  168   PAFNCGVKLVSMGFLIDKDQPVIWRGPMLNGIIRQFLYQVEWGELDYLIVDMPPGTGDAQ  227

Query  1100  LTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---DADGKRY  1270
             LTL Q VP+  AVIVTTPQ +A +D  KG++MF ++ VP + +VENM +F   D   ++Y
Sbjct  228   LTLTQAVPMAGAVIVTTPQNVALLDARKGLKMFQQMGVPVLGIVENMSYFIPPDMPDRQY  287

Query  1271  YPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVV  1450
               FG G G +  Q+ G+P L  +P+   L   GD+G P V+ADP    A   QE+     
Sbjct  288   DIFGSGGGEKTAQELGVPLLGCVPLEIHLREGGDAGVPVVIADPECASAKALQEI-----  342

Query  1451  QQCARIRQQVSTA  1489
                 RI  +VS A
Sbjct  343   --AGRIAGRVSVA  353


 Score =   108 bits (270),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 95/144 (66%), Gaps = 5/144 (3%)
 Frame = +1

Query  382  VLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVV  561
            VL+ L  + DP+    +V    ++++ ++   G+VSF L LTTPACP+++   ++  + V
Sbjct  10   VLEVLRPVQDPELRKSLVEMNMIRNIKIDG--GKVSFTLVLTTPACPLREFIVEECQKAV  67

Query  562  AALPWVKTVKVTMSAQ-PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYTL  738
              LP V+ V V ++A+ P +     +   G+  + NI+A+SS KGGVGK+TVAVN+A +L
Sbjct  68   KDLPGVEDVVVDVTAETPQQKALPDR--QGIGGVKNILAISSGKGGVGKTTVAVNVAVSL  125

Query  739  ADMGARVGIFDADVYGPSLPTMVS  810
            A  GA+VG+ DAD+YGP++PTM+ 
Sbjct  126  ARAGAKVGMIDADIYGPNVPTMLG  149



>ref|WP_008478703.1| mrp [Nitrolancea hollandica]
 emb|CCF84500.1| Protein mrp homolog, putative ATPase [Nitrolancea hollandica 
Lb]
Length=365

 Score =   152 bits (383),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 108/170 (64%), Gaps = 4/170 (2%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFA-GQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             I+P E  GVK++S GF     RA++ RGP+V+ +INQ L   +WGELDYLVID+PPGTGD
Sbjct  163   IVPLEAFGVKMMSIGFLLDADRALIWRGPLVAQLINQFLNDVDWGELDYLVIDLPPGTGD  222

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD--GKR  1267
             +QLTL Q +PL+ A+IVTTPQ +A  D  KG+ MF ++K   + ++ENM +F     G+R
Sbjct  223   VQLTLVQRIPLSGAIIVTTPQDVALADAVKGLSMFKEVKTTILGIIENMSYFSCPHCGER  282

Query  1268  YYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVA  1417
                FG G G +   ++ +P L  +P+   +   GD+G P V A P    A
Sbjct  283   SEIFGFGGGERTATRYDVPLLGQIPLVTEIRQGGDTGHPIVAAAPESATA  332


 Score =   125 bits (313),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 6/156 (4%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            N   E +V++AL  + DP+ G  +V    +KD+ +++  G V  ++ELTTPACP+KD  E
Sbjct  4    NGLTEEQVIEALRPVKDPEIGRSLVELRMIKDVEISD--GAVQLKVELTTPACPLKDKIE  61

Query  541  QKANEVVAALPWVKTVKVTMSAQPAKPVFAGQLPPG--LQTISNIVAVSSCKGGVGKSTV  714
                + +  LP +K +K+T +++  +   AG LP    L  + N +AV+S KGGVGKSTV
Sbjct  62   TDVRQALTTLPGIKDLKITFTSR-VRSSGAG-LPDKSPLPGVKNTIAVASGKGGVGKSTV  119

Query  715  AVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            AVNLA +LA  GA VG+ DADVYGPS+P M+    R
Sbjct  120  AVNLAISLAQEGASVGLLDADVYGPSIPMMMGSGRR  155



