BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2160_g1_i1 len=422 path=[400:0-281 682:282-327 728:328-421]

Length=422
                                                                      Score     E

emb|CDP06053.1|  unnamed protein product                              62.8    4e-09   
gb|EEC72786.1|  hypothetical protein OsI_06465                        62.4    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_003571833.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  61.2    2e-08   
ref|XP_010234083.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  61.2    2e-08   
ref|XP_003571832.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  61.2    2e-08   
ref|XP_010234082.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  61.2    2e-08   
gb|EYU26296.1|  hypothetical protein MIMGU_mgv1a010617mg              60.1    4e-08   
ref|XP_011082802.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  60.1    4e-08   
ref|XP_011082801.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  60.1    4e-08   
gb|EEE56612.1|  hypothetical protein OsJ_05990                        60.1    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011098185.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  59.7    5e-08   
ref|XP_011098184.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  59.7    5e-08   
ref|XP_011098183.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  59.7    6e-08   
ref|XP_011098180.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  59.7    6e-08   
ref|XP_008348551.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    9e-08   
gb|KDO41163.1|  hypothetical protein CISIN_1g0221261mg                55.8    1e-07   
ref|XP_009615203.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.5    1e-07   
ref|XP_009760835.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.5    1e-07   
ref|XP_009615204.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.5    1e-07   
ref|XP_009760836.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.5    1e-07   
ref|XP_009615202.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_009760825.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_009615193.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_009760834.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_010644081.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_010644080.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_009388693.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  58.2    2e-07   
ref|XP_010925577.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.8    2e-07   
ref|XP_010644078.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.8    2e-07   
ref|XP_010925576.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.8    2e-07   
ref|XP_010644077.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.8    2e-07   
ref|XP_006492277.1|  PREDICTED: uncharacterized protein LOC102612...  57.8    3e-07   
ref|XP_006448048.1|  hypothetical protein CICLE_v10016084mg           57.8    3e-07   
ref|XP_006492276.1|  PREDICTED: uncharacterized protein LOC102612...  57.8    3e-07   
ref|XP_008381091.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    3e-07   
ref|XP_008381092.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    3e-07   
emb|CDY25709.1|  BnaC03g69660D                                        57.4    3e-07   
ref|XP_006647101.1|  PREDICTED: uncharacterized protein LOC102703...  57.4    3e-07   
gb|AFJ04810.1|  HEI10                                                 57.4    3e-07   
emb|CDY24093.1|  BnaA06g00910D                                        57.4    3e-07   
ref|XP_006647100.1|  PREDICTED: uncharacterized protein LOC102703...  57.4    3e-07   
ref|XP_009147601.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    3e-07   
sp|I6PL68.1|HEI10_ORYSJ  RecName: Full=E3 ubiquitin-protein ligas...  57.4    3e-07   
ref|NP_001046371.1|  Os02g0232100                                     57.4    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009147598.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    3e-07   
ref|XP_009376734.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    3e-07   
ref|XP_009376735.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    4e-07   
ref|XP_008794149.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    4e-07   
ref|XP_007021985.1|  RING/U-box superfamily protein isoform 4         57.4    4e-07   
ref|XP_007021986.1|  RING/U-box superfamily protein isoform 5         57.4    4e-07   
ref|XP_008794146.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.4    4e-07   
emb|CDY45115.1|  BnaC06g06360D                                        57.4    4e-07   
ref|XP_008381089.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    4e-07   
ref|XP_008381090.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    4e-07   
ref|XP_008381085.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    4e-07   
ref|XP_004965590.1|  PREDICTED: uncharacterized protein LOC101758...  57.0    4e-07   
ref|XP_004965591.1|  PREDICTED: uncharacterized protein LOC101758...  57.0    4e-07   
ref|XP_009376732.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    4e-07   
ref|XP_010062785.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    4e-07   
ref|XP_004965588.1|  PREDICTED: uncharacterized protein LOC101758...  57.0    4e-07   
ref|XP_009376733.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    4e-07   
ref|XP_007021982.1|  RING/U-box superfamily protein isoform 1         57.0    5e-07   
ref|XP_007021984.1|  RING/U-box superfamily protein isoform 3         57.0    5e-07   
ref|XP_004965589.1|  PREDICTED: uncharacterized protein LOC101758...  57.0    5e-07   
ref|XP_010062784.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    5e-07   
ref|XP_008226339.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    5e-07   
dbj|BAK03940.1|  predicted protein                                    57.0    5e-07   
ref|XP_011045536.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    5e-07   
ref|XP_010552137.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    5e-07   
dbj|BAK07208.1|  predicted protein                                    56.6    5e-07   
ref|XP_011045535.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    5e-07   
ref|XP_010552135.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  57.0    5e-07   
ref|XP_006370068.1|  hypothetical protein POPTR_0001s39250g           56.6    5e-07   
dbj|BAJ90978.1|  predicted protein                                    56.6    6e-07   
ref|XP_010062779.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    6e-07   
