BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21607_g2_i3 len=2052 path=[3875:0-92 1939:93-116 1963:117-1215
3062:1216-1220 3067:1221-1319 3166:1320-1456 3303:1457-2051]

Length=2052
                                                                      Score     E

ref|XP_009612784.1|  PREDICTED: probable zinc metalloprotease EGY...    650   0.0      
ref|XP_009612782.1|  PREDICTED: probable zinc metalloprotease EGY...    645   0.0      
ref|XP_009612783.1|  PREDICTED: probable zinc metalloprotease EGY...    645   0.0      
ref|XP_009612781.1|  PREDICTED: probable zinc metalloprotease EGY...    641   0.0      
ref|XP_009778927.1|  PREDICTED: probable zinc metalloprotease EGY...    631   0.0      
ref|XP_009778926.1|  PREDICTED: probable zinc metalloprotease EGY...    627   0.0      
ref|XP_002271131.2|  PREDICTED: probable zinc metalloprotease EGY...    626   0.0      Vitis vinifera
ref|XP_009778925.1|  PREDICTED: probable zinc metalloprotease EGY...    618   0.0      
ref|XP_010658292.1|  PREDICTED: probable zinc metalloprotease EGY...    616   0.0      
ref|XP_009778924.1|  PREDICTED: probable zinc metalloprotease EGY...    613   0.0      
gb|EYU19993.1|  hypothetical protein MIMGU_mgv1a004301mg                602   0.0      
gb|KHG22482.1|  Peroxisomal biogenesis factor 2                         601   0.0      
ref|XP_010031249.1|  PREDICTED: probable zinc metalloprotease EGY...    601   0.0      
ref|XP_010262813.1|  PREDICTED: probable zinc metalloprotease EGY...    599   0.0      
ref|XP_010262812.1|  PREDICTED: probable zinc metalloprotease EGY...    598   0.0      
gb|KGN45781.1|  hypothetical protein Csa_6G011070                       594   0.0      
ref|XP_006435704.1|  hypothetical protein CICLE_v10031204mg             590   0.0      
ref|XP_006486338.1|  PREDICTED: uncharacterized protein LOC102611...    589   0.0      
gb|KDO69033.1|  hypothetical protein CISIN_1g009542mg                   587   0.0      
gb|KDP44801.1|  hypothetical protein JCGZ_01301                         587   0.0      
emb|CDP14043.1|  unnamed protein product                                586   0.0      
ref|XP_006486342.1|  PREDICTED: uncharacterized protein LOC102611...    586   0.0      
ref|XP_006486341.1|  PREDICTED: uncharacterized protein LOC102611...    581   0.0      
ref|XP_006486340.1|  PREDICTED: uncharacterized protein LOC102611...    580   0.0      
ref|XP_007219012.1|  hypothetical protein PRUPE_ppa004270mg             570   0.0      
ref|XP_007009043.1|  Ethylene-dependent gravitropism-deficient an...    568   0.0      
ref|XP_007009042.1|  Ethylene-dependent gravitropism-deficient an...    567   0.0      
ref|XP_006367712.1|  PREDICTED: uncharacterized protein LOC102594...    565   0.0      
ref|XP_008441639.1|  PREDICTED: probable zinc metalloprotease EGY...    563   0.0      
ref|XP_009344642.1|  PREDICTED: probable zinc metalloprotease EGY...    565   0.0      
ref|XP_008392943.1|  PREDICTED: probable zinc metalloprotease EGY...    564   0.0      
ref|XP_006367711.1|  PREDICTED: uncharacterized protein LOC102594...    561   0.0      
ref|XP_006367710.1|  PREDICTED: uncharacterized protein LOC102594...    561   0.0      
gb|KFK25011.1|  hypothetical protein AALP_AA8G055000                    560   0.0      
ref|XP_004240688.1|  PREDICTED: probable zinc metalloprotease EGY...    558   0.0      
ref|XP_002526886.1|  metalloendopeptidase, putative                     560   0.0      Ricinus communis
ref|XP_006367709.1|  PREDICTED: uncharacterized protein LOC102594...    556   0.0      
ref|XP_011076833.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...    558   0.0      
ref|XP_009350821.1|  PREDICTED: probable zinc metalloprotease EGY...    557   0.0      
ref|NP_974736.1|  S2P-like putative metalloprotease                     557   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008785379.1|  PREDICTED: probable zinc metalloprotease EGY...    558   0.0      
ref|XP_006367713.1|  PREDICTED: uncharacterized protein LOC102594...    555   0.0      
ref|XP_006287504.1|  hypothetical protein CARUB_v10000713mg             555   0.0      
ref|XP_004308926.1|  PREDICTED: uncharacterized protein LOC101295669    555   0.0      
ref|XP_010689476.1|  PREDICTED: probable zinc metalloprotease EGY...    555   0.0      
emb|CDX80971.1|  BnaC03g02250D                                          555   0.0      
ref|NP_001190232.1|  S2P-like putative metalloprotease                  554   0.0      
ref|XP_010321954.1|  PREDICTED: probable zinc metalloprotease EGY...    552   0.0      
ref|XP_009350827.1|  PREDICTED: probable zinc metalloprotease EGY...    551   0.0      
ref|XP_009130897.1|  PREDICTED: probable zinc metalloprotease EGY...    552   0.0      
ref|XP_003519388.1|  PREDICTED: uncharacterized protein LOC100778800    550   0.0      
ref|XP_009130896.1|  PREDICTED: probable zinc metalloprotease EGY...    551   0.0      
gb|KHN48555.1|  hypothetical protein glysoja_034178                     550   0.0      
ref|XP_008785376.1|  PREDICTED: probable zinc metalloprotease EGY...    551   0.0      
ref|XP_010923077.1|  PREDICTED: probable zinc metalloprotease EGY...    551   0.0      
ref|XP_008785377.1|  PREDICTED: probable zinc metalloprotease EGY...    551   0.0      
ref|XP_006399031.1|  hypothetical protein EUTSA_v10013357mg             546   0.0      
ref|XP_010321955.1|  PREDICTED: probable zinc metalloprotease EGY...    542   0.0      
ref|XP_007141781.1|  hypothetical protein PHAVU_008G225100g             545   0.0      
ref|XP_009405583.1|  PREDICTED: probable zinc metalloprotease EGY...    544   0.0      
ref|XP_007141780.1|  hypothetical protein PHAVU_008G225100g             539   0.0      
ref|XP_010095087.1|  hypothetical protein L484_026396                   545   0.0      
ref|XP_011043011.1|  PREDICTED: probable zinc metalloprotease EGY...    543   0.0      
emb|CDY11338.1|  BnaA03g01740D                                          543   0.0      
ref|XP_011043151.1|  PREDICTED: probable zinc metalloprotease EGY...    538   0.0      
ref|XP_003544103.1|  PREDICTED: uncharacterized protein LOC100816506    541   0.0      
ref|XP_010552872.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...    541   0.0      
ref|NP_196193.1|  S2P-like putative metalloprotease                     542   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311209.2|  hypothetical protein POPTR_0008s06640g             540   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011042934.1|  PREDICTED: probable zinc metalloprotease EGY...    539   0.0      
tpg|DAA53531.1|  TPA: hypothetical protein ZEAMMB73_972585              533   3e-180   
ref|XP_002873222.1|  peptidase M50 family protein                       536   4e-180   
ref|XP_004490978.1|  PREDICTED: uncharacterized protein LOC101500172    534   1e-179   
tpg|DAA53529.1|  TPA: hypothetical protein ZEAMMB73_972585              533   2e-179   
gb|KDO69039.1|  hypothetical protein CISIN_1g009542mg                   529   3e-179   
tpg|DAA53521.1|  TPA: hypothetical protein ZEAMMB73_972585              533   4e-179   
gb|ACG47154.1|  metalloendopeptidase                                    533   5e-179   Zea mays [maize]
ref|XP_010491109.1|  PREDICTED: probable zinc metalloprotease EGY...    530   4e-178   
ref|XP_004968164.1|  PREDICTED: uncharacterized protein LOC101762864    530   7e-178   
ref|XP_010423434.1|  PREDICTED: probable zinc metalloprotease EGY...    530   7e-178   
ref|XP_010452480.1|  PREDICTED: probable zinc metalloprotease EGY...    530   8e-178   
ref|XP_010423433.1|  PREDICTED: probable zinc metalloprotease EGY...    529   1e-177   
gb|AES99561.2|  M50 family peptidase                                    527   4e-177   
gb|EPS68104.1|  hypothetical protein M569_06667                         526   1e-176   
ref|XP_002455223.1|  hypothetical protein SORBIDRAFT_03g006530          527   2e-176   Sorghum bicolor [broomcorn]
ref|XP_003616603.1|  hypothetical protein MTR_5g082260                  527   2e-176   
ref|NP_001041989.1|  Os01g0142100                                       523   6e-175   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD61067.1|  unknown protein                                        523   7e-175   Oryza sativa Japonica Group [Japonica rice]
sp|B8AD72.1|EGY2_ORYSI  RecName: Full=Probable zinc metalloprotea...    523   7e-175   Oryza sativa Indica Group [Indian rice]
gb|KDO69040.1|  hypothetical protein CISIN_1g009542mg                   516   8e-174   
ref|XP_006643737.1|  PREDICTED: uncharacterized protein LOC102711191    519   2e-173   
ref|XP_008233736.1|  PREDICTED: LOW QUALITY PROTEIN: probable zin...    517   4e-173   
gb|KDO69041.1|  hypothetical protein CISIN_1g009542mg                   514   4e-173   
gb|KHN20855.1|  hypothetical protein glysoja_009163                     515   7e-173   
ref|XP_006287503.1|  hypothetical protein CARUB_v10000713mg             505   5e-170   
ref|XP_006848164.1|  hypothetical protein AMTR_s00029p00233910          507   6e-170   
ref|XP_007009044.1|  Ethylene-dependent gravitropism-deficient an...    503   2e-169   
ref|XP_004138568.1|  PREDICTED: uncharacterized protein LOC101217814    503   2e-168   
ref|XP_010230441.1|  PREDICTED: probable zinc metalloprotease EGY...    501   3e-167   
ref|XP_003568414.1|  PREDICTED: probable zinc metalloprotease EGY...    501   5e-166   
ref|XP_007009045.1|  Ethylene-dependent gravitropism-deficient an...    490   1e-164   
gb|EMT18188.1|  hypothetical protein F775_15393                         492   7e-163   
emb|CDM81041.1|  unnamed protein product                                494   1e-162   
dbj|BAJ86140.1|  predicted protein                                      493   2e-162   
gb|EMS60260.1|  hypothetical protein TRIUR3_00545                       491   4e-162   
ref|XP_011043078.1|  PREDICTED: probable zinc metalloprotease EGY...    467   3e-154   
gb|ABK24818.1|  unknown                                                 459   1e-150   Picea sitchensis
gb|KDO69042.1|  hypothetical protein CISIN_1g009542mg                   441   5e-145   
ref|XP_004169797.1|  PREDICTED: uncharacterized protein LOC101225644    408   5e-133   
ref|XP_008368078.1|  PREDICTED: probable zinc metalloprotease EGY...    399   5e-130   
gb|KDO69045.1|  hypothetical protein CISIN_1g009542mg                   389   4e-126   
gb|KDO69044.1|  hypothetical protein CISIN_1g009542mg                   389   7e-126   
ref|XP_010321956.1|  PREDICTED: probable zinc metalloprotease EGY...    385   2e-123   
ref|XP_002991591.1|  hypothetical protein SELMODRAFT_133892             352   8e-111   
ref|XP_002971707.1|  hypothetical protein SELMODRAFT_95889              351   2e-110   
ref|XP_008360780.1|  PREDICTED: probable zinc metalloprotease EGY...    283   7e-86    
tpg|DAA53528.1|  TPA: hypothetical protein ZEAMMB73_972585              249   7e-73    
gb|ACR35180.1|  unknown                                                 243   2e-71    Zea mays [maize]
ref|XP_005647168.1|  hypothetical protein COCSUDRAFT_63768              207   4e-56    
ref|XP_005845043.1|  hypothetical protein CHLNCDRAFT_137300             207   8e-56    
tpg|DAA53530.1|  TPA: hypothetical protein ZEAMMB73_972585              197   3e-54    
gb|ACF87459.1|  unknown                                                 196   3e-53    Zea mays [maize]
ref|WP_009555773.1|  putative membrane-associated Zn-dependent pr...    199   4e-52    
ref|WP_006457279.1|  peptidase, M50 family protein                      199   5e-52    
ref|WP_017711300.1|  hypothetical protein                               198   1e-51    
ref|WP_017663365.1|  hypothetical protein                               194   2e-50    
ref|WP_015199055.1|  peptidase M50                                      193   3e-50    
ref|WP_015191816.1|  peptidase M50                                      193   3e-50    
ref|WP_019505679.1|  hypothetical protein                               193   3e-50    
ref|WP_015230981.1|  membrane-associated Zn-dependent protease          192   9e-50    
ref|WP_016952522.1|  peptidase M50                                      192   1e-49    
ref|WP_023064717.1|  peptidase M50 family protein                       191   1e-49    
ref|WP_015151797.1|  putative membrane-associated Zn-dependent pr...    191   2e-49    
ref|WP_015205332.1|  peptidase M50                                      191   3e-49    
ref|WP_011317918.1|  peptidase M50                                      189   5e-49    
ref|WP_015215624.1|  peptidase M50                                      189   6e-49    
ref|WP_015171010.1|  peptidase M50                                      189   1e-48    
ref|WP_009784378.1|  Peptidase M50                                      188   2e-48    
ref|WP_009545030.1|  MULTISPECIES: peptidase M50                        188   2e-48    
ref|WP_008277029.1|  Peptidase M50                                      188   2e-48    
ref|XP_002958157.1|  hypothetical protein VOLCADRAFT_119887             188   3e-48    
ref|WP_015159790.1|  putative membrane-associated Zn-dependent pr...    187   3e-48    
ref|WP_013191411.1|  peptidase M50                                      186   5e-48    
ref|WP_015224241.1|  peptidase M50                                      187   5e-48    
ref|WP_010996272.1|  hypothetical protein                               186   8e-48    
ref|WP_006508506.1|  putative membrane-associated Zn-dependent pr...    185   1e-47    
ref|WP_040935682.1|  peptidase M50                                      184   4e-47    
ref|WP_040944195.1|  peptidase M50                                      184   4e-47    
ref|WP_017322887.1|  peptidase M50                                      184   4e-47    
ref|WP_035985423.1|  peptidase M50                                      184   5e-47    
ref|WP_012412293.1|  peptidase M50                                      183   7e-47    
ref|XP_001690234.1|  predicted protein                                  181   7e-47    Chlamydomonas reinhardtii
ref|WP_016874597.1|  peptidase M50                                      183   7e-47    
ref|WP_040938706.1|  peptidase M50                                      183   9e-47    
ref|WP_006278268.1|  Peptidase M50                                      182   1e-46    
ref|WP_009341443.1|  Peptidase M50                                      182   1e-46    
ref|WP_029634567.1|  peptidase M50 [                                    182   1e-46    
ref|WP_016863256.1|  peptidase M50                                      182   2e-46    
ref|WP_036003298.1|  peptidase M50                                      182   2e-46    
ref|WP_008231554.1|  Zinc metalloprotease                               182   2e-46    
gb|AHJ28239.1|  Zinc metalloprotease                                    182   3e-46    
ref|WP_006197075.1|  Peptidase M50                                      182   3e-46    
ref|WP_015138383.1|  putative membrane-associated Zn-dependent pr...    181   3e-46    
ref|WP_028091274.1|  peptidase M50                                      181   4e-46    
ref|WP_026731300.1|  peptidase M50                                      181   4e-46    
ref|WP_026148516.1|  peptidase M50                                      181   4e-46    
ref|WP_008230103.1|  Zinc metalloprotease                               181   5e-46    
ref|WP_012307010.1|  membrane-associated Zn-dependent proteases 1       181   6e-46    
ref|WP_021833683.1|  Peptidase M50                                      181   6e-46    
ref|WP_017311834.1|  peptidase M50                                      180   7e-46    
ref|WP_021830770.1|  Peptidase M50                                      181   7e-46    
ref|WP_021835009.1|  Peptidase M50                                      181   8e-46    
ref|WP_039740188.1|  peptidase M50                                      180   8e-46    
ref|WP_039201805.1|  peptidase M50                                      180   8e-46    
ref|WP_015218252.1|  peptidase M50                                      181   8e-46    
ref|WP_015221535.1|  peptidase M50                                      180   9e-46    
ref|WP_027404901.1|  peptidase M50                                      180   1e-45    
dbj|GAL92581.1|  peptidase M50                                          180   1e-45    
ref|WP_015206519.1|  putative membrane-associated Zn-dependent pr...    179   2e-45    
ref|WP_013320498.1|  peptidase M50                                      179   2e-45    
ref|WP_024546216.1|  peptidase M50                                      179   2e-45    
ref|WP_028082085.1|  peptidase M50                                      179   2e-45    
emb|CDN13196.1|  Zinc metalloprotease                                   179   2e-45    
ref|WP_037219960.1|  peptidase M50                                      179   2e-45    
ref|WP_030006587.1|  peptidase M50                                      179   3e-45    
ref|WP_015130229.1|  peptidase M50                                      179   3e-45    
ref|WP_015078547.1|  peptidase M50                                      179   3e-45    
ref|WP_007306071.1|  Peptidase M50                                      179   3e-45    
ref|WP_017750019.1|  peptidase M50                                      179   3e-45    
ref|WP_011243844.1|  hypothetical protein                               179   3e-45    
ref|WP_011378522.1|  MULTISPECIES: hypothetical protein                 179   3e-45    
ref|WP_011610276.1|  peptidase M50                                      179   3e-45    
ref|WP_041032880.1|  peptidase M50                                      178   4e-45    
ref|WP_012595338.1|  MULTISPECIES: peptidase M50                        178   5e-45    
ref|WP_040054451.1|  peptidase M50                                      177   6e-45    
gb|KIE09820.1|  peptidase M50                                           177   6e-45    
ref|WP_015956910.1|  peptidase M50                                      177   9e-45    
ref|WP_016865864.1|  peptidase M50                                      177   1e-44    
ref|WP_015187728.1|  peptidase M50                                      177   1e-44    
ref|WP_017304876.1|  hypothetical protein                               177   1e-44    
gb|KIJ81862.1|  peptidase M50                                           177   1e-44    
ref|WP_012627821.1|  peptidase M50                                      177   1e-44    
ref|WP_002800641.1|  putative peptidase M                               176   2e-44    
ref|WP_015120567.1|  putative membrane-associated Zn-dependent pr...    176   2e-44    
ref|WP_017315960.1|  peptidase M50                                      176   3e-44    
ref|WP_002782685.1|  putative peptidase M                               176   3e-44    
ref|WP_038531645.1|  peptidase M50                                      176   3e-44    
ref|WP_023074940.1|  peptidase m50                                      176   3e-44    
gb|AIE75167.1|  Zinc metalloprotease                                    176   3e-44    
ref|WP_017720928.1|  hypothetical protein                               176   4e-44    
ref|WP_004163219.1|  putative peptidase M                               175   4e-44    
ref|WP_006513808.1|  putative membrane-associated Zn-dependent pr...    175   6e-44    
ref|WP_009457225.1|  MULTISPECIES: peptidase M50                        174   7e-44    
ref|WP_002760286.1|  putative peptidase M                               174   1e-43    
ref|WP_008196986.1|  putative peptidase M                               174   1e-43    
ref|WP_015144804.1|  putative membrane-associated Zn-dependent pr...    174   1e-43    
dbj|BAP18401.1|  peptidase M50                                          173   2e-43    
ref|WP_002735685.1|  peptidase M50 family protein                       173   3e-43    
ref|WP_017293559.1|  hypothetical protein                               173   3e-43    
ref|WP_006098521.1|  peptidase, M50 family protein                      173   3e-43    
ref|WP_010872254.1|  hypothetical protein                               173   3e-43    
ref|WP_016516802.1|  Zn-dependent proteases                             173   3e-43    
ref|WP_002744090.1|  peptidase M50 family protein                       172   4e-43    
ref|WP_002750360.1|  Similar to tr|Q8YV67|Q8YV67                        172   4e-43    
ref|WP_024970168.1|  peptidase M50                                      172   4e-43    
ref|WP_015181376.1|  membrane-associated Zn-dependent protease          172   5e-43    
ref|WP_017651298.1|  peptidase M50                                      172   5e-43    
ref|WP_015132568.1|  peptidase M50                                      172   6e-43    
ref|WP_002790809.1|  Similar to tr|Q8YV67|Q8YV67                        172   6e-43    
ref|WP_002765755.1|  Similar to tr|Q8YV67|Q8YV67                        172   7e-43    
ref|WP_015156024.1|  peptidase M50                                      172   7e-43    
ref|WP_002785935.1|  Similar to tr|Q8YV67|Q8YV67                        171   8e-43    
ref|WP_012264351.1|  putative peptidase M                               171   9e-43    
ref|WP_039716438.1|  peptidase M50                                      171   9e-43    
ref|XP_002316224.2|  hypothetical protein POPTR_0010s19810g             162   1e-42    Populus trichocarpa [western balsam poplar]
ref|XP_004170486.1|  PREDICTED: uncharacterized LOC101217814            160   1e-42    
ref|WP_018396897.1|  hypothetical protein                               171   2e-42    
ref|WP_027846599.1|  peptidase M50                                      170   2e-42    
ref|WP_026722695.1|  peptidase M50                                      170   2e-42    
ref|WP_019493774.1|  peptidase M50                                      170   3e-42    
ref|WP_035148897.1|  peptidase M50                                      169   4e-42    
ref|WP_022608739.1|  putative membrane-associated Zn-dependent pr...    169   4e-42    
ref|WP_015112975.1|  peptidase M50                                      169   6e-42    
ref|WP_002776361.1|  Similar to tr|Q8YV67|Q8YV67                        169   7e-42    
ref|WP_012954612.1|  putative membrane-associated Zn-dependent pr...    168   8e-42    
ref|WP_006626236.1|  peptidase M50                                      168   9e-42    
gb|EHJ12119.1|  Peptidase M50                                           165   1e-41    
ref|WP_008050062.1|  Peptidase M50                                      168   1e-41    
ref|WP_006670066.1|  peptidase M50                                      168   1e-41    
ref|WP_006620010.1|  peptidase M50                                      168   1e-41    
ref|WP_017296618.1|  hypothetical protein                               167   2e-41    
ref|WP_006529819.1|  putative membrane-associated Zn-dependent pr...    166   4e-41    
ref|WP_007355969.1|  MULTISPECIES: Peptidase M50                        167   4e-41    
ref|WP_014275759.1|  hypothetical protein                               166   5e-41    
ref|WP_036477010.1|  peptidase M50                                      166   8e-41    
ref|WP_026787979.1|  MULTISPECIES: peptidase M50                        165   1e-40    
gb|KEI67586.1|  hypothetical protein A19Y_2700                          166   1e-40    
ref|WP_026796641.1|  peptidase M50                                      165   1e-40    
ref|WP_035827175.1|  peptidase M50                                      164   1e-40    
ref|WP_015177784.1|  peptidase M50                                      166   1e-40    
ref|WP_039728324.1|  peptidase M50                                      165   2e-40    
ref|WP_006631465.1|  peptidase M50                                      165   2e-40    
ref|WP_009631307.1|  putative membrane-associated Zn-dependent pr...    163   6e-40    
ref|WP_008314582.1|  putative membrane-associated Zn-dependent pr...    160   4e-39    
ref|WP_008179343.1|  putative membrane-associated Zn-dependent pr...    160   6e-39    
ref|WP_015166249.1|  peptidase M50                                      155   3e-37    
ref|WP_011057032.1|  hypothetical protein                               154   4e-37    
ref|WP_009626024.1|  peptidase M50                                      154   6e-37    
ref|WP_024124496.1|  intramembrane metalloprotease                      154   6e-37    
ref|WP_015125035.1|  putative membrane-associated Zn-dependent pr...    151   6e-36    
ref|WP_010476705.1|  M50 family peptidase                               150   2e-35    
ref|WP_012162248.1|  M50 family peptidase                               149   4e-35    
ref|WP_015167287.1|  putative membrane-associated Zn-dependent pr...    147   2e-34    
ref|WP_011431481.1|  peptidase M50                                      143   4e-33    
ref|WP_019500625.1|  hypothetical protein                               143   4e-33    
ref|WP_011432882.1|  peptidase M50                                      142   1e-32    
ref|WP_017328043.1|  hypothetical protein                               135   1e-30    
ref|XP_005705620.1|  peptidase, M50 family protein                      137   2e-30    
ref|XP_005712081.1|  unnamed protein product                            134   9e-30    
ref|WP_023174840.1|  peptidase M50                                      131   4e-29    
gb|KDP39656.1|  hypothetical protein JCGZ_02676                         125   8e-27    
gb|KHG07238.1|  High-affinity nickel transport nic1                     124   8e-27    
ref|XP_006339202.1|  PREDICTED: uncharacterized protein LOC102597135    124   1e-26    
ref|XP_006443495.1|  hypothetical protein CICLE_v10019476mg             125   1e-26    
ref|XP_010677790.1|  PREDICTED: probable zinc metalloprotease EGY...    124   1e-26    
ref|XP_006403068.1|  hypothetical protein EUTSA_v10003446mg             124   2e-26    
dbj|BAJ33691.1|  unnamed protein product                                124   2e-26    
ref|XP_011079259.1|  PREDICTED: probable zinc metalloprotease EGY...    124   2e-26    
ref|XP_009144640.1|  PREDICTED: probable zinc metalloprotease EGY...    124   2e-26    
ref|XP_004249371.1|  PREDICTED: probable zinc metalloprotease EGY...    123   3e-26    
ref|XP_010435422.1|  PREDICTED: probable zinc metalloprotease EGY...    123   3e-26    
gb|KDO66071.1|  hypothetical protein CISIN_1g008143mg                   123   4e-26    
ref|XP_006283448.1|  hypothetical protein CARUB_v10004495mg             123   4e-26    
emb|CDY52660.1|  BnaA05g35590D                                          123   4e-26    
ref|XP_003624692.1|  hypothetical protein MTR_7g086430                  123   4e-26    
emb|CDY06459.1|  BnaC06g11850D                                          122   6e-26    
ref|XP_002525695.1|  sterol regulatory element-binding protein si...    122   7e-26    
gb|ACJ85619.1|  unknown                                                 122   8e-26    
ref|XP_010450360.1|  PREDICTED: probable zinc metalloprotease EGY...    122   8e-26    
ref|XP_002269447.1|  PREDICTED: probable zinc metalloprotease EGY...    121   1e-25    
ref|XP_010553794.1|  PREDICTED: probable zinc metalloprotease EGY...    122   1e-25    
ref|XP_008681626.1|  PREDICTED: uncharacterized protein LOC100276...    121   1e-25    
ref|XP_002870425.1|  ethylene-dependent gravitropism-deficient an...    121   1e-25    
ref|XP_002463756.1|  hypothetical protein SORBIDRAFT_01g005580          121   1e-25    
ref|NP_001131230.1|  uncharacterized protein LOC100192539               121   1e-25    
ref|XP_002319720.2|  hypothetical protein POPTR_0013s06090g             121   2e-25    
ref|XP_003548687.1|  PREDICTED: uncharacterized protein LOC100782345    120   2e-25    
ref|XP_004493210.1|  PREDICTED: uncharacterized protein LOC101495088    120   3e-25    
ref|XP_011034291.1|  PREDICTED: probable zinc metalloprotease EGY...    120   3e-25    
ref|XP_009598274.1|  PREDICTED: probable zinc metalloprotease EGY...    120   3e-25    
ref|XP_010909990.1|  PREDICTED: probable zinc metalloprotease EGY...    120   3e-25    
gb|EYU30344.1|  hypothetical protein MIMGU_mgv1a004011mg                120   3e-25    
gb|KFK30768.1|  hypothetical protein AALP_AA6G023700                    120   4e-25    
dbj|BAJ96115.1|  predicted protein                                      120   4e-25    
ref|XP_010088493.1|  hypothetical protein L484_013698                   120   4e-25    
ref|XP_010440699.1|  PREDICTED: probable zinc metalloprotease EGY...    120   4e-25    
ref|XP_004981479.1|  PREDICTED: uncharacterized protein LOC101752817    120   4e-25    
ref|XP_008681629.1|  PREDICTED: uncharacterized protein LOC100276...    119   6e-25    
ref|NP_198372.1|  metalloprotease EGY1                                  119   6e-25    
ref|XP_006651895.1|  PREDICTED: uncharacterized protein LOC102716031    119   6e-25    
ref|XP_008681628.1|  PREDICTED: uncharacterized protein LOC100276...    119   7e-25    
ref|XP_004149105.1|  PREDICTED: uncharacterized protein LOC101218567    119   7e-25    
ref|XP_004309741.1|  PREDICTED: uncharacterized protein LOC101302515    119   7e-25    
ref|XP_005716998.1|  unnamed protein product                            119   1e-24    
ref|XP_008442024.1|  PREDICTED: probable zinc metalloprotease EGY...    119   1e-24    
gb|AAO37991.2|  expressed protein                                       117   1e-24    
ref|XP_009762211.1|  PREDICTED: probable zinc metalloprotease EGY...    118   1e-24    
sp|Q852K0.3|EGY1_ORYSJ  RecName: Full=Probable zinc metalloprotea...    118   2e-24    
ref|XP_008681627.1|  PREDICTED: uncharacterized protein LOC100276...    118   2e-24    
ref|NP_001051523.1|  Os03g0792400                                       117   3e-24    
ref|XP_010036254.1|  PREDICTED: probable zinc metalloprotease EGY...    117   3e-24    
ref|XP_003554044.1|  PREDICTED: uncharacterized protein LOC100808073    117   3e-24    
ref|XP_010553793.1|  PREDICTED: probable zinc metalloprotease EGY...    117   3e-24    
ref|XP_007162002.1|  hypothetical protein PHAVU_001G115400g             117   3e-24    
ref|XP_006283449.1|  hypothetical protein CARUB_v10004495mg             116   4e-24    
ref|XP_006826333.1|  hypothetical protein AMTR_s00004p00107700          116   5e-24    
ref|XP_010909991.1|  PREDICTED: probable zinc metalloprotease EGY...    116   5e-24    
ref|XP_007029999.1|  Peptidase M50 family protein isoform 1             116   5e-24    
ref|XP_011034293.1|  PREDICTED: probable zinc metalloprotease EGY...    115   7e-24    
ref|XP_011034292.1|  PREDICTED: probable zinc metalloprotease EGY...    115   8e-24    
ref|WP_011141712.1|  hypothetical protein                               115   1e-23    
ref|XP_007030002.1|  Peptidase M50 family protein isoform 4             114   1e-23    
ref|XP_010553795.1|  PREDICTED: probable zinc metalloprotease EGY...    115   1e-23    
ref|XP_009762210.1|  PREDICTED: probable zinc metalloprotease EGY...    114   2e-23    
ref|XP_008791388.1|  PREDICTED: probable zinc metalloprotease EGY...    114   2e-23    
ref|XP_010266698.1|  PREDICTED: probable zinc metalloprotease EGY...    114   3e-23    
ref|XP_009406557.1|  PREDICTED: probable zinc metalloprotease EGY...    114   4e-23    
ref|XP_003557844.2|  PREDICTED: probable zinc metalloprotease EGY...    113   2e-22    
ref|XP_001785762.1|  predicted protein                                  110   2e-22    
ref|XP_008791389.1|  PREDICTED: probable zinc metalloprotease EGY...    110   3e-22    
ref|XP_009353084.1|  PREDICTED: probable zinc metalloprotease EGY...    110   6e-22    
ref|XP_008391716.1|  PREDICTED: probable zinc metalloprotease EGY...    110   6e-22    
ref|XP_007203756.1|  hypothetical protein PRUPE_ppa003667mg             110   7e-22    
ref|XP_009353085.1|  PREDICTED: probable zinc metalloprotease EGY...    109   1e-21    
ref|XP_002509340.1|  peptidase M50 family protein                       109   2e-21    
gb|KEH23543.1|  M50 family peptidase                                    106   3e-21    
ref|XP_008244135.1|  PREDICTED: probable zinc metalloprotease EGY...    107   4e-21    
ref|XP_001420429.1|  predicted protein                                  106   4e-21    
emb|CBN77543.1|  conserved unknown protein                              106   2e-20    
ref|WP_015155219.1|  peptidase M50                                      105   2e-20    
dbj|BAA98209.1|  unnamed protein product                                104   3e-20    
gb|EWM28543.1|  peptidase m50                                           105   3e-20    
ref|XP_003061419.1|  predicted protein                                  102   9e-20    
ref|XP_009366503.1|  PREDICTED: probable zinc metalloprotease EGY...    103   9e-20    
ref|XP_010909994.1|  PREDICTED: probable zinc metalloprotease EGY...    102   2e-19    
ref|XP_001699451.1|  membrane associated metalloprotease                103   2e-19    
ref|XP_007509547.1|  predicted protein                                  103   2e-19    
ref|XP_001758571.1|  predicted protein                                  100   2e-19    
ref|XP_007030001.1|  Peptidase M50 family protein isoform 3             100   3e-19    
ref|XP_007030000.1|  Peptidase M50 family protein isoform 2             100   4e-19    
ref|WP_039200242.1|  peptidase M50                                      101   4e-19    
ref|XP_005651040.1|  hypothetical protein COCSUDRAFT_46110              101   5e-19    
emb|CEF99551.1|  Peptidase M50                                          101   5e-19    
ref|WP_027404372.1|  peptidase M50                                      100   5e-19    
ref|NP_001131703.1|  hypothetical protein                             95.9    1e-18    
ref|XP_002950938.1|  hypothetical protein VOLCADRAFT_61017            99.0    1e-18    
ref|XP_005537986.1|  hypothetical protein, conserved                    100   1e-18    
ref|WP_039716560.1|  peptidase M50                                    99.0    2e-18    
ref|WP_019490096.1|  hypothetical protein                             98.6    3e-18    
ref|WP_015228900.1|  membrane-associated Zn-dependent protease        98.6    3e-18    
ref|WP_041034076.1|  peptidase M50                                    97.8    5e-18    
gb|EMT17722.1|  Speckle-type POZ protein                              98.6    7e-18    
ref|WP_011056715.1|  hypothetical protein                             95.5    3e-17    
gb|AHJ30811.1|  Zinc metalloprotease                                  94.4    4e-17    
ref|WP_006198253.1|  hypothetical protein                             94.4    4e-17    
ref|WP_018396453.1|  hypothetical protein                             94.7    6e-17    
ref|WP_024125801.1|  intramembrane metalloprotease family M50         93.6    1e-16    
ref|WP_015225641.1|  peptidase M50                                    93.6    1e-16    
ref|WP_015118513.1|  putative membrane-associated Zn-dependent pr...  93.2    2e-16    
ref|WP_017322719.1|  peptidase M50                                    92.8    2e-16    
ref|WP_028089304.1|  peptidase M50                                    92.8    2e-16    
ref|WP_011377434.1|  MULTISPECIES: hypothetical protein               92.8    2e-16    
ref|WP_011243729.1|  hypothetical protein                             92.8    2e-16    
gb|KIJ83756.1|  peptidase M50                                         92.4    2e-16    
gb|AJD56824.1|  peptidase M50                                         92.4    3e-16    
ref|WP_009341720.1|  Peptidase M50                                    92.0    3e-16    
ref|WP_015206410.1|  putative membrane-associated Zn-dependent pr...  92.0    4e-16    
ref|WP_015083380.1|  peptidase M50                                    92.0    4e-16    
ref|WP_028085185.1|  peptidase M50                                    91.7    5e-16    
ref|WP_013190875.1|  peptidase M50                                    91.3    5e-16    
ref|WP_015150493.1|  putative membrane-associated Zn-dependent pr...  91.3    6e-16    
ref|WP_008231619.1|  Zinc metalloprotease                             90.9    7e-16    
ref|WP_011430577.1|  peptidase M50                                    90.9    9e-16    
ref|XP_010909993.1|  PREDICTED: probable zinc metalloprotease EGY...  90.5    1e-15    
ref|WP_026731033.1|  peptidase M50                                    90.5    1e-15    
ref|XP_010909992.1|  PREDICTED: probable zinc metalloprotease EGY...  90.5    1e-15    
emb|CDP12645.1|  unnamed protein product                              89.0    1e-15    
gb|KFM27050.1|  hypothetical protein F751_5882                        90.5    1e-15    
ref|WP_006275798.1|  Peptidase M50                                    89.0    3e-15    
ref|WP_009556918.1|  putative membrane-associated Zn-dependent pr...  89.0    4e-15    
gb|KIE08671.1|  peptidase M50                                         88.6    5e-15    
ref|WP_015177197.1|  peptidase M50                                    88.2    6e-15    
ref|WP_028954478.1|  peptidase M50                                    87.8    9e-15    
ref|WP_012408444.1|  peptidase M50                                    87.4    1e-14    
ref|XP_002463944.1|  hypothetical protein SORBIDRAFT_01g009370        87.4    1e-14    
gb|KDR54406.1|  peptidase M50                                         86.7    2e-14    
ref|WP_015145341.1|  putative membrane-associated Zn-dependent pr...  86.7    2e-14    
ref|WP_015201863.1|  peptidase M50                                    86.7    2e-14    
ref|WP_006617324.1|  peptidase M50                                    86.7    2e-14    
ref|WP_035155126.1|  peptidase M50                                    86.7    2e-14    
ref|WP_016876629.1|  peptidase M50                                    86.7    2e-14    
ref|WP_035738059.1|  peptidase M50                                    86.3    2e-14    
gb|EKD11475.1|  peptidase M50                                         86.7    2e-14    
ref|WP_021833990.1|  Zinc metalloprotease                             86.3    2e-14    
ref|WP_008049243.1|  putative zinc metallopeptidase, M50 family       86.3    3e-14    
ref|WP_015212948.1|  peptidase M50                                    86.3    3e-14    
ref|WP_006668084.1|  MULTISPECIES: peptidase M50                      85.9    3e-14    
ref|WP_015197483.1|  peptidase M50                                    85.5    4e-14    
ref|XP_002292900.1|  predicted protein                                85.1    6e-14    
ref|WP_017719636.1|  hypothetical protein                             85.1    6e-14    
ref|WP_007311247.1|  Zinc metalloprotease                             85.1    7e-14    
ref|WP_021831660.1|  Zinc metalloprotease                             84.7    7e-14    
ref|WP_007306049.1|  Peptidase M50                                    84.7    8e-14    
ref|XP_003516765.1|  PREDICTED: uncharacterized protein LOC100818...  84.7    8e-14    
dbj|BAJ91477.1|  predicted protein                                    84.7    9e-14    
ref|WP_011431885.1|  peptidase M50                                    84.3    1e-13    
ref|WP_039726305.1|  peptidase M50                                    84.3    1e-13    
ref|WP_015188915.1|  peptidase M50                                    84.3    1e-13    
gb|ACF87643.1|  unknown                                               84.0    1e-13    
ref|WP_008275662.1|  hypothetical protein                             84.3    1e-13    
ref|WP_017310514.1|  peptidase M50                                    84.0    1e-13    
ref|XP_009335346.1|  PREDICTED: probable zinc metallopeptidase EG...  84.3    1e-13    
ref|WP_017747655.1|  peptidase M50                                    84.0    1e-13    
ref|NP_001142102.1|  uncharacterized protein LOC100274266             84.3    1e-13    
ref|XP_003604372.1|  Peptidase M50 family                             84.0    2e-13    
ref|WP_010469165.1|  M50 family peptidase                             83.6    2e-13    
tpg|DAA51147.1|  TPA: peptidase, M50 family                           84.0    2e-13    
ref|XP_009617672.1|  PREDICTED: probable zinc metallopeptidase EG...  83.6    2e-13    
ref|XP_007157198.1|  hypothetical protein PHAVU_002G050700g           83.6    2e-13    
gb|KDP44548.1|  hypothetical protein JCGZ_16381                       83.2    3e-13    
ref|WP_036535244.1|  peptidase M50                                    82.8    3e-13    
ref|WP_015129803.1|  peptidase M50                                    82.8    3e-13    
ref|XP_002186442.1|  predicted protein                                83.2    3e-13    
ref|XP_010691542.1|  PREDICTED: probable zinc metallopeptidase EG...  82.8    4e-13    
ref|XP_008236259.1|  PREDICTED: probable zinc metallopeptidase EG...  82.8    4e-13    
ref|WP_017307073.1|  hypothetical protein                             82.4    5e-13    
ref|XP_008785731.1|  PREDICTED: probable zinc metallopeptidase EG...  82.4    5e-13    
ref|XP_008454418.1|  PREDICTED: probable zinc metallopeptidase EG...  82.4    5e-13    
ref|XP_006650535.1|  PREDICTED: uncharacterized protein LOC102702830  82.4    5e-13    
sp|A2XLM6.1|EGY3_ORYSI  RecName: Full=Probable zinc metalloprotea...  82.4    6e-13    
ref|XP_002982514.1|  hypothetical protein SELMODRAFT_445223           79.3    6e-13    
ref|XP_004150265.1|  PREDICTED: uncharacterized protein LOC101220315  82.0    7e-13    
ref|WP_029632231.1|  peptidase M50 [                                  81.6    7e-13    
ref|NP_001051151.1|  Os03g0729000                                     82.0    7e-13    
ref|XP_006422752.1|  hypothetical protein CICLE_v10028052mg           82.0    7e-13    
ref|WP_026787374.1|  MULTISPECIES: peptidase M50                      81.6    8e-13    
emb|CDN15288.1|  Zinc metalloprotease                                 81.3    9e-13    
ref|WP_017654012.1|  peptidase M50                                    81.3    1e-12    
ref|WP_027842884.1|  peptidase M50                                    80.9    1e-12    
ref|WP_006634816.1|  peptidase M50                                    80.9    1e-12    
ref|XP_004981900.1|  PREDICTED: uncharacterized protein LOC101752556  80.9    2e-12    
ref|WP_012161327.1|  M50 family peptidase                             80.5    2e-12    
gb|KDO49538.1|  hypothetical protein CISIN_1g012885mg                 80.1    2e-12    
gb|KEI69124.1|  hypothetical protein A19Y_4479                        80.1    2e-12    
ref|WP_017659237.1|  hypothetical protein                             80.1    2e-12    
ref|XP_002298791.2|  hypothetical protein POPTR_0001s29700g           80.1    3e-12    
ref|WP_015132605.1|  peptidase M50                                    79.7    3e-12    
ref|WP_037222775.1|  peptidase M50                                    79.7    3e-12    
ref|XP_006486883.1|  PREDICTED: uncharacterized protein LOC102621999  79.7    3e-12    
gb|KHG12833.1|  putative cytosol aminopeptidase                       79.7    3e-12    
ref|WP_026793526.1|  MULTISPECIES: peptidase M50                      79.3    4e-12    
ref|WP_015115190.1|  peptidase M50                                    79.3    4e-12    
ref|WP_026099602.1|  peptidase M50                                    79.3    4e-12    
ref|XP_010939357.1|  PREDICTED: probable zinc metallopeptidase EG...  79.3    5e-12    
ref|WP_009455347.1|  MULTISPECIES: peptidase M50                      79.0    5e-12    
tpg|DAA51840.1|  TPA: hypothetical protein ZEAMMB73_544800            77.8    5e-12    
ref|XP_007042686.1|  Ethylene-dependent gravitropism-deficient an...  79.3    5e-12    
ref|WP_016860613.1|  peptidase M50                                    79.0    5e-12    
ref|WP_027268798.1|  peptidase M50                                    79.0    6e-12    
gb|EJK75123.1|  hypothetical protein THAOC_03166                      79.3    6e-12    
ref|XP_002522110.1|  sterol regulatory element-binding protein si...  79.0    6e-12    
ref|WP_015140148.1|  putative membrane-associated Zn-dependent pr...  78.6    6e-12    
ref|XP_004156868.1|  PREDICTED: uncharacterized LOC101220315          79.0    7e-12    
ref|WP_016866278.1|  peptidase M50                                    78.6    7e-12    
ref|XP_011030296.1|  PREDICTED: probable zinc metallopeptidase EG...  78.6    8e-12    
ref|XP_011014535.1|  PREDICTED: probable zinc metallopeptidase EG...  78.6    8e-12    
ref|XP_005539291.1|  hypothetical protein, conserved                  78.6    8e-12    
ref|XP_006346281.1|  PREDICTED: uncharacterized protein LOC102606295  78.2    1e-11    
ref|WP_026722359.1|  peptidase M50                                    77.8    1e-11    
ref|XP_003560291.1|  PREDICTED: probable zinc metalloprotease EGY...  78.2    1e-11    