>ref|WP_004595267.1| MULTISPECIES: hypothetical protein [Halorubrum]
 gb|ELZ32964.1| hypothetical protein C473_07209 [Halorubrum terrestre JCM 10247]
 gb|ELZ53863.1| hypothetical protein C465_00639 [Halorubrum distributum JCM 9100]
 gb|ELZ56018.1| hypothetical protein C466_04209 [Halorubrum distributum JCM 10118]
 gb|EMA57707.1| hypothetical protein C470_13507 [Halorubrum litoreum JCM 13561]
 gb|EMA67935.1| hypothetical protein C462_14725 [Halorubrum arcis JCM 13916]
Length=347

 Score =   157 bits (397),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 114/194 (59%), Gaps = 6/194 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + +TI+P E  GVKL+S  F  G+   ++ RGPMV  +I QL+   EWGELDYLV+D+PP
Sbjct  150   DGETIVPPERFGVKLMSMDFLTGEDDPVIWRGPMVHKIITQLVEDVEWGELDYLVMDLPP  209

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD QLT+ Q +PLT AVIVTTPQ +A  D  KG+RMF K     + + ENM  F    
Sbjct  210   GTGDTQLTILQTLPLTGAVIVTTPQDVALDDAVKGLRMFGKHDTNVLGIAENMAGFRCPD  269

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G  +  FG G G  + Q+  +P L  +P+ P +   GD G P V+ D  GE A  F+ L
Sbjct  270   CGGFHEIFGSGGGKALAQEHDLPFLGGIPLDPEVRTGGDDGEPVVLED--GETADAFKVL  327

Query  1436  GVCVVQQCARIRQQ  1477
                V      +R++
Sbjct  328   VENVANNAGVVRRR  341


 Score =   119 bits (299),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 92/151 (61%), Gaps = 8/151 (5%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            EA+V + LA + DPD G DIVS G V D+ V+E  G V   L L  P  P +        
Sbjct  3    EADVRERLADVRDPDLGDDIVSLGLVNDVEVDEGAGTVRVSLALGAPFSPNESAVADDVR  62

Query  553  EVVAALPWVKTVKVTMSAQPAKPVFAG-QLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            E +A       + V +SA     + A  Q+ PG+Q   N++AV+S KGGVGKSTVAVNLA
Sbjct  63   EALAD----TGLDVELSASIPDDLSADEQVLPGVQ---NVIAVASGKGGVGKSTVAVNLA  115

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENR  822
              L+ +GARVG+FDADVYGP++P MVS E R
Sbjct  116  AGLSQLGARVGLFDADVYGPNVPRMVSAEER  146



>ref|WP_017344385.1| ATP-binding protein [Halorubrum sp. T3]
Length=347

 Score =   157 bits (397),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 115/194 (59%), Gaps = 6/194 (3%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGF-AGQGRAIM-RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + +TI+P E  GVKL+S  F  G+   ++ RGPMV  +I QL+   EWGELDYLV+D+PP
Sbjct  150   DGETIVPPERFGVKLMSMDFLTGEDDPVIWRGPMVHKIITQLVEDVEWGELDYLVMDLPP  209

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFDAD-  1258
             GTGD QLT+ Q +PLT AVIVTTPQ++A  D  KG+RMF K     + + ENM  F    
Sbjct  210   GTGDTQLTILQTLPLTGAVIVTTPQEVALDDAVKGLRMFGKHDTNVLGIAENMAGFRCPD  269

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G  +  FG G G  + Q+  +P L  +P+ P +   GD G P V+ D  GE A  F+ L
Sbjct  270   CGGFHEIFGSGGGKALAQEHDLPFLGGIPLDPEVRTGGDDGEPVVLED--GETADAFKVL  327

Query  1436  GVCVVQQCARIRQQ  1477
                V      +R++
Sbjct  328   VENVANNAGVVRRR  341


 Score =   119 bits (297),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 71/151 (47%), Positives = 91/151 (60%), Gaps = 8/151 (5%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E++V + LA + DPD G DIVS G V D+ V+E  G V   L L  P  P +        
Sbjct  3    ESDVRERLADVRDPDLGDDIVSLGLVNDIEVDEGTGTVRVSLALGAPFSPNESAVADDVR  62