ref|XP_010062783.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    6e-07   
ref|XP_002453571.1|  hypothetical protein SORBIDRAFT_04g008310        56.6    6e-07   Sorghum bicolor [broomcorn]
ref|XP_011045533.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    6e-07   
ref|XP_011045534.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    6e-07   
ref|XP_010272708.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    6e-07   
ref|XP_011045528.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    6e-07   
gb|KEH19378.1|  zinc finger, C3HC4 type (RING finger) protein         56.6    6e-07   
ref|XP_008791972.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    7e-07   
ref|XP_010272707.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    7e-07   
ref|XP_008791965.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    7e-07   
ref|XP_010272706.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    7e-07   
gb|KEH19379.1|  zinc finger, C3HC4 type (RING finger) protein         56.6    7e-07   
ref|XP_008791940.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    7e-07   
emb|CDY25851.1|  BnaA05g14420D                                        56.6    7e-07   
ref|XP_007133309.1|  hypothetical protein PHAVU_011G168700g           56.6    7e-07   
ref|XP_010479916.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    7e-07   
gb|KEH19380.1|  zinc finger, C3HC4 type (RING finger) protein         56.6    7e-07   
ref|XP_010462247.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    7e-07   
ref|XP_010462248.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    7e-07   
ref|XP_010501000.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    7e-07   
gb|KEH19377.1|  zinc finger, C3HC4 type (RING finger) protein         56.6    7e-07   
gb|KDP33220.1|  hypothetical protein JCGZ_12742                       56.6    7e-07   
ref|XP_010462246.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.6    7e-07   
ref|XP_010479915.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    7e-07   
ref|XP_010501001.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    7e-07   
ref|NP_175754.2|  RING finger-containing protein HEI10                56.2    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305851.1|  hypothetical protein CARUB_v10010926mg           56.2    8e-07   
ref|XP_002891754.1|  predicted protein                                56.2    8e-07   
ref|XP_010479912.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    8e-07   
ref|XP_010462243.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    8e-07   
ref|XP_010500999.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    8e-07   
ref|XP_010479914.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    8e-07   
ref|XP_010500997.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  56.2    8e-07   
ref|XP_006392785.1|  hypothetical protein EUTSA_v10011691mg           56.2    8e-07   
gb|EPS61430.1|  hypothetical protein M569_13367                       56.2    8e-07   
gb|KEH19376.1|  zinc finger, C3HC4 type (RING finger) protein         56.2    9e-07   
ref|XP_011044581.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.8    1e-06   
ref|XP_011044580.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.8    1e-06   
ref|XP_006377726.1|  bZIP family protein                              55.8    1e-06   
ref|XP_007211689.1|  hypothetical protein PRUPE_ppa009152mg           55.8    1e-06   
ref|XP_011044577.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.8    1e-06   
ref|XP_011044579.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.8    1e-06   
ref|XP_009615574.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.5    2e-06   
ref|XP_009615573.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.5    2e-06   
ref|XP_006587155.1|  PREDICTED: uncharacterized protein LOC100810...  55.5    2e-06   
ref|XP_006597970.1|  PREDICTED: uncharacterized protein LOC100101...  55.5    2e-06   
ref|XP_003533893.1|  PREDICTED: uncharacterized protein LOC100810...  55.5    2e-06   
ref|XP_004516257.1|  PREDICTED: uncharacterized protein LOC101488...  55.5    2e-06   
ref|XP_006587152.1|  PREDICTED: uncharacterized protein LOC100810...  55.5    2e-06   
ref|XP_006597966.1|  PREDICTED: uncharacterized protein LOC100101...  55.5    2e-06   
ref|XP_006597969.1|  PREDICTED: uncharacterized protein LOC100101...  55.5    2e-06   
ref|XP_004516256.1|  PREDICTED: uncharacterized protein LOC101488...  55.5    2e-06   
ref|XP_009615572.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.5    2e-06   
ref|XP_009615569.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.5    2e-06   
ref|XP_009409384.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.1    2e-06   
ref|XP_009409385.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  55.1    2e-06   
ref|XP_008643831.1|  PREDICTED: DNA binding protein isoform X3        54.7    3e-06   
ref|NP_001152027.1|  DNA binding protein                              54.7    3e-06   Zea mays [maize]
ref|XP_010093450.1|  hypothetical protein L484_017511                 55.1    3e-06   
gb|KGN53579.1|  hypothetical protein Csa_4G083540                     54.7    3e-06   
ref|XP_008643830.1|  PREDICTED: DNA binding protein isoform X2        54.7    3e-06   
ref|XP_008451738.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_008451737.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_008643828.1|  PREDICTED: DNA binding protein isoform X1        54.7    3e-06   
ref|XP_010324728.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_010324729.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_010675279.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_008451733.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_008451736.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_004137226.1|  PREDICTED: uncharacterized protein LOC101209267  54.7    3e-06   
ref|XP_010675278.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.7    3e-06   
ref|XP_004244784.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.3    4e-06   
ref|XP_010324727.1|  PREDICTED: E3 ubiquitin-protein ligase CCNB1...  54.3    4e-06   
ref|XP_006351079.1|  PREDICTED: uncharacterized protein LOC102590...  54.3    4e-06   
ref|XP_006852683.1|  hypothetical protein AMTR_s00021p00251280        54.3    4e-06   
ref|XP_006351080.1|  PREDICTED: uncharacterized protein LOC102590...  54.3    4e-06   
ref|XP_004294166.1|  PREDICTED: uncharacterized protein LOC101315126  52.8    2e-05   
ref|XP_001769363.1|  predicted protein                                50.1    7e-05   
gb|AFW66323.1|  hypothetical protein ZEAMMB73_651615                  48.5    5e-04   