>ref|XP_009612784.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X4 [Nicotiana tomentosiformis]
Length=537

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/536 (74%), Positives = 451/536 (84%), Gaps = 7/536 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ---IDFPTKHLLRFAFNMKR  1693
             M+ PA+ R ++VP+  QCSSC + R QPLLS      QK    I+FP +H LRF    K 
Sbjct  1     MNMPAVCRVSIVPVSPQCSSCCYNRLQPLLSSPSTGPQKHSSSINFPARHFLRFVARNKG  60

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
              VIC  S +ETEPD+N++ + KL EE + +   +  S +    NS  DQD  Q  GMLE+
Sbjct  61    SVICRSSETETEPDKNDDKDEKLAEEADGANLNEDKSLEL---NSRPDQDKDQPLGMLEN  117

Query  1512  KDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGF  1333
               L N N   VN Q G ED  +++++SGSPLPG+KP QLDE+IRIPKETI+IL++QVFGF
Sbjct  118   TSLENNNGAQVNEQPGIEDGTEVKVSSGSPLPGVKPLQLDESIRIPKETIEILRNQVFGF  177

Query  1332  DTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAV  1153
             DTFFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD YKLFLL NPEDDKPVAV
Sbjct  178   DTFFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDAYKLFLLNNPEDDKPVAV  237

Query  1152  VVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
             VVPR+TLQP+T AVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLSV DN DLL++GLPGA
Sbjct  238   VVPRMTLQPETIAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSVVDNLDLLKDGLPGA  297

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             L+TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFGAITRI+NIVPKREDLLK AA
Sbjct  298   LITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFGAITRIVNIVPKREDLLKVAA  357

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGP+AGFS+G ILLL GF LPP DG+G++VDPSVFHES LAGGIAKLLLGDALKEGTPIS
Sbjct  358   AGPIAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFLAGGIAKLLLGDALKEGTPIS  417

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDV  433
             VNPLV+W+ AGLLINAINSIPAGELDGGRI+F+ WGRK SARLSS SIGLLGISALFSDV
Sbjct  418   VNPLVIWAWAGLLINAINSIPAGELDGGRIAFATWGRKASARLSSLSIGLLGISALFSDV  477

Query  432   AFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             AFYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLLGLLVCLPYPFPF++EA
Sbjct  478   AFYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLLGLLVCLPYPFPFSSEA  533



>ref|XP_009612782.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/537 (74%), Positives = 451/537 (84%), Gaps = 8/537 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ---IDFPTKHLLRFAFNMKR  1693
             M+ PA+ R ++VP+  QCSSC + R QPLLS      QK    I+FP +H LRF    K 
Sbjct  1     MNMPAVCRVSIVPVSPQCSSCCYNRLQPLLSSPSTGPQKHSSSINFPARHFLRFVARNKG  60

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
              VIC  S +ETEPD+N++ + KL EE + +   +  S +    NS  DQD  Q  GMLE+
Sbjct  61    SVICRSSETETEPDKNDDKDEKLAEEADGANLNEDKSLEL---NSRPDQDKDQPLGMLEN  117

Query  1512  KDLVNGNSVNVNAQTGNE-DADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFG  1336
               L N N   VN Q G E D  +++++SGSPLPG+KP QLDE+IRIPKETI+IL++QVFG
Sbjct  118   TSLENNNGAQVNEQPGIEQDGTEVKVSSGSPLPGVKPLQLDESIRIPKETIEILRNQVFG  177

Query  1335  FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVA  1156
             FDTFFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD YKLFLL NPEDDKPVA
Sbjct  178   FDTFFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDAYKLFLLNNPEDDKPVA  237

Query  1155  VVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPG  976
             VVVPR+TLQP+T AVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLSV DN DLL++GLPG
Sbjct  238   VVVPRMTLQPETIAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSVVDNLDLLKDGLPG  297

Query  975   ALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFA  796
             AL+TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFGAITRI+NIVPKREDLLK A
Sbjct  298   ALITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFGAITRIVNIVPKREDLLKVA  357

Query  795   AAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPI  616
             AAGP+AGFS+G ILLL GF LPP DG+G++VDPSVFHES LAGGIAKLLLGDALKEGTPI
Sbjct  358   AAGPIAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFLAGGIAKLLLGDALKEGTPI  417

Query  615   SVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSD  436
             SVNPLV+W+ AGLLINAINSIPAGELDGGRI+F+ WGRK SARLSS SIGLLGISALFSD
Sbjct  418   SVNPLVIWAWAGLLINAINSIPAGELDGGRIAFATWGRKASARLSSLSIGLLGISALFSD  477

Query  435   VAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             VAFYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLLGLLVCLPYPFPF++EA
Sbjct  478   VAFYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLLGLLVCLPYPFPFSSEA  534



>ref|XP_009612783.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X3 [Nicotiana tomentosiformis]
Length=538

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/537 (74%), Positives = 451/537 (84%), Gaps = 8/537 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ---IDFPTKHLLRFAFNMKR  1693
             M+ PA+ R ++VP+  QCSSC + R QPLLS      QK    I+FP +H LRF    K 
Sbjct  1     MNMPAVCRVSIVPVSPQCSSCCYNRLQPLLSSPSTGPQKHSSSINFPARHFLRFVARNKG  60

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
              VIC  S +ETEPD+N++ + KL EE + +   +  S +    NS  DQD  Q  GMLE+
Sbjct  61    SVICRSSETETEPDKNDDKDEKLAEEADGANLNEDKSLEL---NSRPDQDKDQPLGMLEN  117

Query  1512  KDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLK-PQQLDEAIRIPKETIDILKDQVFG  1336
               L N N   VN Q G ED  +++++SGSPLPG+K P QLDE+IRIPKETI+IL++QVFG
Sbjct  118   TSLENNNGAQVNEQPGIEDGTEVKVSSGSPLPGVKVPLQLDESIRIPKETIEILRNQVFG  177

Query  1335  FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVA  1156
             FDTFFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD YKLFLL NPEDDKPVA
Sbjct  178   FDTFFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDAYKLFLLNNPEDDKPVA  237

Query  1155  VVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPG  976
             VVVPR+TLQP+T AVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLSV DN DLL++GLPG
Sbjct  238   VVVPRMTLQPETIAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSVVDNLDLLKDGLPG  297

Query  975   ALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFA  796
             AL+TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFGAITRI+NIVPKREDLLK A
Sbjct  298   ALITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFGAITRIVNIVPKREDLLKVA  357

Query  795   AAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPI  616
             AAGP+AGFS+G ILLL GF LPP DG+G++VDPSVFHES LAGGIAKLLLGDALKEGTPI
Sbjct  358   AAGPIAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFLAGGIAKLLLGDALKEGTPI  417

Query  615   SVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSD  436
             SVNPLV+W+ AGLLINAINSIPAGELDGGRI+F+ WGRK SARLSS SIGLLGISALFSD
Sbjct  418   SVNPLVIWAWAGLLINAINSIPAGELDGGRIAFATWGRKASARLSSLSIGLLGISALFSD  477

Query  435   VAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             VAFYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLLGLLVCLPYPFPF++EA
Sbjct  478   VAFYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLLGLLVCLPYPFPFSSEA  534



>ref|XP_009612781.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=539

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/538 (74%), Positives = 451/538 (84%), Gaps = 9/538 (2%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ---IDFPTKHLLRFAFNMKR  1693
             M+ PA+ R ++VP+  QCSSC + R QPLLS      QK    I+FP +H LRF    K 
Sbjct  1     MNMPAVCRVSIVPVSPQCSSCCYNRLQPLLSSPSTGPQKHSSSINFPARHFLRFVARNKG  60

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
              VIC  S +ETEPD+N++ + KL EE + +   +  S +    NS  DQD  Q  GMLE+
Sbjct  61    SVICRSSETETEPDKNDDKDEKLAEEADGANLNEDKSLEL---NSRPDQDKDQPLGMLEN  117

Query  1512  KDLVNGNSVNVNAQTGNE-DADDIQIASGSPLPGLK-PQQLDEAIRIPKETIDILKDQVF  1339
               L N N   VN Q G E D  +++++SGSPLPG+K P QLDE+IRIPKETI+IL++QVF
Sbjct  118   TSLENNNGAQVNEQPGIEQDGTEVKVSSGSPLPGVKVPLQLDESIRIPKETIEILRNQVF  177

Query  1338  GFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPV  1159
             GFDTFFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD YKLFLL NPEDDKPV
Sbjct  178   GFDTFFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDAYKLFLLNNPEDDKPV  237

Query  1158  AVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLP  979
             AVVVPR+TLQP+T AVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLSV DN DLL++GLP
Sbjct  238   AVVVPRMTLQPETIAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSVVDNLDLLKDGLP  297

Query  978   GALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKF  799
             GAL+TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFGAITRI+NIVPKREDLLK 
Sbjct  298   GALITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFGAITRIVNIVPKREDLLKV  357

Query  798   AAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTP  619
             AAAGP+AGFS+G ILLL GF LPP DG+G++VDPSVFHES LAGGIAKLLLGDALKEGTP
Sbjct  358   AAAGPIAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFLAGGIAKLLLGDALKEGTP  417

Query  618   ISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFS  439
             ISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F+ WGRK SARLSS SIGLLGISALFS
Sbjct  418   ISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFATWGRKASARLSSLSIGLLGISALFS  477

Query  438   DVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             DVAFYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLLGLLVCLPYPFPF++EA
Sbjct  478   DVAFYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLLGLLVCLPYPFPFSSEA  535



>ref|XP_009778927.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X4 [Nicotiana sylvestris]
Length=534

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/534 (73%), Positives = 446/534 (84%), Gaps = 6/534 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ-IDFPTKHLLRFAFNMKRDV  1687
             M+ PA+ R +++ +  QCSSC + R QPLLS       K  I+FPT++ LRF    K   
Sbjct  1     MNMPAVCRVSILSVSPQCSSCCYNRLQPLLSSPSAGPLKHSINFPTRNSLRFVARNKGSF  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKD  1507
             +C      TEPD++++ +  L +E +     DS +  + E NS  DQD  Q  GMLE+  
Sbjct  61    LCR----STEPDKSDDKDENLDKEADGVNLNDSVADKSLELNSRTDQDKDQTMGMLENPS  116

Query  1506  LVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDT  1327
             L N N   VN Q   ED  ++Q+ASGSPLPG+KP QLDE+ RIPKETI+IL++QVFGFDT
Sbjct  117   LENNNGAQVNEQPRVEDGTEVQVASGSPLPGVKPLQLDESTRIPKETIEILRNQVFGFDT  176

Query  1326  FFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVV  1147
             FFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD+YKLFLL NPEDDKPVAVVV
Sbjct  177   FFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDVYKLFLLNNPEDDKPVAVVV  236

Query  1146  PRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALV  967
             PR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLSV DN DLL++GLPGAL+
Sbjct  237   PRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSVVDNLDLLKDGLPGALI  296

Query  966   TALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAG  787
             TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFGAITRI+NIVP+REDLLK AAAG
Sbjct  297   TAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFGAITRIVNIVPEREDLLKVAAAG  356

Query  786   PlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVN  607
             PLAGFS+G ILLL GF LPP DG+G++VDPSVFHES LAGGIAKLLLGDALKEGTPISVN
Sbjct  357   PLAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFLAGGIAKLLLGDALKEGTPISVN  416

Query  606   PLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAF  427
             PLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK SARLSS SIGLLGISALFSDVAF
Sbjct  417   PLVIWAWAGLLINAINSIPAGELDGGRIAFAMWGRKASARLSSLSIGLLGISALFSDVAF  476

Query  426   YWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             YWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLLGLLVCLPYPF F+NEA
Sbjct  477   YWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLLGLLVCLPYPFLFSNEA  530



>ref|XP_009778926.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X3 [Nicotiana sylvestris]
Length=535

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/535 (73%), Positives = 446/535 (83%), Gaps = 7/535 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ-IDFPTKHLLRFAFNMKRDV  1687
             M+ PA+ R +++ +  QCSSC + R QPLLS       K  I+FPT++ LRF    K   
Sbjct  1     MNMPAVCRVSILSVSPQCSSCCYNRLQPLLSSPSAGPLKHSINFPTRNSLRFVARNKGSF  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKD  1507
             +C      TEPD++++ +  L +E +     DS +  + E NS  DQD  Q  GMLE+  
Sbjct  61    LCR----STEPDKSDDKDENLDKEADGVNLNDSVADKSLELNSRTDQDKDQTMGMLENPS  116

Query  1506  LVNGNSVNVNAQTGNEDADDIQIASGSPLPGLK-PQQLDEAIRIPKETIDILKDQVFGFD  1330
             L N N   VN Q   ED  ++Q+ASGSPLPG+K P QLDE+ RIPKETI+IL++QVFGFD
Sbjct  117   LENNNGAQVNEQPRVEDGTEVQVASGSPLPGVKVPLQLDESTRIPKETIEILRNQVFGFD  176

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD+YKLFLL NPEDDKPVAVV
Sbjct  177   TFFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDVYKLFLLNNPEDDKPVAVV  236

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGAL  970
             VPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLSV DN DLL++GLPGAL
Sbjct  237   VPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSVVDNLDLLKDGLPGAL  296

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             +TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFGAITRI+NIVP+REDLLK AAA
Sbjct  297   ITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFGAITRIVNIVPEREDLLKVAAA  356

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             GPLAGFS+G ILLL GF LPP DG+G++VDPSVFHES LAGGIAKLLLGDALKEGTPISV
Sbjct  357   GPLAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFLAGGIAKLLLGDALKEGTPISV  416

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             NPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK SARLSS SIGLLGISALFSDVA
Sbjct  417   NPLVIWAWAGLLINAINSIPAGELDGGRIAFAMWGRKASARLSSLSIGLLGISALFSDVA  476

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             FYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLLGLLVCLPYPF F+NEA
Sbjct  477   FYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLLGLLVCLPYPFLFSNEA  531



>ref|XP_002271131.2| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI25504.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/541 (70%), Positives = 439/541 (81%), Gaps = 7/541 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+FPA FRGN  P   CSSC  LRFQP LS   + RQK+    +     + R     +  
Sbjct  1     MNFPATFRGNFNPFSHCSSCCDLRFQPFLSSPIVWRQKRCRISNLQVHQVSRLGSRRRPR  60

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNS--LADQDNGQ--NFGM  1522
             ++C  + +ETEP+ N + E+             +   D    +   +ADQD  Q  +  M
Sbjct  61    IVCGVTETETEPENNNDEEKAHENGGMPPSIDSTVQNDPQLDSQPLVADQDKDQFVHNAM  120

Query  1521  LESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQV  1342
             L   ++VN ++    AQ   +D++++++ASGSPLPG+KPQ LDE+IRIPKETIDILKDQV
Sbjct  121   LNGDNMVNSDNQETEAQGNVQDSENLEVASGSPLPGVKPQVLDESIRIPKETIDILKDQV  180

Query  1341  FGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKP  1162
             FGFDTFFVT+QEPYEGGVLFKGNLRG+AA+SYEKI+ RMQDRFGD YKLFLLINPEDDKP
Sbjct  181   FGFDTFFVTNQEPYEGGVLFKGNLRGKAAKSYEKITIRMQDRFGDKYKLFLLINPEDDKP  240

Query  1161  VAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGL  982
             VAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTL LRNVPALQ+NLLSVFDN +LL +GL
Sbjct  241   VAVVVPRNTLQPETTAVPEWFAAGAFGLVTVFTLFLRNVPALQSNLLSVFDNLNLLMDGL  300

Query  981   PGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK  802
             PGALVTAL+LG HEISH LVA+  GIKLGVPYFVPSWQIGSFGAITRILNIVP REDLLK
Sbjct  301   PGALVTALVLGTHEISHILVARSTGIKLGVPYFVPSWQIGSFGAITRILNIVPNREDLLK  360

Query  801   FAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGT  622
              AAAGP+AGFSLG +LLLLGF LPP+DG+GVVVD SVFHESLLAGGIAKLLLGD LKEGT
Sbjct  361   VAAAGPIAGFSLGLVLLLLGFLLPPSDGIGVVVDASVFHESLLAGGIAKLLLGDVLKEGT  420

Query  621   PISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF  442
             PISVNPL++W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR ++ASI LLG+S+LF
Sbjct  421   PISVNPLLIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTAASIALLGLSSLF  480

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             +DVAFYWVVLIF LQRGPIAPLSEEITDP++KY+ALG+ VLLLGLLVCLPYPFPF NE  
Sbjct  481   NDVAFYWVVLIFFLQRGPIAPLSEEITDPEDKYVALGVVVLLLGLLVCLPYPFPFTNEVT  540

Query  261   M  259
             +
Sbjct  541   V  541



>ref|XP_009778925.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Nicotiana sylvestris]
Length=556

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/556 (70%), Positives = 445/556 (80%), Gaps = 28/556 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ-IDFPTKHLLRFAFNMKRDV  1687
             M+ PA+ R +++ +  QCSSC + R QPLLS       K  I+FPT++ LRF    K   
Sbjct  1     MNMPAVCRVSILSVSPQCSSCCYNRLQPLLSSPSAGPLKHSINFPTRNSLRFVARNKGSF  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKD  1507
             +C      TEPD++++ +  L +E +     DS +  + E NS  DQD  Q  GMLE+  
Sbjct  61    LCR----STEPDKSDDKDENLDKEADGVNLNDSVADKSLELNSRTDQDKDQTMGMLENPS  116

Query  1506  LVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDT  1327
             L N N   VN Q   ED  ++Q+ASGSPLPG+KP QLDE+ RIPKETI+IL++QVFGFDT
Sbjct  117   LENNNGAQVNEQPRVEDGTEVQVASGSPLPGVKPLQLDESTRIPKETIEILRNQVFGFDT  176

Query  1326  FFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVV  1147
             FFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD+YKLFLL NPEDDKPVAVVV
Sbjct  177   FFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDVYKLFLLNNPEDDKPVAVVV  236

Query  1146  PRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL------------------  1021
             PR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NL                   
Sbjct  237   PRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLFSKCSSVIYRILNKFYLNS  296

Query  1020  ----SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
                 SV DN DLL++GLPGAL+TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSFG
Sbjct  297   LKLQSVVDNLDLLKDGLPGALITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSFG  356

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITRI+NIVP+REDLLK AAAGPLAGFS+G ILLL GF LPP DG+G++VDPSVFHES L
Sbjct  357   AITRIVNIVPEREDLLKVAAAGPLAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESFL  416

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
             AGGIAKLLLGDALKEGTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S
Sbjct  417   AGGIAKLLLGDALKEGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFAMWGRKAS  476

Query  492   ARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlll  313
             ARLSS SIGLLGISALFSDVAFYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLLL
Sbjct  477   ARLSSLSIGLLGISALFSDVAFYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLLL  536

Query  312   gllVCLPYPFPFNNEA  265
             GLLVCLPYPF F+NEA
Sbjct  537   GLLVCLPYPFLFSNEA  552



>ref|XP_010658292.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=512

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/539 (69%), Positives = 431/539 (80%), Gaps = 34/539 (6%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+FPA FRGN  P   CSSC  LRFQP LS   + RQK+    +     + R     +  
Sbjct  1     MNFPATFRGNFNPFSHCSSCCDLRFQPFLSSPIVWRQKRCRISNLQVHQVSRLGSRRRPR  60

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
             ++C  + +ETEP+                             N+  ++   +N GM  S 
Sbjct  61    IVCGVTETETEPE-----------------------------NNNDEEKAHENGGMPPSI  91

Query  1509  DLVNGNSVNVNAQ--TGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFG  1336
             D    N   +++Q    ++D++++++ASGSPLPG+KPQ LDE+IRIPKETIDILKDQVFG
Sbjct  92    DSTVQNDPQLDSQPLVADQDSENLEVASGSPLPGVKPQVLDESIRIPKETIDILKDQVFG  151

Query  1335  FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVA  1156
             FDTFFVT+QEPYEGGVLFKGNLRG+AA+SYEKI+ RMQDRFGD YKLFLLINPEDDKPVA
Sbjct  152   FDTFFVTNQEPYEGGVLFKGNLRGKAAKSYEKITIRMQDRFGDKYKLFLLINPEDDKPVA  211

Query  1155  VVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPG  976
             VVVPR TLQP+TTAVPEWFAAGAFGLVT+FTL LRNVPALQ+NLLSVFDN +LL +GLPG
Sbjct  212   VVVPRNTLQPETTAVPEWFAAGAFGLVTVFTLFLRNVPALQSNLLSVFDNLNLLMDGLPG  271

Query  975   ALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFA  796
             ALVTAL+LG HEISH LVA+  GIKLGVPYFVPSWQIGSFGAITRILNIVP REDLLK A
Sbjct  272   ALVTALVLGTHEISHILVARSTGIKLGVPYFVPSWQIGSFGAITRILNIVPNREDLLKVA  331

Query  795   AAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPI  616
             AAGP+AGFSLG +LLLLGF LPP+DG+GVVVD SVFHESLLAGGIAKLLLGD LKEGTPI
Sbjct  332   AAGPIAGFSLGLVLLLLGFLLPPSDGIGVVVDASVFHESLLAGGIAKLLLGDVLKEGTPI  391

Query  615   SVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSD  436
             SVNPL++W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR ++ASI LLG+S+LF+D
Sbjct  392   SVNPLLIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTAASIALLGLSSLFND  451

Query  435   VAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVM  259
             VAFYWVVLIF LQRGPIAPLSEEITDP++KY+ALG+ VLLLGLLVCLPYPFPF NE  +
Sbjct  452   VAFYWVVLIFFLQRGPIAPLSEEITDPEDKYVALGVVVLLLGLLVCLPYPFPFTNEVTV  510



>ref|XP_009778924.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/557 (70%), Positives = 445/557 (80%), Gaps = 29/557 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL-QCSSCSHLRFQPLLSCTGIARQKQ-IDFPTKHLLRFAFNMKRDV  1687
             M+ PA+ R +++ +  QCSSC + R QPLLS       K  I+FPT++ LRF    K   
Sbjct  1     MNMPAVCRVSILSVSPQCSSCCYNRLQPLLSSPSAGPLKHSINFPTRNSLRFVARNKGSF  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKD  1507
             +C      TEPD++++ +  L +E +     DS +  + E NS  DQD  Q  GMLE+  
Sbjct  61    LCR----STEPDKSDDKDENLDKEADGVNLNDSVADKSLELNSRTDQDKDQTMGMLENPS  116

Query  1506  LVNGNSVNVNAQTGNEDADDIQIASGSPLPGLK-PQQLDEAIRIPKETIDILKDQVFGFD  1330
             L N N   VN Q   ED  ++Q+ASGSPLPG+K P QLDE+ RIPKETI+IL++QVFGFD
Sbjct  117   LENNNGAQVNEQPRVEDGTEVQVASGSPLPGVKVPLQLDESTRIPKETIEILRNQVFGFD  176

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVTSQEPYEGGVLFKGNLRGQAA +YEK+SKRMQDR GD+YKLFLL NPEDDKPVAVV
Sbjct  177   TFFVTSQEPYEGGVLFKGNLRGQAATAYEKVSKRMQDRLGDVYKLFLLNNPEDDKPVAVV  236

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL-----------------  1021
             VPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NL                  
Sbjct  237   VPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLFSKCSSVIYRILNKFYLN  296

Query  1020  -----SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSF  856
                  SV DN DLL++GLPGAL+TA +LGVHE+SH LVA++ G+KLGVPYFVPSWQIGSF
Sbjct  297   SLKLQSVVDNLDLLKDGLPGALITAFVLGVHEVSHLLVAKEVGVKLGVPYFVPSWQIGSF  356

Query  855   GAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESl  676
             GAITRI+NIVP+REDLLK AAAGPLAGFS+G ILLL GF LPP DG+G++VDPSVFHES 
Sbjct  357   GAITRIVNIVPEREDLLKVAAAGPLAGFSVGLILLLSGFILPPTDGIGIIVDPSVFHESF  416

Query  675   laggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKT  496
             LAGGIAKLLLGDALKEGTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK 
Sbjct  417   LAGGIAKLLLGDALKEGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFAMWGRKA  476

Query  495   SARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavll  316
             SARLSS SIGLLGISALFSDVAFYWVVLIF LQRGPIAPLSEEITDPDNKYIALG+ VLL
Sbjct  477   SARLSSLSIGLLGISALFSDVAFYWVVLIFFLQRGPIAPLSEEITDPDNKYIALGVVVLL  536

Query  315   lgllVCLPYPFPFNNEA  265
             LGLLVCLPYPF F+NEA
Sbjct  537   LGLLVCLPYPFLFSNEA  553



>gb|EYU19993.1| hypothetical protein MIMGU_mgv1a004301mg [Erythranthe guttata]
Length=534

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/536 (71%), Positives = 442/536 (82%), Gaps = 12/536 (2%)
 Frame = -1

Query  1863  TMSFPAIFRGN-VVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRDV  1687
              M+ PA F GN  VPL QC+SC+H+R    LS   IA  K   F ++HLL  AF     V
Sbjct  6     AMNLPASFGGNFAVPLSQCNSCAHVR----LSYPAIADWK---FSSRHLLSDAFRGNLKV  58

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKD  1507
             +C  S +ETEP+ N E ER+L+ E+     +DS + +    N   D  + ++  +LE+K 
Sbjct  59    VCRASEAETEPESNNEEERELNGEKEGFVPSDSVNTELGSQN--GDSQSAES-SVLETKS  115

Query  1506  LVNGNSVNVN-AQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFD  1330
             LVN  S   N AQ   E  +D+ +ASGSPLPG+K  + DE+IRIPKETIDILKDQVFGFD
Sbjct  116   LVNDGSDEKNEAQPKLEVVNDVPVASGSPLPGVKRLEFDESIRIPKETIDILKDQVFGFD  175

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVTSQEPYEGGVLFKGNLRGQAA+SYEKI++R++DR GD +KLFLLINP+DDKPVAVV
Sbjct  176   TFFVTSQEPYEGGVLFKGNLRGQAAKSYEKIARRLKDRLGDQFKLFLLINPDDDKPVAVV  235

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGAL  970
             VPR  LQPDT AVPEWFAAGAFGLVTIFTLLLRNVPALQ NLLSV DN DLL++GL GAL
Sbjct  236   VPRKALQPDTAAVPEWFAAGAFGLVTIFTLLLRNVPALQTNLLSVIDNVDLLKDGLSGAL  295

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             VTALILGVHEISH LVA++AG+KLGVPYFVPSWQIGSFG+ITRILNIVPKREDLLK AAA
Sbjct  296   VTALILGVHEISHFLVAKEAGVKLGVPYFVPSWQIGSFGSITRILNIVPKREDLLKLAAA  355

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             GP+AG+SLGF+LLLLGF LPP+D LGVVVD SVFHESLL GGIAK+LLGD LKEGTP+SV
Sbjct  356   GPVAGYSLGFVLLLLGFVLPPSDQLGVVVDSSVFHESLLIGGIAKVLLGDVLKEGTPLSV  415

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             NPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK S+RL+  SI LLG+S+LFSDV+
Sbjct  416   NPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKVSSRLTGVSIALLGLSSLFSDVS  475

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             FYWVVLIF LQRGPIAPLSEEI+DP++KY ALGI VLL+GLLVCLPYPFPF+++ +
Sbjct  476   FYWVVLIFFLQRGPIAPLSEEISDPEDKYKALGIVVLLIGLLVCLPYPFPFSSDVL  531



>gb|KHG22482.1| Peroxisomal biogenesis factor 2 [Gossypium arboreum]
Length=527

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/534 (70%), Positives = 428/534 (80%), Gaps = 12/534 (2%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRF-AFNMKRDVI  1684
             M+  A FRGN   L QCSSC  LRFQPLLS +  A  ++         R      KR++ 
Sbjct  1     MNLAASFRGNFGVLSQCSSCCDLRFQPLLSSSSFANSQRCRLRNLKFSRVPRLCRKREMF  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDL  1504
             C  + +ET PD N + E   HE      +           +S+ ++D+  +   +  +  
Sbjct  61    CRVTETETGPDSNNDEEEDTHESGEKPATT----------DSVEEKDSQIDLQPINVQQ-  109

Query  1503  VNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTF  1324
             +N N     AQ   ++ D I++ SGSPLPG+KPQQLDE++RIPKETIDILKDQVF FDTF
Sbjct  110   INNNDAETTAQGAVQEDDAIEVTSGSPLPGVKPQQLDESMRIPKETIDILKDQVFAFDTF  169

Query  1323  FVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVP  1144
             FVTSQEPYEGGVLFKGNLRGQAARSYEKIS RMQ++FGD YKLFLLINPEDDKPVAVVVP
Sbjct  170   FVTSQEPYEGGVLFKGNLRGQAARSYEKISTRMQNKFGDEYKLFLLINPEDDKPVAVVVP  229

Query  1143  RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVT  964
             + TLQP+TTAVPEW AAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL NGLPGA VT
Sbjct  230   KTTLQPETTAVPEWLAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLSNGLPGAFVT  289

Query  963   ALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGP  784
             AL+LGVHE+ H LVA+  G+KLGVP+FVPSWQIGSFGAITRI NIVP REDLLK AAAGP
Sbjct  290   ALLLGVHELGHILVAKSTGVKLGVPFFVPSWQIGSFGAITRIKNIVPNREDLLKVAAAGP  349

Query  783   lagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNP  604
             LAGFSLGF+L LLGF LPP+DG+GVVVD SVFHES LAGG+AKLLLGD LKEGTPISVNP
Sbjct  350   LAGFSLGFVLFLLGFILPPSDGIGVVVDASVFHESFLAGGVAKLLLGDVLKEGTPISVNP  409

Query  603   LVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFY  424
             LV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR +S SIGLLG+S+LF+DVAFY
Sbjct  410   LVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTSLSIGLLGLSSLFNDVAFY  469

Query  423   WVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             WVVLIF+LQRGPIAPLSEEITDPDNKY+ALG+ VL+LGLLVCLPYPFPFN +++
Sbjct  470   WVVLIFILQRGPIAPLSEEITDPDNKYVALGVLVLILGLLVCLPYPFPFNYDSI  523



>ref|XP_010031249.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Eucalyptus grandis]
 gb|KCW50512.1| hypothetical protein EUGRSUZ_J00234 [Eucalyptus grandis]
Length=528

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/540 (69%), Positives = 435/540 (81%), Gaps = 22/540 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQID-------FPTKHLLRFAFN  1702
             MS  A FRG++  + +C SC  LR QP    + I+R ++         F +   LR    
Sbjct  1     MSVSAAFRGSLASVWRCGSCCDLRLQPCFDSSVISRHRRAACRSSLKLFVSSSELRL--R  58

Query  1701  MKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGM  1522
              KR  +C  + +ETEP+ N++ E+++HE+   + SADS +     P SL   ++      
Sbjct  59    SKRRFLCRVTNTETEPESNDDKEKEMHEDGEKASSADSFTEGQLGPQSLGTDES------  112

Query  1521  LESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQV  1342
                   +N  S N   Q G + ADD+Q+ASGSPLPG+KPQQLDE++RI KETI++LKDQV
Sbjct  113   ------INSESEN-KLQDGIQGADDMQVASGSPLPGVKPQQLDESMRISKETIEVLKDQV  165

Query  1341  FGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKP  1162
             FGFDTFFVTSQEPYEGGVLFKGNLRGQAA+SYEKIS RMQ++F D YKLFLL+NPEDDKP
Sbjct  166   FGFDTFFVTSQEPYEGGVLFKGNLRGQAAKSYEKISIRMQNKFEDQYKLFLLVNPEDDKP  225

Query  1161  VAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGL  982
             VAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL++GL
Sbjct  226   VAVVVPRTTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLKDGL  285

Query  981   PGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK  802
             PGALVT LILGVHE+SH LVA+  G+KLGVPY VPSWQIGSFGAITRI+NIVPKREDLLK
Sbjct  286   PGALVTLLILGVHELSHILVAKSCGVKLGVPYLVPSWQIGSFGAITRIVNIVPKREDLLK  345

Query  801   FAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGT  622
              A AGPLAGFS+G +LLLLGFFLPP DGLGVVVD SVFHESLLAGGIAKLLLGD LKEGT
Sbjct  346   VAVAGPLAGFSVGLVLLLLGFFLPPTDGLGVVVDASVFHESLLAGGIAKLLLGDVLKEGT  405

Query  621   PISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF  442
             PISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR ++ASIGLLG+S+LF
Sbjct  406   PISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTAASIGLLGLSSLF  465

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             +DVAFYWV LIF LQRGPIAPLSEE+TDPD KY+ LGI VL +GLL+CLPYPFPF +E +
Sbjct  466   NDVAFYWVALIFFLQRGPIAPLSEEVTDPDQKYVTLGILVLFIGLLICLPYPFPFTDEVM  525



>ref|XP_010262813.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=543

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/542 (68%), Positives = 438/542 (81%), Gaps = 11/542 (2%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFN-MKR  1693
             M+FPA F  N   +LQC+SC   RF P+++ + + R+K           + R  F   +R
Sbjct  1     MNFPATFHDNFSSILQCTSCYEFRFHPVVASSILLRRKCFRGDKLQANPVSRLVFQRTRR  60

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNS---LADQDNGQN--F  1528
              +IC  S +ETEPD N + E+++ E      SA+       E +S   ++D D  Q    
Sbjct  61    TIICRLSETETEPDSNNDKEKQILESGEMPSSANPIMQTNQEIDSQPAVSDPDENQASVV  120

Query  1527  GMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
              ML+S D V  ++  + A+   + +D++++ASGSPLPG+K  QL EAIRIPKETIDILKD
Sbjct  121   EMLDSDDKVKNSNGELKAEGDTKASDNVEVASGSPLPGVK--QLGEAIRIPKETIDILKD  178

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVTSQ+PYEGGVLFKGNLRG+AA+SYEKI+KRMQD+FGD YKLFLLINPEDD
Sbjct  179   QVFGFDTFFVTSQDPYEGGVLFKGNLRGKAAKSYEKITKRMQDKFGDQYKLFLLINPEDD  238

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR +LQP+TTAVPEWF AGAFGLVTIFTLLLRNVPALQ+NLLS FDN  LL++
Sbjct  239   KPVAVVVPRKSLQPETTAVPEWFGAGAFGLVTIFTLLLRNVPALQSNLLSTFDNLGLLKD  298

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GL GALVTAL+LGVHE+ H LVA+  GIKLGVPYFVPSWQIGSFGAITRI+NIVPKREDL
Sbjct  299   GLSGALVTALVLGVHELGHFLVARSTGIKLGVPYFVPSWQIGSFGAITRIVNIVPKREDL  358

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFS+GF+ LLLGF LPP DG+G+VVD SVFHESLL GGIAKLLLGD LKE
Sbjct  359   LKLAAAGPLAGFSVGFVFLLLGFILPPTDGIGIVVDSSVFHESLLVGGIAKLLLGDVLKE  418

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGR+SF++WGRK SAR+++ SI LLG+++
Sbjct  419   GTPISVNPLVVWAWAGLLINAINSIPAGELDGGRVSFALWGRKVSARITAVSIALLGLAS  478

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LF+DVAFYWVVLIF LQRGPIAP SEEITDPDNKY+ALGIAVLLLGLL+C PYPFPF +E
Sbjct  479   LFNDVAFYWVVLIFFLQRGPIAPSSEEITDPDNKYVALGIAVLLLGLLICFPYPFPFTSE  538

Query  267   AV  262
              +
Sbjct  539   DI  540



>ref|XP_010262812.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=547

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/546 (67%), Positives = 436/546 (80%), Gaps = 15/546 (3%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFN-MKR  1693
             M+FPA F  N   +LQC+SC   RF P+++ + + R+K           + R  F   +R
Sbjct  1     MNFPATFHDNFSSILQCTSCYEFRFHPVVASSILLRRKCFRGDKLQANPVSRLVFQRTRR  60

Query  1692  DVICSFSASETEPDRneenerklhee---------enssgsadsasadtsEPNSLADQDN  1540
              +IC  S +ETEPD N + E+++ E             +     +    S+P +  D++ 
Sbjct  61    TIICRLSETETEPDSNNDKEKQILESGEMPSSANPIMQTNQEIDSQPAVSDPVTPQDENQ  120

Query  1539  GQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETID  1360
                  ML+S D V  ++  + A+   + +D++++ASGSPLPG+K  QL EAIRIPKETID
Sbjct  121   ASVVEMLDSDDKVKNSNGELKAEGDTKASDNVEVASGSPLPGVK--QLGEAIRIPKETID  178

Query  1359  ILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLIN  1180
             ILKDQVFGFDTFFVTSQ+PYEGGVLFKGNLRG+AA+SYEKI+KRMQD+FGD YKLFLLIN
Sbjct  179   ILKDQVFGFDTFFVTSQDPYEGGVLFKGNLRGKAAKSYEKITKRMQDKFGDQYKLFLLIN  238

Query  1179  PEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFD  1000
             PEDDKPVAVVVPR +LQP+TTAVPEWF AGAFGLVTIFTLLLRNVPALQ+NLLS FDN  
Sbjct  239   PEDDKPVAVVVPRKSLQPETTAVPEWFGAGAFGLVTIFTLLLRNVPALQSNLLSTFDNLG  298

Query  999   LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPK  820
             LL++GL GALVTAL+LGVHE+ H LVA+  GIKLGVPYFVPSWQIGSFGAITRI+NIVPK
Sbjct  299   LLKDGLSGALVTALVLGVHELGHFLVARSTGIKLGVPYFVPSWQIGSFGAITRIVNIVPK  358

Query  819   REDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgd  640
             REDLLK AAAGPLAGFS+GF+ LLLGF LPP DG+G+VVD SVFHESLL GGIAKLLLGD
Sbjct  359   REDLLKLAAAGPLAGFSVGFVFLLLGFILPPTDGIGIVVDSSVFHESLLVGGIAKLLLGD  418

Query  639   aLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigll  460
              LKEGTPISVNPLV+W+ AGLLINAINSIPAGELDGGR+SF++WGRK SAR+++ SI LL
Sbjct  419   VLKEGTPISVNPLVVWAWAGLLINAINSIPAGELDGGRVSFALWGRKVSARITAVSIALL  478