Query  553  EVVAALPWVKTVKVTMSAQ-PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            E +A       + V +SA  P       Q+ PG+Q   N++AV+S KGGVGKSTVAVNLA
Sbjct  63   EALAD----TGLDVELSASIPDDLSTDEQVLPGVQ---NVIAVASGKGGVGKSTVAVNLA  115

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENR  822
              L+ +GARVG+FDADVYGP++P MVS E R
Sbjct  116  AGLSQLGARVGLFDADVYGPNVPRMVSAEER  146



>ref|WP_012473003.1| mrp [Candidatus Amoebophilus asiaticus]
 ref|YP_001957967.1| hypothetical protein Aasi_0869 [Candidatus Amoebophilus asiaticus 
5a2]
 gb|ACE06238.1| hypothetical protein Aasi_0869 [Candidatus Amoebophilus asiaticus 
5a2]
Length=366

 Score =   163 bits (413),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/194 (45%), Positives = 120/194 (62%), Gaps = 11/194 (6%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAG--QGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             EKK ++P    G+KL S GF    +G  I RGPM S  + QLL  T W +LDYL+ID+PP
Sbjct  160   EKKYMLPLIKYGIKLNSIGFLTPQEGAVIWRGPMASSALRQLLYDTAWEDLDYLLIDLPP  219

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSK--LKVPCVAVVENMCHF--  1249
             GT DIQLTL Q VP+T  VIVTTPQK+A  DV K + MF K  ++VP + ++ENM +F  
Sbjct  220   GTSDIQLTLVQAVPVTGTVIVTTPQKVALSDVTKSIAMFQKSGIEVPILGIIENMAYFIP  279

Query  1250  --DADG-KRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVAS  1420
                A+G +RYYPFG+G G Q+  ++ +P L ++P+   +   GD G P   A   G++ +
Sbjct  280   EDSANGQQRYYPFGQGGGKQLADKYQVPFLGEIPLITAIREKGDQGIP--AATDSGKLNN  337

Query  1421  TFQELGVCVVQQCA  1462
              F  L   + QQ +
Sbjct  338   LFNGLASTLAQQIS  351


 Score =   112 bits (281),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 93/156 (60%), Gaps = 8/156 (5%)
 Frame = +1

Query  361  NQTAEAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFE  540
            N+  E  VL+AL+ + DPD   D+VS G ++ L V   + EV+F L LTTPACP+++  +
Sbjct  2    NKDLEKTVLQALSSVYDPDLKQDLVSLGMIQSLQV--TIKEVNFTLVLTTPACPLQEFLK  59

Query  541  QKANEVV-AALPWVKTVKVTMSAQ-PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTV  714
            +   E +   +     V + ++AQ        G LP     I NI+A+++ KGGVGKST+
Sbjct  60   KACIEAIHTQVNQQLIVNIQLTAQVTTNKSNTGTLP----HIKNIIAIAAGKGGVGKSTI  115

Query  715  AVNLAYTLADMGARVGIFDADVYGPSLPTMVSPENR  822
            A NLA  LA  GA VG+ DAD++GPS+P M   EN 
Sbjct  116  ATNLAVGLAQQGAAVGLLDADIFGPSIPIMFGCENE  151



>ref|WP_039749662.1| ATP-binding protein [Hassallia byssoidea]
 gb|KIF31599.1| ATP-binding protein [Hassallia byssoidea VB512170]
Length=363

 Score =   159 bits (401),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 116/191 (61%), Gaps = 9/191 (5%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAG--QGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
             K  I+P E  GVKL+S GF        I RGPM S  + Q  +   WG+LDYL+ID+PPG
Sbjct  160   KNMIVPLEQYGVKLLSIGFLAPPDSAMIWRGPMASSALKQFFSDALWGDLDYLLIDLPPG  219

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSK--LKVPCVAVVENMCHFDAD  1258
             TGDI LTL Q VP+T AVIVTTPQK+A  D  KG+ MF +  + VP + VVENM +F  +
Sbjct  220   TGDIHLTLVQTVPVTGAVIVTTPQKVALADANKGLLMFRQPAINVPVLGVVENMAYFTPE  279