>emb|CDP06053.1| unnamed protein product [Coffea canephora]
Length=298

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/28 (93%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA+STTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGQAVSTTCGHLLCPEDA  28



>gb|EEC72786.1| hypothetical protein OsI_06465 [Oryza sativa Indica Group]
Length=388

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 37/55 (67%), Gaps = 0/55 (0%)
 Frame = +1

Query  256  RYFSFIPIFRN*LNCCMKLYS*FLKAEMRCNACWRELESQAISTTCGHLLCPEDA  420
            +   FI +    L     + +  ++++M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  59   KIIGFISLIAPFLRITSSVLNLLVRSKMKCNACWRELEGQAVSTTCGHLLCTEDA  113



>ref|XP_003571833.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Brachypodium distachyon]
Length=294

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRE+E QAISTTCGHLLCPEDA
Sbjct  1    MKCNACWREMEGQAISTTCGHLLCPEDA  28



>ref|XP_010234083.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Brachypodium distachyon]
Length=295

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRE+E QAISTTCGHLLCPEDA
Sbjct  1    MKCNACWREMEGQAISTTCGHLLCPEDA  28



>ref|XP_003571832.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Brachypodium distachyon]
Length=303

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRE+E QAISTTCGHLLCPEDA
Sbjct  1    MKCNACWREMEGQAISTTCGHLLCPEDA  28



>ref|XP_010234082.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Brachypodium distachyon]
Length=304

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRE+E QAISTTCGHLLCPEDA
Sbjct  1    MKCNACWREMEGQAISTTCGHLLCPEDA  28



>gb|EYU26296.1| hypothetical protein MIMGU_mgv1a010617mg [Erythranthe guttata]
Length=307

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCPEDA  28



>ref|XP_011082802.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Sesamum indicum]
Length=306

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCPEDA  28



>ref|XP_011082801.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Sesamum indicum]
Length=307

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCPEDA  28



>gb|EEE56612.1| hypothetical protein OsJ_05990 [Oryza sativa Japonica Group]
Length=336

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +1

Query  322  FLKAEMRCNACWRELESQAISTTCGHLLCPEDA  420
             ++++M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  29   LVRSKMKCNACWRELEGQAVSTTCGHLLCTEDA  61



>ref|XP_011098185.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Sesamum indicum]
Length=297

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A++TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAVTTTCGHLLCPEDA  28



>ref|XP_011098184.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Sesamum indicum]
Length=304

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A++TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAVTTTCGHLLCPEDA  28



>ref|XP_011098183.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Sesamum indicum]
Length=307

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A++TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAVTTTCGHLLCPEDA  28



>ref|XP_011098180.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Sesamum indicum]
 ref|XP_011098181.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Sesamum indicum]
Length=314

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 27/28 (96%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A++TTCGHLLCPEDA
Sbjct  1    MRCNACWRELEGRAVTTTCGHLLCPEDA  28