Query  459   gisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFP  280
             G+++LF+DVAFYWVVLIF LQRGPIAP SEEITDPDNKY+ALGIAVLLLGLL+C PYPFP
Sbjct  479   GLASLFNDVAFYWVVLIFFLQRGPIAPSSEEITDPDNKYVALGIAVLLLGLLICFPYPFP  538

Query  279   FNNEAV  262
             F +E +
Sbjct  539   FTSEDI  544



>gb|KGN45781.1| hypothetical protein Csa_6G011070 [Cucumis sativus]
Length=522

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/534 (68%), Positives = 427/534 (80%), Gaps = 16/534 (3%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLS-CTGIARQKQIDFPTKHLLRFAFNMKRDVI  1684
             M  PA FRGN  PL QCSSC ++RF P  +  T    Q++I   +  L + +   KR + 
Sbjct  1     MDLPAAFRGNSFPLSQCSSCCYMRFNPCFAPFTNFRDQQRIRHSSLKLCQVSSRGKRGIA  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDL  1504
             C  + ++TEPD N + E    +  +                S +D      F  L+S+ +
Sbjct  61    CKVTETQTEPDGNNDKEEDDSKGGDQP--------------SFSDSAAEDKF-QLDSQAV  105

Query  1503  VNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTF  1324
                N V    Q   +D D++++ASGSPLPGLKPQQLDE+ RIP+ET++ILK+QVFGFDTF
Sbjct  106   DEVNIVENKDQGDIQDIDNVEVASGSPLPGLKPQQLDESFRIPRETVEILKNQVFGFDTF  165

Query  1323  FVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVP  1144
             FVTSQ+PYEGGVLFKGNLRG+AA+SYEKI++RMQD FGD+YKLFLLINPEDDKPVAVVVP
Sbjct  166   FVTSQDPYEGGVLFKGNLRGEAAKSYEKITRRMQDTFGDVYKLFLLINPEDDKPVAVVVP  225

Query  1143  RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVT  964
             R TLQP+TTAVPEWFAA AFGLVT+FTLLLRNVPALQ+NLLS FDN +LL++GLPGA VT
Sbjct  226   RKTLQPETTAVPEWFAAAAFGLVTVFTLLLRNVPALQSNLLSTFDNLELLKDGLPGAFVT  285

Query  963   ALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGP  784
             AL+LGVHE+ H LVA+ AG+K G+PYFVPSWQIGSFGAITRILNIVPKREDLLK A AGP
Sbjct  286   ALVLGVHELGHILVARDAGVKFGIPYFVPSWQIGSFGAITRILNIVPKREDLLKVALAGP  345

Query  783   lagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNP  604
             LAGFS+GF+L +LGF LPP+DG+GV+VD SVFHES LAGGIAKLLLGDALKEGTPIS+NP
Sbjct  346   LAGFSVGFLLYILGFILPPSDGIGVIVDASVFHESFLAGGIAKLLLGDALKEGTPISLNP  405

Query  603   LVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFY  424
             LV+W+ AGLLINAINSIPAGELDGGRI+FSIWGRK S+R++  SI LLG+++LFSDVAFY
Sbjct  406   LVIWAWAGLLINAINSIPAGELDGGRIAFSIWGRKASSRITGVSIVLLGLASLFSDVAFY  465

Query  423   WVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             WV LIF LQRGPIAPLSEEITDPD KYI LG+ VL LGLLVCLP+PFPF+ EA+
Sbjct  466   WVALIFFLQRGPIAPLSEEITDPDEKYIGLGVLVLFLGLLVCLPFPFPFSGEAI  519



>ref|XP_006435704.1| hypothetical protein CICLE_v10031204mg [Citrus clementina]
 ref|XP_006486339.1| PREDICTED: uncharacterized protein LOC102611605 isoform X2 [Citrus 
sinensis]
 gb|ESR48944.1| hypothetical protein CICLE_v10031204mg [Citrus clementina]
 gb|KDO69036.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=531

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/542 (67%), Positives = 433/542 (80%), Gaps = 23/542 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  166

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  167   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  226

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  227   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  286

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  287   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  346

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  347   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  406

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S RL+  SI LLG+S+
Sbjct  407   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKASTRLTGVSIVLLGLSS  466

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYIALG+ VL LGLLVCLPYPFPF+++
Sbjct  467   LFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYIALGVLVLFLGLLVCLPYPFPFSDQ  526

Query  267   AV  262
             AV
Sbjct  527   AV  528



>ref|XP_006486338.1| PREDICTED: uncharacterized protein LOC102611605 isoform X1 [Citrus 
sinensis]
 gb|KDO69038.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=532

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/542 (67%), Positives = 430/542 (79%), Gaps = 22/542 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V        +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDVADTKGGVQQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  167

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  168   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  227

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  228   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  287

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  288   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  347

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  348   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  407

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S RL+  SI LLG+S+
Sbjct  408   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKASTRLTGVSIVLLGLSS  467

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYIALG+ VL LGLLVCLPYPFPF+++
Sbjct  468   LFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYIALGVLVLFLGLLVCLPYPFPFSDQ  527

Query  267   AV  262
             AV
Sbjct  528   AV  529



>gb|KDO69033.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=528

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/542 (67%), Positives = 437/542 (81%), Gaps = 26/542 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + R     KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSR----KKRE  56

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD N + E+++H+ + +             P + +DQ  D  Q    L+
Sbjct  57    LICRVTDTQTEPDSNNDKEKEVHDGQENQ------------PATASDQEDDKSQPDSQLD  104

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  105   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  163

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  164   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  223

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  224   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  283

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  284   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  343

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  344   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  403

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S RL+  SI LLG+S+
Sbjct  404   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKASTRLTGVSIVLLGLSS  463

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYIALG+ VL LGLLVCLPYPFPF+++
Sbjct  464   LFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYIALGVLVLFLGLLVCLPYPFPFSDQ  523

Query  267   AV  262
             AV
Sbjct  524   AV  525



>gb|KDP44801.1| hypothetical protein JCGZ_01301 [Jatropha curcas]
Length=534

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/543 (68%), Positives = 436/543 (80%), Gaps = 23/543 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL----QCSSCSH--LRFQPLLSCTGIARQKQI----DFPTKHLLRF  1711
             MS  A F+GN  P L    +CSSCS+  L  +P L+ +GI R+K+     DF   ++ RF
Sbjct  1     MSILATFQGNFSPFLSLSPKCSSCSNCQLHSRPFLASSGIYRRKKWCRLRDFKLLNVSRF  60

Query  1710  AFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQN  1531
                 KR ++C  + ++TEPD + + E+++HE   +  +             L +Q N Q 
Sbjct  61    --QEKRRILCRVTETQTEPDSDNDKEKEVHEGGETPPAP-----------DLLEQVNSQP  107

Query  1530  FGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILK  1351
                    + +N   V +NA+ G +D D++++ASGSPLPG+KPQQ DE+IRIPK+TIDILK
Sbjct  108   DSEPTVINQINNKDVEINAEGGTQDLDNVEVASGSPLPGVKPQQFDESIRIPKKTIDILK  167

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
             DQVFGFDTFFVTSQEPYEGGVLFKGNLRG+AA+SYEKI+ RMQ+ FGD YKLFLL+NPED
Sbjct  168   DQVFGFDTFFVTSQEPYEGGVLFKGNLRGKAAKSYEKIANRMQNTFGDEYKLFLLVNPED  227

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLE  991
             DKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL+
Sbjct  228   DKPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLELLK  287

Query  990   NGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRED  811
             +GLPGA VTALILGVHEI H LVA+   +KLGVPYFVPSWQIGSFGAITRI NIVPKRED
Sbjct  288   DGLPGAFVTALILGVHEIGHILVAKSNNVKLGVPYFVPSWQIGSFGAITRITNIVPKRED  347

Query  810   LLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLK  631
             LLK A AGPLAGF+LG +L LLGF LPP+DG+G++VD SVFH+S LAGGIAKLLLGDALK
Sbjct  348   LLKVAVAGPLAGFALGLVLFLLGFILPPSDGIGLIVDASVFHDSFLAGGIAKLLLGDALK  407

Query  630   EGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgis  451
             EGT ISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR +S SI LLG+S
Sbjct  408   EGTQISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTSFSIILLGLS  467

Query  450   aLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNN  271
             +LF DVAFYWVVLIF LQRGPI+PLSEEITDP+ KY+ALG+ VLLLGLLVCLPYPFPF +
Sbjct  468   SLFDDVAFYWVVLIFFLQRGPISPLSEEITDPEEKYVALGVMVLLLGLLVCLPYPFPFTD  527

Query  270   EAV  262
             E +
Sbjct  528   EVI  530



>emb|CDP14043.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/534 (69%), Positives = 425/534 (80%), Gaps = 20/534 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRDVIC  1681
             M+  A  + +++PL QC SCS +  QPL     I+R+ +  F    L R   N K  V+C
Sbjct  1     MNLGASCQASLLPLSQCGSCSVIHSQPLAFPPVISRKLKAHFLATQLRR---NGK--VVC  55

Query  1680  SFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDLV  1501
               S ++ +P+ +     +   E                    +D       GMLES  L 
Sbjct  56    RMSETDIDPESDNNETDQSVHEGEDQLK--------------SDTHQSPETGMLESNSLE  101

Query  1500  NGNSVNVNAQTGN-EDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTF  1324
               +S   +AQTG  ED +D+Q++ GSPLPG+KPQQLDE+IRIPKETID+L+DQVFGFDTF
Sbjct  102   VKHSPETDAQTGGAEDGEDLQVSIGSPLPGVKPQQLDESIRIPKETIDVLRDQVFGFDTF  161

Query  1323  FVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVP  1144
             FVT QEPYEGGVLFKGNLRGQA +SYEKI+KRM+D+FGD YKLFLLINPEDDKPVAVVVP
Sbjct  162   FVTGQEPYEGGVLFKGNLRGQATKSYEKITKRMEDKFGDEYKLFLLINPEDDKPVAVVVP  221

Query  1143  RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVT  964
             R +L PDTTA+PEWFAAGAFGLVT+FTLLLRNVPALQ+N L  FDN +LL++GLPGALVT
Sbjct  222   RKSLPPDTTALPEWFAAGAFGLVTLFTLLLRNVPALQSNFLLTFDNLELLKDGLPGALVT  281

Query  963   ALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGP  784
              L+LG HE  H LVA ++GIKLGVPYF+PSWQIGSFGAITRILNIV KREDLLKFAAAGP
Sbjct  282   LLVLGAHEACHILVASESGIKLGVPYFIPSWQIGSFGAITRILNIVKKREDLLKFAAAGP  341

Query  783   lagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNP  604
             LAGFSLG +LLLLGF LPP+DGLGVVVD SVFH+SLLAGGIAKLLLGD LKEGT ISVNP
Sbjct  342   LAGFSLGVLLLLLGFILPPSDGLGVVVDASVFHDSLLAGGIAKLLLGDVLKEGTAISVNP  401

Query  603   LVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFY  424
             LVLW+ AGLLINAINSIPAGELDGGRISF++WGRK SARLS+A+IGLLGI++LF+DVAFY
Sbjct  402   LVLWAWAGLLINAINSIPAGELDGGRISFAMWGRKASARLSAAAIGLLGIASLFNDVAFY  461

Query  423   WVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             WVVLIF+LQRGPIAPLSEEITDPDN YI LGI VLLLGLLV LPYPFPF +EA+
Sbjct  462   WVVLIFILQRGPIAPLSEEITDPDNTYITLGIVVLLLGLLVYLPYPFPFTSEAI  515



>ref|XP_006486342.1| PREDICTED: uncharacterized protein LOC102611605 isoform X5 [Citrus 
sinensis]
 gb|KDO69034.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=529

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/542 (67%), Positives = 434/542 (80%), Gaps = 25/542 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + R     KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSR----KKRE  56

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD N + E+++H+ + +             P + +DQ  D  Q    L+
Sbjct  57    LICRVTDTQTEPDSNNDKEKEVHDGQENQ------------PATASDQEDDKSQPDSQLD  104

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V        +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  105   SQPQVENQINGNDVADTKGGVQQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  164

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  165   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  224

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  225   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  284

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  285   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  344

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  345   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  404

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S RL+  SI LLG+S+
Sbjct  405   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKASTRLTGVSIVLLGLSS  464

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYIALG+ VL LGLLVCLPYPFPF+++
Sbjct  465   LFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYIALGVLVLFLGLLVCLPYPFPFSDQ  524

Query  267   AV  262
             AV
Sbjct  525   AV  526



>ref|XP_006486341.1| PREDICTED: uncharacterized protein LOC102611605 isoform X4 [Citrus 
sinensis]
 gb|KDO69035.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=529

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/542 (67%), Positives = 431/542 (80%), Gaps = 25/542 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+K  QLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVK--QLDEYIRIPKETIDILKD  164

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  165   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  224

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  225   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  284

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  285   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  344

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  345   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  404

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S RL+  SI LLG+S+
Sbjct  405   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKASTRLTGVSIVLLGLSS  464

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYIALG+ VL LGLLVCLPYPFPF+++
Sbjct  465   LFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYIALGVLVLFLGLLVCLPYPFPFSDQ  524

Query  267   AV  262
             AV
Sbjct  525   AV  526



>ref|XP_006486340.1| PREDICTED: uncharacterized protein LOC102611605 isoform X3 [Citrus 
sinensis]
 gb|KDO69037.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=530

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/542 (67%), Positives = 428/542 (79%), Gaps = 24/542 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V        +D  + ++ASGSPLPG+K  QLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDVADTKGGVQQDDGNGEVASGSPLPGVK--QLDEYIRIPKETIDILKD  165

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  166   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  225

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  226   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  285

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  286   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  345

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  346   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  405

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S RL+  SI LLG+S+
Sbjct  406   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKASTRLTGVSIVLLGLSS  465

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYIALG+ VL LGLLVCLPYPFPF+++
Sbjct  466   LFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYIALGVLVLFLGLLVCLPYPFPFSDQ  525

Query  267   AV  262
             AV
Sbjct  526   AV  527



>ref|XP_007219012.1| hypothetical protein PRUPE_ppa004270mg [Prunus persica]
 gb|EMJ20211.1| hypothetical protein PRUPE_ppa004270mg [Prunus persica]
Length=519

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/545 (66%), Positives = 424/545 (78%), Gaps = 41/545 (8%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCT-GIARQKQIDFPTKHLLRFAFNM-KRDV  1687
             M+  A F GN VPL QCSSC  LR QP L+ + G  R++     +  L   A N+ K++V
Sbjct  1     MNLSATFHGNFVPLSQCSSCCDLRIQPYLAASMGSWRKRHRRRSSLKLYHVARNLRKQEV  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFG------  1525
             +C  S ++TEPD                             N+  +++  +N G      
Sbjct  61    VCRLSETQTEPDS----------------------------NNDEEKEVNENEGGDSEEP  92

Query  1524  MLESKDLVN---GNSVNVNAQTGNEDADD-IQIASGSPLPGLKPQQLDEAIRIPKETIDI  1357
              L+S  +V     N     A+ G +D D+ ++++SGSPLPG+KPQQ  E+IRIPKET+DI
Sbjct  93    HLDSPPIVVDQINNDAETKAEFGVQDVDNNVEVSSGSPLPGVKPQQ-GESIRIPKETLDI  151

Query  1356  LKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINP  1177
             LK+QVFGFDTFFVT+Q+PYE GVLFKGNLRG AA+SYEKISKRMQD+FGD YKLFLL+NP
Sbjct  152   LKNQVFGFDTFFVTAQDPYEAGVLFKGNLRGVAAKSYEKISKRMQDKFGDEYKLFLLVNP  211

Query  1176  EDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDL  997
             EDD+PVAVVVPR TLQP++TAVPEWFAAGAFGLVT+FTLLLRNVP LQ+NLLS +DN +L
Sbjct  212   EDDQPVAVVVPRRTLQPESTAVPEWFAAGAFGLVTLFTLLLRNVPELQSNLLSAYDNLEL  271

Query  996   LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKR  817
             L+NGLPGALVTA +LG+HE+SH LVA+  G+ LGVPYFVPSWQIGSFG ITRI+NIVPKR
Sbjct  272   LKNGLPGALVTASVLGIHELSHVLVAKNTGVMLGVPYFVPSWQIGSFGTITRIINIVPKR  331

Query  816   EDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgda  637
             EDLLK AAAGPLAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHE  L GGIAKLLLGDA
Sbjct  332   EDLLKVAAAGPLAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHECFLVGGIAKLLLGDA  391

Query  636   LKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllg  457
             LKEGTPIS+NPL+LW+ AGL+INAINSIPAGELDGGRISF+IWGRK + R++ ASI LLG
Sbjct  392   LKEGTPISLNPLLLWAWAGLVINAINSIPAGELDGGRISFAIWGRKAATRITGASIALLG  451

Query  456   isaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPF  277
             +S+L SDVAFYWV LIF LQRGPIAPL EEITDPD+KY+ LG+ VL LGLLVCLPYPFPF
Sbjct  452   LSSLVSDVAFYWVALIFFLQRGPIAPLYEEITDPDDKYVGLGLLVLFLGLLVCLPYPFPF  511

Query  276   NNEAV  262
               E +
Sbjct  512   TEEVI  516



>ref|XP_007009043.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 2 [Theobroma cacao]
 gb|EOY17853.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 2 [Theobroma cacao]
Length=523

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/533 (68%), Positives = 432/533 (81%), Gaps = 13/533 (2%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRDVIC  1681
             M+F   FRGN   L QCSSC  LRFQPLL+   +A+ K+     ++L     + +R+++C
Sbjct  1     MNFAVSFRGNFGVLSQCSSCCDLRFQPLLASPSLAKSKRCRL--RNLKFSQLSRRREIVC  58

Query  1680  SFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDLV  1501
               + +ETE D N E E++ +E   +  +  S           A++++ Q      + + +
Sbjct  59    RVTETETESDSNNEKEKEENEGGENPDTTGS-----------AERNDSQIDPQPVNVEQI  107

Query  1500  NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFF  1321
               N     AQ G ++  D+++ SGSPLPG+KPQQLDE +RIPKETIDILKDQVF FDTFF
Sbjct  108   KNNGAETIAQGGVQEDGDVEVTSGSPLPGVKPQQLDETMRIPKETIDILKDQVFAFDTFF  167

Query  1320  VTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPR  1141
             VTSQEPYEGGVLFKGNLRGQAARSYEKIS RMQ++FGD YKLFLLINPEDDKPVAVVVP+
Sbjct  168   VTSQEPYEGGVLFKGNLRGQAARSYEKISTRMQNKFGDQYKLFLLINPEDDKPVAVVVPK  227

Query  1140  ITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTA  961
              TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVP+LQ+NLLS FDN +LL +GLPGA VTA
Sbjct  228   TTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPSLQSNLLSTFDNLNLLLDGLPGAFVTA  287

Query  960   LILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPl  781
             L+LG+HE  H LVA+  G+KLGVP+FVPSWQIGSFGAITRI +IVPKREDLLK AAAGPL
Sbjct  288   LLLGLHEFGHILVAKSTGVKLGVPFFVPSWQIGSFGAITRIKSIVPKREDLLKVAAAGPL  347

Query  780   agfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPL  601
             AGFSLGF+L LLGF LPP+DG+GVVVD SVFHES LAGG+AKLLLGDALKEGTPIS+NPL
Sbjct  348   AGFSLGFVLFLLGFILPPSDGIGVVVDASVFHESFLAGGVAKLLLGDALKEGTPISLNPL  407

Query  600   VLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYW  421
             V+W+ AGLLINAINSIPAGELDGGRIS +IWGRK S+R ++ SI LLGIS+LF+DVAFYW
Sbjct  408   VIWAWAGLLINAINSIPAGELDGGRISLAIWGRKASSRFTAVSIALLGISSLFNDVAFYW  467

Query  420   VVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             VVLIF LQRGPI+PLSEEITDPD KY+ALG+ VL+LGLLVCLPYPFPF +E++
Sbjct  468   VVLIFFLQRGPISPLSEEITDPDGKYVALGVLVLILGLLVCLPYPFPFTDESI  520



>ref|XP_007009042.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 1 [Theobroma cacao]
 gb|EOY17852.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 1 [Theobroma cacao]
Length=526

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/534 (68%), Positives = 431/534 (81%), Gaps = 12/534 (2%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFA-FNMKRDVI  1684
             M+F   FRGN   L QCSSC  LRFQPLL+   +A+ K+         + + F  +R+++
Sbjct  1     MNFAVSFRGNFGVLSQCSSCCDLRFQPLLASPSLAKSKRCRLRNLKFSQLSRFCRRREIV  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDL  1504
             C  + +ETE D N E E++ +E   +  +  S           A++++ Q      + + 
Sbjct  61    CRVTETETESDSNNEKEKEENEGGENPDTTGS-----------AERNDSQIDPQPVNVEQ  109

Query  1503  VNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTF  1324
             +  N     AQ G ++  D+++ SGSPLPG+KPQQLDE +RIPKETIDILKDQVF FDTF
Sbjct  110   IKNNGAETIAQGGVQEDGDVEVTSGSPLPGVKPQQLDETMRIPKETIDILKDQVFAFDTF  169

Query  1323  FVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVP  1144
             FVTSQEPYEGGVLFKGNLRGQAARSYEKIS RMQ++FGD YKLFLLINPEDDKPVAVVVP
Sbjct  170   FVTSQEPYEGGVLFKGNLRGQAARSYEKISTRMQNKFGDQYKLFLLINPEDDKPVAVVVP  229

Query  1143  RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVT  964
             + TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVP+LQ+NLLS FDN +LL +GLPGA VT
Sbjct  230   KTTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPSLQSNLLSTFDNLNLLLDGLPGAFVT  289

Query  963   ALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGP  784
             AL+LG+HE  H LVA+  G+KLGVP+FVPSWQIGSFGAITRI +IVPKREDLLK AAAGP
Sbjct  290   ALLLGLHEFGHILVAKSTGVKLGVPFFVPSWQIGSFGAITRIKSIVPKREDLLKVAAAGP  349

Query  783   lagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNP  604
             LAGFSLGF+L LLGF LPP+DG+GVVVD SVFHES LAGG+AKLLLGDALKEGTPIS+NP
Sbjct  350   LAGFSLGFVLFLLGFILPPSDGIGVVVDASVFHESFLAGGVAKLLLGDALKEGTPISLNP  409

Query  603   LVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFY  424
             LV+W+ AGLLINAINSIPAGELDGGRIS +IWGRK S+R ++ SI LLGIS+LF+DVAFY
Sbjct  410   LVIWAWAGLLINAINSIPAGELDGGRISLAIWGRKASSRFTAVSIALLGISSLFNDVAFY  469

Query  423   WVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             WVVLIF LQRGPI+PLSEEITDPD KY+ALG+ VL+LGLLVCLPYPFPF +E++
Sbjct  470   WVVLIFFLQRGPISPLSEEITDPDGKYVALGVLVLILGLLVCLPYPFPFTDESI  523



>ref|XP_006367712.1| PREDICTED: uncharacterized protein LOC102594117 isoform X4 [Solanum 
tuberosum]
Length=484

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/492 (70%), Positives = 404/492 (82%), Gaps = 29/492 (6%)
 Frame = -1

Query  1734  PTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSL  1555
             P  H LRF    K  V+C  S +  + D  +                          ++ 
Sbjct  22    PPTHFLRFVIRKKGSVVCRLSDNNKDDDSVQ--------------------------DNN  55

Query  1554  ADQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             + QDN Q    LE+  L N +    + QTG ED  D+Q+ASGSPLPG+KPQQL+E+IRIP
Sbjct  56    SHQDNDQP---LENTSLENNDGPQPDQQTGLEDGTDVQVASGSPLPGVKPQQLNESIRIP  112

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             KET++IL++QVF FDTFFVTSQEPYEGGVLF GNLRGQAA++YEK+SKRMQ++ GD YKL
Sbjct  113   KETVEILRNQVFSFDTFFVTSQEPYEGGVLFNGNLRGQAAKTYEKVSKRMQEKLGDDYKL  172

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLSV
Sbjct  173   FLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSV  232

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKLG+PYFVPSWQIG FGAITRIL
Sbjct  233   FDNLDLLKDGLPGALITAFLLGVHEVSHHLVATEVGIKLGIPYFVPSWQIGCFGAITRIL  292

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             N+VP REDLLK AAAGPLAGFS+GFILLL GF LPP+DG+G++VDPSVFHES LAGGIAK
Sbjct  293   NVVPNREDLLKVAAAGPLAGFSVGFILLLSGFILPPSDGIGIIVDPSVFHESFLAGGIAK  352

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLGD L+EG+PISVNPLV+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SARLS+ 
Sbjct  353   LLLGDVLQEGSPISVNPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASARLSAF  412

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             SIGLLGIS+LF+DVAFYW+VLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGLLVCL
Sbjct  413   SIGLLGISSLFNDVAFYWLVLIFFLQRGPIAPLSEELTHPQNKYMALGVVVLFLGLLVCL  472

Query  294   PYPFPFNNEAVM  259
             PYPFPF+N+  +
Sbjct  473   PYPFPFSNQPAL  484



>ref|XP_008441639.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic, 
partial [Cucumis melo]
Length=474

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/479 (72%), Positives = 398/479 (83%), Gaps = 15/479 (3%)
 Frame = -1

Query  1698  KRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGML  1519
             KR + C  + ++TEPD N + E    +  +                S +D      F  L
Sbjct  8     KRRIACRVTETQTEPDGNNDKEEDGSKGGDQP--------------SFSDSVAEDKF-QL  52

Query  1518  ESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVF  1339
             +S+ +   N+V    Q   +D D++++ASGSPLPGLKPQQLDE+ RIP+ETI+ILK+QVF
Sbjct  53    DSQAVDEVNNVENKDQGDIQDIDNVEVASGSPLPGLKPQQLDESFRIPRETIEILKNQVF  112

Query  1338  GFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPV  1159
             GFDTFFVTSQ+PYEGGVLFKGNLRG+AA+SYEKI++RMQD FGD+YKLFLLINPEDDKPV
Sbjct  113   GFDTFFVTSQDPYEGGVLFKGNLRGEAAKSYEKITRRMQDTFGDVYKLFLLINPEDDKPV  172

Query  1158  AVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLP  979
             AVVVPR TLQPDTTAVPEWFAA AFGLVT+FTLLLRNVPALQ+NLLS FDN +LL++GLP
Sbjct  173   AVVVPRKTLQPDTTAVPEWFAAAAFGLVTVFTLLLRNVPALQSNLLSTFDNLELLKDGLP  232

Query  978   GALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKF  799
             GA VTAL LGVHE+ H LVA+ AG+K G+PYFVPSWQIGSFGAITRILNIVPKREDLLK 
Sbjct  233   GAFVTALTLGVHELGHILVARDAGVKFGIPYFVPSWQIGSFGAITRILNIVPKREDLLKV  292

Query  798   AAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTP  619
             A AGPLAGFS+GF+L +LGF LPP+DG+GV+VD SVFHES LAGGIAKLLLGDALKEGTP
Sbjct  293   ALAGPLAGFSVGFLLYILGFILPPSDGIGVIVDASVFHESFLAGGIAKLLLGDALKEGTP  352

Query  618   ISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFS  439
             IS+NPLV+W+ AGLLINAINSIPAGELDGGRI+FSIWGRK S+R++  SI LLG+++LFS
Sbjct  353   ISLNPLVIWAWAGLLINAINSIPAGELDGGRIAFSIWGRKASSRITGVSIVLLGLASLFS  412

Query  438   DVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             DVAFYWV LIF LQRGPIAPLSEEITDPD KYI LGI VL LGLLVCLP+PFPF+ EA+
Sbjct  413   DVAFYWVALIFFLQRGPIAPLSEEITDPDEKYIGLGILVLFLGLLVCLPFPFPFSEEAI  471



>ref|XP_009344642.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Pyrus x bretschneideri]
Length=517

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/537 (67%), Positives = 422/537 (79%), Gaps = 22/537 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLL-SCTGIARQKQIDFPTKHLLRFAFNMKRDVI  1684
             M+F   FRGN VPL QCSSC  LRFQP   S TG  R++     +  L       KR+V+
Sbjct  1     MNFSVTFRGNFVPLSQCSSCCDLRFQPYFASETGSWRKRHRHRSSLKLQVSRILRKREVV  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDL  1504
             C  S +ETEPD N + E+    E     +A    +       +ADQ N            
Sbjct  61    CRVSETETEPDSNNDEEKGHGNEGGDCDAAVHHDSQPV----VADQAN------------  104

Query  1503  VNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTF  1324
                N     AQ G ++A++++++SGSPLPG+KPQ L E++RIPKET+DILK+QVFGFDTF
Sbjct  105   ---NDAETKAQFGVQEAENVEVSSGSPLPGVKPQ-LGESMRIPKETLDILKNQVFGFDTF  160

Query  1323  FVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVP  1144
             FVT Q+PYE GVLFKGNLRG  A+SYEKISKR+Q +FGD YKLFLL+NPEDD+PVAVVVP
Sbjct  161   FVTGQDPYESGVLFKGNLRGVPAKSYEKISKRLQQKFGDEYKLFLLVNPEDDQPVAVVVP  220

Query  1143  RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVT  964
             +  LQP++TAVPEWFAAGAFGLVT+FTLLLRNVP LQ+NLLS FDN +LL+NGLPGALVT
Sbjct  221   QRILQPESTAVPEWFAAGAFGLVTLFTLLLRNVPELQSNLLSAFDNPELLKNGLPGALVT  280

Query  963   ALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGP  784
             A +LGVHE+ H LVA   G+ LGVPYF+PSWQIGSFG ITRI+NIVPKRE+LLK AAAGP
Sbjct  281   AAVLGVHELGHVLVANSTGVVLGVPYFIPSWQIGSFGTITRIVNIVPKRENLLKVAAAGP  340

Query  783   lagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNP  604
             LAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHES L GG AKLL+GDALKEGTPIS+NP
Sbjct  341   LAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHESFLIGGTAKLLVGDALKEGTPISLNP  400

Query  603   LVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFY  424
             L+LW+ AGL+INAINSIPAGELDGGRISF+IWGRK + R++ ASI LLG+S+L SDVAFY
Sbjct  401   LLLWAWAGLVINAINSIPAGELDGGRISFAIWGRKAATRITGASIALLGLSSLVSDVAFY  460

Query  423   WVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVMVS  253
             WVVLIF+LQRGPIAPL EEITDPD+KY+ LG+ VL LGLLVCLPYPFPF +E +M S
Sbjct  461   WVVLIFILQRGPIAPLYEEITDPDDKYVGLGVLVLFLGLLVCLPYPFPFVDE-IMTS  516



>ref|XP_008392943.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Malus domestica]
Length=517

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/542 (67%), Positives = 423/542 (78%), Gaps = 32/542 (6%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLL-SCTGI-----ARQKQIDFPTKHLLRFAFNM  1699
             M+F A FRGN VPL QCSSC  LRFQP   S TG       R+  +      +LR     
Sbjct  1     MNFSATFRGNFVPLSQCSSCCDLRFQPCFASGTGSWGKRHRRRSSLKLQVSRILR-----  55

Query  1698  KRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGML  1519
             KR+V+C  S +ETEPD N + E+    E   S +A    +       +ADQ N       
Sbjct  56    KREVVCRVSETETEPDSNNDEEKGHGNEGGDSDAAVHHDSQPV----VADQAN-------  104

Query  1518  ESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVF  1339
                     N     AQ G ++ ++++++SGSPLPG+KPQ L E++RIPKET+DILK+QVF
Sbjct  105   --------NDAETKAQFGVQEVENVEVSSGSPLPGVKPQ-LGESMRIPKETLDILKNQVF  155

Query  1338  GFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPV  1159
             GFDTFFVT Q PYE GVLFKGNLRG  A SYEKISKR+QD+FGD YKLFLL+NPEDD+PV
Sbjct  156   GFDTFFVTGQVPYESGVLFKGNLRGVPAISYEKISKRLQDKFGDEYKLFLLVNPEDDQPV  215

Query  1158  AVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLP  979
             AVVVPR TLQP++TAVPEWFAAGAFGLVT+FTLLLRNVP LQ+NLLS FDN +LL+NGLP
Sbjct  216   AVVVPRRTLQPESTAVPEWFAAGAFGLVTLFTLLLRNVPELQSNLLSAFDNPELLKNGLP  275

Query  978   GALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKF  799
             GALVTA +LGVHE+ H LVA   G+ LGVPYF+PSWQIGSFG ITRI+NIVPKRE+LLK 
Sbjct  276   GALVTAAVLGVHELGHVLVANSTGVVLGVPYFIPSWQIGSFGTITRIVNIVPKRENLLKV  335

Query  798   AAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTP  619
             AAAGPLAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHES L GG AKLLLGD LKEGTP
Sbjct  336   AAAGPLAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHESFLIGGTAKLLLGDVLKEGTP  395

Query  618   ISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFS  439
             IS+NPL+LW+ AGL+INAINSIPAGELDGGRISF+IWGRK + R++ ASI LLG+S+L S
Sbjct  396   ISLNPLLLWAWAGLVINAINSIPAGELDGGRISFAIWGRKAATRITGASIALLGLSSLVS  455

Query  438   DVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVM  259
             DVAFYWVVLIF+L+RGPIAPL EEITDPD+KY+ LG+ VL LGLLVCLPYPFPF +E +M
Sbjct  456   DVAFYWVVLIFILZRGPIAPLYEEITDPDDKYVGLGVLVLFLGLLVCLPYPFPFVDE-IM  514

Query  258   VS  253
              S
Sbjct  515   TS  516



>ref|XP_006367711.1| PREDICTED: uncharacterized protein LOC102594117 isoform X3 [Solanum 
tuberosum]
Length=485

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/493 (70%), Positives = 404/493 (82%), Gaps = 30/493 (6%)
 Frame = -1

Query  1734  PTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSL  1555
             P  H LRF    K  V+C  S +  + D  +                          ++ 
Sbjct  22    PPTHFLRFVIRKKGSVVCRLSDNNKDDDSVQ--------------------------DNN  55

Query  1554  ADQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLK-PQQLDEAIRI  1378
             + QDN Q    LE+  L N +    + QTG ED  D+Q+ASGSPLPG+K PQQL+E+IRI
Sbjct  56    SHQDNDQP---LENTSLENNDGPQPDQQTGLEDGTDVQVASGSPLPGVKVPQQLNESIRI  112

Query  1377  PKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYK  1198
             PKET++IL++QVF FDTFFVTSQEPYEGGVLF GNLRGQAA++YEK+SKRMQ++ GD YK
Sbjct  113   PKETVEILRNQVFSFDTFFVTSQEPYEGGVLFNGNLRGQAAKTYEKVSKRMQEKLGDDYK  172

Query  1197  LFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLS  1018
             LFLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS
Sbjct  173   LFLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLS  232

Query  1017  VFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRI  838
             VFDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKLG+PYFVPSWQIG FGAITRI
Sbjct  233   VFDNLDLLKDGLPGALITAFLLGVHEVSHHLVATEVGIKLGIPYFVPSWQIGCFGAITRI  292

Query  837   LNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggia  658
             LN+VP REDLLK AAAGPLAGFS+GFILLL GF LPP+DG+G++VDPSVFHES LAGGIA
Sbjct  293   LNVVPNREDLLKVAAAGPLAGFSVGFILLLSGFILPPSDGIGIIVDPSVFHESFLAGGIA  352

Query  657   klllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlss  478
             KLLLGD L+EG+PISVNPLV+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SARLS+
Sbjct  353   KLLLGDVLQEGSPISVNPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASARLSA  412

Query  477   asigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVC  298
              SIGLLGIS+LF+DVAFYW+VLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGLLVC
Sbjct  413   FSIGLLGISSLFNDVAFYWLVLIFFLQRGPIAPLSEELTHPQNKYMALGVVVLFLGLLVC  472

Query  297   LPYPFPFNNEAVM  259
             LPYPFPF+N+  +
Sbjct  473   LPYPFPFSNQPAL  485



>ref|XP_006367710.1| PREDICTED: uncharacterized protein LOC102594117 isoform X2 [Solanum 
tuberosum]
Length=485

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/493 (70%), Positives = 404/493 (82%), Gaps = 30/493 (6%)
 Frame = -1

Query  1734  PTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSL  1555
             P  H LRF    K  V+C  S +  + D  +                          ++ 
Sbjct  22    PPTHFLRFVIRKKGSVVCRLSDNNKDDDSVQ--------------------------DNN  55

Query  1554  ADQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRI  1378
             + QDN Q    LE+  L N +    + QTG  +D  D+Q+ASGSPLPG+KPQQL+E+IRI
Sbjct  56    SHQDNDQP---LENTSLENNDGPQPDQQTGLEQDGTDVQVASGSPLPGVKPQQLNESIRI  112

Query  1377  PKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYK  1198
             PKET++IL++QVF FDTFFVTSQEPYEGGVLF GNLRGQAA++YEK+SKRMQ++ GD YK
Sbjct  113   PKETVEILRNQVFSFDTFFVTSQEPYEGGVLFNGNLRGQAAKTYEKVSKRMQEKLGDDYK  172

Query  1197  LFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLS  1018
             LFLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS
Sbjct  173   LFLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLS  232

Query  1017  VFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRI  838
             VFDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKLG+PYFVPSWQIG FGAITRI
Sbjct  233   VFDNLDLLKDGLPGALITAFLLGVHEVSHHLVATEVGIKLGIPYFVPSWQIGCFGAITRI  292

Query  837   LNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggia  658
             LN+VP REDLLK AAAGPLAGFS+GFILLL GF LPP+DG+G++VDPSVFHES LAGGIA
Sbjct  293   LNVVPNREDLLKVAAAGPLAGFSVGFILLLSGFILPPSDGIGIIVDPSVFHESFLAGGIA  352

Query  657   klllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlss  478
             KLLLGD L+EG+PISVNPLV+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SARLS+
Sbjct  353   KLLLGDVLQEGSPISVNPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASARLSA  412

Query  477   asigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVC  298
              SIGLLGIS+LF+DVAFYW+VLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGLLVC
Sbjct  413   FSIGLLGISSLFNDVAFYWLVLIFFLQRGPIAPLSEELTHPQNKYMALGVVVLFLGLLVC  472

Query  297   LPYPFPFNNEAVM  259
             LPYPFPF+N+  +
Sbjct  473   LPYPFPFSNQPAL  485



>gb|KFK25011.1| hypothetical protein AALP_AA8G055000 [Arabis alpina]
Length=528

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/542 (64%), Positives = 418/542 (77%), Gaps = 24/542 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCT-------GIARQKQIDFPTKHLLRFAFN  1702
             M+  A FRGN+  L QCSSC  L+FQP ++ +       GI+R+K+ +   + + R    
Sbjct  1     MNLAASFRGNLGVLSQCSSCCSLQFQPFVATSSLDFGQSGISRRKK-NLKLERVFR----  55

Query  1701  MKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGM  1522
              KR+     + ++TEP+         ++EEN     +  ++    P+ +  + N Q+  +
Sbjct  56    -KRETFVRATETQTEPE-------GNNDEENGGEDKEKETSADDPPSQIPTELNSQSTVV  107

Query  1521  LESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQV  1342
              E    +  N     AQ  ++D D +++++GSPLPG+ P QLDE++R+PKETIDIL  QV
Sbjct  108   NE----LPSNEEENKAQFSSQDGDKLEVSTGSPLPGVNPLQLDESMRLPKETIDILMGQV  163

Query  1341  FGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKP  1162
             FGFDTFFVTSQEPYEGGVLFKGNLRGQAA+SYEKI  R++++FGD YKLFLL NPEDDKP
Sbjct  164   FGFDTFFVTSQEPYEGGVLFKGNLRGQAAKSYEKIKTRLENKFGDQYKLFLLSNPEDDKP  223

Query  1161  VAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGL  982
             VAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GL
Sbjct  224   VAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGL  283

Query  981   PGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK  802
             PGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIVPKREDLLK
Sbjct  284   PGALVTALVLGVHELGHILVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVPKREDLLK  343

Query  801   FAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGT  622
              AAAGPLAGFSLG +L L G   PP+DG+GVVVD SVFHES L GGIAKLLLGD LKEGT
Sbjct  344   VAAAGPLAGFSLGLVLFLAGLIFPPSDGIGVVVDASVFHESFLVGGIAKLLLGDVLKEGT  403

Query  621   PISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF  442
              ISVNPLV+W+ AGLLIN INSIPAGELDGG+I+F+IWGRK S RL+  SI LLG+SALF
Sbjct  404   SISVNPLVIWAWAGLLINGINSIPAGELDGGKIAFAIWGRKASTRLTGLSIALLGLSALF  463

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             SDVAFYWVVLIF LQRGPIAPL+EEIT+PD+KY++LGI VL L LLVCLPYPF F  E  
Sbjct  464   SDVAFYWVVLIFFLQRGPIAPLAEEITEPDDKYVSLGILVLFLSLLVCLPYPFAFTGEEA  523

Query  261   MV  256
             M+
Sbjct  524   MM  525



>ref|XP_004240688.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=484

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/496 (69%), Positives = 399/496 (80%), Gaps = 26/496 (5%)
 Frame = -1

Query  1746  QIDFPTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsE  1567
             Q   P  HLLR     K  ++C  S    + D + ++                       
Sbjct  15    QCSTPPAHLLRLVIRKKGRLVCRLSHDNNKEDDSVQDN----------------------  52

Query  1566  PNSLADQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEA  1387
              N+ + QDN Q    LE+  L N +   +N  TG ED  D Q+AS SPLPG+KPQQLDE+
Sbjct  53    -NNNSHQDNDQP---LENTSLENNDGPQLNGLTGFEDDTDDQLASESPLPGVKPQQLDES  108