Query  1259  ---GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
                  RYY FGK  G ++ ++ G+  L ++P+  ++  SGDSG P V+ +  G + + F 
Sbjct  280   ELPDNRYYIFGKDGGKKLAEKHGVTILGEIPLVQSIRESGDSGLPVVLKE--GPMQTAFM  337

Query  1430  ELGVCVVQQCA  1462
              L   + +Q A
Sbjct  338   ALAETLARQVA  348


 Score =   117 bits (292),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 6/151 (4%)
 Frame = +1

Query  373  EAEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKAN  552
            E ++L+AL+++ DPD   D+VS   ++D+ V  A   VSF + LTTPACP+KD   Q   
Sbjct  5    EKDILQALSKVEDPDLKRDLVSLNMIRDVKVAPA--SVSFTVVLTTPACPLKDKIRQDCY  62

Query  553  EVVAALPWVKT-VKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            + V A+      + +TM++          L PG   + NI+A++S KGGVGKSTV  NLA
Sbjct  63   DAVEAVTGADVEINITMTSSVTTLRSNAPLLPG---VKNIIAIASGKGGVGKSTVTANLA  119

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENR  822
              LA  GA+VG+ DAD+YGPS+PTM + E+ 
Sbjct  120  VALAKSGAKVGLIDADIYGPSVPTMFNCEHE  150



>ref|WP_017653912.1| mrp [Microchaete sp. PCC 7126]
Length=356

 Score =   164 bits (414),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 111/181 (61%), Gaps = 5/181 (3%)
 Frame = +2

Query  920   IIPTEYLGVKLVSFGFA--GQGRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGD  1093
             +IP    GVKLVS GF        I RGPM++GVI Q L   EWGELDYLV+DMPPGTGD
Sbjct  166   LIPAFNHGVKLVSMGFLIDRDQPVIWRGPMLNGVIRQFLYQVEWGELDYLVVDMPPGTGD  225

Query  1094  IQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHF---DADGK  1264
              QLTL Q VP+  AVIVTTPQ +A +D  KG+RMF ++ VP + +VENM +F   D   K
Sbjct  226   AQLTLTQAVPMAGAVIVTTPQTVALLDSRKGLRMFQQMNVPVLGIVENMSYFIPPDMPEK  285

Query  1265  RYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVC  1444
             +Y  FG G G +   + G+P L  +P+  +    GDSG P VV +P    A   + + + 
Sbjct  286   QYDIFGSGGGEKTAAELGVPLLGCVPLEISTRIGGDSGVPIVVQEPDSASAKALKAIALT  345

Query  1445  V  1447
             +
Sbjct  346   I  346


 Score =   111 bits (278),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  382  VLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVV  561
            VL+ L  + DP+    +V    ++++ + +  G+VSF L LTTPACP+K+   +   + V
Sbjct  10   VLEVLRPVQDPELQKSLVELNMIRNVKIED--GQVSFTLVLTTPACPLKEFIVEDCQKAV  67

Query  562  AALPWVKTVKVTMSAQPAKPVFAGQLPP--GLQTISNIVAVSSCKGGVGKSTVAVNLAYT  735
              LP V  V V ++A+  +      LP   G+  + NI+AVSS KGGVGKSTVAVN+A  
Sbjct  68   KKLPGVTKVSVEVTAETPQ---QKSLPDRTGVTGVKNIIAVSSGKGGVGKSTVAVNIAVA  124

Query  736  LADMGARVGIFDADVYGPSLPTMVS  810
            LA  GA+VG+ DAD+YGP+ PTM+ 
Sbjct  125  LAQTGAKVGLLDADIYGPNDPTMLG  149



>ref|WP_026464137.1| ATP-binding protein [Adhaeribacter aquaticus]
Length=367

 Score =   162 bits (410),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 122/195 (63%), Gaps = 9/195 (5%)
 Frame = +2