>ref|XP_008348551.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog [Malus 
domestica]
Length=165

 Score = 57.4 bits (137),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>gb|KDO41163.1| hypothetical protein CISIN_1g0221261mg, partial [Citrus sinensis]
Length=73

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_009615203.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Nicotiana tomentosiformis]
Length=296

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009760835.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Nicotiana sylvestris]
Length=296

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009615204.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Nicotiana tomentosiformis]
Length=295

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009760836.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Nicotiana sylvestris]
Length=295

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009615202.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Nicotiana tomentosiformis]
Length=304

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009760825.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760826.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760827.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760828.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760830.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760831.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760832.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009760833.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana sylvestris]
Length=305

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009615193.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615195.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615196.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615197.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615198.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615199.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615200.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615201.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=305

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_009760834.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Nicotiana sylvestris]
Length=304

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ CP DA
Sbjct  1    MRCNACWRELEGQAITTTCGHVFCPNDA  28



>ref|XP_010644081.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Vitis vinifera]
Length=291

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCSEDA  28



>ref|XP_010644080.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Vitis vinifera]
Length=292

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCSEDA  28



>ref|XP_009388693.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog [Musa 
acuminata subsp. malaccensis]
Length=302

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA+STTCGHL C EDA
Sbjct  1    MRCNACWRELEGQAVSTTCGHLFCTEDA  28



>ref|XP_010925577.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Elaeis guineensis]
Length=293

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGKAISTTCGHLLCTEDA  28



>ref|XP_010644078.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Vitis vinifera]
 emb|CBI20110.3| unnamed protein product [Vitis vinifera]
Length=301

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCSEDA  28



>ref|XP_010925576.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Elaeis guineensis]
Length=303

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGKAISTTCGHLLCTEDA  28



>ref|XP_010644077.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Vitis vinifera]
 ref|XP_002285631.2| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Vitis vinifera]
Length=302

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCSEDA  28



>ref|XP_006492277.1| PREDICTED: uncharacterized protein LOC102612332 isoform X2 [Citrus 
sinensis]
Length=301

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_006448048.1| hypothetical protein CICLE_v10016084mg [Citrus clementina]
 gb|ESR61288.1| hypothetical protein CICLE_v10016084mg [Citrus clementina]
Length=301

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_006492276.1| PREDICTED: uncharacterized protein LOC102612332 isoform X1 [Citrus 
sinensis]
Length=302

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_008381091.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Malus domestica]
Length=295

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_008381092.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X5 [Malus domestica]
Length=294

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>emb|CDY25709.1| BnaC03g69660D [Brassica napus]
Length=304

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_006647101.1| PREDICTED: uncharacterized protein LOC102703651 isoform X2 [Oryza 
brachyantha]
Length=294

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAVSTTCGHLLCTEDA  28



>gb|AFJ04810.1| HEI10 [Oryza sativa Japonica Group]
Length=295

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAVSTTCGHLLCTEDA  28



>emb|CDY24093.1| BnaA06g00910D [Brassica napus]
Length=316

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_006647100.1| PREDICTED: uncharacterized protein LOC102703651 isoform X1 [Oryza 
brachyantha]
Length=303

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAVSTTCGHLLCTEDA  28



>ref|XP_009147601.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Brassica rapa]
Length=316

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>sp|I6PL68.1|HEI10_ORYSJ RecName: Full=E3 ubiquitin-protein ligase CCNB1IP1 homolog; AltName: 
Full=RING finger-containing protein HEI10 [Oryza sativa 
Japonica Group]
 gb|AFJ04809.1| HEI10 [Oryza sativa Japonica Group]
Length=304

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAVSTTCGHLLCTEDA  28



>ref|NP_001046371.1| Os02g0232100 [Oryza sativa Japonica Group]
 dbj|BAD27706.1| putative bZIP protein [Oryza sativa Japonica Group]
 dbj|BAF08285.1| Os02g0232100 [Oryza sativa Japonica Group]
Length=303

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QA+STTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAVSTTCGHLLCTEDA  28



>ref|XP_009147598.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Brassica rapa]
 ref|XP_009147600.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Brassica rapa]
Length=317

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_009376734.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Pyrus x bretschneideri]
Length=295

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_009376735.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Pyrus x bretschneideri]
Length=294

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_008794149.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Phoenix dactylifera]
Length=293

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGKAVSTTCGHLLCTEDA  28



>ref|XP_007021985.1| RING/U-box superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY13510.1| RING/U-box superfamily protein isoform 4 [Theobroma cacao]
Length=295