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
             IRIPKET++IL++QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA++YEK+SKRMQ++ GD
Sbjct  109   IRIPKETVEILRNQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAKTYEKVSKRMQEKLGD  168

Query  1206  LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQAN  1027
              YK FLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTL LRNVPALQ+N
Sbjct  169   DYKFFLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLFLRNVPALQSN  228

Query  1026  LLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
              LSVFDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKL +PYFVPSWQIG FGAI
Sbjct  229   FLSVFDNLDLLKDGLPGALMTAFLLGVHEVSHRLVATEVGIKLSIPYFVPSWQIGCFGAI  288

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TRILN+VP REDLLK AAAGPLAGF +GFILLL GF LPP+DG+G++VDPSVFHES LAG
Sbjct  289   TRILNVVPNREDLLKVAAAGPLAGFCVGFILLLSGFMLPPSDGIGIIVDPSVFHESFLAG  348

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
             GIAKL LGD L+EG+PISV+PLV+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SAR
Sbjct  349   GIAKLYLGDVLQEGSPISVHPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASAR  408

Query  486   lssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgl  307
             LS+ SIGLLGI +LF+DVAFYWVVLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGL
Sbjct  409   LSALSIGLLGICSLFNDVAFYWVVLIFFLQRGPIAPLSEEVTHPQNKYMALGVVVLFLGL  468

Query  306   lVCLPYPFPFNNEAVM  259
             LVCLPYPFPF+N+  +
Sbjct  469   LVCLPYPFPFSNQPAL  484



>ref|XP_002526886.1| metalloendopeptidase, putative [Ricinus communis]
 gb|EEF35517.1| metalloendopeptidase, putative [Ricinus communis]
Length=525

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/541 (67%), Positives = 428/541 (79%), Gaps = 27/541 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLL--------QCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAF  1705
             MS  A FRGN  PLL         C+S   +  Q  L C      +  DF   H+ RF  
Sbjct  1     MSLIAAFRGNFTPLLLPLSSHCSSCTSSVSVTSQRKLRC------RLRDFKLYHVSRFV-  53

Query  1704  NMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFG  1525
               KR ++C  + +ETEPD N + E+++HE   +  +  S           A Q + ++  
Sbjct  54    -EKRVIVCRVTETETEPDGNNDKEKEVHEGGETPPTTGS-----------AGQVSSESDS  101

Query  1524  MLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQ  1345
                  + ++ N    N+++  +DAD   +ASGSPLPG+K QQLDE+ RIPK TIDILKDQ
Sbjct  102   QPRVVNQISNNDEQTNSESSTQDADAENVASGSPLPGVKTQQLDESFRIPKGTIDILKDQ  161

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             VFGFDTFFVTSQEPYEGGVLFKGNLRG+AA+SYEK++ RMQ++FGD Y+LFLL+NPEDD+
Sbjct  162   VFGFDTFFVTSQEPYEGGVLFKGNLRGKAAKSYEKLTNRMQNKFGDEYRLFLLVNPEDDR  221

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PVAVVVPR TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLS FDN +LL++G
Sbjct  222   PVAVVVPRKTLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSTFDNLELLKDG  281

Query  984   LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLL  805
             L GAL+TALILGVHE+ H LVA+ + +KLGVPYFVPSWQIGSFGAITRI+NIVPKREDLL
Sbjct  282   LSGALITALILGVHEVGHILVAKSSDVKLGVPYFVPSWQIGSFGAITRIVNIVPKREDLL  341

Query  804   KFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEG  625
             K AAAGPLAGF+LGF+L L+GF LPP+DG+G+VVD SVFHES LAGGIAKLLLGDALKEG
Sbjct  342   KVAAAGPLAGFALGFVLFLVGFVLPPSDGIGLVVDASVFHESFLAGGIAKLLLGDALKEG  401

Query  624   TPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaL  445
             TPISVNPLV+W+ AG+LINAINSIPAGELDGGRI F+IWGRK SAR ++ SIGLLGISAL
Sbjct  402   TPISVNPLVIWAWAGMLINAINSIPAGELDGGRILFAIWGRKASARFTAVSIGLLGISAL  461

Query  444   FSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             F+DVAFYWVVLI  LQRGPIAPLSEEITDP+ KY++LGI VLLLGLLVCLPYPFPF +E 
Sbjct  462   FNDVAFYWVVLIAFLQRGPIAPLSEEITDPEEKYVSLGILVLLLGLLVCLPYPFPFTDEV  521

Query  264   V  262
             +
Sbjct  522   L  522



>ref|XP_006367709.1| PREDICTED: uncharacterized protein LOC102594117 isoform X1 [Solanum 
tuberosum]
Length=486

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/494 (70%), Positives = 404/494 (82%), Gaps = 31/494 (6%)
 Frame = -1

Query  1734  PTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSL  1555
             P  H LRF    K  V+C  S +  + D  +                          ++ 
Sbjct  22    PPTHFLRFVIRKKGSVVCRLSDNNKDDDSVQ--------------------------DNN  55

Query  1554  ADQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLK-PQQLDEAIR  1381
             + QDN Q    LE+  L N +    + QTG  +D  D+Q+ASGSPLPG+K PQQL+E+IR
Sbjct  56    SHQDNDQP---LENTSLENNDGPQPDQQTGLEQDGTDVQVASGSPLPGVKVPQQLNESIR  112

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IPKET++IL++QVF FDTFFVTSQEPYEGGVLF GNLRGQAA++YEK+SKRMQ++ GD Y
Sbjct  113   IPKETVEILRNQVFSFDTFFVTSQEPYEGGVLFNGNLRGQAAKTYEKVSKRMQEKLGDDY  172

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             KLFLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLL
Sbjct  173   KLFLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLL  232

Query  1020  SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITR  841
             SVFDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKLG+PYFVPSWQIG FGAITR
Sbjct  233   SVFDNLDLLKDGLPGALITAFLLGVHEVSHHLVATEVGIKLGIPYFVPSWQIGCFGAITR  292

Query  840   ILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggi  661
             ILN+VP REDLLK AAAGPLAGFS+GFILLL GF LPP+DG+G++VDPSVFHES LAGGI
Sbjct  293   ILNVVPNREDLLKVAAAGPLAGFSVGFILLLSGFILPPSDGIGIIVDPSVFHESFLAGGI  352

Query  660   aklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARls  481
             AKLLLGD L+EG+PISVNPLV+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SARLS
Sbjct  353   AKLLLGDVLQEGSPISVNPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASARLS  412

Query  480   sasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllV  301
             + SIGLLGIS+LF+DVAFYW+VLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGLLV
Sbjct  413   AFSIGLLGISSLFNDVAFYWLVLIFFLQRGPIAPLSEELTHPQNKYMALGVVVLFLGLLV  472

Query  300   CLPYPFPFNNEAVM  259
             CLPYPFPF+N+  +
Sbjct  473   CLPYPFPFSNQPAL  486



>ref|XP_011076833.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc metalloprotease 
EGY2, chloroplastic [Sesamum indicum]
Length=525

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/532 (70%), Positives = 431/532 (81%), Gaps = 22/532 (4%)
 Frame = -1

Query  1848  AIFRGN-VVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRDV--ICS  1678
             + F GN V+PL +C SC+ +RF    S   I R +   F ++ LLR  + ++ +V  IC 
Sbjct  6     SCFGGNFVIPLSRCDSCNRIRF----SSPAIGRWR---FSSRQLLRSDYVVRGNVKVICR  58

Query  1677  FSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDN-GQNFGMLESKDLV  1501
              S +ETEP+ N E ERKL+ E +   S+DS S + SE  S    +N   +  MLE+K +V
Sbjct  59    VSETETEPESNNEEERKLNGENDGLVSSDSISWNNSEQVSENVGNNQSADLDMLETKSVV  118

Query  1500  NGNSVNVNAQTGN-EDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTF  1324
             N +    N   G  ED +D+Q+A+GSPLPG+K       I IPKETI+ILKDQVFGFDTF
Sbjct  119   NSDGDVTNEDPGKLEDVNDVQVATGSPLPGVK-----VIIMIPKETIEILKDQVFGFDTF  173

Query  1323  FVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVP  1144
             FVTSQEPYEGGVLFKGNLRGQAARSYEKI++RM DRFGDLYKLFLLINPEDDKPVAVVVP
Sbjct  174   FVTSQEPYEGGVLFKGNLRGQAARSYEKIARRMGDRFGDLYKLFLLINPEDDKPVAVVVP  233

Query  1143  RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVT  964
             R TLQPDTTAVPEWFAAGAFGLVT+FTLLLRNVPALQANLLSVFDN DLL++GLPGALVT
Sbjct  234   RKTLQPDTTAVPEWFAAGAFGLVTVFTLLLRNVPALQANLLSVFDNVDLLKDGLPGALVT  293

Query  963   ALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGP  784
             ALIL VHE+ H +VA++AGIKLGVPYFVPSWQIGSFG+ITRILNIVPKREDLLK AAAGP
Sbjct  294   ALILAVHEVGHIVVAKEAGIKLGVPYFVPSWQIGSFGSITRILNIVPKREDLLKVAAAGP  353

Query  783   lagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNP  604
             LAGF+LGF+LLLLGF LPPAD LG+VVDPSVFHESLL GGIAKLLLGD LKEGTP+S+NP
Sbjct  354   LAGFALGFLLLLLGFVLPPADELGIVVDPSVFHESLLVGGIAKLLLGDVLKEGTPLSLNP  413

Query  603   LVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFY  424
             LV+W+ AGLLINA         DGGRISF+IWGRK S+R ++ASI LLG+++L +DVAFY
Sbjct  414   LVIWAWAGLLINAXXX-----XDGGRISFAIWGRKASSRFTAASIVLLGLASLLNDVAFY  468

Query  423   WVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             WVVLIF LQRGPIAPLSEEITDPDNKY A+G+ VLLLGLLVCLPYPF F ++
Sbjct  469   WVVLIFFLQRGPIAPLSEEITDPDNKYKAIGVLVLLLGLLVCLPYPFQFTSD  520



>ref|XP_009350821.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=517

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/540 (65%), Positives = 421/540 (78%), Gaps = 28/540 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLL---SCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
             M+F A FRGN VPL QCSSC  LRFQP     +C+   R ++      H +   F  KR+
Sbjct  1     MNFSATFRGNFVPLSQCSSCCDLRFQPYFASGTCSWQKRHRRRSSLKLHQVS-RFLRKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
             V+C  S +ETEP  +  N+ +                         ++D   +   L S+
Sbjct  60    VVCRVSKTETEPPPDSNNDEEK--------------------QGHENEDGDSDAVHLASQ  99

Query  1509  DLVNGNSVNVNAQT-GNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGF  1333
              +V  + VN +A+T   ++ ++++++SGSPLPG+KPQ L E+IRIPKETIDILK+QVFGF
Sbjct  100   PIV-ADQVNNDAETKAQQEVENVELSSGSPLPGVKPQ-LGESIRIPKETIDILKNQVFGF  157

Query  1332  DTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAV  1153
             DTFFVT Q+PYE GVLFKGNLRG  A+SYEKIS+RMQD+FGD YKLFLL+NPEDD+PVAV
Sbjct  158   DTFFVTGQDPYETGVLFKGNLRGVPAKSYEKISRRMQDKFGDEYKLFLLVNPEDDQPVAV  217

Query  1152  VVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
             VVP+ TLQP++TAVPEWFAAGAFGLVT FTLLL+NVP LQ+N LS FDN +LL+NGLPGA
Sbjct  218   VVPQRTLQPESTAVPEWFAAGAFGLVTFFTLLLQNVPELQSNFLSAFDNPELLKNGLPGA  277

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             LVTA +LGVHE+ H LVA   G+ LGVPYF+PSWQIGSFG ITRI+NIVPKRE LLK A 
Sbjct  278   LVTAAVLGVHELGHVLVANSTGVVLGVPYFIPSWQIGSFGTITRIVNIVPKRESLLKVAV  337

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGPLAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHES L GG AKLLLG+ALKEGTPIS
Sbjct  338   AGPLAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHESFLIGGTAKLLLGEALKEGTPIS  397

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDV  433
             +NPL+LW+ AGL+INAINSIPAGELDGGRISF+IWGRK + R++ ASI LLG+S+L SDV
Sbjct  398   LNPLLLWAWAGLVINAINSIPAGELDGGRISFAIWGRKAATRITGASIALLGLSSLVSDV  457

Query  432   AFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVMVS  253
             AFYWV LIF LQRGPIAPL EEITDPD+KY+ LG+ VL LGLLVCLPYPFPF +E +M S
Sbjct  458   AFYWVALIFFLQRGPIAPLYEEITDPDDKYVGLGVLVLFLGLLVCLPYPFPFVDE-IMTS  516



>ref|NP_974736.1| S2P-like putative metalloprotease [Arabidopsis thaliana]
 gb|AED90917.1| S2P-like putative metalloprotease [Arabidopsis thaliana]
Length=527

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/540 (65%), Positives = 417/540 (77%), Gaps = 29/540 (5%)
 Frame = -1

Query  1848  AIFRGNVVPLLQCSSCSHLRFQPLLSCT--------GIARQKQIDFPTKHLLRFAFNMKR  1693
             A FRGN   L QCSSC  L+FQP ++ T        G +R+K+ D   + + R     KR
Sbjct  6     ASFRGNFGVLSQCSSCCSLQFQPFVAATSSLNFGQTGTSRRKK-DLKLERVFR-----KR  59

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
             + +   + ++TEP+            ++        S+    P  +  + N Q+  + E+
Sbjct  60    ETLVRVTETQTEPE----------GNDDEDNKEGKESSADDPPTKIPTELNSQSTVVNEA  109

Query  1512  KDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGF  1333
                  GN     AQ  ++D D ++++SGSPLPG+ P QLD+++R+PKETIDIL+ QVFGF
Sbjct  110   P----GNEEENKAQFSSQDGDKLEVSSGSPLPGVNPLQLDDSMRLPKETIDILRGQVFGF  165

Query  1332  DTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAV  1153
             DTFFVTSQEPYEGGVLFKGNLRG+ A SYEKI  RM++ FGD YKLFLL NPEDDKPVAV
Sbjct  166   DTFFVTSQEPYEGGVLFKGNLRGKPATSYEKIKTRMENNFGDQYKLFLLTNPEDDKPVAV  225

Query  1152  VVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
             VVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GLPGA
Sbjct  226   VVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPGA  285

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             LVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIV KREDLLK AA
Sbjct  286   LVTALVLGVHELGHILVANSLGIKLGVPFFVPSWQIGSFGAITRIKNIVAKREDLLKVAA  345

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGPLAGFSLG IL L+G F+PP+DG+GVVVD SVFHES LAGGIAKLLLGDALKEGT IS
Sbjct  346   AGPLAGFSLGLILFLIGLFVPPSDGIGVVVDASVFHESFLAGGIAKLLLGDALKEGTSIS  405

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDV  433
             +NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRKT+ RL+ ASI LLG+SALFSDV
Sbjct  406   LNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKTATRLTGASIALLGLSALFSDV  465

Query  432   AFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN-NEAVMV  256
             AFYWVVLIF LQRGPIAPL+EEIT PD+KY++LGI VL L LLVCLPYPF F  NEA+M+
Sbjct  466   AFYWVVLIFFLQRGPIAPLAEEITVPDDKYVSLGILVLFLSLLVCLPYPFAFTGNEAMMI  525



>ref|XP_008785379.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X3 [Phoenix dactylifera]
Length=572

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/431 (77%), Positives = 379/431 (88%), Gaps = 2/431 (0%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQT-GNEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             ++D G + G+L+  + +  + V++  Q    E  DD+++ASGSPLPG+K QQL E IRIP
Sbjct  139   NKDEGGSKGLLDLGNTLEKSEVDLVTQNDKQEKNDDLEVASGSPLPGMK-QQLGEPIRIP  197

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+AA+SYEKI+KRMQD FGD YKL
Sbjct  198   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKAAKSYEKITKRMQDTFGDKYKL  257

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPEDDKPVAVVVPR TLQP++TA+PEWFAAGAFGLVTIFTLLLRNVPALQ NLLS 
Sbjct  258   FLLINPEDDKPVAVVVPRQTLQPESTAIPEWFAAGAFGLVTIFTLLLRNVPALQTNLLST  317

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN  LL NGLPGALVTAL+LG HEI H L+A+  GIKLGVPYFVPSWQ GSFGAITRIL
Sbjct  318   FDNLGLLRNGLPGALVTALVLGFHEIGHILIARDTGIKLGVPYFVPSWQTGSFGAITRIL  377

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             +IV  REDL+K AAAGPLAGFS+GF+LLLLGF LPPADG+G+VVDP+VFHES LAGGIAK
Sbjct  378   SIVANREDLIKLAAAGPLAGFSVGFVLLLLGFILPPADGIGIVVDPAVFHESFLAGGIAK  437

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLG+ LKEG+P+S+NPLVLW+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR +S 
Sbjct  438   LLLGEVLKEGSPLSINPLVLWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARWTSV  497

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             ++ LLGIS+LF+DVAFYWVVLIF LQRGPIAPLSEEIT+P+N+Y  LG+AVLL GLLVCL
Sbjct  498   TLALLGISSLFNDVAFYWVVLIFFLQRGPIAPLSEEITEPENRYAILGVAVLLFGLLVCL  557

Query  294   PYPFPFNNEAV  262
             PYPFPF NE +
Sbjct  558   PYPFPFTNEGM  568



>ref|XP_006367713.1| PREDICTED: uncharacterized protein LOC102594117 isoform X5 [Solanum 
tuberosum]
Length=482

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/494 (69%), Positives = 402/494 (81%), Gaps = 35/494 (7%)
 Frame = -1

Query  1734  PTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSL  1555
             P  H LRF    K  V+C  S +  + D                              S+
Sbjct  22    PPTHFLRFVIRKKGSVVCRLSDNNKDDD------------------------------SV  51

Query  1554  ADQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLK-PQQLDEAIR  1381
              D ++ Q    LE+  L N +    + QTG  +D  D+Q+ASGSPLPG+K PQQL+E+IR
Sbjct  52    QDNNSHQP---LENTSLENNDGPQPDQQTGLEQDGTDVQVASGSPLPGVKVPQQLNESIR  108

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IPKET++IL++QVF FDTFFVTSQEPYEGGVLF GNLRGQAA++YEK+SKRMQ++ GD Y
Sbjct  109   IPKETVEILRNQVFSFDTFFVTSQEPYEGGVLFNGNLRGQAAKTYEKVSKRMQEKLGDDY  168

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             KLFLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLL
Sbjct  169   KLFLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLL  228

Query  1020  SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITR  841
             SVFDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKLG+PYFVPSWQIG FGAITR
Sbjct  229   SVFDNLDLLKDGLPGALITAFLLGVHEVSHHLVATEVGIKLGIPYFVPSWQIGCFGAITR  288

Query  840   ILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggi  661
             ILN+VP REDLLK AAAGPLAGFS+GFILLL GF LPP+DG+G++VDPSVFHES LAGGI
Sbjct  289   ILNVVPNREDLLKVAAAGPLAGFSVGFILLLSGFILPPSDGIGIIVDPSVFHESFLAGGI  348

Query  660   aklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARls  481
             AKLLLGD L+EG+PISVNPLV+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SARLS
Sbjct  349   AKLLLGDVLQEGSPISVNPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASARLS  408

Query  480   sasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllV  301
             + SIGLLGIS+LF+DVAFYW+VLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGLLV
Sbjct  409   AFSIGLLGISSLFNDVAFYWLVLIFFLQRGPIAPLSEELTHPQNKYMALGVVVLFLGLLV  468

Query  300   CLPYPFPFNNEAVM  259
             CLPYPFPF+N+  +
Sbjct  469   CLPYPFPFSNQPAL  482



>ref|XP_006287504.1| hypothetical protein CARUB_v10000713mg [Capsella rubella]
 gb|EOA20402.1| hypothetical protein CARUB_v10000713mg [Capsella rubella]
Length=524

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/553 (64%), Positives = 413/553 (75%), Gaps = 58/553 (10%)
 Frame = -1

Query  1848  AIFRGNVVPLLQCSSCSHLRFQPLLSC-------TGIARQKQIDFPTKHLLRFAFNMKRD  1690
             A F GN   L +CSSC  L+FQP ++        TGI+R+K+ D   + + R     KRD
Sbjct  6     ASFSGNFGVLSKCSSCCSLQFQPFVATSSLNFGQTGISRRKK-DLKLERVFR-----KRD  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
                  + ++TEP+ N                               D+DN    G   S 
Sbjct  60    TFVRATDTQTEPEDNN------------------------------DEDNNGEEGKENSA  89

Query  1509  D--------LVNGNSVNVNAQTGNE------DADDIQIASGSPLPGLKPQQLDEAIRIPK  1372
             D         +N  S  VN   GNE      D D ++I+SGSPLPG+ P QLD+++R+PK
Sbjct  90    DDPPTQVPTELNSQSTVVNEAPGNEEDNISQDGDKLEISSGSPLPGVNPLQLDDSMRLPK  149

Query  1371  ETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLF  1192
             ETIDIL+ +VFGFDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  RM++ FGD YKLF
Sbjct  150   ETIDILRGEVFGFDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRMENNFGDQYKLF  209

Query  1191  LLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVF  1012
             LL NPEDDKPVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS F
Sbjct  210   LLTNPEDDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAF  269

Query  1011  DNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILN  832
             DN +LL++GLPGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI N
Sbjct  270   DNLELLKDGLPGALVTALVLGVHELGHILVANSLGIKLGVPFFVPSWQIGSFGAITRIKN  329

Query  831   IVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiakl  652
             IV KREDLLK AAAGPLAGFSLG IL L+G F+PP+DG+GVVVD SVFHES LAGGIAKL
Sbjct  330   IVAKREDLLKLAAAGPLAGFSLGLILFLVGLFVPPSDGIGVVVDASVFHESFLAGGIAKL  389

Query  651   llgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssas  472
             LLGD LKEGT IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRKT+ RL+ AS
Sbjct  390   LLGDVLKEGTSISLNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKTATRLTGAS  449

Query  471   igllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLP  292
             I LLG+SALFSDVAFYWVVLIF LQRGPIAPL+EEIT PD+KY++LGI VL L LLVCLP
Sbjct  450   IALLGLSALFSDVAFYWVVLIFFLQRGPIAPLAEEITAPDDKYVSLGILVLFLSLLVCLP  509

Query  291   YPFPFNN-EAVMV  256
             YPF F + EA+M+
Sbjct  510   YPFAFTSGEAMMI  522



>ref|XP_004308926.1| PREDICTED: uncharacterized protein LOC101295669 [Fragaria vesca 
subsp. vesca]
Length=529

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/545 (67%), Positives = 426/545 (78%), Gaps = 32/545 (6%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGI--ARQKQIDFPTKHLLR--FAFNMKR  1693
             M+  A FRGN V + QCSSC  LRFQP L+ +G    R++        + R    F  KR
Sbjct  1     MNLSANFRGNFVSISQCSSCCDLRFQPYLASSGSWPKRRRTTSVNLHRISRGELRFLRKR  60

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
             +V C  S +E E D N + E++ HE                  +   D D  Q    L++
Sbjct  61    EVGCRVSETEKESDDNNDEEKEGHE------------------HESGDSDEAQ----LDA  98

Query  1512  KDLVNGNSVNVNAQT----GNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQ  1345
             + +V  N +N  A+T    G +DAD++++ASGSPLPG+KPQQ  E+IRIPKET++ILK+Q
Sbjct  99    QPIV-ANQINNEAETKPQEGVQDADNVEVASGSPLPGVKPQQ-GESIRIPKETLEILKNQ  156

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             VFGFDTFFVT Q+PYE GVLFKGNLRG+AA+SYEKI+KRM+D+FGD YKLFLL+NPEDD+
Sbjct  157   VFGFDTFFVTGQDPYEAGVLFKGNLRGEAAKSYEKITKRMKDKFGDEYKLFLLVNPEDDQ  216

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PVAVVVPR TLQP+TTAVPEW AAGAFGLVT+FTLLLRNVP LQAN+LS FDN +LL  G
Sbjct  217   PVAVVVPRRTLQPETTAVPEWVAAGAFGLVTLFTLLLRNVPELQANILSAFDNVELLNKG  276

Query  984   LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLL  805
             LPGALVTAL+LGVHE+ H L A   GIKLGVP+FVPSWQIGSFG ITRI+NIVPKREDLL
Sbjct  277   LPGALVTALVLGVHELGHILAANSTGIKLGVPFFVPSWQIGSFGTITRIVNIVPKREDLL  336

Query  804   KFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEG  625
             K AAAGPLAGF+LG +LLLLGF LPP+DG+GV+VD SVFHES LAGGIAKLLLGDALKEG
Sbjct  337   KVAAAGPLAGFALGIVLLLLGFILPPSDGVGVIVDASVFHESFLAGGIAKLLLGDALKEG  396

Query  624   TPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaL  445
             TPISVNPL+LW+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR +  SI LLG+S+L
Sbjct  397   TPISVNPLLLWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTGFSIVLLGLSSL  456

Query  444   FSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
              +DVAFYWV LIF LQRGPIAPL+EEITDPD+KY+A G+ VL LGLLVCLPYPFPF ++ 
Sbjct  457   INDVAFYWVALIFFLQRGPIAPLAEEITDPDDKYVAAGVLVLFLGLLVCLPYPFPFTDDM  516

Query  264   VMVSS  250
                SS
Sbjct  517   TTFSS  521



>ref|XP_010689476.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=536

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/538 (65%), Positives = 415/538 (77%), Gaps = 6/538 (1%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLL---RFAFNMKRD  1690
             MS     R N      C+SCS LRFQPL++   +   ++        L   R     K D
Sbjct  1     MSSAVTLRCNSSSFSHCTSCSVLRFQPLIASYSLEFPRKFHNCALQFLAVSRLNNRRKID  60

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
              +C    ++ EP   + N+ K  ++  +  +     +  S+P+   +++      +    
Sbjct  61    FVCRVGETDAEP---DGNDDKGDKDGGNEIAGSIDYSTESDPSPELEKEQLSTDILNSDS  117

Query  1509  DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFD  1330
             + V  N + VN +   +D D+ Q+ASGSPLPG+K QQLDEA+RIPKETIDIL+DQVFGFD
Sbjct  118   NNVGSNEIKVNEEGRKQDPDNSQVASGSPLPGVKLQQLDEAVRIPKETIDILRDQVFGFD  177

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVT QEPYEGG+LFKGNLRG A +SYEKISKR+QDRFGD YKLFLLINPEDDKPVAVV
Sbjct  178   TFFVTGQEPYEGGLLFKGNLRGVATKSYEKISKRLQDRFGDQYKLFLLINPEDDKPVAVV  237

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGAL  970
             VPR TLQP+TTAVPEW AAGAFGLVT+FTLLLRNVP LQ++LLS FD  +LL+NGLPGAL
Sbjct  238   VPRRTLQPETTAVPEWLAAGAFGLVTLFTLLLRNVPELQSDLLSSFDKLELLKNGLPGAL  297

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             V+ LILGVHE+ H  +A+  G+KLGVPYF+PSWQIGSFGAITRI+NIVPKREDLLK AAA
Sbjct  298   VSVLILGVHELGHYAIAKGCGVKLGVPYFIPSWQIGSFGAITRIVNIVPKREDLLKIAAA  357

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             GPLAG+SLG IL LLGF LPP+DGLG+VVD  VFHES L GGIAKLLLGD LKEG  IS+
Sbjct  358   GPLAGYSLGLILFLLGFILPPSDGLGIVVDAGVFHESFLVGGIAKLLLGDVLKEGQAISL  417

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             NPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK +AR + ASI LLG+S+LF+DVA
Sbjct  418   NPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKAAARFTGASIVLLGLSSLFNDVA  477

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVMV  256
             FYWVVLI++LQRGPIAPL+EEI++PD    ALGIAVLLLGLLVCLPYPFPF ++A+M 
Sbjct  478   FYWVVLIYILQRGPIAPLAEEISEPDQTSTALGIAVLLLGLLVCLPYPFPFTSDALMT  535



>emb|CDX80971.1| BnaC03g02250D [Brassica napus]
Length=528

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/542 (63%), Positives = 419/542 (77%), Gaps = 24/542 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQC-SSCSHLRFQPLLSCTGIARQKQIDFPTKHLLR-FAFNMKRDV  1687
             M+  A FRGN   L QC SS   L+FQPL++ + +   ++  +  K  L+ F    KR+ 
Sbjct  1     MNLAASFRGNYGVLSQCCSSRCSLQFQPLVATSSLGFGQRDSYRRKKELKLFRVQRKRET  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQN--FGMLES  1513
              C  + ++TEPD N + E    ++                  +LAD+   Q     ++  
Sbjct  61    FCRVTDTQTEPDGNNDEESGGEDK-----------------EALADEPPSQTPPTELVPE  103

Query  1512  KDLVN---GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQV  1342
               +V+   G++     Q  ++D D +++++GSPLPG+ P QLD+++R+PKETIDILKDQV
Sbjct  104   ATVVDEAVGSNEENKVQFSSQDGDKLEVSTGSPLPGVNPLQLDDSMRLPKETIDILKDQV  163

Query  1341  FGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKP  1162
             FGFDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  R++++FGD YKLFLL NPEDDKP
Sbjct  164   FGFDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRLENKFGDQYKLFLLSNPEDDKP  223

Query  1161  VAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGL  982
             VAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GL
Sbjct  224   VAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGL  283

Query  981   PGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK  802
             PGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIVPKREDLLK
Sbjct  284   PGALVTALVLGVHELGHVLVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVPKREDLLK  343

Query  801   FAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGT  622
              AAAGPLAGFSLGF+L L+G  +PP+DG+GVVV+ SVFHES L GGIAKLLLGD LKEGT
Sbjct  344   VAAAGPLAGFSLGFVLFLVGLVVPPSDGIGVVVNSSVFHESFLVGGIAKLLLGDVLKEGT  403

Query  621   PISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF  442
              IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRK SARL+S S+ LLG+SALF
Sbjct  404   SISLNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKASARLTSVSLALLGLSALF  463

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             SDVAFYWVVLIF LQRGPIAPL+EEIT+P+ K++ LGI VL L LLVCLPYPFPF  E  
Sbjct  464   SDVAFYWVVLIFFLQRGPIAPLAEEITEPEEKFVYLGILVLFLSLLVCLPYPFPFTGEDA  523

Query  261   MV  256
             M+
Sbjct  524   MM  525



>ref|NP_001190232.1| S2P-like putative metalloprotease [Arabidopsis thaliana]
 gb|AED90919.1| S2P-like putative metalloprotease [Arabidopsis thaliana]
Length=524

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/540 (64%), Positives = 413/540 (76%), Gaps = 32/540 (6%)
 Frame = -1

Query  1848  AIFRGNVVPLLQCSSCSHLRFQPLLSCT--------GIARQKQIDFPTKHLLRFAFNMKR  1693
             A FRGN   L QCSSC  L+FQP ++ T        G +R+K+               KR
Sbjct  6     ASFRGNFGVLSQCSSCCSLQFQPFVAATSSLNFGQTGTSRRKK---------DLKLERKR  56

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
             + +   + ++TEP+            ++        S+    P  +  + N Q+  + E+
Sbjct  57    ETLVRVTETQTEPE----------GNDDEDNKEGKESSADDPPTKIPTELNSQSTVVNEA  106

Query  1512  KDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGF  1333
                  GN     AQ  ++D D ++++SGSPLPG+ P QLD+++R+PKETIDIL+ QVFGF
Sbjct  107   P----GNEEENKAQFSSQDGDKLEVSSGSPLPGVNPLQLDDSMRLPKETIDILRGQVFGF  162

Query  1332  DTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAV  1153
             DTFFVTSQEPYEGGVLFKGNLRG+ A SYEKI  RM++ FGD YKLFLL NPEDDKPVAV
Sbjct  163   DTFFVTSQEPYEGGVLFKGNLRGKPATSYEKIKTRMENNFGDQYKLFLLTNPEDDKPVAV  222

Query  1152  VVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
             VVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GLPGA
Sbjct  223   VVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPGA  282

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             LVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIV KREDLLK AA
Sbjct  283   LVTALVLGVHELGHILVANSLGIKLGVPFFVPSWQIGSFGAITRIKNIVAKREDLLKVAA  342

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGPLAGFSLG IL L+G F+PP+DG+GVVVD SVFHES LAGGIAKLLLGDALKEGT IS
Sbjct  343   AGPLAGFSLGLILFLIGLFVPPSDGIGVVVDASVFHESFLAGGIAKLLLGDALKEGTSIS  402

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDV  433
             +NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRKT+ RL+ ASI LLG+SALFSDV
Sbjct  403   LNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKTATRLTGASIALLGLSALFSDV  462

Query  432   AFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN-NEAVMV  256
             AFYWVVLIF LQRGPIAPL+EEIT PD+KY++LGI VL L LLVCLPYPF F  NEA+M+
Sbjct  463   AFYWVVLIFFLQRGPIAPLAEEITVPDDKYVSLGILVLFLSLLVCLPYPFAFTGNEAMMI  522



>ref|XP_010321954.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=489

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/501 (68%), Positives = 399/501 (80%), Gaps = 31/501 (6%)
 Frame = -1

Query  1746  QIDFPTKHLLRFAFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsE  1567
             Q   P  HLLR     K  ++C  S    + D + ++                       
Sbjct  15    QCSTPPAHLLRLVIRKKGRLVCRLSHDNNKEDDSVQDN----------------------  52

Query  1566  PNSLADQDNGQNFGMLESKDLVNGNSVNVNAQTGNE-----DADDIQIASGSPLPGLKPQ  1402
              N+ + QDN Q    LE+  L N +   +N  TG E     D  D Q+AS SPLPG+KPQ
Sbjct  53    -NNNSHQDNDQP---LENTSLENNDGPQLNGLTGFEPWLKQDDTDDQLASESPLPGVKPQ  108

Query  1401  QLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQ  1222
             QLDE+IRIPKET++IL++QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA++YEK+SKRMQ
Sbjct  109   QLDESIRIPKETVEILRNQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAKTYEKVSKRMQ  168

Query  1221  DRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVP  1042
             ++ GD YK FLLINPEDDKPVAVVVPR+TLQP+TTAVPEWFAAGAFGLVT+FTL LRNVP
Sbjct  169   EKLGDDYKFFLLINPEDDKPVAVVVPRMTLQPETTAVPEWFAAGAFGLVTVFTLFLRNVP  228

Query  1041  ALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             ALQ+N LSVFDN DLL++GLPGAL+TA +LGVHE+SH LVA + GIKL +PYFVPSWQIG
Sbjct  229   ALQSNFLSVFDNLDLLKDGLPGALMTAFLLGVHEVSHRLVATEVGIKLSIPYFVPSWQIG  288

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
              FGAITRILN+VP REDLLK AAAGPLAGF +GFILLL GF LPP+DG+G++VDPSVFHE
Sbjct  289   CFGAITRILNVVPNREDLLKVAAAGPLAGFCVGFILLLSGFMLPPSDGIGIIVDPSVFHE  348

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
             S LAGGIAKL LGD L+EG+PISV+PLV+W+ AGL+INAINSIPAGELDGGRI+F++WGR
Sbjct  349   SFLAGGIAKLYLGDVLQEGSPISVHPLVIWAWAGLVINAINSIPAGELDGGRIAFAMWGR  408

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiav  322
             K SARLS+ SIGLLGI +LF+DVAFYWVVLIF LQRGPIAPLSEE+T P NKY+ALG+ V
Sbjct  409   KASARLSALSIGLLGICSLFNDVAFYWVVLIFFLQRGPIAPLSEEVTHPQNKYMALGVVV  468

Query  321   lllgllVCLPYPFPFNNEAVM  259
             L LGLLVCLPYPFPF+N+  +
Sbjct  469   LFLGLLVCLPYPFPFSNQPAL  489



>ref|XP_009350827.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=515

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/540 (65%), Positives = 419/540 (78%), Gaps = 30/540 (6%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLL---SCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
             M+F A FRGN VPL QCSSC  LRFQP     +C+   R ++      H +   F  KR+
Sbjct  1     MNFSATFRGNFVPLSQCSSCCDLRFQPYFASGTCSWQKRHRRRSSLKLHQVS-RFLRKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
             V+C  S +ETEP  +  N+ +                         ++D   +   L S+
Sbjct  60    VVCRVSKTETEPPPDSNNDEEK--------------------QGHENEDGDSDAVHLASQ  99

Query  1509  DLVNGNSVNVNAQT-GNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGF  1333
              +V  + VN +A+T   ++ ++++++SGSPLPG+K   L E+IRIPKETIDILK+QVFGF
Sbjct  100   PIV-ADQVNNDAETKAQQEVENVELSSGSPLPGVK---LGESIRIPKETIDILKNQVFGF  155

Query  1332  DTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAV  1153
             DTFFVT Q+PYE GVLFKGNLRG  A+SYEKIS+RMQD+FGD YKLFLL+NPEDD+PVAV
Sbjct  156   DTFFVTGQDPYETGVLFKGNLRGVPAKSYEKISRRMQDKFGDEYKLFLLVNPEDDQPVAV  215

Query  1152  VVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
             VVP+ TLQP++TAVPEWFAAGAFGLVT FTLLL+NVP LQ+N LS FDN +LL+NGLPGA
Sbjct  216   VVPQRTLQPESTAVPEWFAAGAFGLVTFFTLLLQNVPELQSNFLSAFDNPELLKNGLPGA  275

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             LVTA +LGVHE+ H LVA   G+ LGVPYF+PSWQIGSFG ITRI+NIVPKRE LLK A 
Sbjct  276   LVTAAVLGVHELGHVLVANSTGVVLGVPYFIPSWQIGSFGTITRIVNIVPKRESLLKVAV  335

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGPLAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHES L GG AKLLLG+ALKEGTPIS
Sbjct  336   AGPLAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHESFLIGGTAKLLLGEALKEGTPIS  395

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDV  433
             +NPL+LW+ AGL+INAINSIPAGELDGGRISF+IWGRK + R++ ASI LLG+S+L SDV
Sbjct  396   LNPLLLWAWAGLVINAINSIPAGELDGGRISFAIWGRKAATRITGASIALLGLSSLVSDV  455

Query  432   AFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVMVS  253
             AFYWV LIF LQRGPIAPL EEITDPD+KY+ LG+ VL LGLLVCLPYPFPF +E +M S
Sbjct  456   AFYWVALIFFLQRGPIAPLYEEITDPDDKYVGLGVLVLFLGLLVCLPYPFPFVDE-IMTS  514



>ref|XP_009130897.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Brassica rapa]
 ref|XP_009130898.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X3 [Brassica rapa]
Length=529

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/543 (63%), Positives = 416/543 (77%), Gaps = 25/543 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSS--CSHLRFQPLLSCTGIARQKQIDFPTKHLLR-FAFNMKRD  1690
             M+  A FR N   L QC S  C  L+FQPL++ + +   ++  +  K  L+ F    KR+
Sbjct  1     MNLAASFRANYGVLPQCCSSRCCSLQFQPLVATSSLGFGQRDSYRRKKELKLFPVQRKRE  60

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQN--FGMLE  1516
               C  + ++TEPD N + E    ++                  +LAD+   Q     ++ 
Sbjct  61    TFCRVTDAQTEPDGNNDEESGGEDK-----------------EALADEPPSQAPPTELVP  103

Query  1515  SKDLVN---GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQ  1345
                +V+   G++     Q  ++D D +++++GSPLPG+ P QLD+++R+PKETIDILKDQ
Sbjct  104   EATVVDEAVGSNEENKVQFSSQDGDKLEVSTGSPLPGVNPLQLDDSMRLPKETIDILKDQ  163

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             VFGFDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  R++++FGD YKLFLL NPEDDK
Sbjct  164   VFGFDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRLENKFGDQYKLFLLSNPEDDK  223

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++G
Sbjct  224   PVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDG  283

Query  984   LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLL  805
             LPGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIVPKREDLL
Sbjct  284   LPGALVTALVLGVHELGHVLVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVPKREDLL  343

Query  804   KFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEG  625
             K AAAGPLAGFSLGF+L L+G  +PP+DG+GVVVD SVFHES L GGIAKLLLGD LKEG
Sbjct  344   KVAAAGPLAGFSLGFVLFLVGLVVPPSDGIGVVVDSSVFHESFLVGGIAKLLLGDVLKEG  403

Query  624   TPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaL  445
             T IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRK S RL+S S+ LLG+SAL
Sbjct  404   TSISLNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKASTRLTSVSLALLGLSAL  463

Query  444   FSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
             FSDVAFYWVVLIF LQRGPIAPL+EEIT+P+ KY+ LGI VL L LLVCLPYPF F  + 
Sbjct  464   FSDVAFYWVVLIFFLQRGPIAPLAEEITEPEEKYVYLGILVLFLSLLVCLPYPFAFTGQD  523

Query  264   VMV  256
              M+
Sbjct  524   AMM  526



>ref|XP_003519388.1| PREDICTED: uncharacterized protein LOC100778800 [Glycine max]
Length=523

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/540 (65%), Positives = 416/540 (77%), Gaps = 27/540 (5%)
 Frame = -1