Query  902   NPEKKTII-PTEYLGVKLVSFGFAG--QGRAIMRGPMVSGVINQLLTTTEWGELDYLVID  1072
             +P+ + +I P E  G+K++S GF    +   + RGPM S  + Q ++  +WGELDYL+ID
Sbjct  158   SPDGRNLIEPVERYGIKMISIGFLAPAESAVVWRGPMASSALKQFISDVDWGELDYLLID  217

Query  1073  MPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFS--KLKVPCVAVVENMCH  1246
             +PPGT DI LT+ Q VP+T A+IVTTPQK+A  D  KG++MF   ++ VP + ++ENM +
Sbjct  218   LPPGTSDIHLTMVQTVPVTGAIIVTTPQKVALADAQKGLQMFKQPQINVPVLGIIENMAY  277

Query  1247  F---DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVA  1417
             F   +    +YY FG+G G Q+  ++ +P L  +P+  ++  SGD+G PEV+  P     
Sbjct  278   FTPAELPNNKYYIFGEGGGKQLSDRWNVPLLGQVPLIQSIRESGDAGRPEVL-KPDSPAG  336

Query  1418  STFQELGVCVVQQCA  1462
               F+E+   V QQ +
Sbjct  337   KVFEEIAQSVAQQVS  351


 Score =   112 bits (281),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 9/151 (6%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-ANE  555
            EVLKAL+ + +PD G D+V+   ++D+ +N    EVSF + LTTPACP+KD+      N 
Sbjct  7    EVLKALSYVEEPDLGKDLVTLNMIEDVEINGK--EVSFTVILTTPACPMKDLIRNACVNA  64

Query  556  VVAALPWVKTVKVTMSAQ--PAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLA  729
            V   +    +V V M+++   A+   +G L    + + NI+A++S KGGVGKSTV  NLA
Sbjct  65   VHIMVDKEASVTVNMTSRVTTARANNSGIL----KDVKNIIAIASGKGGVGKSTVTSNLA  120

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPENR  822
              LA MGA+VG+ DAD+ GPS+P M   E  
Sbjct  121  IALAQMGAKVGLIDADISGPSIPVMFDTEEE  151



>gb|ETZ19296.1| mrp [Pedobacter sp. V48]
Length=370

 Score =   154 bits (388),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 117/199 (59%), Gaps = 8/199 (4%)
 Frame = +2

Query  911   KKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPPG  1084
             K  I+P E  G+KL+S GF       +  RGPM S  + QL    +WGELDYL++D+PPG
Sbjct  172   KTLILPIEKYGIKLLSLGFFADPDQPVPWRGPMASNAVKQLFNDADWGELDYLIVDLPPG  231

Query  1085  TGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSK--LKVPCVAVVENMCHFDAD  1258
             TGDI +T+ Q  P+T AVIVTTPQ++A  D  KG+ MF    + +P + VVENM +F  +
Sbjct  232   TGDIHITITQSFPITGAVIVTTPQQVALADTRKGLAMFKMPGINIPVLGVVENMAYFTPE  291

Query  1259  ---GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQ  1429
                  +YY FGK  G ++ + F +P L ++PI  +++ +GD+G P +  +    ++  F 
Sbjct  292   ELPESKYYIFGKDGGKELAKSFDVPFLGEIPIVQSIAEAGDNGAP-IALNTESVLSGAFA  350

Query  1430  ELGVCVVQQCARIRQQVST  1486
             E+   V QQ A    Q + 
Sbjct  351   EIAGRVAQQVAINNAQTAN  369


 Score =   120 bits (302),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/143 (48%), Positives = 93/143 (65%), Gaps = 7/143 (5%)
 Frame = +1

Query  379  EVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQK-ANE  555
            +VL AL  + DPD   D+V+   +KDL + +    VSF LELTTPACP+KDM +    N 
Sbjct  19   QVLAALRNVEDPDLKKDLVTLNMIKDLKIEDK--NVSFTLELTTPACPMKDMLKNACLNA  76

Query  556  VVAALPWVKTVKVTMSAQPAKPVFAGQLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYT  735
            +   +     V + ++++  KP+ + QL    + I NI+ VSS KGGVGKSTVA NLA +
Sbjct  77   IKHFVSQQAEVSINITSRVTKPMDSTQL----KDIRNIILVSSGKGGVGKSTVASNLAVS  132