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_007021986.1| RING/U-box superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY13511.1| RING/U-box superfamily protein isoform 5 [Theobroma cacao]
Length=294

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_008794146.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008794147.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008794148.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Phoenix dactylifera]
Length=303

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGKAVSTTCGHLLCTEDA  28



>emb|CDY45115.1| BnaC06g06360D [Brassica napus]
Length=334

 Score = 57.4 bits (137),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/28 (89%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTEDA  28



>ref|XP_008381089.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Malus domestica]
Length=305

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_008381090.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Malus domestica]
Length=304

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_008381085.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Malus domestica]
 ref|XP_008381086.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Malus domestica]
 ref|XP_008381087.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Malus domestica]
Length=306

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_004965590.1| PREDICTED: uncharacterized protein LOC101758105 isoform X3 [Setaria 
italica]
Length=294

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_004965591.1| PREDICTED: uncharacterized protein LOC101758105 isoform X4 [Setaria 
italica]
Length=293

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_009376732.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Pyrus x bretschneideri]
Length=305

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_010062785.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Eucalyptus grandis]
Length=293

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCNEDA  28



>ref|XP_004965588.1| PREDICTED: uncharacterized protein LOC101758105 isoform X1 [Setaria 
italica]
Length=303

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_009376733.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Pyrus x bretschneideri]
Length=304

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_007021982.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007021983.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY13507.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY13508.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=304

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_007021984.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
 gb|EOY13509.1| RING/U-box superfamily protein isoform 3 [Theobroma cacao]
Length=305

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_004965589.1| PREDICTED: uncharacterized protein LOC101758105 isoform X2 [Setaria 
italica]
Length=302

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_010062784.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Eucalyptus grandis]
Length=294

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCNEDA  28



>ref|XP_008226339.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog [Prunus 
mume]
Length=304

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>dbj|BAK03940.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=293

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_011045536.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X5 [Populus euphratica]
Length=294

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_010552137.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Tarenaya hassleriana]
Length=306

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGH+LC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHILCTEDA  28



>dbj|BAK07208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_011045535.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Populus euphratica]
Length=295

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_010552135.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010552136.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Tarenaya hassleriana]
Length=307

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGH+LC EDA
Sbjct  1    MRCNACWRELEGRAISTTCGHILCTEDA  28



>ref|XP_006370068.1| hypothetical protein POPTR_0001s39250g [Populus trichocarpa]
 gb|ERP66637.1| hypothetical protein POPTR_0001s39250g [Populus trichocarpa]
Length=294

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>dbj|BAJ90978.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=303

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAI+TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGQAITTTCGHLLCTEDA  28



>ref|XP_010062779.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Eucalyptus grandis]
 ref|XP_010062780.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Eucalyptus grandis]
 ref|XP_010062781.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Eucalyptus grandis]
 ref|XP_010062782.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Eucalyptus grandis]
Length=304

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCNEDA  28



>ref|XP_010062783.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Eucalyptus grandis]
 gb|KCW69905.1| hypothetical protein EUGRSUZ_F03234 [Eucalyptus grandis]
Length=303

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCNEDA  28



>ref|XP_002453571.1| hypothetical protein SORBIDRAFT_04g008310 [Sorghum bicolor]
 gb|EES06547.1| hypothetical protein SORBIDRAFT_04g008310 [Sorghum bicolor]
Length=304

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE QAISTTCGHLLC +DA
Sbjct  1    MKCNACWRELEGQAISTTCGHLLCADDA  28



>ref|XP_011045533.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Populus euphratica]
Length=305

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_011045534.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Populus euphratica]
Length=304

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_010272708.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Nelumbo nucifera]
Length=294

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCTEDA  28



>ref|XP_011045528.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
 ref|XP_011045529.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
 ref|XP_011045530.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
 ref|XP_011045531.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
 ref|XP_011045532.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
Length=311

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLLCTEDA  28



>gb|KEH19378.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=295

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC EDA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTEDA  28



>ref|XP_008791972.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Phoenix dactylifera]
Length=294

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWREL+ +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELDGKAISTTCGHLLCTEDA  28



>ref|XP_010272707.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Nelumbo nucifera]
Length=304

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCTEDA  28



>ref|XP_008791965.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Phoenix dactylifera]
Length=303

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWREL+ +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELDGKAISTTCGHLLCTEDA  28



>ref|XP_010272706.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nelumbo nucifera]
Length=310