Query  1866  FTMSFPAIFRGNV-VPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
              +++ P+ FRGN+ VPL +C+SC  L  +          Q    F      R  F + RD
Sbjct  3     LSLAAPSAFRGNLLVPLSRCTSCFKLDLR---------FQHSDGFRHSRCRRSLFKLIRD  53

Query  1689  VICS----FSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGM  1522
                S     + S TEPD   + + K  ++   +   + +S  +  P   A+Q N      
Sbjct  54    PRSSRRRGIACSVTEPDNGSDEKEKEADKNGETLRVEDSSEQSIPPPVDAEQLN------  107

Query  1521  LESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQV  1342
              E  D   G S   N    NE      +ASGSPLPG+KPQ+LDEAI+IPKETI+ILK+QV
Sbjct  108   -EFSDENKGQSDVQNMDDSNE------VASGSPLPGVKPQKLDEAIKIPKETIEILKNQV  160

Query  1341  FGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKP  1162
             FGFDTFFVTSQ+PYEGGVLFKGNLRGQAA+SY+KISKR++D+FGD YKLFLL+NPEDDKP
Sbjct  161   FGFDTFFVTSQDPYEGGVLFKGNLRGQAAKSYDKISKRLKDKFGDEYKLFLLVNPEDDKP  220

Query  1161  VAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGL  982
             VAVVVPR TLQP+TTAVPEWFAAG+FGL+T+FTLLLRNVPALQ++LLS FDN +LL++GL
Sbjct  221   VAVVVPRTTLQPETTAVPEWFAAGSFGLITVFTLLLRNVPALQSDLLSTFDNLNLLKDGL  280

Query  981   PGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK  802
             PGALVTALILGVHE+ H L A+  G+KLGVPYFVPSWQIGSFGAITRI NIVP REDLLK
Sbjct  281   PGALVTALILGVHELGHFLAAKDTGVKLGVPYFVPSWQIGSFGAITRIRNIVPNREDLLK  340

Query  801   FAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGT  622
              AAAGP+AG++LG +LLLLGF LPP+DG+GVVVD SVFHES LAGGIAKLLLG+ LKEGT
Sbjct  341   VAAAGPIAGYALGLLLLLLGFVLPPSDGIGVVVDASVFHESFLAGGIAKLLLGNVLKEGT  400

Query  621   PISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF  442
              IS+NPLV+W+ AGLLINAINSIPAGELDGGRISF++WGRK S R +  SI LLG+S+L 
Sbjct  401   AISINPLVIWAWAGLLINAINSIPAGELDGGRISFALWGRKASLRFTGVSIALLGVSSLL  460

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             +DVAFYWVVLIF LQRGPIAPLSEEITDP  KY+A+G+ VLLLGLLVCLPYPFPF  E +
Sbjct  461   NDVAFYWVVLIFFLQRGPIAPLSEEITDPGEKYVAIGVTVLLLGLLVCLPYPFPFTEETI  520



>ref|XP_009130896.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Brassica rapa]
Length=546

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/546 (63%), Positives = 420/546 (77%), Gaps = 14/546 (3%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSS--CSHLRFQPLLSCTGIARQKQIDFPTKHLLR-FAFNMKRD  1690
             M+  A FR N   L QC S  C  L+FQPL++ + +   ++  +  K  L+ F    KR+
Sbjct  1     MNLAASFRANYGVLPQCCSSRCCSLQFQPLVATSSLGFGQRDSYRRKKELKLFPVQRKRE  60

Query  1689  VICSFSASETEPD--RneenerklheeenssgsadsasadtsEPNSLADQ---DNGQNFG  1525
               C  + ++TEPD   +EE+  +  E       + +   +     ++ D+    N +N  
Sbjct  61    TFCRVTDAQTEPDGNNDEESGGEDKEALADEPPSQAPPTELVPEATVVDEAVGSNEENKV  120

Query  1524  MLESKDLVNGNSVNVNAQT---GNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDIL  1354
                S+D   G+ + V+  +   G  D D +++++GSPLPG+ P QLD+++R+PKETIDIL
Sbjct  121   QFSSQD---GDKLEVSTGSPLPGVNDGDKLEVSTGSPLPGVNPLQLDDSMRLPKETIDIL  177

Query  1353  KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPE  1174
             KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  R++++FGD YKLFLL NPE
Sbjct  178   KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRLENKFGDQYKLFLLSNPE  237

Query  1173  DDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLL  994
             DDKPVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL
Sbjct  238   DDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELL  297

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
             ++GLPGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIVPKRE
Sbjct  298   KDGLPGALVTALVLGVHELGHVLVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVPKRE  357

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
             DLLK AAAGPLAGFSLGF+L L+G  +PP+DG+GVVVD SVFHES L GGIAKLLLGD L
Sbjct  358   DLLKVAAAGPLAGFSLGFVLFLVGLVVPPSDGIGVVVDSSVFHESFLVGGIAKLLLGDVL  417

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
             KEGT IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRK S RL+S S+ LLG+
Sbjct  418   KEGTSISLNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKASTRLTSVSLALLGL  477

Query  453   saLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN  274
             SALFSDVAFYWVVLIF LQRGPIAPL+EEIT+P+ KY+ LGI VL L LLVCLPYPF F 
Sbjct  478   SALFSDVAFYWVVLIFFLQRGPIAPLAEEITEPEEKYVYLGILVLFLSLLVCLPYPFAFT  537

Query  273   NEAVMV  256
              +  M+
Sbjct  538   GQDAMM  543



>gb|KHN48555.1| hypothetical protein glysoja_034178 [Glycine soja]
Length=523

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/542 (65%), Positives = 417/542 (77%), Gaps = 31/542 (6%)
 Frame = -1

Query  1866  FTMSFPAIFRGNV-VPLLQCSSCSHL--RFQPLLSCTGIARQKQIDFPTKHLLRFAFNMK  1696
              +++ P+ FRGN+ VPL +C+SC  L  RFQ               F      R  F + 
Sbjct  3     LSLAAPSAFRGNLLVPLSRCTSCFKLDLRFQ-----------HSDGFRHSRCRRSLFKLI  51

Query  1695  RDVICS----FSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNF  1528
             RD   S     + S TEPD   + + K  ++   +   + +S  +  P   A+Q N    
Sbjct  52    RDPRSSRRRGIACSVTEPDNGSDEKEKEADKNGETPRVEDSSEQSIPPPVDAEQLN----  107

Query  1527  GMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
                E  D   G S   N    NE      +ASGSPLPG+KPQ+LDEAI+IPKETI+ILK+
Sbjct  108   ---EFSDENKGQSDVQNMDDSNE------VASGSPLPGVKPQKLDEAIKIPKETIEILKN  158

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVTSQ+PYEGGVLFKGNLRGQAA+SY+KISKR++D+FGD YKLFLL+NPEDD
Sbjct  159   QVFGFDTFFVTSQDPYEGGVLFKGNLRGQAAKSYDKISKRLKDKFGDEYKLFLLVNPEDD  218

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAG+FGL+T+FTLLLRNVPALQ++LLS FDN +LL++
Sbjct  219   KPVAVVVPRTTLQPETTAVPEWFAAGSFGLITVFTLLLRNVPALQSDLLSTFDNLNLLKD  278

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTALILGVHE+ H L A+  G+KLGVPYFVPSWQIGSFGAITRI NIVP REDL
Sbjct  279   GLPGALVTALILGVHELGHFLAAKDTGVKLGVPYFVPSWQIGSFGAITRIRNIVPNREDL  338

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGP+AG++LG +LLLLGF LPP+DG+GVVVD SVFHES LAGGIAKLLLG+ LKE
Sbjct  339   LKVAAAGPIAGYALGLLLLLLGFVLPPSDGIGVVVDASVFHESFLAGGIAKLLLGNVLKE  398

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GT IS+NPLV+W+ AGLLINAINSIPAGELDGGRISF++WGRK S R +  SI LLG+S+
Sbjct  399   GTAISINPLVIWAWAGLLINAINSIPAGELDGGRISFALWGRKASLRFTGVSIALLGVSS  458

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             L +DVAFYWVVLIF LQRGPIAPLSEEITDP  KY+A+G+ VLLLGLLVCLPYPFPF  E
Sbjct  459   LLNDVAFYWVVLIFFLQRGPIAPLSEEITDPGEKYVAIGVTVLLLGLLVCLPYPFPFTEE  518

Query  267   AV  262
              +
Sbjct  519   TI  520



>ref|XP_008785376.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=578

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/437 (76%), Positives = 379/437 (87%), Gaps = 8/437 (2%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQT-GNEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             ++D G + G+L+  + +  + V++  Q    E  DD+++ASGSPLPG+K QQL E IRIP
Sbjct  139   NKDEGGSKGLLDLGNTLEKSEVDLVTQNDKQEKNDDLEVASGSPLPGMK-QQLGEPIRIP  197

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+AA+SYEKI+KRMQD FGD YKL
Sbjct  198   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKAAKSYEKITKRMQDTFGDKYKL  257

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL--  1021
             FLLINPEDDKPVAVVVPR TLQP++TA+PEWFAAGAFGLVTIFTLLLRNVPALQ NLL  
Sbjct  258   FLLINPEDDKPVAVVVPRQTLQPESTAIPEWFAAGAFGLVTIFTLLLRNVPALQTNLLYE  317

Query  1020  ----SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
                 S FDN  LL NGLPGALVTAL+LG HEI H L+A+  GIKLGVPYFVPSWQ GSFG
Sbjct  318   VSLISTFDNLGLLRNGLPGALVTALVLGFHEIGHILIARDTGIKLGVPYFVPSWQTGSFG  377

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITRIL+IV  REDL+K AAAGPLAGFS+GF+LLLLGF LPPADG+G+VVDP+VFHES L
Sbjct  378   AITRILSIVANREDLIKLAAAGPLAGFSVGFVLLLLGFILPPADGIGIVVDPAVFHESFL  437

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
             AGGIAKLLLG+ LKEG+P+S+NPLVLW+ AGLLINAINSIPAGELDGGRISF+IWGRK S
Sbjct  438   AGGIAKLLLGEVLKEGSPLSINPLVLWAWAGLLINAINSIPAGELDGGRISFAIWGRKAS  497

Query  492   ARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlll  313
             AR +S ++ LLGIS+LF+DVAFYWVVLIF LQRGPIAPLSEEIT+P+N+Y  LG+AVLL 
Sbjct  498   ARWTSVTLALLGISSLFNDVAFYWVVLIFFLQRGPIAPLSEEITEPENRYAILGVAVLLF  557

Query  312   gllVCLPYPFPFNNEAV  262
             GLLVCLPYPFPF NE +
Sbjct  558   GLLVCLPYPFPFTNEGM  574



>ref|XP_010923077.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Elaeis guineensis]
Length=570

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/431 (77%), Positives = 380/431 (88%), Gaps = 2/431 (0%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDA-DDIQIASGSPLPGLKPQQLDEAIRIP  1375
             ++D+  + G+L+    +  +  ++  Q G ++  DD+++ASGSPLPG+K QQL E IRIP
Sbjct  137   NKDDVGSKGLLDLGGSLEKSEGDLVTQNGKQEKNDDLEVASGSPLPGMK-QQLGEPIRIP  195

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTS EPYEGGVLFKGNLRG+AA+SYEKI+KRMQDRFGD YKL
Sbjct  196   KATIDILKDQVFGFDTFFVTSHEPYEGGVLFKGNLRGKAAKSYEKITKRMQDRFGDEYKL  255

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPEDDKPVAVVVPR TLQP++TA+PEWFAAGAFGLVTIFTLLLRNVPALQ NLLS 
Sbjct  256   FLLINPEDDKPVAVVVPRQTLQPESTAIPEWFAAGAFGLVTIFTLLLRNVPALQTNLLST  315

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN  LL++GLPGALVTAL+LG HEI H LVA+  GIKLGVPYFVPSWQ GSFGAITRIL
Sbjct  316   FDNLGLLKDGLPGALVTALVLGFHEIGHILVARDTGIKLGVPYFVPSWQTGSFGAITRIL  375

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             +IV  RE L+K AAAGPLAGFS+GF+LLLLGF LPPADG+G+VVDP+VFHES LAGGIAK
Sbjct  376   SIVANREGLIKLAAAGPLAGFSVGFVLLLLGFILPPADGIGIVVDPAVFHESFLAGGIAK  435

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLG+ LKEG+P+S+NPLVLW+ AGLLINAINSIPAGELDGGRISF+IWGRK SARL+S 
Sbjct  436   LLLGEVLKEGSPLSINPLVLWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARLTSV  495

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             S+ LLGIS+LF+DVAFYWVVLIF LQRGPIAPLSEEIT+P+NKY  LG+AVLL GLLVCL
Sbjct  496   SLALLGISSLFNDVAFYWVVLIFFLQRGPIAPLSEEITEPENKYAILGVAVLLFGLLVCL  555

Query  294   PYPFPFNNEAV  262
             PYPFPF NE +
Sbjct  556   PYPFPFANEGM  566



>ref|XP_008785377.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=575

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/437 (76%), Positives = 379/437 (87%), Gaps = 8/437 (2%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQT-GNEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             ++D G + G+L+  + +  + V++  Q    E  DD+++ASGSPLPG+K QQL E IRIP
Sbjct  136   NKDEGGSKGLLDLGNTLEKSEVDLVTQNDKQEKNDDLEVASGSPLPGMK-QQLGEPIRIP  194

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+AA+SYEKI+KRMQD FGD YKL
Sbjct  195   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKAAKSYEKITKRMQDTFGDKYKL  254

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL--  1021
             FLLINPEDDKPVAVVVPR TLQP++TA+PEWFAAGAFGLVTIFTLLLRNVPALQ NLL  
Sbjct  255   FLLINPEDDKPVAVVVPRQTLQPESTAIPEWFAAGAFGLVTIFTLLLRNVPALQTNLLYE  314

Query  1020  ----SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
                 S FDN  LL NGLPGALVTAL+LG HEI H L+A+  GIKLGVPYFVPSWQ GSFG
Sbjct  315   VSLISTFDNLGLLRNGLPGALVTALVLGFHEIGHILIARDTGIKLGVPYFVPSWQTGSFG  374

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITRIL+IV  REDL+K AAAGPLAGFS+GF+LLLLGF LPPADG+G+VVDP+VFHES L
Sbjct  375   AITRILSIVANREDLIKLAAAGPLAGFSVGFVLLLLGFILPPADGIGIVVDPAVFHESFL  434

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
             AGGIAKLLLG+ LKEG+P+S+NPLVLW+ AGLLINAINSIPAGELDGGRISF+IWGRK S
Sbjct  435   AGGIAKLLLGEVLKEGSPLSINPLVLWAWAGLLINAINSIPAGELDGGRISFAIWGRKAS  494

Query  492   ARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlll  313
             AR +S ++ LLGIS+LF+DVAFYWVVLIF LQRGPIAPLSEEIT+P+N+Y  LG+AVLL 
Sbjct  495   ARWTSVTLALLGISSLFNDVAFYWVVLIFFLQRGPIAPLSEEITEPENRYAILGVAVLLF  554

Query  312   gllVCLPYPFPFNNEAV  262
             GLLVCLPYPFPF NE +
Sbjct  555   GLLVCLPYPFPFTNEGM  571



>ref|XP_006399031.1| hypothetical protein EUTSA_v10013357mg [Eutrema salsugineum]
 ref|XP_006399032.1| hypothetical protein EUTSA_v10013357mg [Eutrema salsugineum]
 gb|ESQ40484.1| hypothetical protein EUTSA_v10013357mg [Eutrema salsugineum]
 gb|ESQ40485.1| hypothetical protein EUTSA_v10013357mg [Eutrema salsugineum]
Length=493

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/510 (64%), Positives = 388/510 (76%), Gaps = 22/510 (4%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKH-LLRFAFNMKRDVI  1684
             MS  A FRGN   L QCSSC  L+FQP ++   +   K+     K  L+ F    KR+ +
Sbjct  1     MSLAASFRGNFGVLSQCSSCCSLQFQPFVATLSLDSGKRETLRRKKDLILFRVRRKRETL  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQ-NFGMLESKD  1507
             C  + ++TEPD                   +       +  +LAD    Q    M+    
Sbjct  61    CRVTDTQTEPD-----------------GNNDEENGEEDKEALADDPPSQIPTEMITEST  103

Query  1506  LVN---GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFG  1336
             +VN   GN      Q  ++D D +++ +GSPLPG+ P +LD+++R+PKETIDIL+ QVFG
Sbjct  104   VVNEAPGNEEENKVQLSSQDGDKLEVNTGSPLPGVNPLRLDDSMRLPKETIDILRGQVFG  163

Query  1335  FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVA  1156
             FDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  R++++FGD YKLFLL NPEDDKPVA
Sbjct  164   FDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRLENKFGDQYKLFLLSNPEDDKPVA  223

Query  1155  VVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPG  976
             VVVPR TL+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GLPG
Sbjct  224   VVVPRRTLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPG  283

Query  975   ALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFA  796
             ALVTAL+LGVHE+ H LV  K GIK GVP+FVPSWQIGSFGAITRI NIVPKREDLLK A
Sbjct  284   ALVTALVLGVHELGHILVGNKLGIKFGVPFFVPSWQIGSFGAITRIKNIVPKREDLLKVA  343

Query  795   AAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPI  616
             AAGPLAGFSLG +L L+G F+PP+DG+GVVVD SVFHES LAGGIAKLLLGD LKEGT I
Sbjct  344   AAGPLAGFSLGLVLFLVGLFVPPSDGIGVVVDASVFHESFLAGGIAKLLLGDVLKEGTSI  403

Query  615   SVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSD  436
             S+NPLV+W+ AGLLIN INSIPAGELDGGRI+F+IWGRK S RL+  SI LLG+SALFSD
Sbjct  404   SLNPLVIWAWAGLLINGINSIPAGELDGGRIAFAIWGRKASTRLTGLSIALLGLSALFSD  463

Query  435   VAFYWVVLIFVLQRGPIAPLSEEITDPDNK  346
             VAFYWVVLIF LQRGPIAPL+EEIT+PD+K
Sbjct  464   VAFYWVVLIFFLQRGPIAPLAEEITEPDDK  493



>ref|XP_010321955.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X3 [Solanum lycopersicum]
Length=444

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/414 (78%), Positives = 370/414 (89%), Gaps = 0/414 (0%)
 Frame = -1

Query  1500  NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFF  1321
              G  V   +   N+D  D Q+AS SPLPG+KPQQLDE+IRIPKET++IL++QVFGFDTFF
Sbjct  31    KGRLVCRLSHDNNKDDTDDQLASESPLPGVKPQQLDESIRIPKETVEILRNQVFGFDTFF  90

Query  1320  VTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPR  1141
             VTSQEPYEGGVLFKGNLRGQAA++YEK+SKRMQ++ GD YK FLLINPEDDKPVAVVVPR
Sbjct  91    VTSQEPYEGGVLFKGNLRGQAAKTYEKVSKRMQEKLGDDYKFFLLINPEDDKPVAVVVPR  150

Query  1140  ITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTA  961
             +TLQP+TTAVPEWFAAGAFGLVT+FTL LRNVPALQ+N LSVFDN DLL++GLPGAL+TA
Sbjct  151   MTLQPETTAVPEWFAAGAFGLVTVFTLFLRNVPALQSNFLSVFDNLDLLKDGLPGALMTA  210

Query  960   LILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPl  781
              +LGVHE+SH LVA + GIKL +PYFVPSWQIG FGAITRILN+VP REDLLK AAAGPL
Sbjct  211   FLLGVHEVSHRLVATEVGIKLSIPYFVPSWQIGCFGAITRILNVVPNREDLLKVAAAGPL  270

Query  780   agfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPL  601
             AGF +GFILLL GF LPP+DG+G++VDPSVFHES LAGGIAKL LGD L+EG+PISV+PL
Sbjct  271   AGFCVGFILLLSGFMLPPSDGIGIIVDPSVFHESFLAGGIAKLYLGDVLQEGSPISVHPL  330

Query  600   VLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYW  421
             V+W+ AGL+INAINSIPAGELDGGRI+F++WGRK SARLS+ SIGLLGI +LF+DVAFYW
Sbjct  331   VIWAWAGLVINAINSIPAGELDGGRIAFAMWGRKASARLSALSIGLLGICSLFNDVAFYW  390

Query  420   VVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVM  259
             VVLIF LQRGPIAPLSEE+T P NKY+ALG+ VL LGLLVCLPYPFPF+N+  +
Sbjct  391   VVLIFFLQRGPIAPLSEEVTHPQNKYMALGVVVLFLGLLVCLPYPFPFSNQPAL  444



>ref|XP_007141781.1| hypothetical protein PHAVU_008G225100g [Phaseolus vulgaris]
 gb|ESW13775.1| hypothetical protein PHAVU_008G225100g [Phaseolus vulgaris]
Length=522

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/552 (63%), Positives = 417/552 (76%), Gaps = 52/552 (9%)
 Frame = -1

Query  1866  FTMSFPAIFRGNVV-PLLQCSSCSH--LRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMK  1696
              +++ P+ FRGN++ PL +C+SC    LRF       G    ++  F +  L R   + +
Sbjct  3     LSLAAPSAFRGNLLLPLSRCTSCFEFDLRFH---HSRGFPHSRR-RFTSFKLFRNPRSSR  58

Query  1695  RDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLE  1516
             R  I   + S TEP                              N   + +  +N   L 
Sbjct  59    RRGI---ACSVTEPQNG---------------------------NDEKENEAYKNGETLP  88

Query  1515  SKDL--------VNGNSVNVNAQTGNEDADDIQ------IASGSPLPGLKPQQLDEAIRI  1378
             S+D         V+G  +N      N+D +D+Q      +ASGSPLPG+KPQ+LDEAI+I
Sbjct  89    SEDSSEQSISPPVDGEQLN-EFSDANKDQNDVQNVDSDEVASGSPLPGVKPQKLDEAIQI  147

Query  1377  PKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYK  1198
             PKE I+IL++QVFGFDTFFVTSQ+PYEGGVLFKGNLRGQAA+SY+KISKR++D+FGD YK
Sbjct  148   PKEAIEILRNQVFGFDTFFVTSQDPYEGGVLFKGNLRGQAAKSYDKISKRLKDKFGDEYK  207

Query  1197  LFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLS  1018
             LFLL+NPEDDKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLL+RNVPALQ++LLS
Sbjct  208   LFLLVNPEDDKPVAVVVPRTTLQPETTAVPEWFAAGAFGLVTVFTLLIRNVPALQSDLLS  267

Query  1017  VFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRI  838
              FDN +LL++GL GALVTALILGVHE+ H L A+  G+KLGVPYFVPSWQIGSFGAITRI
Sbjct  268   AFDNLNLLKDGLSGALVTALILGVHELGHFLAAKDCGVKLGVPYFVPSWQIGSFGAITRI  327

Query  837   LNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggia  658
              NIVP REDLLK AAAGP+AG+ LG +LLLLGF LPP+DG+GVVVD SVFHES LAGGIA
Sbjct  328   RNIVPNREDLLKVAAAGPIAGYCLGLLLLLLGFVLPPSDGIGVVVDASVFHESFLAGGIA  387

Query  657   klllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlss  478
             KLLLG+ LKEGT IS+NPLV+W+ AGLLINAINSIPAGELDGGRISF++WGRK S R++ 
Sbjct  388   KLLLGNVLKEGTAISINPLVIWAWAGLLINAINSIPAGELDGGRISFALWGRKASLRITG  447

Query  477   asigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVC  298
              SI LLG+S+L +DVAFYWVVLIF LQRGPIAPLSEEITDP  KY+A+GI VLLLGLLVC
Sbjct  448   VSIALLGLSSLLNDVAFYWVVLIFFLQRGPIAPLSEEITDPGEKYVAIGIIVLLLGLLVC  507

Query  297   LPYPFPFNNEAV  262
             LPYPFPF +E +
Sbjct  508   LPYPFPFTDETL  519



>ref|XP_009405583.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=539

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/535 (66%), Positives = 418/535 (78%), Gaps = 17/535 (3%)
 Frame = -1

Query  1845  IFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDF------PTKHLLRFAFNMKRDVI  1684
             +FRG+     QC  C  LR  P L CT +   + + F       ++        ++R  I
Sbjct  7     LFRGS-----QCFHCCSLRAGPYL-CTPVFASRSVFFWRSSPSTSRPPCLLGLKLRRHQI  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQ--NFGMLESK  1510
                + +ETEPD N+E +    E  ++  +AD    +    +S+ DQD  +  +  +L   
Sbjct  61    VCQAMTETEPDSNDEKKVAPVEHTSTPSTADLIQNNGHA-DSIIDQDKDEPCDDELLNQD  119

Query  1509  DLVNGNSVNVNAQTGNEDADD-IQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGF  1333
               +  N  ++ A   N++ DD +++ASGSPLPG+K QQLDE ++IPK TIDILKDQVFGF
Sbjct  120   ITLQKNEDDLVANNNNQEKDDNLEVASGSPLPGMK-QQLDETVKIPKATIDILKDQVFGF  178

Query  1332  DTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAV  1153
             DTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ RMQ +FGD YKLFLLINPEDDKPVAV
Sbjct  179   DTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITNRMQGKFGDQYKLFLLINPEDDKPVAV  238

Query  1152  VVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
             VVP+ TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLS FDN  LL +GLPGA
Sbjct  239   VVPKRTLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSTFDNLALLNDGLPGA  298

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             +VT LI+G HEI H LVA+ AGIKLGVPYFVPSWQIGSFGAITRIL+IV  REDLLK +A
Sbjct  299   IVTVLIVGFHEIGHILVARDAGIKLGVPYFVPSWQIGSFGAITRILSIVANREDLLKLSA  358

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGPLAGF++G ILLLLGF LPP DG G+V+DP+VFHES LAGGIAKL LG+ALKEG P+S
Sbjct  359   AGPLAGFTMGLILLLLGFVLPPVDGTGIVIDPAVFHESFLAGGIAKLFLGNALKEGAPLS  418

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDV  433
             +NPLVLW+ +GLL+NA+NSIPAGELDGGRISF+IWGRK S RLS  ++ LLGIS+LF+DV
Sbjct  419   INPLVLWAWSGLLVNALNSIPAGELDGGRISFAIWGRKASTRLSGIALALLGISSLFNDV  478

Query  432   AFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             AFYW VLIF LQRGPIAPLSEEIT+P+N+Y+ LGIAVLLLGLLVCLPYPFPFN E
Sbjct  479   AFYWTVLIFFLQRGPIAPLSEEITEPENRYVGLGIAVLLLGLLVCLPYPFPFNTE  533



>ref|XP_007141780.1| hypothetical protein PHAVU_008G225100g [Phaseolus vulgaris]
 gb|ESW13774.1| hypothetical protein PHAVU_008G225100g [Phaseolus vulgaris]
Length=434

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/401 (79%), Positives = 363/401 (91%), Gaps = 0/401 (0%)
 Frame = -1

Query  1464  NEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVL  1285
              ++ D  ++ASGSPLPG+KPQ+LDEAI+IPKE I+IL++QVFGFDTFFVTSQ+PYEGGVL
Sbjct  31    KQNVDSDEVASGSPLPGVKPQKLDEAIQIPKEAIEILRNQVFGFDTFFVTSQDPYEGGVL  90

Query  1284  FKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPE  1105
             FKGNLRGQAA+SY+KISKR++D+FGD YKLFLL+NPEDDKPVAVVVPR TLQP+TTAVPE
Sbjct  91    FKGNLRGQAAKSYDKISKRLKDKFGDEYKLFLLVNPEDDKPVAVVVPRTTLQPETTAVPE  150

Query  1104  WFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTL  925
             WFAAGAFGLVT+FTLL+RNVPALQ++LLS FDN +LL++GL GALVTALILGVHE+ H L
Sbjct  151   WFAAGAFGLVTVFTLLIRNVPALQSDLLSAFDNLNLLKDGLSGALVTALILGVHELGHFL  210

Query  924   VAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillll  745
              A+  G+KLGVPYFVPSWQIGSFGAITRI NIVP REDLLK AAAGP+AG+ LG +LLLL
Sbjct  211   AAKDCGVKLGVPYFVPSWQIGSFGAITRIRNIVPNREDLLKVAAAGPIAGYCLGLLLLLL  270

Query  744   gfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINA  565
             GF LPP+DG+GVVVD SVFHES LAGGIAKLLLG+ LKEGT IS+NPLV+W+ AGLLINA
Sbjct  271   GFVLPPSDGIGVVVDASVFHESFLAGGIAKLLLGNVLKEGTAISINPLVIWAWAGLLINA  330

Query  564   INSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPI  385
             INSIPAGELDGGRISF++WGRK S R++  SI LLG+S+L +DVAFYWVVLIF LQRGPI
Sbjct  331   INSIPAGELDGGRISFALWGRKASLRITGVSIALLGLSSLLNDVAFYWVVLIFFLQRGPI  390

Query  384   APLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             APLSEEITDP  KY+A+GI VLLLGLLVCLPYPFPF +E +
Sbjct  391   APLSEEITDPGEKYVAIGIIVLLLGLLVCLPYPFPFTDETL  431



>ref|XP_010095087.1| hypothetical protein L484_026396 [Morus notabilis]
 gb|EXB58193.1| hypothetical protein L484_026396 [Morus notabilis]
Length=587

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/501 (68%), Positives = 409/501 (82%), Gaps = 14/501 (3%)
 Frame = -1

Query  1848  AIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRDVICSFSA  1669
             A+  GN +     SSC  LRFQP L+     R K+    +    R+A + KR+V    + 
Sbjct  5     AVLCGNYISSSPSSSCCDLRFQPYLAPPTGVRLKRRRH-SSSSFRYA-SRKREVDRRVTE  62

Query  1668  SETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDLVNGNS  1489
             ++T+PD N   + + +E++  +  +          ++ A  DN  +   L ++ + +   
Sbjct  63    TQTDPDSNNNEDEEGNEDDEQAQPSTDF-------SAQAQDDNHVDPKPLAAEQIDD---  112

Query  1488  VNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQ  1309
              NV A+T + +A+++++ SGSPLPG+KPQQLDE+I IPKETI+ILK+QVFGFDTFFVTSQ
Sbjct  113   -NV-AETNSHEAENVEVTSGSPLPGVKPQQLDESIIIPKETIEILKNQVFGFDTFFVTSQ  170

Query  1308  EPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQ  1129
             EPYE GVLFKGNLRG+ A+SYEKI++RM+D+FG+ YKLFLL+NPEDD+PVAVVVPR TLQ
Sbjct  171   EPYELGVLFKGNLRGEPAKSYEKITRRMEDQFGNQYKLFLLVNPEDDRPVAVVVPRKTLQ  230

Query  1128  PDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILG  949
             P+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN DLL+NG  GALV  LILG
Sbjct  231   PETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLDLLKNGASGALVMGLILG  290

Query  948   VHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfs  769
             VHE+SH LVA+ + +KLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK AAAGPLAGFS
Sbjct  291   VHELSHILVAKSSDVKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKVAAAGPLAGFS  350

Query  768   lgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWS  589
             LG +LLLLGFFLPPADGLGVV+D SVFHESLLAGGIAKLLLGD LKEGTP+SVNPLV+W+
Sbjct  351   LGLVLLLLGFFLPPADGLGVVIDSSVFHESLLAGGIAKLLLGDVLKEGTPLSVNPLVIWA  410

Query  588   LAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLI  409
              AGLLINAINSIPAGELDGGRI+F+IWGRKTS R ++A+IG+LG+SA+F+DVAFYWVVLI
Sbjct  411   WAGLLINAINSIPAGELDGGRIAFAIWGRKTSVRFTAAAIGMLGLSAIFNDVAFYWVVLI  470

Query  408   FVLQRGPIAPLSEEITDPDNK  346
             FVLQRGPIAPLSEEITDPDNK
Sbjct  471   FVLQRGPIAPLSEEITDPDNK  491



>ref|XP_011043011.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Populus euphratica]
Length=541

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/544 (65%), Positives = 419/544 (77%), Gaps = 22/544 (4%)
 Frame = -1

Query  1869  IFTMSFPAIFRGNVVPLL--QCSSC-SHLRFQPLLSCTGI----ARQKQIDFPTKHLLRF  1711
             +  MS  A FRGN   LL  Q S C    R + +L+ + +     R +  DF    +  F
Sbjct  1     MLKMSVSATFRGNFSSLLIPQSSYCPCDYRPRHILASSSVISWRKRCRTRDFKLYQVSEF  60

Query  1710  AFNMKRDVI-CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQ  1534
                 KR++I C  + +E EPD +  + ++    E                +S+   D+  
Sbjct  61    C--EKREIIVCRAAETEIEPDNSNNDNKEKEVHEGGEEHPTI--------DSVGQTDDQP  110

Query  1533  NFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDIL  1354
             +    +   L   N   +    G ++ADD ++ SGSPLPG+KPQQLDE+IRIPKETIDIL
Sbjct  111   DS---QPTILNQINGGEITTGGGTQEADD-EVVSGSPLPGVKPQQLDESIRIPKETIDIL  166

Query  1353  KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPE  1174
             ++QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA+SYEK++ RMQ++FGD YK+FLL+NPE
Sbjct  167   RNQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAKSYEKLTNRMQNKFGDEYKIFLLVNPE  226

Query  1173  DDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLL  994
             DDKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVPALQ+N+LS FDN  LL
Sbjct  227   DDKPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPALQSNILSTFDNPQLL  286

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
              +GLPGALVTAL+LG HE+SH LVA+   +KLGVPYFVPSWQIGSFGAITRI +IVPKRE
Sbjct  287   MDGLPGALVTALVLGAHELSHILVAKSNEVKLGVPYFVPSWQIGSFGAITRITSIVPKRE  346

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              LLK A AGPLAGFSLG +L LLGF LPP+DG+G+VVD SVFHES LAGGIAKLLLGD L
Sbjct  347   VLLKVAVAGPLAGFSLGLVLFLLGFILPPSDGIGLVVDASVFHESFLAGGIAKLLLGDVL  406

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
             KEGTPISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR +  SI LLG+
Sbjct  407   KEGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTGFSIVLLGL  466

Query  453   saLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN  274
             S+L +DVAFYWVVLIF LQRGPI+P+SEEI+DP+NKY+ALG+ VL+LGLLVCLPYPFPF 
Sbjct  467   SSLLNDVAFYWVVLIFFLQRGPISPVSEEISDPENKYVALGLLVLVLGLLVCLPYPFPFT  526

Query  273   NEAV  262
             +E V
Sbjct  527   DETV  530



>emb|CDY11338.1| BnaA03g01740D [Brassica napus]
Length=545

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/546 (63%), Positives = 420/546 (77%), Gaps = 15/546 (3%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSS--CSHLRFQPLLSCTGIARQKQIDFP-TKHLLRFAFNMKRD  1690
             M+  A FR N   L QC S  CS L+FQPL++ + +   ++  +   K L  F    KR+
Sbjct  1     MNLAASFRCNYGVLPQCCSSRCS-LQFQPLVATSSLGFGQRDSYRRNKELKLFPVQRKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsas--adtsEPNSLADQDNG---QNFG  1525
               C  + ++TEPD N + E    ++E  +    S +   +     ++ D+  G   +N  
Sbjct  60    TFCRVTDAQTEPDGNNDEESGGEDKEALADEPPSQTPPTELLSEATVVDEAVGSSEENKA  119

Query  1524  MLESKDLVNGNSVNVNAQT---GNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDIL  1354
                S+D   G+ + V+  +   G  D D +++++GSPLPG+ P QLD+++R+PKETIDIL
Sbjct  120   QFSSQD---GDKLEVSTGSPLPGVNDGDKLEVSTGSPLPGVNPLQLDDSMRLPKETIDIL  176

Query  1353  KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPE  1174
             KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  R++++FGD YKLFLL NPE
Sbjct  177   KDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRLENKFGDQYKLFLLSNPE  236

Query  1173  DDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLL  994
             DDKPVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL
Sbjct  237   DDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELL  296

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
             ++GLPGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIVPKRE
Sbjct  297   KDGLPGALVTALVLGVHELGHVLVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVPKRE  356

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
             DLLK AAAGPLAGFSLGF+L L+G  +PP+DG+GVVVD SVFHES L GGIAKLLLGD L
Sbjct  357   DLLKVAAAGPLAGFSLGFVLFLVGLVVPPSDGIGVVVDSSVFHESFLVGGIAKLLLGDVL  416

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
             KEGT IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+FSIWGRK S RL+S S+ LLG+
Sbjct  417   KEGTSISLNPLVIWAWAGLLINGINSIPAGELDGGKIAFSIWGRKASTRLTSVSLALLGL  476

Query  453   saLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN  274
             SALFSDVAFYWVVLIF LQRGPIAPL+EEIT+P+ K + LGI VL L LLVCLPYPF F 
Sbjct  477   SALFSDVAFYWVVLIFFLQRGPIAPLAEEITEPEEKDVYLGILVLFLSLLVCLPYPFAFT  536

Query  273   NEAVMV  256
              +  M+
Sbjct  537   GQDAMM  542



>ref|XP_011043151.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X4 [Populus euphratica]
Length=426

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/401 (80%), Positives = 365/401 (91%), Gaps = 1/401 (0%)
 Frame = -1

Query  1464  NEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVL  1285
              ++ADD ++ SGSPLPG+KPQQLDE+IRIPKETIDIL++QVFGFDTFFVTSQEPYEGGVL
Sbjct  16    KQEADD-EVVSGSPLPGVKPQQLDESIRIPKETIDILRNQVFGFDTFFVTSQEPYEGGVL  74

Query  1284  FKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPE  1105
             FKGNLRGQAA+SYEK++ RMQ++FGD YK+FLL+NPEDDKPVAVVVPR TLQP+TTAVPE
Sbjct  75    FKGNLRGQAAKSYEKLTNRMQNKFGDEYKIFLLVNPEDDKPVAVVVPRKTLQPETTAVPE  134

Query  1104  WFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTL  925
             WFAAGAFGLVTIFTLLLRNVPALQ+N+LS FDN  LL +GLPGALVTAL+LG HE+SH L
Sbjct  135   WFAAGAFGLVTIFTLLLRNVPALQSNILSTFDNPQLLMDGLPGALVTALVLGAHELSHIL  194

Query  924   VAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillll  745
             VA+   +KLGVPYFVPSWQIGSFGAITRI +IVPKRE LLK A AGPLAGFSLG +L LL
Sbjct  195   VAKSNEVKLGVPYFVPSWQIGSFGAITRITSIVPKREVLLKVAVAGPLAGFSLGLVLFLL  254

Query  744   gfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINA  565
             GF LPP+DG+G+VVD SVFHES LAGGIAKLLLGD LKEGTPISVNPLV+W+ AGLLINA
Sbjct  255   GFILPPSDGIGLVVDASVFHESFLAGGIAKLLLGDVLKEGTPISVNPLVIWAWAGLLINA  314

Query  564   INSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPI  385
             INSIPAGELDGGRISF+IWGRK SAR +  SI LLG+S+L +DVAFYWVVLIF LQRGPI
Sbjct  315   INSIPAGELDGGRISFAIWGRKASARFTGFSIVLLGLSSLLNDVAFYWVVLIFFLQRGPI  374

Query  384   APLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             +P+SEEI+DP+NKY+ALG+ VL+LGLLVCLPYPFPF +E V
Sbjct  375   SPVSEEISDPENKYVALGLLVLVLGLLVCLPYPFPFTDETV  415



>ref|XP_003544103.1| PREDICTED: uncharacterized protein LOC100816506 [Glycine max]
Length=520

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/536 (65%), Positives = 420/536 (78%), Gaps = 22/536 (4%)
 Frame = -1

Query  1866  FTMSFPAIFRGNV-VPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
              +++ P+ FRGN+ VPL +C+SC  L  +  +  +   R  +  + +  L+R   N +R 
Sbjct  3     LSLAAPSSFRGNLLVPLSRCTSCLELDLR--IQHSEGFRHLRPRWSSFKLIR---NPRRR  57

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
             VI   + S TEP    + + K  ++   +   + +S  +  P   A+Q N       E  
Sbjct  58    VI---ACSVTEPHNGSDEKEKEADKNGETLPLEDSSEQSIPPPVDAEQIN-------EFS  107

Query  1509  DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFD  1330
             D   G S   N    NE      +ASGSPLPG+KPQ+LDEAI+IPKETI+ILK+QVFGFD
Sbjct  108   DENKGQSDVQNMDDSNE------VASGSPLPGVKPQKLDEAIKIPKETIEILKNQVFGFD  161

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVTSQ+PYEGGVLFKGNLRGQAA+SY+KISKR++D+FGD YKLFLL+NPED+ PVAVV
Sbjct  162   TFFVTSQDPYEGGVLFKGNLRGQAAKSYDKISKRLKDKFGDEYKLFLLVNPEDNMPVAVV  221

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGAL  970
             VPR TLQP+TTAVPEWFAAG+FGLVT+FTLLLRNVP+LQ++LLS FDN +LL++GLPGAL
Sbjct  222   VPRTTLQPETTAVPEWFAAGSFGLVTVFTLLLRNVPSLQSDLLSTFDNLNLLKDGLPGAL  281

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             VTALILGVHE+ H L A+  G+KLGVPYFVPSWQIGSFGAITRI NIVP REDLLK AAA
Sbjct  282   VTALILGVHELGHFLAAKDTGVKLGVPYFVPSWQIGSFGAITRIRNIVPNREDLLKVAAA  341

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             GP+AG++LG +LLLLGF LPP+DG+GVVVD SVFHES LAGGIAKLLLG+ LKEGT IS+
Sbjct  342   GPIAGYALGLLLLLLGFILPPSDGIGVVVDASVFHESFLAGGIAKLLLGNVLKEGTAISI  401