Query  736  LADMGARVGIFDADVYGPSLPTM  804
            LA  GA+VG+ DAD+YGPS+PTM
Sbjct  133  LAADGAKVGLIDADIYGPSVPTM  155



>ref|WP_015118640.1| chromosome partitioning ATPase [Rivularia sp. PCC 7116]
 ref|YP_007055614.1| chromosome partitioning ATPase [Rivularia sp. PCC 7116]
 gb|AFY55067.1| ATPase involved in chromosome partitioning [Rivularia sp. PCC 
7116]
Length=356

 Score =   168 bits (425),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 90/191 (47%), Positives = 117/191 (61%), Gaps = 6/191 (3%)
 Frame = +2

Query  893   NL*NPEKKTII-PTEYLGVKLVSFGFA--GQGRAIMRGPMVSGVINQLLTTTEWGELDYL  1063
             N+   EK  I+ P    GVKLVS GF        I RGPM++GVI Q L   EWGELDYL
Sbjct  156   NVRQGEKGEILEPAFNHGVKLVSMGFLIDRDQPVIWRGPMLNGVIRQFLYQVEWGELDYL  215

Query  1064  VIDMPPGTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC  1243
             ++DMPPGTGD QLTL Q VP+  AVIVTTPQ +A +D  KG+RMF ++KVP + ++ENM 
Sbjct  216   IVDMPPGTGDAQLTLTQAVPIAGAVIVTTPQNVALLDSRKGLRMFQQMKVPVLGIIENMS  275

Query  1244  HF---DADGKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEV  1414
             +F   D   K+Y  FG G G +   + GIP L  +P+  +    GD G P V+ADP    
Sbjct  276   YFIPPDMPEKQYDIFGSGGGLKTATELGIPLLGCVPLEISTRVGGDKGIPIVIADPESAS  335

Query  1415  ASTFQELGVCV  1447
             A   +E+ + +
Sbjct  336   AIALKEISLAI  346


 Score =   106 bits (265),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 91/149 (61%), Gaps = 7/149 (5%)
 Frame = +1

Query  376  AEVLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANE  555
            + VL  L  + DP+    +V    ++++ + +  G+VSF L LTTPACP+++   +   +
Sbjct  8    SSVLDVLRPVQDPELRKSLVELNMIRNVKIED--GKVSFTLVLTTPACPLREFIVEDCQK  65

Query  556  VVAALPWVKTVKVTMSAQPAKPVFAGQLPP--GLQTISNIVAVSSCKGGVGKSTVAVNLA  729
             V  L  V  V + ++A+  +      LP   G+  I NI+AVSS KGGVGKSTVAVN+A
Sbjct  66   AVRQLRGVADVSIEVTAETPQ---QKSLPDRNGVPGIKNIIAVSSGKGGVGKSTVAVNIA  122

Query  730  YTLADMGARVGIFDADVYGPSLPTMVSPE  816
              LA  GA+VG+ DAD+YGP+ PTM+  E
Sbjct  123  VALAQTGAKVGLLDADIYGPNDPTMLGLE  151



>ref|WP_004368525.1| hypothetical protein [Thauera phenylacetica]
 gb|ENO96079.1| hypothetical protein C667_15814 [Thauera phenylacetica B4P]
Length=363

 Score =   167 bits (424),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 119/189 (63%), Gaps = 4/189 (2%)
 Frame = +2

Query  908   EKKTIIPTEYLGVKLVSFGFAGQGRAIM--RGPMVSGVINQLLTTTEWGELDYLVIDMPP  1081
             + KT+IP +  G++ +S GF       M  RGPM +  +NQ+L  T W +LDYLVIDMPP
Sbjct  157   DGKTMIPLQAFGLQAMSIGFLIDADTPMVWRGPMATQALNQMLKDTAWDDLDYLVIDMPP  216

Query  1082  GTGDIQLTLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMC-HFDAD  1258
             GTGDIQLTL Q VP+T AVIVTTPQ +A +D  KGV+MF K+ VP + VVENM  H  + 
Sbjct  217   GTGDIQLTLSQSVPVTGAVIVTTPQDIALLDARKGVKMFEKVGVPILGVVENMSIHICSK  276