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCTEDA  28



>gb|KEH19379.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=294

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC EDA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTEDA  28



>ref|XP_008791940.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008791948.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008791957.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Phoenix dactylifera]
Length=304

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWREL+ +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELDGKAISTTCGHLLCTEDA  28



>emb|CDY25851.1| BnaA05g14420D [Brassica napus]
Length=303

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWREL+ +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRELQGRAISTTCGHLLCTEDA  28



>ref|XP_007133309.1| hypothetical protein PHAVU_011G168700g [Phaseolus vulgaris]
 gb|ESW05303.1| hypothetical protein PHAVU_011G168700g [Phaseolus vulgaris]
Length=305

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTCGHLLC +DA
Sbjct  1    MRCNACWRELEGRAISTTCGHLLCTDDA  28



>ref|XP_010479916.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Camelina sativa]
Length=294

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>gb|KEH19380.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=304

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC EDA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTEDA  28



>ref|XP_010462247.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Camelina sativa]
Length=295

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010462248.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Camelina sativa]
Length=294

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010501000.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Camelina sativa]
Length=295

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>gb|KEH19377.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=305

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC EDA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTEDA  28



>gb|KDP33220.1| hypothetical protein JCGZ_12742 [Jatropha curcas]
Length=305

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAITTTCGHLLCTEDA  28



>ref|XP_010462246.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Camelina sativa]
Length=304

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010479915.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Camelina sativa]
Length=295

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010501001.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Camelina sativa]
Length=294

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|NP_175754.2| RING finger-containing protein HEI10 [Arabidopsis thaliana]
 sp|F4HRI2.1|HEI10_ARATH RecName: Full=E3 ubiquitin-protein ligase CCNB1IP1 homolog; AltName: 
Full=RING finger-containing protein HEI10 [Arabidopsis 
thaliana]
 gb|AEE32948.1| RING finger-containing protein HEI10 [Arabidopsis thaliana]
Length=304

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_006305851.1| hypothetical protein CARUB_v10010926mg [Capsella rubella]
 gb|EOA38749.1| hypothetical protein CARUB_v10010926mg [Capsella rubella]
Length=303

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_002891754.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68013.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=303

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010479912.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010479913.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Camelina sativa]
Length=305

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010462243.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010462244.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Camelina sativa]
Length=305

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010500999.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Camelina sativa]
Length=304

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010479914.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Camelina sativa]
Length=304

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_010500997.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Camelina sativa]
 ref|XP_010500998.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Camelina sativa]
Length=305

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWR+LE +AISTTCGHLLC EDA
Sbjct  1    MRCNACWRDLEGRAISTTCGHLLCTEDA  28



>ref|XP_006392785.1| hypothetical protein EUTSA_v10011691mg [Eutrema salsugineum]
 gb|ESQ30071.1| hypothetical protein EUTSA_v10011691mg [Eutrema salsugineum]
Length=304

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AI+TTCGHLLC EDA
Sbjct  1    MRCNACWRELEGRAIATTCGHLLCTEDA  28



>gb|EPS61430.1| hypothetical protein M569_13367 [Genlisea aurea]
Length=306

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACW ELE +A++TTCGHLLCPEDA
Sbjct  1    MRCNACWVELEGRAVTTTCGHLLCPEDA  28



>gb|KEH19376.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=313

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC EDA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTEDA  28



>ref|XP_011044581.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Populus euphratica]
Length=294

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCN+CWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNSCWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_011044580.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Populus euphratica]
Length=295

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCN+CWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNSCWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_006377726.1| bZIP family protein [Populus trichocarpa]
 gb|ERP55523.1| bZIP family protein [Populus trichocarpa]
Length=280

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCN+CWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNSCWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_007211689.1| hypothetical protein PRUPE_ppa009152mg [Prunus persica]
 gb|EMJ12888.1| hypothetical protein PRUPE_ppa009152mg [Prunus persica]
Length=304

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +A+STTCGHLLC EDA
Sbjct  1    MRCNACWREVEGRAVSTTCGHLLCTEDA  28



>ref|XP_011044577.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
 ref|XP_011044578.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Populus euphratica]
Length=305

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCN+CWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNSCWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_011044579.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Populus euphratica]
Length=304

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCN+CWRELE +A+STTCGHLLC EDA
Sbjct  1    MRCNSCWRELEGRAVSTTCGHLLCTEDA  28



>ref|XP_009615574.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Nicotiana tomentosiformis]
Length=295

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA++TTCGHL C +DA
Sbjct  1    MRCNACWRELEGQAVTTTCGHLFCRDDA  28