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             NPLV+W+ AGLLINAINSIPAGELDGGRISF++WGRK S R +  SI LLG+S+L +DVA
Sbjct  402   NPLVIWAWAGLLINAINSIPAGELDGGRISFALWGRKASLRFTGVSIALLGVSSLLNDVA  461

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             FYWVVLIF LQRGPIAPLSEEITDP  KY+A+G+ VLLLGLLVCLPYPFPF  E +
Sbjct  462   FYWVVLIFFLQRGPIAPLSEEITDPGEKYVAIGVTVLLLGLLVCLPYPFPFTEETL  517



>ref|XP_010552872.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc metalloprotease 
EGY2, chloroplastic [Tarenaya hassleriana]
Length=517

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/539 (65%), Positives = 409/539 (76%), Gaps = 29/539 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPT-KHLLRFAFNMKRDVI  1684
             M+  A FRG+V  L QCS C  ++FQP ++ T      Q   P  K+L  F  +  R+VI
Sbjct  1     MNLAAGFRGSVGILSQCSLCCGIKFQPFVAATSHLDFVQTRNPRRKNLKLFRIHRNREVI  60

Query  1683  CSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK--  1510
             C  + ++TEPD                   ++   +  +  + AD    QN   L  +  
Sbjct  61    CRATDTQTEPD------------------GNNDKENAEDKEASADDSPSQNTTDLNPQPT  102

Query  1509  --DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFG  1336
               D    N V   AQ   +D D+++++SGSPLPG+ PQQLDE++RIPK+TIDILKDQVFG
Sbjct  103   VVDETMSNEVENKAQASFQDGDNLEVSSGSPLPGVNPQQLDESMRIPKQTIDILKDQVFG  162

Query  1335  FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVA  1156
             FDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  RM+++FGD YK+FLL+N EDDKPVA
Sbjct  163   FDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKTRMENKFGDQYKVFLLVNLEDDKPVA  222

Query  1155  VVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPG  976
             VVVP++TLQP+TTAVPEWFAAGAFG VT+FTLLLRNVP LQ+NLLS FDN +LL  GL G
Sbjct  223   VVVPKVTLQPETTAVPEWFAAGAFGTVTLFTLLLRNVPVLQSNLLSTFDNLNLLSEGLSG  282

Query  975   ALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFA  796
             ALVTALILG HE++H LVA  AGIKLGVPYFVPSWQIGSFGAITRI NIVPKREDLLK A
Sbjct  283   ALVTALILGAHELAHVLVANNAGIKLGVPYFVPSWQIGSFGAITRIRNIVPKREDLLKVA  342

Query  795   AAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPI  616
             AAGPLAGFSLG  L LLGF +PPADGLGVVVDPSVFHESLL GGIAK+LLGD LKEG+PI
Sbjct  343   AAGPLAGFSLGLALFLLGFIIPPADGLGVVVDPSVFHESLLVGGIAKVLLGDVLKEGSPI  402

Query  615   SVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSD  436
             SVNPLV+W       NAINSIPAGELDGGRI+FSIWGRKTS RL+  SI +LG+++LF+D
Sbjct  403   SVNPLVIWX------NAINSIPAGELDGGRIAFSIWGRKTSTRLTGLSIVVLGLASLFND  456

Query  435   VAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVM  259
             VAFYWV LIF LQRGPIAPL EEITDP  + +ALG+ VLLL LLVCLPYP PF  +AV+
Sbjct  457   VAFYWVFLIFFLQRGPIAPLEEEITDPRPRSVALGVGVLLLALLVCLPYPLPFAADAVI  515



>ref|NP_196193.1| S2P-like putative metalloprotease [Arabidopsis thaliana]
 sp|Q9FFK3.1|EGY2_ARATH RecName: Full=Probable zinc metalloprotease EGY2, chloroplastic; 
AltName: Full=Protein ETHYLENE-DEPENDENT GRAVITROPISM-DEFICIENT 
AND YELLOW-GREEN 2; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09668.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED90918.1| S2P-like putative metalloprotease [Arabidopsis thaliana]
Length=556

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/569 (61%), Positives = 418/569 (73%), Gaps = 58/569 (10%)
 Frame = -1

Query  1848  AIFRGNVVPLLQCSSCSHLRFQPLLSCT--------GIARQKQIDFPTKHLLRFAFNMKR  1693
             A FRGN   L QCSSC  L+FQP ++ T        G +R+K+ D   + + R     KR
Sbjct  6     ASFRGNFGVLSQCSSCCSLQFQPFVAATSSLNFGQTGTSRRKK-DLKLERVFR-----KR  59

Query  1692  DVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLES  1513
             + +   + ++TEP+            ++        S+    P  +  + N Q+  + E+
Sbjct  60    ETLVRVTETQTEPE----------GNDDEDNKEGKESSADDPPTKIPTELNSQSTVVNEA  109

Query  1512  KDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGL--------------------------  1411
                  GN     AQ  ++D D ++++SGSPLPG+                          
Sbjct  110   P----GNEEENKAQFSSQDGDKLEVSSGSPLPGVNVSIIIHVIYKDDSIMFSGCLSFIKS  165

Query  1410  ---KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEK  1240
                +P QLD+++R+PKETIDIL+ QVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A SYEK
Sbjct  166   CCEQPLQLDDSMRLPKETIDILRGQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPATSYEK  225

Query  1239  ISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTL  1060
             I  RM++ FGD YKLFLL NPEDDKPVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL
Sbjct  226   IKTRMENNFGDQYKLFLLTNPEDDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTL  285

Query  1059  LLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFV  880
              LRNVPALQ++LLS FDN +LL++GLPGALVTAL+LGVHE+ H LVA   GIKLGVP+FV
Sbjct  286   FLRNVPALQSDLLSAFDNLELLKDGLPGALVTALVLGVHELGHILVANSLGIKLGVPFFV  345

Query  879   PSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVD  700
             PSWQIGSFGAITRI NIV KREDLLK AAAGPLAGFSLG IL L+G F+PP+DG+GVVVD
Sbjct  346   PSWQIGSFGAITRIKNIVAKREDLLKVAAAGPLAGFSLGLILFLIGLFVPPSDGIGVVVD  405

Query  699   PSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRIS  520
              SVFHES LAGGIAKLLLGDALKEGT IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+
Sbjct  406   ASVFHESFLAGGIAKLLLGDALKEGTSISLNPLVIWAWAGLLINGINSIPAGELDGGKIA  465

Query  519   FSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYi  340
             FSIWGRKT+ RL+ ASI LLG+SALFSDVAFYWVVLIF LQRGPIAPL+EEIT PD+KY+
Sbjct  466   FSIWGRKTATRLTGASIALLGLSALFSDVAFYWVVLIFFLQRGPIAPLAEEITVPDDKYV  525

Query  339   algiavlllgllVCLPYPFPFN-NEAVMV  256
             +LGI VL L LLVCLPYPF F  NEA+M+
Sbjct  526   SLGILVLFLSLLVCLPYPFAFTGNEAMMI  554



>ref|XP_002311209.2| hypothetical protein POPTR_0008s06640g [Populus trichocarpa]
 gb|EEE88576.2| hypothetical protein POPTR_0008s06640g [Populus trichocarpa]
Length=541

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/543 (64%), Positives = 416/543 (77%), Gaps = 20/543 (4%)
 Frame = -1

Query  1869  IFTMSFPAIFRGNVVPLL--QCSSC-SHLRFQPLLSCTGI----ARQKQIDFPTKHLLRF  1711
             +  MS  A FRGN   LL  Q S C    R + +L+ + +     R +  DF    +  F
Sbjct  1     MLKMSVSATFRGNFSSLLIPQSSYCPCDYRPRHILASSSVISWRKRCRTRDFKLYQVSEF  60

Query  1710  AFNMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQN  1531
                 +  ++C  + +E EPD +  + ++    E                +S+   D+  +
Sbjct  61    C-ERREIIVCRAAETEIEPDNSNNDNKEKEVHEGGEEHPTI--------DSVGQTDDQPD  111

Query  1530  FGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILK  1351
                 +   L   N   +    G ++ADD ++ SGSPLPG+KPQQLDE+IRIPKETIDIL+
Sbjct  112   S---QPTILNQINGGEITTGGGTQEADD-EVVSGSPLPGVKPQQLDESIRIPKETIDILR  167

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
             +QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA+SYEK++ RMQ++ GD YK+FLL+NPED
Sbjct  168   NQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAKSYEKLTNRMQNKLGDEYKIFLLVNPED  227

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLE  991
             DKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVPALQ+NLLS FDN +LL 
Sbjct  228   DKPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPALQSNLLSTFDNPELLM  287

Query  990   NGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRED  811
             +GLPGALVTAL+LG HE+SH LVA+   +KLGVPYFVPSWQIGSFGAITRI +IVPKRE 
Sbjct  288   DGLPGALVTALVLGAHELSHILVAKSNEVKLGVPYFVPSWQIGSFGAITRITSIVPKREV  347

Query  810   LLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLK  631
             LLK A AGPLAGFSLG +L LLGF LPP DG+G+VVD SVFHES LAGGIAKLLLGD LK
Sbjct  348   LLKVAVAGPLAGFSLGLVLFLLGFILPPRDGIGLVVDASVFHESFLAGGIAKLLLGDVLK  407

Query  630   EGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgis  451
             EGTPISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK SAR +  SI LLG+S
Sbjct  408   EGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASARFTGFSIVLLGLS  467

Query  450   aLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNN  271
             +L +DVAF+WVVLIF LQRGPI+P+SEEI+DP+NKY+ALG+ VL+LGLLVCLPYPFPF +
Sbjct  468   SLLNDVAFFWVVLIFFLQRGPISPVSEEISDPENKYVALGLLVLVLGLLVCLPYPFPFTD  527

Query  270   EAV  262
             E V
Sbjct  528   ETV  530



>ref|XP_011042934.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Populus euphratica]
Length=565

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/557 (64%), Positives = 422/557 (76%), Gaps = 24/557 (4%)
 Frame = -1

Query  1869  IFTMSFPAIFRGNVVPLL--QCSSC-SHLRFQPLLSCTGI----ARQKQIDFPTKHLLRF  1711
             +  MS  A FRGN   LL  Q S C    R + +L+ + +     R +  DF    +  F
Sbjct  1     MLKMSVSATFRGNFSSLLIPQSSYCPCDYRPRHILASSSVISWRKRCRTRDFKLYQVSEF  60

Query  1710  AFNMKRDVI-CSFSASETEPDRneenerklheeenssgsadsasadts--EPNSLADQDN  1540
                 KR++I C  + +E EPD +  + ++    E         S   +  +P+S     N
Sbjct  61    C--EKREIIVCRAAETEIEPDNSNNDNKEKEVHEGGEEHPTIDSVGQTDDQPDSQPTILN  118

Query  1539  GQNFGMLESKDLVNGNSVNVNAQTGN-----------EDADDIQIASGSPLPGLKPQQLD  1393
               N G + +      N    N    +           ++ADD ++ SGSPLPG+KPQQLD
Sbjct  119   QINGGEITTGGGTQLNETIYNGWPQHPVAIQISLCLKQEADD-EVVSGSPLPGVKPQQLD  177

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E+IRIPKETIDIL++QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA+SYEK++ RMQ++F
Sbjct  178   ESIRIPKETIDILRNQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAKSYEKLTNRMQNKF  237

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD YK+FLL+NPEDDKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVPALQ
Sbjct  238   GDEYKIFLLVNPEDDKPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  297

Query  1032  ANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
             +N+LS FDN  LL +GLPGALVTAL+LG HE+SH LVA+   +KLGVPYFVPSWQIGSFG
Sbjct  298   SNILSTFDNPQLLMDGLPGALVTALVLGAHELSHILVAKSNEVKLGVPYFVPSWQIGSFG  357

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITRI +IVPKRE LLK A AGPLAGFSLG +L LLGF LPP+DG+G+VVD SVFHES L
Sbjct  358   AITRITSIVPKREVLLKVAVAGPLAGFSLGLVLFLLGFILPPSDGIGLVVDASVFHESFL  417

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
             AGGIAKLLLGD LKEGTPISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK S
Sbjct  418   AGGIAKLLLGDVLKEGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKAS  477

Query  492   ARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlll  313
             AR +  SI LLG+S+L +DVAFYWVVLIF LQRGPI+P+SEEI+DP+NKY+ALG+ VL+L
Sbjct  478   ARFTGFSIVLLGLSSLLNDVAFYWVVLIFFLQRGPISPVSEEISDPENKYVALGLLVLVL  537

Query  312   gllVCLPYPFPFNNEAV  262
             GLLVCLPYPFPF +E V
Sbjct  538   GLLVCLPYPFPFTDETV  554



>tpg|DAA53531.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
Length=443

 Score =   533 bits (1372),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 318/427 (74%), Positives = 370/427 (87%), Gaps = 2/427 (0%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K QQLD+++RIP
Sbjct  7     DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK-QQLDDSVRIP  65

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  66    KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  125

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPED+KPVAVV+P+ TLQP+TTAVPEWFAA AFGLVTIFTLLLRNVP LQ NLLS 
Sbjct  126   FLLINPEDEKPVAVVIPKQTLQPETTAVPEWFAAAAFGLVTIFTLLLRNVPVLQENLLST  185

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN +LL++GL GALVT LI+GVHEI H L A+++GIKLGVPYFVPSWQIGSFG ITRI+
Sbjct  186   FDNLELLKDGLSGALVTGLIIGVHEIGHILAARESGIKLGVPYFVPSWQIGSFGGITRIV  245

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L GG+AK
Sbjct  246   NIVRNREDLLKLAAAGPLAGFSLGFVLLLLGFVLPPSDGLGLVIDPTVFHESFLVGGLAK  305

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLGD LKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+ ++WGRK S+R+SS 
Sbjct  306   LLLGDVLKEGTQLSINPLVLWAWAGLLINAINSIPAGELDGGRIALAMWGRKVSSRISSL  365

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             +IGLLG++ALF+DVAFYWVVLIF LQRGPIAPLSEEITDP+N YI +G A+LL GLLVCL
Sbjct  366   AIGLLGVAALFNDVAFYWVVLIFFLQRGPIAPLSEEITDPENSYIGIGAAILLFGLLVCL  425

Query  294   PYPFPFN  274
             PYPFPF+
Sbjct  426   PYPFPFD  432



>ref|XP_002873222.1| peptidase M50 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49481.1| peptidase M50 family protein [Arabidopsis lyrata subsp. lyrata]
Length=558

 Score =   536 bits (1382),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 348/563 (62%), Positives = 417/563 (74%), Gaps = 44/563 (8%)
 Frame = -1

Query  1848  AIFRGNVVPLLQCSSCSHLRFQPLLSCTGIAR--QKQIDFPTKHLLRFAFNMKRDVICSF  1675
             A FRGN   L QCSS   L+FQP ++ T      Q +     K+L       KR+ +   
Sbjct  6     ASFRGNFGVLSQCSSYCSLQFQPFVAATSSLNFGQTRTSRRKKNLKLERVFRKRETLVRV  65

Query  1674  SASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKDLVNG  1495
             + ++TEP+         + +E+++G     ++    P  +  + N Q+  + E+     G
Sbjct  66    TETQTEPE--------GNNDEDNNGEEGKETSADDPPTQIPTELNSQSTIVNEAP----G  113

Query  1494  NSVNVNAQTGNEDADDIQIASGSPLPGL-----------------------------KPQ  1402
             N     AQ  ++D D ++++SGSPLPG+                             +P 
Sbjct  114   NEEENKAQLSSQDGDKLEVSSGSPLPGVNVSITNNVKYKGDSLMLSIYLSFIKSCCEQPL  173

Query  1401  QLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQ  1222
             QLD+++R+PKETIDIL+ QVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI  RM+
Sbjct  174   QLDDSMRLPKETIDILRGQVFGFDTFFVTSQEPYEGGVLFKGNLRGEPAKSYEKIKTRME  233

Query  1221  DRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVP  1042
             + FGD YKLFLL NPEDDKPVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LRNVP
Sbjct  234   NNFGDQYKLFLLSNPEDDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLRNVP  293

Query  1041  ALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             ALQ++LLS FDN +LL++GLPGALVT L+LGVHE+ H LVA   GIKLGVP+FVPSWQIG
Sbjct  294   ALQSDLLSAFDNLELLKDGLPGALVTTLVLGVHELGHILVANSLGIKLGVPFFVPSWQIG  353

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFGAITRI NIV KREDLLK AAAGPLAGFSLG IL LLG F+PP+DG+GVVVD SVFHE
Sbjct  354   SFGAITRIKNIVAKREDLLKVAAAGPLAGFSLGLILFLLGLFVPPSDGIGVVVDASVFHE  413

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
             S LAGGIAKLLLGDALKEGT IS+NPLV+W+ AGLLIN INSIPAGELDGGRI+FSIWGR
Sbjct  414   SFLAGGIAKLLLGDALKEGTSISLNPLVIWAWAGLLINGINSIPAGELDGGRIAFSIWGR  473

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiav  322
             KT+ RL+ ASI LLG+SALFSDVAFYWVVLIF LQRGPIAPL+EEIT PD+KY++LGI V
Sbjct  474   KTATRLTGASIALLGLSALFSDVAFYWVVLIFFLQRGPIAPLAEEITAPDDKYVSLGILV  533

Query  321   lllgllVCLPYPFPFN-NEAVMV  256
             L L LLVCLPYPF F  NEA+M+
Sbjct  534   LFLSLLVCLPYPFAFTGNEAMMI  556



>ref|XP_004490978.1| PREDICTED: uncharacterized protein LOC101500172 [Cicer arietinum]
Length=514

 Score =   534 bits (1375),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 340/539 (63%), Positives = 411/539 (76%), Gaps = 32/539 (6%)
 Frame = -1

Query  1869  IFTMSFPAIFRGN-VVPLLQCSSCSH--LRFQPLLSCTGIARQKQIDFPTKHLLRFAFNM  1699
             I ++  P+ F  N V+PL +C+SC    L FQP    T            K +       
Sbjct  2     ILSLPSPSTFPANFVLPLSRCTSCFQFDLPFQPSNRFTSF----------KWIRNARSTG  51

Query  1698  KRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGML  1519
             +R + CS S    + +  +E  +                       SL D     N   +
Sbjct  52    RRRIACSMSEPNGDNEEEKEAHKNGET------------------QSLEDSFEQSNPPTV  93

Query  1518  ESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVF  1339
             +++ L   +  N + QT  ++ D+I++ SGSPLPG+K QQL + I++PKETIDILK+QVF
Sbjct  94    DAEQLNKFSDENTD-QTDVQNTDNIEVTSGSPLPGVKLQQLGDVIKLPKETIDILKNQVF  152

Query  1338  GFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPV  1159
             GFDTFFVTSQ+PYEGGVLFKGNLRG+A++SY+KISKR+QD+FGD Y+LFLL+NPEDDKPV
Sbjct  153   GFDTFFVTSQDPYEGGVLFKGNLRGKASKSYDKISKRLQDKFGDTYRLFLLVNPEDDKPV  212

Query  1158  AVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLP  979
             AVVVPR TLQP+TTAVPEWFAAG+FGLVT+FTLLLRNVP LQ++LLS  DN +LL++GLP
Sbjct  213   AVVVPRTTLQPETTAVPEWFAAGSFGLVTVFTLLLRNVPTLQSDLLSTVDNLNLLKDGLP  272

Query  978   GALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKF  799
             GALVTALILGVHE+ H LVAQ  G+KLGVPYFVPSWQIGSFG+ITRI +IV  REDLLK 
Sbjct  273   GALVTALILGVHELGHFLVAQNTGVKLGVPYFVPSWQIGSFGSITRIRSIVSNREDLLKV  332

Query  798   AAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTP  619
             AAAGP+AGF++G +LLLLGF +PP+DG+GVVVD SVFHES LAGGIAKLLLG+ LKEG P
Sbjct  333   AAAGPIAGFTVGLVLLLLGFVIPPSDGIGVVVDASVFHESFLAGGIAKLLLGNVLKEGAP  392

Query  618   ISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFS  439
             ISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK S+R +  SI LLG+S+L +
Sbjct  393   ISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRKASSRFTGFSIVLLGLSSLLN  452

Query  438   DVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             DVAFYWV LIF LQRGPIAPLSEEITDPD+KY+ALG+ VLLLGLLVCLPYPFPF +E +
Sbjct  453   DVAFYWVALIFFLQRGPIAPLSEEITDPDDKYVALGVTVLLLGLLVCLPYPFPFIDETL  511



>tpg|DAA53529.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
Length=517

 Score =   533 bits (1373),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 318/427 (74%), Positives = 370/427 (87%), Gaps = 2/427 (0%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K QQLD+++RIP
Sbjct  81    DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK-QQLDDSVRIP  139

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  140   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  199

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPED+KPVAVV+P+ TLQP+TTAVPEWFAA AFGLVTIFTLLLRNVP LQ NLLS 
Sbjct  200   FLLINPEDEKPVAVVIPKQTLQPETTAVPEWFAAAAFGLVTIFTLLLRNVPVLQENLLST  259

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN +LL++GL GALVT LI+GVHEI H L A+++GIKLGVPYFVPSWQIGSFG ITRI+
Sbjct  260   FDNLELLKDGLSGALVTGLIIGVHEIGHILAARESGIKLGVPYFVPSWQIGSFGGITRIV  319

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L GG+AK
Sbjct  320   NIVRNREDLLKLAAAGPLAGFSLGFVLLLLGFVLPPSDGLGLVIDPTVFHESFLVGGLAK  379

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLGD LKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+ ++WGRK S+R+SS 
Sbjct  380   LLLGDVLKEGTQLSINPLVLWAWAGLLINAINSIPAGELDGGRIALAMWGRKVSSRISSL  439

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             +IGLLG++ALF+DVAFYWVVLIF LQRGPIAPLSEEITDP+N YI +G A+LL GLLVCL
Sbjct  440   AIGLLGVAALFNDVAFYWVVLIFFLQRGPIAPLSEEITDPENSYIGIGAAILLFGLLVCL  499

Query  294   PYPFPFN  274
             PYPFPF+
Sbjct  500   PYPFPFD  506



>gb|KDO69039.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=413

 Score =   529 bits (1362),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 314/386 (81%), Positives = 352/386 (91%), Gaps = 0/386 (0%)
 Frame = -1

Query  1419  PGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEK  1240
             P  +PQQLDE IRIPKETIDILKDQVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEK
Sbjct  25    PRCQPQQLDEYIRIPKETIDILKDQVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEK  84

Query  1239  ISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTL  1060
             IS RM+++FGD YKLFLL+NPEDDKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTL
Sbjct  85    ISTRMKNKFGDQYKLFLLVNPEDDKPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTL  144

Query  1059  LLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFV  880
             LLRNVPALQ+NLLS FDN +LL NGLPGALVTAL++GVHE+ H L A+  G++LGVPYFV
Sbjct  145   LLRNVPALQSNLLSTFDNLNLLTNGLPGALVTALVIGVHELGHILAAKSTGVELGVPYFV  204

Query  879   PSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVD  700
             PSWQIGSFGAITRI NIV KREDLLK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD
Sbjct  205   PSWQIGSFGAITRIRNIVSKREDLLKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVD  264

Query  699   PSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRIS  520
              SVFHES LAGG AKLLLGD LK+GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+
Sbjct  265   ASVFHESFLAGGFAKLLLGDVLKDGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIA  324

Query  519   FSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYi  340
             F++WGRK S RL+  SI LLG+S+LFSDV FYWVVL+F LQRGPIAPLSEEITDPD+KYI
Sbjct  325   FALWGRKASTRLTGVSIVLLGLSSLFSDVTFYWVVLVFFLQRGPIAPLSEEITDPDDKYI  384

Query  339   algiavlllgllVCLPYPFPFNNEAV  262
             ALG+ VL LGLLVCLPYPFPF+++AV
Sbjct  385   ALGVLVLFLGLLVCLPYPFPFSDQAV  410



>tpg|DAA53521.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
Length=547

 Score =   533 bits (1374),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 318/427 (74%), Positives = 370/427 (87%), Gaps = 2/427 (0%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K QQLD+++RIP
Sbjct  111   DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK-QQLDDSVRIP  169

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  170   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  229

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPED+KPVAVV+P+ TLQP+TTAVPEWFAA AFGLVTIFTLLLRNVP LQ NLLS 
Sbjct  230   FLLINPEDEKPVAVVIPKQTLQPETTAVPEWFAAAAFGLVTIFTLLLRNVPVLQENLLST  289

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN +LL++GL GALVT LI+GVHEI H L A+++GIKLGVPYFVPSWQIGSFG ITRI+
Sbjct  290   FDNLELLKDGLSGALVTGLIIGVHEIGHILAARESGIKLGVPYFVPSWQIGSFGGITRIV  349

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L GG+AK
Sbjct  350   NIVRNREDLLKLAAAGPLAGFSLGFVLLLLGFVLPPSDGLGLVIDPTVFHESFLVGGLAK  409

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLGD LKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+ ++WGRK S+R+SS 
Sbjct  410   LLLGDVLKEGTQLSINPLVLWAWAGLLINAINSIPAGELDGGRIALAMWGRKVSSRISSL  469

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             +IGLLG++ALF+DVAFYWVVLIF LQRGPIAPLSEEITDP+N YI +G A+LL GLLVCL
Sbjct  470   AIGLLGVAALFNDVAFYWVVLIFFLQRGPIAPLSEEITDPENSYIGIGAAILLFGLLVCL  529

Query  294   PYPFPFN  274
             PYPFPF+
Sbjct  530   PYPFPFD  536



>gb|ACG47154.1| metalloendopeptidase [Zea mays]
 tpg|DAA53523.1| TPA: metalloendopeptidase [Zea mays]
Length=549

 Score =   533 bits (1374),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 318/427 (74%), Positives = 370/427 (87%), Gaps = 2/427 (0%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K QQLD+++RIP
Sbjct  113   DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK-QQLDDSVRIP  171

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  172   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  231

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSV  1015
             FLLINPED+KPVAVV+P+ TLQP+TTAVPEWFAA AFGLVTIFTLLLRNVP LQ NLLS 
Sbjct  232   FLLINPEDEKPVAVVIPKQTLQPETTAVPEWFAAAAFGLVTIFTLLLRNVPVLQENLLST  291

Query  1014  FDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             FDN +LL++GL GALVT LI+GVHEI H L A+++GIKLGVPYFVPSWQIGSFG ITRI+
Sbjct  292   FDNLELLKDGLSGALVTGLIIGVHEIGHILAARESGIKLGVPYFVPSWQIGSFGGITRIV  351

Query  834   NIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiak  655
             NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L GG+AK
Sbjct  352   NIVRNREDLLKLAAAGPLAGFSLGFVLLLLGFVLPPSDGLGLVIDPTVFHESFLVGGLAK  411

Query  654   lllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssa  475
             LLLGD LKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+ ++WGRK S+R+SS 
Sbjct  412   LLLGDVLKEGTQLSINPLVLWAWAGLLINAINSIPAGELDGGRIALAMWGRKVSSRISSL  471

Query  474   sigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCL  295
             +IGLLG++ALF+DVAFYWVVLIF LQRGPIAPLSEEITDP+N YI +G A+LL GLLVCL
Sbjct  472   AIGLLGVAALFNDVAFYWVVLIFFLQRGPIAPLSEEITDPENSYIGIGAAILLFGLLVCL  531

Query  294   PYPFPFN  274
             PYPFPF+
Sbjct  532   PYPFPFD  538



>ref|XP_010491109.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Camelina sativa]
Length=529

 Score =   530 bits (1366),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 324/456 (71%), Positives = 372/456 (82%), Gaps = 19/456 (4%)
 Frame = -1

Query  1566  PNSLADQDNGQNFGMLESKD--------LVNGNSVNVNAQTGNE----------DADDIQ  1441
             P    D+DN    G   S D         +N  S  VN   GNE          D D ++
Sbjct  72    PEGNNDEDNNGEEGKETSADGPPKQIPTELNSQSTVVNEAPGNEEENKTQFKSQDGDKVE  131

Query  1440  IASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQ  1261
             ++SGSPLPG+ P QLD+++R+PKETIDIL+ QVFGFDTFFVTSQEPYEGGVLFKGNLRGQ
Sbjct  132   VSSGSPLPGVNPLQLDDSMRLPKETIDILRGQVFGFDTFFVTSQEPYEGGVLFKGNLRGQ  191

Query  1260  AARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFG  1081
              A+SYEKI  RM++ FGD YKLFLL NPEDDKPVAVVVP+ +L+P+TTAVPEWFAAG+FG
Sbjct  192   PAKSYEKIKTRMENNFGDQYKLFLLTNPEDDKPVAVVVPKRSLEPETTAVPEWFAAGSFG  251

Query  1080  LVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIK  901
             LV +FTL LRNVPALQ++LLS FDN +LL++GLPGALVTAL+LGVHE+ H LVA   GIK
Sbjct  252   LVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPGALVTALVLGVHELGHILVANNLGIK  311

Query  900   LGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppad  721
             LGVP+FVPSWQIGSFGAITRI NIV KREDLLK AAAGPLAGFSLG IL L+G F+PP+D
Sbjct  312   LGVPFFVPSWQIGSFGAITRIKNIVAKREDLLKLAAAGPLAGFSLGLILFLIGLFVPPSD  371

Query  720   glGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGE  541
             G+GVVVD SVFHES L GGIAKLLLGD LK+GT IS+NPLV+W+ AGLLIN INSIPAGE
Sbjct  372   GIGVVVDASVFHESFLVGGIAKLLLGDVLKDGTSISLNPLVIWAWAGLLINGINSIPAGE  431

Query  540   LDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEIT  361
             LDGGRI+F+IWGRKT+ RL+ ASI LLG+SALFSDVAFYWVVLIF LQRGPIAPL+EEIT
Sbjct  432   LDGGRIAFAIWGRKTATRLTGASIALLGLSALFSDVAFYWVVLIFFLQRGPIAPLAEEIT  491

Query  360   DPDNKYialgiavlllgllVCLPYPFPFN-NEAVMV  256
              PD+KY++LGI VL L LLVCLPYPF F   EA+M+
Sbjct  492   TPDDKYVSLGIVVLFLSLLVCLPYPFAFTGGEAMMI  527



>ref|XP_004968164.1| PREDICTED: uncharacterized protein LOC101762864 [Setaria italica]
Length=545

 Score =   530 bits (1366),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 322/428 (75%), Positives = 376/428 (88%), Gaps = 6/428 (1%)
 Frame = -1

Query  1548  QDNGQNFGMLESKDL---VNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRI  1378
             +D   N  +L S D    ++G++   N     E+ + +++ASGSPLPG+K QQLD+A RI
Sbjct  110   KDETTNAELLSSSDAAQNIDGDATTTNDM--QENVEVVEVASGSPLPGMK-QQLDDAERI  166

Query  1377  PKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYK  1198
             PK TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R++++FGD YK
Sbjct  167   PKATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITNRLENKFGDQYK  226

Query  1197  LFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLS  1018
             LFLL+NPED+KPVAVV+PR TLQP+TTAVPEWFAA +FGLVTIFTLLLRNVP LQ NLLS
Sbjct  227   LFLLVNPEDEKPVAVVIPRQTLQPETTAVPEWFAAASFGLVTIFTLLLRNVPVLQDNLLS  286

Query  1017  VFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRI  838
              FDN +LL++GL GALVT LI+GVHEI H L A+++GIKLGVPYFVPSWQIGSFGAITRI
Sbjct  287   TFDNLELLKDGLSGALVTGLIIGVHEIGHILAAKESGIKLGVPYFVPSWQIGSFGAITRI  346

Query  837   LNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggia  658
             +NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+++DP+VFHES L GG+A
Sbjct  347   INIVRNREDLLKLAAAGPLAGFSLGFVLLLLGFILPPSDGLGLIIDPTVFHESFLVGGLA  406

Query  657   klllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlss  478
             KLLLGDALKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+F++WGRK S+RLSS
Sbjct  407   KLLLGDALKEGTQLSINPLVLWAWAGLLINAINSIPAGELDGGRIAFAMWGRKISSRLSS  466

Query  477   asigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVC  298
              +IGLLGI+ALF+DVAFYWVVLIF LQRGPIAPLSEEITDP+N YI +GIAVLL GLL+C
Sbjct  467   LTIGLLGIAALFNDVAFYWVVLIFFLQRGPIAPLSEEITDPENNYIGIGIAVLLFGLLIC  526

Query  297   LPYPFPFN  274
             LPYPFPF+
Sbjct  527   LPYPFPFD  534



>ref|XP_010423434.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Camelina sativa]
Length=528

 Score =   530 bits (1364),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 312/414 (75%), Positives = 358/414 (86%), Gaps = 0/414 (0%)
 Frame = -1

Query  1497  GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFV  1318
             GN      Q  ++D D ++++SGSPLPG+ P QLD+++R+PKETIDIL+ QVFGFDTFFV
Sbjct  112   GNEEENKTQFSSQDGDKLEVSSGSPLPGVNPLQLDDSMRLPKETIDILRGQVFGFDTFFV  171

Query  1317  TSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRI  1138
             TSQEPYEGGVLFKGNLRGQ A+SYEKI  RM++ FGD YKLFLL NPEDDKPVAVVVPR 
Sbjct  172   TSQEPYEGGVLFKGNLRGQPAKSYEKIKTRMENNFGDQYKLFLLTNPEDDKPVAVVVPRR  231

Query  1137  TLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTAL  958
             +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GLPGALVTAL
Sbjct  232   SLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPGALVTAL  291

Query  957   ILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPla  778
             +LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIV KREDLLK AAAGPLA
Sbjct  292   VLGVHELGHILVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVAKREDLLKLAAAGPLA  351

Query  777   gfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLV  598
             GFSLG IL L+G F+PP+DG+GVVVD SVFHES L GGIAKLLLGD LK+GT IS+NPLV
Sbjct  352   GFSLGLILFLIGLFVPPSDGIGVVVDASVFHESFLVGGIAKLLLGDVLKDGTSISLNPLV  411

Query  597   LWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWV  418
             +W+ AGLLIN INSIPAGELDGG+I+FSIWGRKT+ RL+ ASI LLG+SALFSDVAFYWV
Sbjct  412   IWAWAGLLINGINSIPAGELDGGKIAFSIWGRKTATRLTGASIALLGLSALFSDVAFYWV  471

Query  417   VLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVMV  256
             VLIF LQRGPIAPL+EEIT PD+KY++LGI VL L LLVCLPYPF F     M+
Sbjct  472   VLIFFLQRGPIAPLAEEITTPDDKYVSLGIVVLFLSLLVCLPYPFAFTGGETMM  525



>ref|XP_010452480.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Camelina sativa]
Length=529

 Score =   530 bits (1364),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 312/416 (75%), Positives = 361/416 (87%), Gaps = 1/416 (0%)
 Frame = -1

Query  1497  GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFV  1318
             GN      Q  ++D D ++++SGSPLPG+ P QLD+++R+PKETIDIL+ QVFGFDTFFV
Sbjct  113   GNEEENKTQFSSQDGDKVEVSSGSPLPGVNPLQLDDSMRLPKETIDILRGQVFGFDTFFV  172

Query  1317  TSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRI  1138
             TSQEPYEGGVLFKGNLRGQ A+SYEKI  RM++ FGD YKLFLL NPEDDKPVAVVVPR 
Sbjct  173   TSQEPYEGGVLFKGNLRGQPAKSYEKIKTRMENNFGDQYKLFLLTNPEDDKPVAVVVPRR  232

Query  1137  TLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTAL  958
             +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GLPGALVTAL
Sbjct  233   SLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPGALVTAL  292

Query  957   ILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPla  778
             +LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIV KREDLLK AAAGPLA
Sbjct  293   VLGVHELGHILVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVAKREDLLKLAAAGPLA  352

Query  777   gfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLV  598
             GFSLG +L L+G F+PP+DG+GVVVD SVFHES L GGIAKLLLGD LK+GT IS+NPLV
Sbjct  353   GFSLGLVLFLIGLFVPPSDGIGVVVDASVFHESFLVGGIAKLLLGDVLKDGTSISLNPLV  412

Query  597   LWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWV  418
             +W+ AGLLIN INSIPAGELDGG+I+F+IWGRKT+ RL+ ASI LLG+SALFSDVAFYWV
Sbjct  413   IWAWAGLLINGINSIPAGELDGGKIAFAIWGRKTATRLTGASIALLGLSALFSDVAFYWV  472

Query  417   VLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN-NEAVMVS  253
             VLIF LQRGPIAPL+EEIT PD+KY++LGI VL L LLVCLPYPF F   EA+M+ 
Sbjct  473   VLIFFLQRGPIAPLAEEITTPDDKYVSLGIVVLFLSLLVCLPYPFAFTGGEAMMIG  528



>ref|XP_010423433.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Camelina sativa]
Length=531

 Score =   529 bits (1363),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 312/414 (75%), Positives = 358/414 (86%), Gaps = 0/414 (0%)
 Frame = -1

Query  1497  GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFV  1318
             GN      Q  ++D D ++++SGSPLPG+ P QLD+++R+PKETIDIL+ QVFGFDTFFV
Sbjct  115   GNEEENKTQFSSQDGDKLEVSSGSPLPGVNPLQLDDSMRLPKETIDILRGQVFGFDTFFV  174

Query  1317  TSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRI  1138
             TSQEPYEGGVLFKGNLRGQ A+SYEKI  RM++ FGD YKLFLL NPEDDKPVAVVVPR 
Sbjct  175   TSQEPYEGGVLFKGNLRGQPAKSYEKIKTRMENNFGDQYKLFLLTNPEDDKPVAVVVPRR  234

Query  1137  TLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTAL  958
             +L+P+TTAVPEWFAAG+FGLV +FTL LRNVPALQ++LLS FDN +LL++GLPGALVTAL
Sbjct  235   SLEPETTAVPEWFAAGSFGLVALFTLFLRNVPALQSDLLSAFDNLELLKDGLPGALVTAL  294

Query  957   ILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPla  778
             +LGVHE+ H LVA   GIKLGVP+FVPSWQIGSFGAITRI NIV KREDLLK AAAGPLA
Sbjct  295   VLGVHELGHILVANNLGIKLGVPFFVPSWQIGSFGAITRIKNIVAKREDLLKLAAAGPLA  354

Query  777   gfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLV  598
             GFSLG IL L+G F+PP+DG+GVVVD SVFHES L GGIAKLLLGD LK+GT IS+NPLV
Sbjct  355   GFSLGLILFLIGLFVPPSDGIGVVVDASVFHESFLVGGIAKLLLGDVLKDGTSISLNPLV  414

Query  597   LWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWV  418
             +W+ AGLLIN INSIPAGELDGG+I+FSIWGRKT+ RL+ ASI LLG+SALFSDVAFYWV
Sbjct  415   IWAWAGLLINGINSIPAGELDGGKIAFSIWGRKTATRLTGASIALLGLSALFSDVAFYWV  474

Query  417   VLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAVMV  256
             VLIF LQRGPIAPL+EEIT PD+KY++LGI VL L LLVCLPYPF F     M+
Sbjct  475   VLIFFLQRGPIAPLAEEITTPDDKYVSLGIVVLFLSLLVCLPYPFAFTGGETMM  528



>gb|AES99561.2| M50 family peptidase [Medicago truncatula]
Length=514

 Score =   527 bits (1358),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 337/536 (63%), Positives = 410/536 (76%), Gaps = 38/536 (7%)
 Frame = -1

Query  1851  PAIFRGNVVPLLQCSSCS--HLRFQP----LLSCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
             P+ FR  VVPL  C+SC   +LRF P      SC+      + + PT          +R 
Sbjct  8     PSTFR--VVPLSHCTSCFQFNLRFHPSNRFHNSCSS---SLKFNPPTVR--------RRR  54

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
             + CS + S+ + D  +E  +                       SL D     N   +++ 
Sbjct  55    IACSVNESDGDNDEEKEAHKNGET------------------QSLEDTSEQSNPPPVDAG  96

Query  1509  DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFD  1330
              L      N N Q   ++ D+I++ SGSPLPG+KPQQLD+ I+IPKE I+ILK+QVFGFD
Sbjct  97    QLNKFGDENTN-QNDVQNTDNIEVTSGSPLPGVKPQQLDDVIKIPKEKIEILKNQVFGFD  155

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVTSQ+PYEGGVLFKGNLRGQA++SY+KISKR+QD+FGD Y+LFLL+NPEDDKPVAVV
Sbjct  156   TFFVTSQDPYEGGVLFKGNLRGQASKSYDKISKRLQDKFGDEYRLFLLVNPEDDKPVAVV  215

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGAL  970
             VPR TLQP+TT VPEWF A +FG+VT+FTLLLRNVP LQ++LLS  DN +LL++GLPGAL
Sbjct  216   VPRTTLQPETTPVPEWFGAASFGIVTVFTLLLRNVPNLQSDLLSTVDNLNLLKDGLPGAL  275

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             VTALI+GVHE+ H LVAQ  G+KLGVPYF+PSWQIGSFG+ITRI +IV  REDLLK AAA
Sbjct  276   VTALIIGVHELGHFLVAQNLGVKLGVPYFIPSWQIGSFGSITRIRSIVSNREDLLKIAAA  335