Query  1259  -GKRYYPFGKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQEL  1435
              G   + FG+G G ++   F +P L  LP+   +    DSG P VVADP G ++S ++++
Sbjct  277   CGHEEHIFGQGGGEKMCADFKVPFLGALPLDIQIRTEADSGAPTVVADPEGRISSIYKQI  336

Query  1436  GVCVVQQCA  1462
                V  + A
Sbjct  337   ARKVAVRIA  345


 Score =   107 bits (266),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 7/145 (5%)
 Frame = +1

Query  382  VLKALAQIIDPDFGTDIVSCGFVKDLLVNEALGEVSFRLELTTPACPIKDMFEQKANEVV  561
            V +AL Q+IDP+ G D V+   +++L V    GEV F +EL  PA    +      +E V
Sbjct  8    VTEALKQVIDPNTGKDFVAGRSIRNLSVQG--GEVRFDVELGYPAKSQHEPIRALLSEAV  65

Query  562  AALPWVKTVKVTMSAQP-AKPVFAG-QLPPGLQTISNIVAVSSCKGGVGKSTVAVNLAYT  735
            A LP V+ V VT+S++  A  V  G +L PG   + NI+AV+S KGGVGKST AVNLA  
Sbjct  66   AKLPGVERVAVTVSSKVVAHAVQQGVKLLPG---VRNIIAVASGKGGVGKSTTAVNLALA  122

Query  736  LADMGARVGIFDADVYGPSLPTMVS  810
            L+  GARVG+ DAD+YGPS P M+ 
Sbjct  123  LSAEGARVGLLDADIYGPSQPQMLG  147



>ref|XP_002997115.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY69663.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=295

 Score =   225 bits (574),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/283 (42%), Positives = 177/283 (63%), Gaps = 15/283 (5%)
 Frame = +2

Query  953   VSFGFAGQ----------GRAIMRGPMVSGVINQLLTTTEWGELDYLVIDMPPGTGDIQL  1102
             +SFGF  Q          G A+MRGPMVS +++QL+  TEWG+LDYLV+DMPPGTGDIQ+
Sbjct  1     MSFGFVNQRAAPGAGAGVGAAVMRGPMVSKLVDQLILGTEWGDLDYLVVDMPPGTGDIQI  60

Query  1103  TLCQVVPLTAAVIVTTPQKLAFIDVAKGVRMFSKLKVPCVAVVENMCHFD-ADGKRYYPF  1279
             +L Q + ++AAV+VTTPQ+L+F+DV KG+ MF  LKV   AVVENM +FD + G+R+YPF
Sbjct  61    SLSQQMAISAAVVVTTPQRLSFVDVEKGIAMFEDLKVKTAAVVENMSYFDCSHGQRHYPF  120

Query  1280  GKGSGAQVVQQFGIPHLFDLPIRPTLSASGDSGTPEVVADPRGEVASTFQELGVCVVQQC  1459
             G G   ++V ++ + ++F LPI    S S DSG P V++    E   ++  L   V ++ 
Sbjct  121   GLGHTQELVDKYNMKNVFKLPISEQFSLSADSGRPFVLSGLFPEEEKSYDSLATTVAKEL  180

Query  1460  ARIRQQVSTA--VSYDRSIK-AIKVKVPNSDEEFYLHPATVRRNDRSAESVVEWSGEQKL  1630
               ++ +   A  + YD++    +++   N  +E  LHPA +R   R A+ + E++GEQ L
Sbjct  181   VVLKHKARLAPELLYDKNRGIVLRLYSLNEAKEAVLHPADLRVQCRCAQCIDEFTGEQIL  240

Query  1631  QYSDVPEDIEPEEIRPMGNYAVSITWPDGF-SQIAPYDQLQTI  1756
               + +PEDI P  +   GNYA ++TW DG  S +  YD +  +
Sbjct  241   DQAAIPEDIHPTAVERKGNYAFAVTWSDGHTSSLYTYDAITEL  283



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6314516345676