>ref|XP_009615573.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Nicotiana tomentosiformis]
Length=296

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA++TTCGHL C +DA
Sbjct  1    MRCNACWRELEGQAVTTTCGHLFCRDDA  28



>ref|XP_006587155.1| PREDICTED: uncharacterized protein LOC100810502 isoform X5 [Glycine 
max]
Length=295

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_006597970.1| PREDICTED: uncharacterized protein LOC100101885 isoform X5 [Glycine 
max]
Length=295

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_003533893.1| PREDICTED: uncharacterized protein LOC100810502 isoform X1 [Glycine 
max]
Length=304

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_004516257.1| PREDICTED: uncharacterized protein LOC101488298 isoform X2 [Cicer 
arietinum]
Length=294

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_006587152.1| PREDICTED: uncharacterized protein LOC100810502 isoform X2 [Glycine 
max]
 ref|XP_006587153.1| PREDICTED: uncharacterized protein LOC100810502 isoform X3 [Glycine 
max]
 ref|XP_006587154.1| PREDICTED: uncharacterized protein LOC100810502 isoform X4 [Glycine 
max]
Length=305

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_006597966.1| PREDICTED: uncharacterized protein LOC100101885 isoform X1 [Glycine 
max]
 ref|XP_006597967.1| PREDICTED: uncharacterized protein LOC100101885 isoform X2 [Glycine 
max]
 ref|XP_006597968.1| PREDICTED: uncharacterized protein LOC100101885 isoform X3 [Glycine 
max]
Length=305

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_006597969.1| PREDICTED: uncharacterized protein LOC100101885 isoform X4 [Glycine 
max]
 gb|KHN02612.1| E3 ubiquitin-protein ligase CCNB1IP1 [Glycine soja]
Length=304

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_004516256.1| PREDICTED: uncharacterized protein LOC101488298 isoform X1 [Cicer 
arietinum]
Length=304

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRE+E +AISTTCGHLLC +DA
Sbjct  1    MRCNACWREVEGRAISTTCGHLLCTDDA  28



>ref|XP_009615572.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Nicotiana tomentosiformis]
Length=305

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA++TTCGHL C +DA
Sbjct  1    MRCNACWRELEGQAVTTTCGHLFCRDDA  28



>ref|XP_009615569.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615570.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009615571.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Nicotiana tomentosiformis]
Length=306

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA++TTCGHL C +DA
Sbjct  1    MRCNACWRELEGQAVTTTCGHLFCRDDA  28



>ref|XP_009409384.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=301

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHL C EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLYCNEDA  28



>ref|XP_009409385.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=301

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +A+STTCGHL C EDA
Sbjct  1    MRCNACWRELEGRAVSTTCGHLYCNEDA  28



>ref|XP_008643831.1| PREDICTED: DNA binding protein isoform X3 [Zea mays]
Length=294

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWR+LE QA+STTCGHLLC +DA
Sbjct  1    MKCNACWRDLEGQAVSTTCGHLLCADDA  28



>ref|NP_001152027.1| DNA binding protein [Zea mays]
 gb|ACG45442.1| DNA binding protein [Zea mays]
 gb|ACN35640.1| unknown [Zea mays]
 gb|AFW71221.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=295

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWR+LE QA+STTCGHLLC +DA
Sbjct  1    MKCNACWRDLEGQAVSTTCGHLLCADDA  28



>ref|XP_010093450.1| hypothetical protein L484_017511 [Morus notabilis]
 gb|EXB54074.1| hypothetical protein L484_017511 [Morus notabilis]
Length=346

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  325  LKAEMRCNACWRELESQAISTTCGHLLC  408
            + AEMRCNACWRELE +AI+TTCGH+LC
Sbjct  1    MTAEMRCNACWRELEGRAITTTCGHVLC  28



>gb|KGN53579.1| hypothetical protein Csa_4G083540 [Cucumis sativus]
Length=294

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +A++TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGRAVTTTCGHLLCTEDA  28



>ref|XP_008643830.1| PREDICTED: DNA binding protein isoform X2 [Zea mays]
Length=303

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWR+LE QA+STTCGHLLC +DA
Sbjct  1    MKCNACWRDLEGQAVSTTCGHLLCADDA  28



>ref|XP_008451738.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Cucumis melo]
Length=293

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +A++TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGRAVTTTCGHLLCTEDA  28



>ref|XP_008451737.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Cucumis melo]
Length=294

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +A++TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGRAVTTTCGHLLCTEDA  28