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             GP+AGF+LGF+LLLLGF +PP+DG+GVVVD SVFHES LAGGIAKL LG+ LKEGTPIS+
Sbjct  336   GPIAGFALGFVLLLLGFVIPPSDGIGVVVDASVFHESFLAGGIAKLFLGNVLKEGTPISI  395

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             NPLV+W+ AGLLINAINSIPAGE+DGGRISF+IWGRK S R +  SI LLG+S+L +DVA
Sbjct  396   NPLVIWAWAGLLINAINSIPAGEIDGGRISFAIWGRKASIRFTGFSIVLLGLSSLLNDVA  455

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             FYWVVLIF LQRGPI+PLS+EIT+PD+KY+ALG+ VLLLGLLVCLPYPFPF +E +
Sbjct  456   FYWVVLIFFLQRGPISPLSDEITEPDDKYVALGVTVLLLGLLVCLPYPFPFIDETL  511



>gb|EPS68104.1| hypothetical protein M569_06667, partial [Genlisea aurea]
Length=518

 Score =   526 bits (1355),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 333/536 (62%), Positives = 403/536 (75%), Gaps = 25/536 (5%)
 Frame = -1

Query  1866  FTMSFPAIFRGN-VVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
             F M+  A F  N V+ L +C+SCS +       C            +   LR        
Sbjct  3     FEMNLSATFGWNLVIGLSRCNSCSRI-------CYSSPGNVSWKLSSNQFLRDYLK----  51

Query  1689  VICSFSASE----TEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGM  1522
             V C  S +E     E +RN   E +    ++S         D   P S A   NG     
Sbjct  52    VSCRLSETEFESSNEEERNLNGEEQGSLPDDSISETPQNLVDDQLPASAAFDSNG-----  106

Query  1521  LESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQV  1342
             L++ D+ N N+    A    E  DD+Q+ASGS LP L+ Q+ DEAIR+PKE+IDIL+DQV
Sbjct  107   LQNSDIDNKNA----AHPKIEAVDDVQVASGSLLPDLQKQEFDEAIRLPKESIDILRDQV  162

Query  1341  FGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKP  1162
             FGFDTFFVT QEPYEGGVLF+GNLRG+A++SY KI KRMQDRFGD+++LFLL++PEDDKP
Sbjct  163   FGFDTFFVTGQEPYEGGVLFRGNLRGEASKSYAKIVKRMQDRFGDIFRLFLLLSPEDDKP  222

Query  1161  VAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGL  982
             VAVVVP  TLQPD+ AVPEWFAAGAFGL+T+FTL LRNVPALQAN+LSVFDN +LL NGL
Sbjct  223   VAVVVPTKTLQPDSAAVPEWFAAGAFGLITVFTLFLRNVPALQANVLSVFDNVELLNNGL  282

Query  981   PGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLK  802
             PGALVTALILG HEI H +VA++ G+KLGVPYFVPSWQIGSFGAITRI NIVP R+D+LK
Sbjct  283   PGALVTALILGAHEIGHIVVAKETGLKLGVPYFVPSWQIGSFGAITRIRNIVPSRKDILK  342

Query  801   FAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGT  622
             FAAAGPLAGF LGFILLL GF +PPAD LG+V+DP+VFHES L GG+ KLLLGD LKEGT
Sbjct  343   FAAAGPLAGFGLGFILLLAGFIVPPADELGLVIDPTVFHESFLVGGVGKLLLGDVLKEGT  402

Query  621   PISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF  442
             PIS+NPLVLW+ +GLL+NAIN+IPAGELDGGRISF+IWGRK ++R+++AS+GLLG+ +LF
Sbjct  403   PISINPLVLWAWSGLLVNAINTIPAGELDGGRISFAIWGRKIASRVTAASVGLLGLCSLF  462

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN  274
             +DV+FYW +LI+ LQRGPIAP++EEIT+ D  Y  +G+ VLLLGLLVCLPYPF F 
Sbjct  463   NDVSFYWAILIWFLQRGPIAPVAEEITEVDGVYKGVGVLVLLLGLLVCLPYPFTFT  518



>ref|XP_002455223.1| hypothetical protein SORBIDRAFT_03g006530 [Sorghum bicolor]
 gb|EES00343.1| hypothetical protein SORBIDRAFT_03g006530 [Sorghum bicolor]
Length=545

 Score =   527 bits (1357),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 320/428 (75%), Positives = 376/428 (88%), Gaps = 6/428 (1%)
 Frame = -1

Query  1548  QDNGQNFGMLESKDLVNGNSVNVNAQTGN---EDADDIQIASGSPLPGLKPQQLDEAIRI  1378
             +D   N  +L S D V   +V+ +A + N   E+ + I++ SGSPLPG+K QQLD+++RI
Sbjct  110   KDETANAELLSSSDTVQ--NVDGDATSTNDVQENVEVIEVVSGSPLPGMK-QQLDDSVRI  166

Query  1377  PKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYK  1198
             PK TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YK
Sbjct  167   PKATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITNRLQNKFGDEYK  226

Query  1197  LFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLS  1018
             LFLLINPED+KPVAVV+P+ TLQP+TTA+PEWFAA +FG+VTIFTLLLRNVP LQ NLLS
Sbjct  227   LFLLINPEDEKPVAVVIPKQTLQPETTALPEWFAAASFGIVTIFTLLLRNVPVLQDNLLS  286

Query  1017  VFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRI  838
              FDN +LL++GL GALVTALI+GVHEI H L A+++GIKLGVPYFVPSWQIGSFGAITRI
Sbjct  287   TFDNLELLKDGLSGALVTALIIGVHEIGHILAARESGIKLGVPYFVPSWQIGSFGAITRI  346

Query  837   LNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggia  658
             +NIV  REDLLK AAAGPLAGFS GF+LLLLGF LPP+DGLG+V+DP+VFHES L GG+A
Sbjct  347   VNIVRNREDLLKLAAAGPLAGFSFGFVLLLLGFILPPSDGLGLVIDPTVFHESFLVGGLA  406

Query  657   klllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlss  478
             KLLLGD LKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+ +IWGRK S+R+SS
Sbjct  407   KLLLGDVLKEGTELSINPLVLWAWAGLLINAINSIPAGELDGGRIALAIWGRKISSRVSS  466

Query  477   asigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVC  298
              +IGLLGISALF+DVAFYWVVLIF LQRGPIAPLSEEITDP++ YI +G+A+LL GLLVC
Sbjct  467   LAIGLLGISALFNDVAFYWVVLIFFLQRGPIAPLSEEITDPESNYIGIGVAILLFGLLVC  526

Query  297   LPYPFPFN  274
             LPYPFPF+
Sbjct  527   LPYPFPFD  534



>ref|XP_003616603.1| hypothetical protein MTR_5g082260 [Medicago truncatula]
Length=545

 Score =   527 bits (1357),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 337/541 (62%), Positives = 412/541 (76%), Gaps = 38/541 (7%)
 Frame = -1

Query  1866  FTMSFPAIFRGNVVPLLQCSSCS--HLRFQP----LLSCTGIARQKQIDFPTKHLLRFAF  1705
              ++  P+ FR  VVPL  C+SC   +LRF P      SC+      + + PT        
Sbjct  3     LSLPSPSTFR--VVPLSHCTSCFQFNLRFHPSNRFHNSCSS---SLKFNPPTVR------  51

Query  1704  NMKRDVICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFG  1525
               +R + CS + S+ + D  +E  +                       SL D     N  
Sbjct  52    --RRRIACSVNESDGDNDEEKEAHKNGET------------------QSLEDTSEQSNPP  91

Query  1524  MLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQ  1345
              +++  L      N N Q   ++ D+I++ SGSPLPG+KPQQLD+ I+IPKE I+ILK+Q
Sbjct  92    PVDAGQLNKFGDENTN-QNDVQNTDNIEVTSGSPLPGVKPQQLDDVIKIPKEKIEILKNQ  150

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             VFGFDTFFVTSQ+PYEGGVLFKGNLRGQA++SY+KISKR+QD+FGD Y+LFLL+NPEDDK
Sbjct  151   VFGFDTFFVTSQDPYEGGVLFKGNLRGQASKSYDKISKRLQDKFGDEYRLFLLVNPEDDK  210

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PVAVVVPR TLQP+TT VPEWF A +FG+VT+FTLLLRNVP LQ++LLS  DN +LL++G
Sbjct  211   PVAVVVPRTTLQPETTPVPEWFGAASFGIVTVFTLLLRNVPNLQSDLLSTVDNLNLLKDG  270

Query  984   LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLL  805
             LPGALVTALI+GVHE+ H LVAQ  G+KLGVPYF+PSWQIGSFG+ITRI +IV  REDLL
Sbjct  271   LPGALVTALIIGVHELGHFLVAQNLGVKLGVPYFIPSWQIGSFGSITRIRSIVSNREDLL  330

Query  804   KFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEG  625
             K AAAGP+AGF+LGF+LLLLGF +PP+DG+GVVVD SVFHES LAGGIAKL LG+ LKEG
Sbjct  331   KIAAAGPIAGFALGFVLLLLGFVIPPSDGIGVVVDASVFHESFLAGGIAKLFLGNVLKEG  390

Query  624   TPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaL  445
             TPIS+NPLV+W+ AGLLINAINSIPAGE+DGGRISF+IWGRK S R +  SI LLG+S+L
Sbjct  391   TPISINPLVIWAWAGLLINAINSIPAGEIDGGRISFAIWGRKASIRFTGFSIVLLGLSSL  450

Query  444   FSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEA  265
              +DVAFYWVVLIF LQRGPI+PLS+EIT+PD+KY+ALG+ VLLLGLLVCLPYPFPF +E 
Sbjct  451   LNDVAFYWVVLIFFLQRGPISPLSDEITEPDDKYVALGVTVLLLGLLVCLPYPFPFIDET  510

Query  264   V  262
             +
Sbjct  511   L  511



>ref|NP_001041989.1| Os01g0142100 [Oryza sativa Japonica Group]
 sp|Q0JQS5.1|EGY2_ORYSJ RecName: Full=Probable zinc metalloprotease EGY2, chloroplastic; 
AltName: Full=Protein ETHYLENE-DEPENDENT GRAVITROPISM-DEFICIENT 
AND YELLOW-GREEN 2; Short=OsEGY2; Flags: Precursor [Oryza 
sativa Japonica Group]
 dbj|BAF03903.1| Os01g0142100 [Oryza sativa Japonica Group]
 gb|EEE53845.1| hypothetical protein OsJ_00322 [Oryza sativa Japonica Group]
Length=546

 Score =   523 bits (1346),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 373/431 (87%), Gaps = 2/431 (0%)
 Frame = -1

Query  1563  NSLADQDNGQNFGMLESKDLV-NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEA  1387
             N+   +D   N   L S D V N +     A    E+ + + +A GSPLPG+K QQLDE+
Sbjct  108   NADNTKDETVNTEPLSSSDTVQNIDGDATPASDAQENVEVVDVAVGSPLPGMK-QQLDES  166

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
             +RIPK TIDILKDQVFGFDTFFVTSQEPYEGG+LFKGNLRGQ A+SYEKI+ R+Q++FGD
Sbjct  167   VRIPKATIDILKDQVFGFDTFFVTSQEPYEGGILFKGNLRGQPAKSYEKITNRLQNKFGD  226

Query  1206  LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQAN  1027
              YKLFLLINPEDDKPVAVVVPR TLQP+TTAVPEWFAA +FG+VTIFTLLLRNVP LQ N
Sbjct  227   QYKLFLLINPEDDKPVAVVVPRQTLQPETTAVPEWFAAASFGVVTIFTLLLRNVPLLQDN  286

Query  1026  LLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
             LLS FDN +LL++G+ GALVTA I+GVHEI+H L A+  GIKL VPYFVPSWQIGSFGAI
Sbjct  287   LLSTFDNLELLKDGVYGALVTAAIIGVHEIAHILAARDTGIKLAVPYFVPSWQIGSFGAI  346

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TRI+NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L G
Sbjct  347   TRIVNIVRNREDLLKVAAAGPLAGFSLGFVLLLLGFILPPSDGLGLVIDPAVFHESFLVG  406

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
             G+AKL+LGDALKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+F++WGRK S+R
Sbjct  407   GLAKLILGDALKEGTKLSINPLVLWAWAGLLINAINSIPAGELDGGRIAFAMWGRKISSR  466

Query  486   lssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgl  307
             +SS +IGLLGISALF+DVAFYWVVLIF LQRGPI+PLSEEIT+P+N YI++G+A+LL GL
Sbjct  467   ISSLAIGLLGISALFNDVAFYWVVLIFFLQRGPISPLSEEITEPENNYISIGVAILLFGL  526

Query  306   lVCLPYPFPFN  274
             LVCLPYPFPF+
Sbjct  527   LVCLPYPFPFD  537



>dbj|BAD61067.1| unknown protein [Oryza sativa Japonica Group]
Length=541

 Score =   523 bits (1346),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 373/431 (87%), Gaps = 2/431 (0%)
 Frame = -1

Query  1563  NSLADQDNGQNFGMLESKDLV-NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEA  1387
             N+   +D   N   L S D V N +     A    E+ + + +A GSPLPG+K QQLDE+
Sbjct  103   NADNTKDETVNTEPLSSSDTVQNIDGDATPASDAQENVEVVDVAVGSPLPGMK-QQLDES  161

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
             +RIPK TIDILKDQVFGFDTFFVTSQEPYEGG+LFKGNLRGQ A+SYEKI+ R+Q++FGD
Sbjct  162   VRIPKATIDILKDQVFGFDTFFVTSQEPYEGGILFKGNLRGQPAKSYEKITNRLQNKFGD  221

Query  1206  LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQAN  1027
              YKLFLLINPEDDKPVAVVVPR TLQP+TTAVPEWFAA +FG+VTIFTLLLRNVP LQ N
Sbjct  222   QYKLFLLINPEDDKPVAVVVPRQTLQPETTAVPEWFAAASFGVVTIFTLLLRNVPLLQDN  281

Query  1026  LLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
             LLS FDN +LL++G+ GALVTA I+GVHEI+H L A+  GIKL VPYFVPSWQIGSFGAI
Sbjct  282   LLSTFDNLELLKDGVYGALVTAAIIGVHEIAHILAARDTGIKLAVPYFVPSWQIGSFGAI  341

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TRI+NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L G
Sbjct  342   TRIVNIVRNREDLLKVAAAGPLAGFSLGFVLLLLGFILPPSDGLGLVIDPAVFHESFLVG  401

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
             G+AKL+LGDALKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+F++WGRK S+R
Sbjct  402   GLAKLILGDALKEGTKLSINPLVLWAWAGLLINAINSIPAGELDGGRIAFAMWGRKISSR  461

Query  486   lssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgl  307
             +SS +IGLLGISALF+DVAFYWVVLIF LQRGPI+PLSEEIT+P+N YI++G+A+LL GL
Sbjct  462   ISSLAIGLLGISALFNDVAFYWVVLIFFLQRGPISPLSEEITEPENNYISIGVAILLFGL  521

Query  306   lVCLPYPFPFN  274
             LVCLPYPFPF+
Sbjct  522   LVCLPYPFPFD  532



>sp|B8AD72.1|EGY2_ORYSI RecName: Full=Probable zinc metalloprotease EGY2, chloroplastic; 
AltName: Full=Protein ETHYLENE-DEPENDENT GRAVITROPISM-DEFICIENT 
AND YELLOW-GREEN 2; Flags: Precursor [Oryza sativa Indica 
Group]
 gb|EEC69919.1| hypothetical protein OsI_00340 [Oryza sativa Indica Group]
Length=545

 Score =   523 bits (1346),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 321/431 (74%), Positives = 373/431 (87%), Gaps = 2/431 (0%)
 Frame = -1

Query  1563  NSLADQDNGQNFGMLESKDLV-NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEA  1387
             N+   +D   N   L S D V N +     A    E+ + + +A GSPLPG+K QQLDE+
Sbjct  107   NADNTKDETVNTEPLSSSDTVQNIDGDATPASDAQENVEVVDVAVGSPLPGMK-QQLDES  165

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
             +RIPK TIDILKDQVFGFDTFFVTSQEPYEGG+LFKGNLRGQ A+SYEKI+ R+Q++FGD
Sbjct  166   VRIPKATIDILKDQVFGFDTFFVTSQEPYEGGILFKGNLRGQPAKSYEKITNRLQNKFGD  225

Query  1206  LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQAN  1027
              YKLFLLINPEDDKPVAVVVPR TLQP+TTAVPEWFAA +FG+VTIFTLLLRNVP LQ N
Sbjct  226   QYKLFLLINPEDDKPVAVVVPRQTLQPETTAVPEWFAAASFGVVTIFTLLLRNVPLLQDN  285

Query  1026  LLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
             LLS FDN +LL++G+ GALVTA I+GVHEI+H L A+  GIKL VPYFVPSWQIGSFGAI
Sbjct  286   LLSTFDNLELLKDGVYGALVTAAIIGVHEIAHILAARDTGIKLAVPYFVPSWQIGSFGAI  345

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TRI+NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP+DGLG+V+DP+VFHES L G
Sbjct  346   TRIVNIVRNREDLLKVAAAGPLAGFSLGFVLLLLGFILPPSDGLGLVIDPAVFHESFLVG  405

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
             G+AKL+LGDALKEGT +S+NPLVLW+ AGLLINAINSIPAGELDGGRI+F++WGRK S+R
Sbjct  406   GLAKLILGDALKEGTKLSINPLVLWAWAGLLINAINSIPAGELDGGRIAFAMWGRKISSR  465

Query  486   lssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgl  307
             +SS +IGLLGISALF+DVAFYWVVLIF LQRGPI+PLSEEIT+P+N YI++G+A+LL GL
Sbjct  466   ISSLAIGLLGISALFNDVAFYWVVLIFFLQRGPISPLSEEITEPENNYISIGVAILLFGL  525

Query  306   lVCLPYPFPFN  274
             LVCLPYPFPF+
Sbjct  526   LVCLPYPFPFD  536



>gb|KDO69040.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=455

 Score =   516 bits (1330),  Expect = 8e-174, Method: Compositional matrix adjust.
 Identities = 304/465 (65%), Positives = 364/465 (78%), Gaps = 23/465 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  166

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  167   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  226

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  227   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  286

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  287   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  346

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  347   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  406

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK S
Sbjct  407   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRKVS  451



>ref|XP_006643737.1| PREDICTED: uncharacterized protein LOC102711191, partial [Oryza 
brachyantha]
Length=539

 Score =   519 bits (1336),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 313/391 (80%), Positives = 357/391 (91%), Gaps = 1/391 (0%)
 Frame = -1

Query  1446  IQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLR  1267
             + +A GSPLPG+K QQLDE++RIPK TIDILKDQVFGFDTFFVTSQEPYEGG+LFKGNLR
Sbjct  141   VDVAVGSPLPGMK-QQLDESVRIPKATIDILKDQVFGFDTFFVTSQEPYEGGILFKGNLR  199

Query  1266  GQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGA  1087
             GQ A+SYEKI+ R+Q++FGD YK+FLLINPED+KPVAVVVPR TLQP+TTAVPEWFAA +
Sbjct  200   GQPAKSYEKITNRLQNKFGDQYKVFLLINPEDEKPVAVVVPRQTLQPETTAVPEWFAAAS  259

Query  1086  FGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAG  907
             FG+VTIFTLLLRNVP LQ NLLS FDN +LL++G+ GALVTA+I+GVHEI H L A+  G
Sbjct  260   FGVVTIFTLLLRNVPVLQDNLLSTFDNLELLKDGVYGALVTAVIIGVHEIGHILAARDTG  319

Query  906   IKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflpp  727
             IKL VPYFVPSWQIGSFGAITRI+NIV  REDLLK AAAGPLAGFSLGF+LLLLGF LPP
Sbjct  320   IKLAVPYFVPSWQIGSFGAITRIINIVRNREDLLKVAAAGPLAGFSLGFVLLLLGFILPP  379

Query  726   adglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPA  547
             +DGLG+V+DPSVFHES L GG+AKL+LGDALKEGT +SVNPLVLW+ AGLLINAINSIPA
Sbjct  380   SDGLGLVIDPSVFHESFLVGGLAKLILGDALKEGTKLSVNPLVLWAWAGLLINAINSIPA  439

Query  546   GELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEE  367
             GELDGGRI+FS+WGRK + R+SS SIGLLGISALF+DVAFYWVVLIF LQRGPIAPLSEE
Sbjct  440   GELDGGRIAFSMWGRKIATRISSFSIGLLGISALFNDVAFYWVVLIFFLQRGPIAPLSEE  499

Query  366   ITDPDNKYialgiavlllgllVCLPYPFPFN  274
             IT+P+N YI++G+A+LL GLLVCLPYPFPF+
Sbjct  500   ITEPENNYISIGVAILLFGLLVCLPYPFPFD  530



>ref|XP_008233736.1| PREDICTED: LOW QUALITY PROTEIN: probable zinc metalloprotease 
EGY2, chloroplastic [Prunus mume]
Length=511

 Score =   517 bits (1331),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 335/545 (61%), Positives = 407/545 (75%), Gaps = 49/545 (9%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSC-TGIARQKQIDFPTKHLLRFAFNM-KRDV  1687
             M+  A FRGN VPL QCSSC  LR QP L+  TG  R++     +  L + + N+ K++V
Sbjct  1     MNLSATFRGNFVPLSQCSSCCDLRIQPYLAASTGSWRKRHRRRSSLKLYQVSRNLRKQEV  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFG------  1525
             +C  S ++TEPD                             N+  +++  +N G      
Sbjct  61    VCRLSETQTEPDS----------------------------NNDEEKEVNENEGGDSEEP  92

Query  1524  MLESKDLVN---GNSVNVNAQTGNEDADD-IQIASGSPLPGLKPQQLDEAIRIPKETIDI  1357
              L+S+ +V     N     A+ G +D D+ ++++SGSPLPG+KPQQ  E+IRIPKET+DI
Sbjct  93    HLDSQPIVVDQINNDAETKAEFGVQDVDNNVEVSSGSPLPGVKPQQ-GESIRIPKETLDI  151

Query  1356  LKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINP  1177
             LK+QVFGFDTFFVT+Q+PYE GVLFKGNLRG AA+SYEKISKRMQD+FGD YKLFLL+NP
Sbjct  152   LKNQVFGFDTFFVTAQDPYEAGVLFKGNLRGVAAKSYEKISKRMQDKFGDEYKLFLLVNP  211

Query  1176  EDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDL  997
             EDD+PVAVVVP+ TLQP++TAVPEWFAAGAFGLVT+FTLLLRNVP LQ+NLLS +DN +L
Sbjct  212   EDDQPVAVVVPQRTLQPESTAVPEWFAAGAFGLVTLFTLLLRNVPELQSNLLSAYDNLEL  271

Query  996   LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKR  817
             L+NGLPGALVTA +LG+HE+ H LVA+  G+ LGVPYFVPSWQIGSFG ITRI+NIVPKR
Sbjct  272   LKNGLPGALVTASVLGIHELGHVLVAKSTGVVLGVPYFVPSWQIGSFGTITRIINIVPKR  331

Query  816   EDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgda  637
             EDLLK AAAGPLAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHE  L GGIAKLLLGDA
Sbjct  332   EDLLKVAAAGPLAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHECFLVGGIAKLLLGDA  391

Query  636   LKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllg  457
             LKEGTPIS+NPL+LW+ AGL +     I         +   ++  + + R++ ASI LLG
Sbjct  392   LKEGTPISLNPLLLWAWAGLKLEIXCKI--------ILMMGLFIXQAATRITGASIALLG  443

Query  456   isaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPF  277
             +S+L SDVAFYWV LIF LQRGPIAPL EEITDPD+KY+ LG+ VLLLGLLVCLPYPFPF
Sbjct  444   LSSLVSDVAFYWVALIFFLQRGPIAPLYEEITDPDDKYVGLGVLVLLLGLLVCLPYPFPF  503

Query  276   NNEAV  262
               E +
Sbjct  504   TEEVI  508



>gb|KDO69041.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=456

 Score =   514 bits (1325),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 303/463 (65%), Positives = 363/463 (78%), Gaps = 23/463 (5%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  166

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  167   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  226

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  227   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  286

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  287   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  346

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES LAGG AKLLLGD LK+
Sbjct  347   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHESFLAGGFAKLLLGDVLKD  406

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
             GTPISVNPLV+W+ AGLLINAINSIPAGELDGGRI+F++WGRK
Sbjct  407   GTPISVNPLVIWAWAGLLINAINSIPAGELDGGRIAFALWGRK  449



>gb|KHN20855.1| hypothetical protein glysoja_009163 [Glycine soja]
Length=480

 Score =   515 bits (1326),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 316/536 (59%), Positives = 382/536 (71%), Gaps = 62/536 (12%)
 Frame = -1

Query  1866  FTMSFPAIFRGNV-VPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFAFNMKRD  1690
              +++ P+ FRGN+ VPL +C+SC  L  +  +  +   R  +  + +  L+R   N +R 
Sbjct  3     LSLAAPSAFRGNLLVPLSRCTSCLELDLR--IQHSEGFRHLRPRWSSFKLIR---NPRRR  57

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESK  1510
             VI   + S TEP    + + K  ++   +   + +S  +  P   A+Q N       E  
Sbjct  58    VI---ACSVTEPHNGSDEKEKEADKNGETLPLEDSSEQSIPPPVDAEQIN-------EFS  107

Query  1509  DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFD  1330
             D   G S   N    NE      +ASGSPLPG+KPQ+LDEAI+IPKETI+ILK+QVFGFD
Sbjct  108   DENKGQSDVQNMDDSNE------VASGSPLPGVKPQKLDEAIKIPKETIEILKNQVFGFD  161

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVTSQ+PYEGGVLFKGNLRGQAA+SY+KISKR++D+FGD YKLFLL+NPED+ PVAVV
Sbjct  162   TFFVTSQDPYEGGVLFKGNLRGQAAKSYDKISKRLKDKFGDEYKLFLLVNPEDNMPVAVV  221

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGAL  970
             VPR TLQP+TTAVPEWFAAG+FGLVT+FTLLLRNVP+LQ++LLS FDN +LL++GLPGAL
Sbjct  222   VPRTTLQPETTAVPEWFAAGSFGLVTVFTLLLRNVPSLQSDLLSTFDNLNLLKDGLPGAL  281

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             VTALILGVHE+ H L A+  G+KLGVPYFVPSWQIGSFGAITRI NIVP REDLLK AAA
Sbjct  282   VTALILGVHELGHFLAAKDTGVKLGVPYFVPSWQIGSFGAITRIRNIVPNREDLLKVAAA  341

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             G                                          +KLLLG+ LKEGT IS+
Sbjct  342   G----------------------------------------SGSKLLLGNVLKEGTAISI  361

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             NPLV+W+ AGLLINAINSIPAGELDGGRISF++WGRK S R +  SI LLG+S+L +DVA
Sbjct  362   NPLVIWAWAGLLINAINSIPAGELDGGRISFALWGRKASLRFTGVSIALLGVSSLLNDVA  421

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             FYWVVLIF LQRGPIAPLSEEITDP  KY+A+G+ VLLLGLLVCLPYPFPF  E +
Sbjct  422   FYWVVLIFFLQRGPIAPLSEEITDPGEKYVAIGVTVLLLGLLVCLPYPFPFTEETL  477



>ref|XP_006287503.1| hypothetical protein CARUB_v10000713mg [Capsella rubella]
 gb|EOA20401.1| hypothetical protein CARUB_v10000713mg [Capsella rubella]
Length=402

 Score =   505 bits (1300),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 303/387 (78%), Positives = 345/387 (89%), Gaps = 1/387 (0%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             +P QLD+++R+PKETIDIL+ +VFGFDTFFVTSQEPYEGGVLFKGNLRGQ A+SYEKI  
Sbjct  15    QPLQLDDSMRLPKETIDILRGEVFGFDTFFVTSQEPYEGGVLFKGNLRGQPAKSYEKIKT  74

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
             RM++ FGD YKLFLL NPEDDKPVAVVVPR +L+P+TTAVPEWFAAG+FGLV +FTL LR
Sbjct  75    RMENNFGDQYKLFLLTNPEDDKPVAVVVPRRSLEPETTAVPEWFAAGSFGLVALFTLFLR  134

Query  1050  NVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             NVPALQ++LLS FDN +LL++GLPGALVTAL+LGVHE+ H LVA   GIKLGVP+FVPSW
Sbjct  135   NVPALQSDLLSAFDNLELLKDGLPGALVTALVLGVHELGHILVANSLGIKLGVPFFVPSW  194

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITRI NIV KREDLLK AAAGPLAGFSLG IL L+G F+PP+DG+GVVVD SV
Sbjct  195   QIGSFGAITRIKNIVAKREDLLKLAAAGPLAGFSLGLILFLVGLFVPPSDGIGVVVDASV  254

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             FHES LAGGIAKLLLGD LKEGT IS+NPLV+W+ AGLLIN INSIPAGELDGG+I+FSI
Sbjct  255   FHESFLAGGIAKLLLGDVLKEGTSISLNPLVIWAWAGLLINGINSIPAGELDGGKIAFSI  314

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialg  331
             WGRKT+ RL+ ASI LLG+SALFSDVAFYWVVLIF LQRGPIAPL+EEIT PD+KY++LG
Sbjct  315   WGRKTATRLTGASIALLGLSALFSDVAFYWVVLIFFLQRGPIAPLAEEITAPDDKYVSLG  374

Query  330   iavlllgllVCLPYPFPFNN-EAVMVS  253
             I VL L LLVCLPYPF F + EA+M+ 
Sbjct  375   ILVLFLSLLVCLPYPFAFTSGEAMMIG  401



>ref|XP_006848164.1| hypothetical protein AMTR_s00029p00233910 [Amborella trichopoda]
 gb|ERN09745.1| hypothetical protein AMTR_s00029p00233910 [Amborella trichopoda]
Length=475

 Score =   507 bits (1306),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 310/423 (73%), Positives = 363/423 (86%), Gaps = 3/423 (1%)
 Frame = -1

Query  1524  MLESKDLVNGNSVNVNAQTGNEDADDI-QIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             +L+S +     S  VN Q   +D ++  ++ASGSPLPGLKP    E IRIPK +IDILKD
Sbjct  55    LLKSSEPGEETSEEVNDQATIQDMNETSEVASGSPLPGLKPP--GELIRIPKASIDILKD  112

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFF+TSQEPYEGGVLFKGNLRG AARSYEKI+KRMQDRFGD YKLF+L NPEDD
Sbjct  113   QVFGFDTFFITSQEPYEGGVLFKGNLRGLAARSYEKITKRMQDRFGDQYKLFILANPEDD  172

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVP+ TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVP LQ+NLLS FDN  LL++
Sbjct  173   KPVAVVVPKETLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPGLQSNLLSTFDNLQLLKD  232

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGAL+TA +L  HE+ H LVA+  G KLGVPYFVPSWQIGSFGAITRI++I+ KREDL
Sbjct  233   GLPGALITAGVLAAHELGHLLVAKYVGAKLGVPYFVPSWQIGSFGAITRIISIMSKREDL  292

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
             +K AAAGPLAGFS+GF++LLLGF LPP+DG G+VVD +VFH+S L GGIAKLLLGD LKE
Sbjct  293   VKIAAAGPLAGFSIGFLILLLGFVLPPSDGFGIVVDATVFHDSFLVGGIAKLLLGDVLKE  352

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
             GTP+S+NPLV+W+ +GLLINAINSIPAGELDGGRI+F++WGRK  +R++  SI LLG SA
Sbjct  353   GTPLSINPLVIWAWSGLLINAINSIPAGELDGGRIAFALWGRKPWSRITGVSIALLGFSA  412

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             LF+DVAFYWV LIF LQRGPIAPLSEEITDP++KY+ALG+ VLLLGLL+ +PYP  F  E
Sbjct  413   LFNDVAFYWVALIFFLQRGPIAPLSEEITDPEDKYVALGVTVLLLGLLILVPYPLSFTAE  472

Query  267   AVM  259
             +++
Sbjct  473   SMV  475



>ref|XP_007009044.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 3 [Theobroma cacao]
 gb|EOY17854.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 3 [Theobroma cacao]
Length=390

 Score =   503 bits (1295),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 316/383 (83%), Positives = 353/383 (92%), Gaps = 0/383 (0%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             +PQQLDE +RIPKETIDILKDQVF FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKIS 
Sbjct  5     QPQQLDETMRIPKETIDILKDQVFAFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKIST  64

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
             RMQ++FGD YKLFLLINPEDDKPVAVVVP+ TLQP+TTAVPEWFAAGAFGLVT+FTLLLR
Sbjct  65    RMQNKFGDQYKLFLLINPEDDKPVAVVVPKTTLQPETTAVPEWFAAGAFGLVTVFTLLLR  124

Query  1050  NVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             NVP+LQ+NLLS FDN +LL +GLPGA VTAL+LG+HE  H LVA+  G+KLGVP+FVPSW
Sbjct  125   NVPSLQSNLLSTFDNLNLLLDGLPGAFVTALLLGLHEFGHILVAKSTGVKLGVPFFVPSW  184

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITRI +IVPKREDLLK AAAGPLAGFSLGF+L LLGF LPP+DG+GVVVD SV
Sbjct  185   QIGSFGAITRIKSIVPKREDLLKVAAAGPLAGFSLGFVLFLLGFILPPSDGIGVVVDASV  244

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             FHES LAGG+AKLLLGDALKEGTPIS+NPLV+W+ AGLLINAINSIPAGELDGGRIS +I
Sbjct  245   FHESFLAGGVAKLLLGDALKEGTPISLNPLVIWAWAGLLINAINSIPAGELDGGRISLAI  304

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialg  331
             WGRK S+R ++ SI LLGIS+LF+DVAFYWVVLIF LQRGPI+PLSEEITDPD KY+ALG
Sbjct  305   WGRKASSRFTAVSIALLGISSLFNDVAFYWVVLIFFLQRGPISPLSEEITDPDGKYVALG  364

Query  330   iavlllgllVCLPYPFPFNNEAV  262
             + VL+LGLLVCLPYPFPF +E++
Sbjct  365   VLVLILGLLVCLPYPFPFTDESI  387



>ref|XP_004138568.1| PREDICTED: uncharacterized protein LOC101217814 [Cucumis sativus]
Length=456

 Score =   503 bits (1295),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 299/465 (64%), Positives = 359/465 (77%), Gaps = 27/465 (6%)
 Frame = -1

Query  1794  LRFQPLLS-CTGIARQKQIDFPTKHLLRFAFNMKRDVICSFSASETEPDRneenerklhe  1618
             +RF P  +  T    Q++I   +  L + +   KR + C  + ++TEPD N + E    +
Sbjct  1     MRFNPCFAPFTNFRDQQRIRHSSLKLCQVSSRGKRGIACKVTETQTEPDGNNDKEEDDSK  60

Query  1617  eenssgsadsasadtsEPNSLADQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQI  1438
               +                S +D      F  L+S+ +   N V    Q   +D D++++
Sbjct  61    GGDQP--------------SFSDSAAEDKF-QLDSQAVDEVNIVENKDQGDIQDIDNVEV  105

Query  1437  ASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQA  1258
             ASGSPLPGLKPQQLDE+ RIP+ET++ILK+QVFGFDTFFVTSQ+PYEGGVLFKGNLRG+A
Sbjct  106   ASGSPLPGLKPQQLDESFRIPRETVEILKNQVFGFDTFFVTSQDPYEGGVLFKGNLRGEA  165

Query  1257  ARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGL  1078
             A+SYEKI++RMQD FGD+YKLFLLINPEDDKPVAVVVPR TLQP+TTAVPEWFAA AFGL
Sbjct  166   AKSYEKITRRMQDTFGDVYKLFLLINPEDDKPVAVVVPRKTLQPETTAVPEWFAAAAFGL  225

Query  1077  VTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKL  898
             VT+FTLLLRNVPALQ+NLLS FDN +LL++GLPGA VTAL+LGVHE+ H LVA+ AG+K 
Sbjct  226   VTVFTLLLRNVPALQSNLLSTFDNLELLKDGLPGAFVTALVLGVHELGHILVARDAGVKF  285

Query  897   GVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg  718
             G+PYFVPSWQIGSFGAITRILNIVPKREDLLK A AGPLAGFS+GF+L +LG        
Sbjct  286   GIPYFVPSWQIGSFGAITRILNIVPKREDLLKVALAGPLAGFSVGFLLYILG--------  337

Query  717   lGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGEL  538
                 + P VFHES LAGGIAKLLLGDALKEGTPIS+NPLV+W+ AGLLINAINSIPAGEL
Sbjct  338   ---FILPPVFHESFLAGGIAKLLLGDALKEGTPISLNPLVIWAWAGLLINAINSIPAGEL  394

Query  537   DGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFV  403
             DGGRI+FSIWGRK S+R++  SI LLG+++LFSDVAFYWV LIF+
Sbjct  395   DGGRIAFSIWGRKASSRITGVSIVLLGLASLFSDVAFYWVALIFL  439



>ref|XP_010230441.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X2 [Brachypodium distachyon]
Length=488

 Score =   501 bits (1289),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 302/388 (78%), Positives = 349/388 (90%), Gaps = 1/388 (0%)
 Frame = -1

Query  1437  ASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQA  1258
             ASGSPLPG+K QQLDE++ IPK TIDILKDQVFGFDTFFVTS EPYEGG+LFKGNLRG  
Sbjct  93    ASGSPLPGMK-QQLDESVTIPKATIDILKDQVFGFDTFFVTSHEPYEGGILFKGNLRGVP  151

Query  1257  ARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGL  1078
             A+S+EKI+ R+Q++FGD YK+FLLINPED+KPVAVVVP+ TL+P T A+PEW AA  FG+
Sbjct  152   AKSFEKITTRLQNKFGDEYKVFLLINPEDEKPVAVVVPKQTLEPATGAIPEWAAAAVFGV  211

Query  1077  VTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKL  898
             VTIFTLLLRNVP LQ NLLS FDN +LL++GL GALVTALI+GVHEI H L A+  G+KL
Sbjct  212   VTIFTLLLRNVPVLQDNLLSTFDNLELLKDGLSGALVTALIVGVHEIGHILAAKDVGVKL  271

Query  897   GVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg  718
              VPYFVPSWQIGSFGAITRI+NIV  REDLLK AAAGP+AGFSLGF+LLLLGF LPP+DG
Sbjct  272   AVPYFVPSWQIGSFGAITRIVNIVRNREDLLKVAAAGPVAGFSLGFVLLLLGFILPPSDG  331

Query  717   lGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGEL  538
             LG+VVDP+VFHES L GG+AKL+LGDALKEGT +++NPLVLW+ AGLLINAINSIPAGEL
Sbjct  332   LGLVVDPTVFHESFLLGGLAKLILGDALKEGTQLAINPLVLWAWAGLLINAINSIPAGEL  391

Query  537   DGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITD  358
             DGGRI+F++WGRK S+RLSS +IGLLG+S+LFSDVAFYWVVLIF LQRGPIAPLSEEIT+
Sbjct  392   DGGRIAFAMWGRKISSRLSSVTIGLLGLSSLFSDVAFYWVVLIFFLQRGPIAPLSEEITE  451

Query  357   PDNKYialgiavlllgllVCLPYPFPFN  274
             P+N YI +G+A+L LGLLVCLPYPFPF+
Sbjct  452   PENNYIGIGVAILFLGLLVCLPYPFPFD  479



>ref|XP_003568414.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X1 [Brachypodium distachyon]
Length=569

 Score =   501 bits (1289),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 302/388 (78%), Positives = 349/388 (90%), Gaps = 1/388 (0%)
 Frame = -1

Query  1437  ASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQA  1258
             ASGSPLPG+K QQLDE++ IPK TIDILKDQVFGFDTFFVTS EPYEGG+LFKGNLRG  
Sbjct  174   ASGSPLPGMK-QQLDESVTIPKATIDILKDQVFGFDTFFVTSHEPYEGGILFKGNLRGVP  232

Query  1257  ARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGL  1078
             A+S+EKI+ R+Q++FGD YK+FLLINPED+KPVAVVVP+ TL+P T A+PEW AA  FG+
Sbjct  233   AKSFEKITTRLQNKFGDEYKVFLLINPEDEKPVAVVVPKQTLEPATGAIPEWAAAAVFGV  292

Query  1077  VTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKL  898
             VTIFTLLLRNVP LQ NLLS FDN +LL++GL GALVTALI+GVHEI H L A+  G+KL
Sbjct  293   VTIFTLLLRNVPVLQDNLLSTFDNLELLKDGLSGALVTALIVGVHEIGHILAAKDVGVKL  352

Query  897   GVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg  718
              VPYFVPSWQIGSFGAITRI+NIV  REDLLK AAAGP+AGFSLGF+LLLLGF LPP+DG
Sbjct  353   AVPYFVPSWQIGSFGAITRIVNIVRNREDLLKVAAAGPVAGFSLGFVLLLLGFILPPSDG  412

Query  717   lGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGEL  538
             LG+VVDP+VFHES L GG+AKL+LGDALKEGT +++NPLVLW+ AGLLINAINSIPAGEL
Sbjct  413   LGLVVDPTVFHESFLLGGLAKLILGDALKEGTQLAINPLVLWAWAGLLINAINSIPAGEL  472

Query  537   DGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITD  358
             DGGRI+F++WGRK S+RLSS +IGLLG+S+LFSDVAFYWVVLIF LQRGPIAPLSEEIT+
Sbjct  473   DGGRIAFAMWGRKISSRLSSVTIGLLGLSSLFSDVAFYWVVLIFFLQRGPIAPLSEEITE  532