>ref|XP_008643828.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
 ref|XP_008643829.1| PREDICTED: DNA binding protein isoform X1 [Zea mays]
Length=304

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWR+LE QA+STTCGHLLC +DA
Sbjct  1    MKCNACWRDLEGQAVSTTCGHLLCADDA  28



>ref|XP_010324728.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X3 [Solanum lycopersicum]
Length=296

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ C  DA
Sbjct  1    MRCNACWRELEGQAITTTCGHIFCQNDA  28



>ref|XP_010324729.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X4 [Solanum lycopersicum]
Length=295

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ C  DA
Sbjct  1    MRCNACWRELEGQAITTTCGHIFCQNDA  28



>ref|XP_010675279.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=294

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA+ST+CGHLLC  DA
Sbjct  1    MRCNACWRELEGQAVSTSCGHLLCTGDA  28



>ref|XP_008451733.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Cucumis melo]
 ref|XP_008451734.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Cucumis melo]
 ref|XP_008451735.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Cucumis melo]
Length=304

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +A++TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGRAVTTTCGHLLCTEDA  28



>ref|XP_008451736.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Cucumis melo]
Length=303

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +A++TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGRAVTTTCGHLLCTEDA  28



>ref|XP_004137226.1| PREDICTED: uncharacterized protein LOC101209267 [Cucumis sativus]
 ref|XP_004156515.1| PREDICTED: uncharacterized protein LOC101230782 [Cucumis sativus]
Length=304

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +A++TTCGHLLC EDA
Sbjct  1    MKCNACWRELEGRAVTTTCGHLLCTEDA  28



>ref|XP_010675278.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=304

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QA+ST+CGHLLC  DA
Sbjct  1    MRCNACWRELEGQAVSTSCGHLLCTGDA  28



>ref|XP_004244784.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Solanum lycopersicum]
 ref|XP_010324722.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Solanum lycopersicum]
 ref|XP_010324723.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Solanum lycopersicum]
 ref|XP_010324725.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Solanum lycopersicum]
 ref|XP_010324726.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X1 [Solanum lycopersicum]
Length=306

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ C  DA
Sbjct  1    MRCNACWRELEGQAITTTCGHIFCQNDA  28



>ref|XP_010324727.1| PREDICTED: E3 ubiquitin-protein ligase CCNB1IP1 homolog isoform 
X2 [Solanum lycopersicum]
Length=305

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ C  DA
Sbjct  1    MRCNACWRELEGQAITTTCGHIFCQNDA  28



>ref|XP_006351079.1| PREDICTED: uncharacterized protein LOC102590430 isoform X1 [Solanum 
tuberosum]
Length=306

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ C  DA
Sbjct  1    MRCNACWRELEGQAITTTCGHIFCQNDA  28



>ref|XP_006852683.1| hypothetical protein AMTR_s00021p00251280 [Amborella trichopoda]
 gb|ERN14150.1| hypothetical protein AMTR_s00021p00251280 [Amborella trichopoda]
Length=318

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACWRELE +AISTTCGH+LC +DA
Sbjct  1    MKCNACWRELEGRAISTTCGHILCTDDA  28



>ref|XP_006351080.1| PREDICTED: uncharacterized protein LOC102590430 isoform X2 [Solanum 
tuberosum]
Length=305

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE QAI+TTCGH+ C  DA
Sbjct  1    MRCNACWRELEGQAITTTCGHIFCQNDA  28



>ref|XP_004294166.1| PREDICTED: uncharacterized protein LOC101315126 [Fragaria vesca 
subsp. vesca]
Length=302

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            MRCNACWRELE +AISTTC HLLC EDA
Sbjct  1    MRCNACWRELEGRAISTTCCHLLCTEDA  28



>ref|XP_001769363.1| predicted protein [Physcomitrella patens]
 gb|EDQ65732.1| predicted protein [Physcomitrella patens]
Length=249

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 18/28 (64%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  337  MRCNACWRELESQAISTTCGHLLCPEDA  420
            M+CNACW+ LE +A++TTCGH+ C EDA
Sbjct  1    MKCNACWKNLEGRAVATTCGHIFCTEDA  28



>gb|AFW66323.1| hypothetical protein ZEAMMB73_651615 [Zea mays]
Length=380

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  328  KAEMRCNACWRELESQAISTTCGHLLC  408
            + +M+CNACW +LE QA+STTCGHLLC
Sbjct  171  RNKMKCNACWPDLEGQAVSTTCGHLLC  197



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 513297653190