Query  357   PDNKYialgiavlllgllVCLPYPFPFN  274
             P+N YI +G+A+L LGLLVCLPYPFPF+
Sbjct  533   PENNYIGIGVAILFLGLLVCLPYPFPFD  560



>ref|XP_007009045.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 4 [Theobroma cacao]
 gb|EOY17855.1| Ethylene-dependent gravitropism-deficient and yellow-green-like 
2 isoform 4 [Theobroma cacao]
Length=378

 Score =   490 bits (1261),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 310/375 (83%), Positives = 346/375 (92%), Gaps = 0/375 (0%)
 Frame = -1

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
             +RIPKETIDILKDQVF FDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKIS RMQ++FGD
Sbjct  1     MRIPKETIDILKDQVFAFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISTRMQNKFGD  60

Query  1206  LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQAN  1027
              YKLFLLINPEDDKPVAVVVP+ TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVP+LQ+N
Sbjct  61    QYKLFLLINPEDDKPVAVVVPKTTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPSLQSN  120

Query  1026  LLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
             LLS FDN +LL +GLPGA VTAL+LG+HE  H LVA+  G+KLGVP+FVPSWQIGSFGAI
Sbjct  121   LLSTFDNLNLLLDGLPGAFVTALLLGLHEFGHILVAKSTGVKLGVPFFVPSWQIGSFGAI  180

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TRI +IVPKREDLLK AAAGPLAGFSLGF+L LLGF LPP+DG+GVVVD SVFHES LAG
Sbjct  181   TRIKSIVPKREDLLKVAAAGPLAGFSLGFVLFLLGFILPPSDGIGVVVDASVFHESFLAG  240

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
             G+AKLLLGDALKEGTPIS+NPLV+W+ AGLLINAINSIPAGELDGGRIS +IWGRK S+R
Sbjct  241   GVAKLLLGDALKEGTPISLNPLVIWAWAGLLINAINSIPAGELDGGRISLAIWGRKASSR  300

Query  486   lssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgl  307
              ++ SI LLGIS+LF+DVAFYWVVLIF LQRGPI+PLSEEITDPD KY+ALG+ VL+LGL
Sbjct  301   FTAVSIALLGISSLFNDVAFYWVVLIFFLQRGPISPLSEEITDPDGKYVALGVLVLILGL  360

Query  306   lVCLPYPFPFNNEAV  262
             LVCLPYPFPF +E++
Sbjct  361   LVCLPYPFPFTDESI  375



>gb|EMT18188.1| hypothetical protein F775_15393 [Aegilops tauschii]
Length=555

 Score =   492 bits (1267),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 292/392 (74%), Positives = 345/392 (88%), Gaps = 1/392 (0%)
 Frame = -1

Query  1449  DIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNL  1270
             D+ +ASGSPLPG+K QQL+EA+ IPK T+DILKDQVF FDTFFVTS EPYEGG+LFKGNL
Sbjct  156   DVNVASGSPLPGMK-QQLEEAVSIPKATVDILKDQVFSFDTFFVTSHEPYEGGILFKGNL  214

Query  1269  RGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAG  1090
             RG  A+S+EKI+ R++++FGD +K+FLLINPED+KPVAVVVP+ T++P T +VPEW AAG
Sbjct  215   RGVPAKSFEKITTRLENKFGDEFKVFLLINPEDEKPVAVVVPKQTVEPATGSVPEWAAAG  274

Query  1089  AFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKA  910
             AFG+VTIFTLLLRNVP LQ NLLS FDN +LL++GLPGALVT LI+GVHEI H L A+ A
Sbjct  275   AFGVVTIFTLLLRNVPVLQDNLLSTFDNLELLKDGLPGALVTGLIVGVHEIGHILAARDA  334

Query  909   GIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflp  730
             G+KL VPYFVPSWQIGSFG ITRI+NIV  R DLLK AAAGP+AGFSLGF LLLLGF LP
Sbjct  335   GVKLSVPYFVPSWQIGSFGGITRIVNIVRNRGDLLKVAAAGPVAGFSLGFGLLLLGFTLP  394

Query  729   padglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIP  550
             P+DGLG++VDP++FH+S L GG+AKL+LGD LKEGT +S+NPLVLW+ AGLLINAINSIP
Sbjct  395   PSDGLGIIVDPAIFHQSFLLGGLAKLILGDVLKEGTQLSINPLVLWAWAGLLINAINSIP  454

Query  549   AGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSE  370
             AGELDGGRI+ ++WGRK S+RL S +I LLG+S+LFSDVAFYW VLIF LQRGPIAPLSE
Sbjct  455   AGELDGGRIALAMWGRKVSSRLGSVTIALLGLSSLFSDVAFYWAVLIFFLQRGPIAPLSE  514

Query  369   EITDPDNKYialgiavlllgllVCLPYPFPFN  274
             EIT+P+N YI LG+A+L LGLLVCLPYPF F+
Sbjct  515   EITEPENSYIGLGVAILFLGLLVCLPYPFLFD  546



>emb|CDM81041.1| unnamed protein product [Triticum aestivum]
Length=616

 Score =   494 bits (1271),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 293/396 (74%), Positives = 346/396 (87%), Gaps = 1/396 (0%)
 Frame = -1

Query  1449  DIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNL  1270
             D+ +ASGSPLPG+K QQL+EA+ IPK T+DILKDQVF FDTFFVTS EPYEGG+LFKGNL
Sbjct  217   DVNVASGSPLPGMK-QQLEEAVSIPKATVDILKDQVFSFDTFFVTSHEPYEGGILFKGNL  275

Query  1269  RGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAG  1090
             RG  A+S+EKI+ R++++FGD +K+FLLINPED+KPVAVVVP+ T++P T +VPEW AAG
Sbjct  276   RGVPAKSFEKITTRLENKFGDEFKVFLLINPEDEKPVAVVVPKQTVEPATGSVPEWAAAG  335

Query  1089  AFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKA  910
             AFG+VTIFTLLLRNVP LQ NLLS FDN +LL++GLPGALVT LI+GVHEI H L A+ A
Sbjct  336   AFGVVTIFTLLLRNVPVLQDNLLSTFDNLELLKDGLPGALVTGLIVGVHEIGHILAARDA  395

Query  909   GIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflp  730
             G+KL VPYFVPSWQIGSFG ITRI+NIV  R DLLK AAAGP+AGFSLGF LLLLGF LP
Sbjct  396   GVKLSVPYFVPSWQIGSFGGITRIVNIVRNRGDLLKVAAAGPVAGFSLGFGLLLLGFTLP  455

Query  729   padglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIP  550
             P+DGLG++VDP+VFH+S L GG+AKL+LGD LKEGT +S+NPLVLW+ AGLLINAINSIP
Sbjct  456   PSDGLGIIVDPAVFHQSFLLGGLAKLILGDVLKEGTQLSINPLVLWAWAGLLINAINSIP  515

Query  549   AGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSE  370
             AGELDGGRI+ ++WGRK S+RL S +I LLG+S+LFSDVAFYW VLIF LQRGPIAPLSE
Sbjct  516   AGELDGGRIALAMWGRKVSSRLGSVTIALLGLSSLFSDVAFYWAVLIFFLQRGPIAPLSE  575

Query  369   EITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             EIT+P+N+YI LG+ +L LGLLVCLPYPF F+   V
Sbjct  576   EITEPENRYIGLGVTILFLGLLVCLPYPFLFDPSQV  611



>dbj|BAJ86140.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96657.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=621

 Score =   493 bits (1270),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 294/396 (74%), Positives = 347/396 (88%), Gaps = 1/396 (0%)
 Frame = -1

Query  1449  DIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNL  1270
             D+ +ASGSPLPG+K QQL+EA+ IPK T+DILKDQVF FDTFFVTS EPYEGG+LFKGNL
Sbjct  222   DVNVASGSPLPGMK-QQLEEAVSIPKATVDILKDQVFSFDTFFVTSHEPYEGGILFKGNL  280

Query  1269  RGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAG  1090
             RG  A+S+EKI+ R++++FGD +K+FLLINPED+KPVAVVVP+ T++P T +VPEW AAG
Sbjct  281   RGVPAKSFEKITTRLENKFGDEFKVFLLINPEDEKPVAVVVPKQTVEPATGSVPEWAAAG  340

Query  1089  AFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKA  910
             AFG+VTIFTLLLRNVP LQ NLLS FDN +LL++GLPGALVT LI+GVHEI H L A+ A
Sbjct  341   AFGVVTIFTLLLRNVPVLQDNLLSTFDNLELLKDGLPGALVTGLIIGVHEIGHILAAKDA  400

Query  909   GIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflp  730
             G+KL VPYFVPSWQIGSFG ITRI+NIV  R DLLK AAAGP+AGFSLGF+LLLLGF LP
Sbjct  401   GVKLSVPYFVPSWQIGSFGGITRIVNIVRNRGDLLKVAAAGPVAGFSLGFVLLLLGFILP  460

Query  729   padglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIP  550
             P+DGLG++VDP+VFH+S L GG+AKL+LGD LKEGT +S+NPLVLW+ AGLLINAINSIP
Sbjct  461   PSDGLGIIVDPAVFHQSFLLGGLAKLILGDVLKEGTQLSINPLVLWAWAGLLINAINSIP  520

Query  549   AGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSE  370
             AGELDGGRI+ ++WGRK S+RL S +I LLG+S+LFSDVAFYW VLIF LQRGPIAPLSE
Sbjct  521   AGELDGGRIALAMWGRKVSSRLGSVTIALLGLSSLFSDVAFYWAVLIFFLQRGPIAPLSE  580

Query  369   EITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             EIT+P+N YI LG+A+L LGLLVCLPYPF F+   V
Sbjct  581   EITEPENSYIGLGVAILFLGLLVCLPYPFLFDPSQV  616



>gb|EMS60260.1| hypothetical protein TRIUR3_00545 [Triticum urartu]
Length=574

 Score =   491 bits (1264),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 294/396 (74%), Positives = 346/396 (87%), Gaps = 1/396 (0%)
 Frame = -1

Query  1449  DIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNL  1270
             D+ +ASGSPLPG+K QQL+EA+ IPK T+DILKDQVF FDTFFVTS EPYEGG+LFKGNL
Sbjct  175   DVNVASGSPLPGMK-QQLEEAVSIPKATVDILKDQVFSFDTFFVTSHEPYEGGILFKGNL  233

Query  1269  RGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAG  1090
             RG  A+S+EKI+ R++++FGD +K+FLLINPED+KPVAVVVP+ T++P T +VPEW AAG
Sbjct  234   RGVPAKSFEKITTRLENKFGDEFKVFLLINPEDEKPVAVVVPKQTVEPATGSVPEWAAAG  293

Query  1089  AFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKA  910
             AFG+VTIFTLLLRNVP LQ NLLS FDN +LL++GLPGALVT LI+GVHEI H L A+ A
Sbjct  294   AFGVVTIFTLLLRNVPVLQDNLLSTFDNLELLKDGLPGALVTGLIVGVHEIGHILAAKDA  353

Query  909   GIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflp  730
             G+KL VPYFVPSWQIGSFG ITRI+NIV  R DLLK AAAGP+AGFSLGF LLLLGF LP
Sbjct  354   GVKLSVPYFVPSWQIGSFGGITRIVNIVRNRGDLLKVAAAGPVAGFSLGFGLLLLGFTLP  413

Query  729   padglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIP  550
             P+DGLG++VDP+VFH+S L GG+AKL+LGD LKEGT +S+NPLVLW+ AGLLINAINSIP
Sbjct  414   PSDGLGIIVDPAVFHQSFLLGGLAKLILGDVLKEGTQLSINPLVLWAWAGLLINAINSIP  473

Query  549   AGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSE  370
             AGELDGGRI+ ++WGRK S+RL S +I LLG+S+LFSDVAFYW VLIF LQRGPIAPLSE
Sbjct  474   AGELDGGRIALAMWGRKVSSRLGSVTIALLGLSSLFSDVAFYWAVLIFFLQRGPIAPLSE  533

Query  369   EITDPDNKYialgiavlllgllVCLPYPFPFNNEAV  262
             EIT+P+N YI LG+A+L LGLLVCLPYPF F+   V
Sbjct  534   EITEPENIYIGLGVAILFLGLLVCLPYPFLFDPSQV  569



>ref|XP_011043078.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X3 [Populus euphratica]
Length=478

 Score =   467 bits (1202),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 300/478 (63%), Positives = 353/478 (74%), Gaps = 24/478 (5%)
 Frame = -1

Query  1869  IFTMSFPAIFRGNVVPLL--QCSSC-SHLRFQPLLSCTGI----ARQKQIDFPTKHLLRF  1711
             +  MS  A FRGN   LL  Q S C    R + +L+ + +     R +  DF    +  F
Sbjct  1     MLKMSVSATFRGNFSSLLIPQSSYCPCDYRPRHILASSSVISWRKRCRTRDFKLYQVSEF  60

Query  1710  AFNMKRDVI-CSFSASETEPDRneenerklheeenssgsadsasadts--EPNSLADQDN  1540
                 KR++I C  + +E EPD +  + ++    E         S   +  +P+S     N
Sbjct  61    C--EKREIIVCRAAETEIEPDNSNNDNKEKEVHEGGEEHPTIDSVGQTDDQPDSQPTILN  118

Query  1539  GQNFGMLESKDLVNGNSVNVNAQTGN-----------EDADDIQIASGSPLPGLKPQQLD  1393
               N G + +      N    N    +           ++ADD ++ SGSPLPG+KPQQLD
Sbjct  119   QINGGEITTGGGTQLNETIYNGWPQHPVAIQISLCLKQEADD-EVVSGSPLPGVKPQQLD  177

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E+IRIPKETIDIL++QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA+SYEK++ RMQ++F
Sbjct  178   ESIRIPKETIDILRNQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAKSYEKLTNRMQNKF  237

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD YK+FLL+NPEDDKPVAVVVPR TLQP+TTAVPEWFAAGAFGLVTIFTLLLRNVPALQ
Sbjct  238   GDEYKIFLLVNPEDDKPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  297

Query  1032  ANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
             +N+LS FDN  LL +GLPGALVTAL+LG HE+SH LVA+   +KLGVPYFVPSWQIGSFG
Sbjct  298   SNILSTFDNPQLLMDGLPGALVTALVLGAHELSHILVAKSNEVKLGVPYFVPSWQIGSFG  357

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITRI +IVPKRE LLK A AGPLAGFSLG +L LLGF LPP+DG+G+VVD SVFHES L
Sbjct  358   AITRITSIVPKREVLLKVAVAGPLAGFSLGLVLFLLGFILPPSDGIGLVVDASVFHESFL  417

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
             AGGIAKLLLGD LKEGTPISVNPLV+W+ AGLLINAINSIPAGELDGGRISF+IWGRK
Sbjct  418   AGGIAKLLLGDVLKEGTPISVNPLVIWAWAGLLINAINSIPAGELDGGRISFAIWGRK  475



>gb|ABK24818.1| unknown [Picea sitchensis]
Length=501

 Score =   459 bits (1180),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 275/429 (64%), Positives = 344/429 (80%), Gaps = 6/429 (1%)
 Frame = -1

Query  1545  DNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKET  1366
             D+GQ    L S D  + ++ ++  +  N DA   ++ SGSPLPG+KP    E ++IPKET
Sbjct  79    DSGQE--ALPSGDSDDSSTAHLEKEQDNIDA--FKVTSGSPLPGVKPP--GEPVKIPKET  132

Query  1365  IDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLL  1186
             +D+L+DQVFGFDTFFVT QEPYEGGVLFKGNLRG+AA+SY K+  R+Q+RFG+ +KLF+L
Sbjct  133   LDVLRDQVFGFDTFFVTGQEPYEGGVLFKGNLRGEAAKSYMKLKGRLQERFGEQFKLFIL  192

Query  1185  INPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDN  1006
              NPEDD+P+AVVVP+ +LQ + TAVPEWFAA AFGLV++FT+LLRN P+LQ NLLS F N
Sbjct  193   ANPEDDRPIAVVVPKESLQSEPTAVPEWFAASAFGLVSLFTILLRNAPSLQMNLLSSFGN  252

Query  1005  FDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIV  826
               LL+ G  GA +TA ILG HEI H L A+  G +LGVPYF+PSWQIGSFGAITR+ N++
Sbjct  253   LGLLKEGFSGAFITAAILGAHEIGHILAAKSLGAELGVPYFIPSWQIGSFGAITRVTNVL  312

Query  825   PKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklll  646
               R+DLL+FAAAGPLAGFSL F +LL GF LPP+DG GV++D SVFHES L GGIAKL L
Sbjct  313   TSRKDLLQFAAAGPLAGFSLSFFILLSGFILPPSDGQGVIIDASVFHESFLVGGIAKLFL  372

Query  645   gdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasig  466
             GD LKEGT ++VNPL++W+ +GLLINA+NSIPAGELDGGRIS ++WGRK   R S  SI 
Sbjct  373   GDILKEGTKLAVNPLIIWAWSGLLINALNSIPAGELDGGRISLALWGRKVWTRFSGLSIA  432

Query  465   llgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYP  286
             LLG S+L SDVAFYWVVLIF LQRGPI P +EEI+ PD+K + +GI VL+LGLL+CLP+P
Sbjct  433   LLGFSSLISDVAFYWVVLIFFLQRGPIPPQAEEISRPDDKNVVVGITVLVLGLLICLPFP  492

Query  285   FPFNNEAVM  259
             FPF +++++
Sbjct  493   FPFMSDSML  501



>gb|KDO69042.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
 gb|KDO69043.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=400

 Score =   441 bits (1133),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 253/403 (63%), Positives = 307/403 (76%), Gaps = 23/403 (6%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  166

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  167   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  226

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  227   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  286

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQIGSFGAITRI NIV KREDL
Sbjct  287   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQIGSFGAITRIRNIVSKREDL  346

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             LK AAAGPLAGFSLGF+L L+GF  PP+DG+G+VVD SVFHES
Sbjct  347   LKVAAAGPLAGFSLGFVLFLVGFIFPPSDGIGIVVDASVFHES  389



>ref|XP_004169797.1| PREDICTED: uncharacterized protein LOC101225644, partial [Cucumis 
sativus]
Length=364

 Score =   408 bits (1049),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 233/373 (62%), Positives = 284/373 (76%), Gaps = 16/373 (4%)
 Frame = -1

Query  1794  LRFQPLLS-CTGIARQKQIDFPTKHLLRFAFNMKRDVICSFSASETEPDRneenerklhe  1618
             +RF P  +  T    Q++I   +  L + +   KR + C  + ++TEPD N + E    +
Sbjct  1     MRFNPCFAPFTNFRDQQRIRHSSLKLCQVSSRGKRGIACKVTETQTEPDGNNDKEEDDSK  60

Query  1617  eenssgsadsasadtsEPNSLADQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQI  1438
               +                S +D      F  L+S+ +   N V    Q   +D D++++
Sbjct  61    GGDQP--------------SFSDSAAEDKF-QLDSQAVDEVNIVENKDQGDIQDIDNVEV  105

Query  1437  ASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQA  1258
             ASGSPLPGLKPQQLDE+ RIP+ET++ILK+QVFGFDTFFVTSQ+PYEGGVLFKGNLRG+A
Sbjct  106   ASGSPLPGLKPQQLDESFRIPRETVEILKNQVFGFDTFFVTSQDPYEGGVLFKGNLRGEA  165

Query  1257  ARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGL  1078
             A+SYEKI++RMQD FGD+YKLFLLINPEDDKPVAVVVPR TLQP+TTAVPEWFAA AFGL
Sbjct  166   AKSYEKITRRMQDTFGDVYKLFLLINPEDDKPVAVVVPRKTLQPETTAVPEWFAAAAFGL  225

Query  1077  VTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKL  898
             VT+FTLLLRNVPALQ+NLLS FDN +LL++GLPGA VTAL+LGVHE+ H LVA+  G+K 
Sbjct  226   VTVFTLLLRNVPALQSNLLSTFDNLELLKDGLPGAFVTALVLGVHELGHILVARDVGVKF  285

Query  897   GVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg  718
             G+PYFVPSWQIGSFGAITRILNIVPKREDLLK A AGPLAGFS+GF+L + GF LPP+DG
Sbjct  286   GIPYFVPSWQIGSFGAITRILNIVPKREDLLKVALAGPLAGFSVGFLLYIFGFILPPSDG  345

Query  717   lGVVVDPSVFHES  679
             +GV+VD SVFHES
Sbjct  346   IGVIVDASVFHES  358



>ref|XP_008368078.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Malus domestica]
Length=333

 Score =   399 bits (1026),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 255/320 (80%), Positives = 287/320 (90%), Gaps = 0/320 (0%)
 Frame = -1

Query  1221  DRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVP  1042
             D+FGD YKLFLL+NPEDD+PVAVVVPR TLQP++TAVPEWFAAGAFGLVT+FTLLL+NVP
Sbjct  11    DKFGDEYKLFLLVNPEDDQPVAVVVPRRTLQPESTAVPEWFAAGAFGLVTLFTLLLQNVP  70

Query  1041  ALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
              LQ+NL S FDN DLL+NGLPGALVTA +LGVHE+ H LVA   G+ LGVPYF+PSWQIG
Sbjct  71    ELQSNLQSAFDNPDLLKNGLPGALVTAAVLGVHELGHVLVANSTGVVLGVPYFIPSWQIG  130

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFG ITRI+NIVPKRE LLK AAAGPLAGFSLGF+LLLLGFFLPP+DG+GVVVD SVFHE
Sbjct  131   SFGTITRIVNIVPKRESLLKVAAAGPLAGFSLGFVLLLLGFFLPPSDGIGVVVDASVFHE  190

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
             S L GGIAKLLLGDALKEGTPIS+NPL+LW+ AGL+INAINSIPAGELDGGRISF+IWGR
Sbjct  191   SFLIGGIAKLLLGDALKEGTPISLNPLLLWAWAGLVINAINSIPAGELDGGRISFAIWGR  250

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiav  322
             K + R++ ASI LLG+S+L SDVAFYWVVLIF LQRGPIAPL EEITDPD+KY+ LG+ V
Sbjct  251   KAATRITGASIALLGLSSLVSDVAFYWVVLIFFLQRGPIAPLYEEITDPDDKYVGLGVLV  310

Query  321   lllgllVCLPYPFPFNNEAV  262
               LGLLVCLPYPFPF +E +
Sbjct  311   FFLGLLVCLPYPFPFVDEII  330



>gb|KDO69045.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=334

 Score =   389 bits (1000),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 202/341 (59%), Positives = 252/341 (74%), Gaps = 23/341 (7%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  166

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  167   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  226

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  227   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  286

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQ+
Sbjct  287   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQV  327



>gb|KDO69044.1| hypothetical protein CISIN_1g009542mg [Citrus sinensis]
Length=331

 Score =   389 bits (998),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 202/340 (59%), Positives = 251/340 (74%), Gaps = 23/340 (7%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQI---DFPTKHLLRFAFNMKRD  1690
             M+F   FRGN+  L  CSSC  +RFQP+L+   + R  +    +F +  + RF    KR+
Sbjct  1     MNFTTTFRGNLSLLPHCSSCCDIRFQPILASLHVTRPVRCRLGNFSSYKVSRFC-RKKRE  59

Query  1689  VICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQ--DNGQNFGMLE  1516
             +IC  + ++TEPD             N+    +      ++P + +DQ  D  Q    L+
Sbjct  60    LICRVTDTQTEPD------------SNNDKEKEVHDGQENQPATASDQEDDKSQPDSQLD  107

Query  1515  SK----DLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             S+    + +NGN V  + + G +D  + ++ASGSPLPG+KPQQLDE IRIPKETIDILKD
Sbjct  108   SQPQVENQINGNDV-ADTKGGVQDDGNGEVASGSPLPGVKPQQLDEYIRIPKETIDILKD  166

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
             QVFGFDTFFVT+QEPYEGGVLFKGNLRGQAA++YEKIS RM+++FGD YKLFLL+NPEDD
Sbjct  167   QVFGFDTFFVTNQEPYEGGVLFKGNLRGQAAKTYEKISTRMKNKFGDQYKLFLLVNPEDD  226

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KPVAVVVPR TLQP+TTAVPEWFAAGAFGLVT+FTLLLRNVPALQ+NLLS FDN +LL N
Sbjct  227   KPVAVVVPRKTLQPETTAVPEWFAAGAFGLVTVFTLLLRNVPALQSNLLSTFDNLNLLTN  286

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQ  868
             GLPGALVTAL++GVHE+ H L A+  G++LGVPYFVPSWQ
Sbjct  287   GLPGALVTALVIGVHELGHILAAKSTGVELGVPYFVPSWQ  326



>ref|XP_010321956.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X4 [Solanum lycopersicum]
 ref|XP_010321957.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X4 [Solanum lycopersicum]
 ref|XP_010321958.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
isoform X4 [Solanum lycopersicum]
Length=396

 Score =   385 bits (988),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 250/335 (75%), Positives = 287/335 (86%), Gaps = 0/335 (0%)
 Frame = -1

Query  1272  LRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAA  1093
             L+G      +K  K+ Q     L       N EDDKPVAVVVPR+TLQP+TTAVPEWFAA
Sbjct  59    LKGIYEDRLQKHMKKYQRECRWLKFPLFFSNLEDDKPVAVVVPRMTLQPETTAVPEWFAA  118

Query  1092  GAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQK  913
             GAFGLVT+FTL LRNVPALQ+N LSVFDN DLL++GLPGAL+TA +LGVHE+SH LVA +
Sbjct  119   GAFGLVTVFTLFLRNVPALQSNFLSVFDNLDLLKDGLPGALMTAFLLGVHEVSHRLVATE  178

Query  912   AGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgffl  733
              GIKL +PYFVPSWQIG FGAITRILN+VP REDLLK AAAGPLAGF +GFILLL GF L
Sbjct  179   VGIKLSIPYFVPSWQIGCFGAITRILNVVPNREDLLKVAAAGPLAGFCVGFILLLSGFML  238

Query  732   ppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSI  553
             PP+DG+G++VDPSVFHES LAGGIAKL LGD L+EG+PISV+PLV+W+ AGL+INAINSI
Sbjct  239   PPSDGIGIIVDPSVFHESFLAGGIAKLYLGDVLQEGSPISVHPLVIWAWAGLVINAINSI  298

Query  552   PAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLS  373
             PAGELDGGRI+F++WGRK SARLS+ SIGLLGI +LF+DVAFYWVVLIF LQRGPIAPLS
Sbjct  299   PAGELDGGRIAFAMWGRKASARLSALSIGLLGICSLFNDVAFYWVVLIFFLQRGPIAPLS  358

Query  372   EEITDPDNKYialgiavlllgllVCLPYPFPFNNE  268
             EE+T P NKY+ALG+ VL LGLLVCLPYPFPF+N+
Sbjct  359   EEVTHPQNKYMALGVVVLFLGLLVCLPYPFPFSNQ  393


 Score = 87.0 bits (214),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -2

Query  1457  MPMTFKLQADPLCQVSSHSNLMKLSGFQRKLLIF*RIKYLVLTLFL*QARNHMRVEFYLK  1278
             M +T  L  + L  VSS +N M  SG  RK L F  IKYLVLT FL QAR+ MRVE+YLK
Sbjct  1     MILTINLLVNHLFPVSSLNNSMNQSGSPRKQLKFSEIKYLVLTRFLLQARSRMRVEYYLK  60

Query  1277  GIYEGRLQEVMKKYQRECR  1221
             GIYE RLQ+ MKKYQRECR
Sbjct  61    GIYEDRLQKHMKKYQRECR  79



>ref|XP_002991591.1| hypothetical protein SELMODRAFT_133892, partial [Selaginella 
moellendorffii]
 gb|EFJ07345.1| hypothetical protein SELMODRAFT_133892, partial [Selaginella 
moellendorffii]
Length=395

 Score =   352 bits (903),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 206/390 (53%), Positives = 292/390 (75%), Gaps = 2/390 (1%)
 Frame = -1

Query  1443  QIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG  1264
             ++ SGSPLPG+K     E+I+IPKE ++ +++Q+FGFDTFF TSQE YE GV+F+GN+RG
Sbjct  8     KVISGSPLPGVKAPL--ESIKIPKEVLETIRNQIFGFDTFFATSQEYYEAGVIFRGNMRG  65

Query  1263  QAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAF  1084
             + A S+ K+S R+Q++FGD Y+LF + +PE DKP+A +V   +LQ +  A+P+WF   AF
Sbjct  66    EPAASHAKLSSRLQEKFGDEYQLFFISDPEGDKPLAAIVRNTSLQTEPGAIPDWFTVAAF  125

Query  1083  GLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGI  904
             GLV++ T+ LRN PALQ +LL+    F+ + + +P ALVT  +L  HE  H + A++ G 
Sbjct  126   GLVSLVTIFLRNSPALQLSLLTGSFTFEQVLDAVPRALVTLSVLLAHEAGHYVAAKRNGA  185

Query  903   KLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppa  724
              +G+PYF+PSWQ+GSFG ITR+ +++  R +L++ AA+GPL G  L   ++++G  L P 
Sbjct  186   SIGLPYFIPSWQLGSFGGITRVTSVLKNRSELVEIAASGPLTGAVLALAIIVVGLLLTPE  245

Query  723   dglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAG  544
              G G++V  S+FH+SLL GGIAKLLLGDALKEG+ IS+NP++L + +GLLINAIN IP G
Sbjct  246   KGDGLLVSSSIFHDSLLVGGIAKLLLGDALKEGSTISINPVILSAWSGLLINAINCIPIG  305

Query  543   ELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEI  364
             E+DGGRI+ ++WGRK  +R +  SI LLG++ +FSDVA YWVVL+  LQRGPIAPL++E+
Sbjct  306   EIDGGRIAQALWGRKGWSRFTGVSIALLGLTGIFSDVALYWVVLVVFLQRGPIAPLADEV  365

Query  363   TDPDNKYialgiavlllgllVCLPYPFPFN  274
             T P +K+I  G++ LLL LLVC P+PF F 
Sbjct  366   TPPSSKHIVAGVSALLLSLLVCCPFPFLFT  395



>ref|XP_002971707.1| hypothetical protein SELMODRAFT_95889, partial [Selaginella moellendorffii]
 gb|EFJ27456.1| hypothetical protein SELMODRAFT_95889, partial [Selaginella moellendorffii]
Length=395

 Score =   351 bits (900),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 206/389 (53%), Positives = 291/389 (75%), Gaps = 2/389 (1%)
 Frame = -1

Query  1443  QIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG  1264
             ++ SGSPLPG+K     E+I+IPKE ++ +++Q+FGFDTFF TSQE YE GV+F+GN+RG
Sbjct  8     KVISGSPLPGVKAPL--ESIKIPKEVLETIRNQIFGFDTFFATSQEYYEAGVIFRGNMRG  65

Query  1263  QAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAF  1084
             + A S+ K+S R+Q++FGD Y+LF + +PE DKP+A +V   +LQ +  A+P+WF   AF
Sbjct  66    EPAASHAKLSSRLQEKFGDEYQLFFISDPEGDKPLAAIVRNTSLQTEPGAIPDWFTVSAF  125

Query  1083  GLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGI  904
             GLV++ T+ LRN PALQ +LL+    F+ + + +P ALVT  +L  HE  H + A++ G 
Sbjct  126   GLVSLVTIFLRNSPALQLSLLTGSFTFEQVLDAVPRALVTLSVLLAHEAGHYVAAKRNGA  185

Query  903   KLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppa  724
              +G+PYF+PSWQ+GSFG ITR+ +++  R +L + AA+GPL G  L   ++++G  L P 
Sbjct  186   SIGLPYFIPSWQLGSFGGITRVTSVLKNRSELAEIAASGPLTGAVLALAIIVVGLLLTPE  245

Query  723   dglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAG  544
              G G++V  S+FH+SLL GGIAKLLLGDALKEG+ IS+NP++L + +GLLINAIN IP G
Sbjct  246   KGDGLLVSSSIFHDSLLVGGIAKLLLGDALKEGSTISINPVILSAWSGLLINAINCIPIG  305

Query  543   ELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEI  364
             E+DGGRI+ ++WGRK  +R +  SI LLG++ +FSDVA YWVVL+  LQRGPIAPL++E+
Sbjct  306   EIDGGRIAQALWGRKGWSRFTGVSIALLGLTGIFSDVALYWVVLVVFLQRGPIAPLADEV  365

Query  363   TDPDNKYialgiavlllgllVCLPYPFPF  277
             T P +K+I  G++ LLL LLVC P+PF F
Sbjct  366   TPPSSKHIVAGVSALLLSLLVCCPFPFLF  394



>ref|XP_008360780.1| PREDICTED: probable zinc metalloprotease EGY2, chloroplastic 
[Malus domestica]
Length=273

 Score =   283 bits (723),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 156/282 (55%), Positives = 194/282 (69%), Gaps = 27/282 (10%)
 Frame = -1

Query  1860  MSFPAIFRGNVVPLLQCSSCSHLRFQPLLSCTGIARQKQIDFPTKHLLRFA--FNMKRDV  1687
             M+F A FRGN VPL QCSSC  LRFQP  +    + QK+    +   L     F  KR+V
Sbjct  1     MNFSATFRGNFVPLSQCSSCCDLRFQPYFASGTSSWQKRNRRRSSLKLHQVSRFLRKREV  60

Query  1686  ICSFSASETEPDRneenerklheeenssgsadsasadtsEPNSLADQDNGQNFGMLESKD  1507
             +C  S +ETEP                       S +  E     ++D   +   L S+ 
Sbjct  61    VCRVSETETEP--------------------PPDSNNDEEKQGHENEDGDSDAVHLASQP  100

Query  1506  LVNGNSVNVNAQT-GNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFD  1330
             +V  + VN +A+T   ++ ++++++SGSPLPG+KP    E+IRIPKETIDILK+QVFGFD
Sbjct  101   IV-ADQVNNDAETEAQQEVENVEVSSGSPLPGVKP---GESIRIPKETIDILKNQVFGFD  156

Query  1329  TFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVV  1150
             TFFVT Q+PYE GVLFKGNLRG  A+SYEKISKRMQD+FGD YKLFLL+NPEDD+PVAVV
Sbjct  157   TFFVTGQDPYETGVLFKGNLRGVPAKSYEKISKRMQDKFGDEYKLFLLVNPEDDQPVAVV  216

Query  1149  VPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL  1024
             VPR TLQP++TAVPEWFAAGAFGLVT+FTLLL+NVP LQ+NL
Sbjct  217   VPRRTLQPESTAVPEWFAAGAFGLVTLFTLLLQNVPELQSNL  258



>tpg|DAA53528.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
Length=292

 Score =   249 bits (635),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 144/178 (81%), Gaps = 4/178 (2%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K   LD+++RIP
Sbjct  113   DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK---LDDSVRIP  169

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  170   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  229

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             FLLINPED+KPVAVV+P+ TLQP+TTAVPEWFAA AFGLVTIFTLLLRNVP LQ NLL
Sbjct  230   FLLINPEDEKPVAVVIPKQTLQPETTAVPEWFAAAAFGLVTIFTLLLRNVPVLQENLL  287



>gb|ACR35180.1| unknown [Zea mays]
 gb|ACR36902.1| unknown [Zea mays]
Length=231

 Score =   243 bits (620),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 144/231 (62%), Positives = 164/231 (71%), Gaps = 0/231 (0%)
 Frame = +2

Query  554   ILLMALMRSPAKDHSTSGFTDMGVPSFRASPRSSLAMPPARSDS*NTEGSTTTPKPSAGG  733
             +LL+AL+R PA+ H TSGF D  VPSF+ SPR S A PP R+DS  T GS T P+PS GG
Sbjct  1     MLLIALIRRPAQAHRTSGFMDNCVPSFKTSPRRSFARPPTRNDSWKTVGSITRPRPSLGG  60

Query  734   RKNPKSKRINPNENPAKGPAAANFKRSSRLGTIFKILVIAPKEPICQLGTKYGTPSLIPA  913
             +  P S+R NP ENPA GPAAA+F RSSRL TI  ILVI PK+PICQLGTKYGTPSLIP 
Sbjct  61    KTKPSSRRTNPKENPANGPAAASFSRSSRLRTILTILVIPPKDPICQLGTKYGTPSLIPL  120

Query  914   FCATKVWLIS*TPRISAVTSAPGRPFSNKSKLSKTDNKFACNAGTLRRRSVNIVTSPKAP  1093
               A ++  IS TP I  VT AP  P  N S+LS  D+KF+C  GT R   V +VT+P A 
Sbjct  121   SLAARICPISCTPIIRPVTRAPDSPSFNNSRLSNVDSKFSCRTGTFRSSRVKMVTNPNAA  180

Query  1094  AANHSGTAVVSGCRVIRgtttatglsssglIKRNSLYKSPNLSCILFDIFS  1246
             AANHSGTAVVSGC V  G TTATG SSSGL++R SLY SPNL C    IFS
Sbjct  181   AANHSGTAVVSGCNVCLGITTATGFSSSGLMRRKSLYSSPNLFCSRLVIFS  231



>ref|XP_005647168.1| hypothetical protein COCSUDRAFT_63768 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22624.1| hypothetical protein COCSUDRAFT_63768 [Coccomyxa subellipsoidea 
C-169]
Length=395

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 142/358 (40%), Positives = 217/358 (61%), Gaps = 7/358 (2%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEG-GVLFKGNLRGQAARSYEKIS  1234
             +P+Q D  +++P E I  L++ +FGFD FFVT  E Y+  GV+FKGNLRG  A +Y++I+
Sbjct  12    EPRQ-DRNLQLPSEVIQRLRNVIFGFD-FFVTKVENYQANGVIFKGNLRGNPATAYDRIA  69

Query  1233  KRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
              R++   G+ Y L+LL + ++++PVAV++P+   +    A  E   + AFGL T+ TLL 
Sbjct  70    ARLKGELGEEYVLYLLED-QEEQPVAVILPKDAAEQPLPATQEALLSAAFGLATLVTLLN  128

Query  1053  RNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS  874
              N   L            +L + LPG ++  L+L  HE  H + A++ G++LG P FVP+
Sbjct  129   ANGLLLLQPDQLDLSPGSVL-SALPGTILFFLLLAAHEAGHRVAAKQEGVELGTPLFVPA  187

Query  873   WQ--IGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVD  700
                 +GSFGAIT   + VP R  LL  AA GP  G +    +LL G  L  A      + 
Sbjct  188   GLGFLGSFGAITSFRSTVPDRATLLHVAAYGPAFGAAASLAMLLAGLALSAAGVGDGELQ  247

Query  699   PSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRIS  520
             P+ F +SLL G + +L +G  L +G  +S+NPL+    AGLL NA+N IP G LDGGRI+
Sbjct  248   PAAFQDSLLVGVLGQLFVGSKLAQGATVSLNPLLAAGWAGLLANALNCIPVGVLDGGRIA  307

Query  519   FSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNK  346
               +WGR+ + RL+   + LLG++ +F  ++ +WV+ +  LQRGPI+P  EE++ P+++
Sbjct  308   HGLWGRRNAGRLNIIGLFLLGVTGIFDTLSLFWVLFVIFLQRGPISPQREELSQPESQ  365



>ref|XP_005845043.1| hypothetical protein CHLNCDRAFT_137300 [Chlorella variabilis]
 gb|EFN52941.1| hypothetical protein CHLNCDRAFT_137300 [Chlorella variabilis]
Length=431

 Score =   207 bits (527),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 150/349 (43%), Positives = 215/349 (62%), Gaps = 5/349 (1%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEG-GVLFKGNLRGQAARSYEKISKRMQD  1219
             D+ +R+P+E I  L+D VF FD+FFVTS E Y   GVLF+GNLRG+ A +Y K+S R++D
Sbjct  42    DDNLRLPREVIQRLRDTVFSFDSFFVTSVENYNADGVLFRGNLRGEPAAAYSKLSARLKD  101

Query  1218  RFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPA  1039
               G+ YK++LL +PE+ KPVAVV+P   +QP  +++ E   A   G  T+ T L  N   
Sbjct  102   ELGEQYKIYLLDSPEE-KPVAVVLPVSAVQPQGSSLAETGLALLLGACTLATTLNINGAE  160

Query  1038  L-QANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             L  A LL+V  + +L+   +PG L    IL  HE  H + A++ G++L  P F+P+    
Sbjct  161   LFNAALLTVGWDPELVALAVPGTLAFLAILATHEAGHWVAARQRGLQLAPPLFIPAGLGL  220

Query  861   SFG--AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVF  688
               G  +ITRI + VP R  L   AAAGPLA  +L   +++ G  L      GV +D + F
Sbjct  221   LGGFGSITRIKSFVPDRTSLAAVAAAGPLASSALAAAIMVAGAVLTVQQVGGVELDVASF  280

Query  687   HESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIW  508
              ESLLAG + K + GD L +   +S NPL +   AGL+INAIN +PAGELDGGR+   + 
Sbjct  281   RESLLAGTMGKAMFGDRLFQSDAVSTNPLFVAGWAGLIINAINMLPAGELDGGRVFHGLC  340

Query  507   GRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEIT  361
             GR+ +ARL S ++ LLG+    + +A +W++L+  LQRGPI P   E++
Sbjct  341   GRRAAARLGSITLLLLGLGGFNNSLALFWLILVVTLQRGPIPPCDNELS  389



>tpg|DAA53530.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
Length=247

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K QQLD+++RIP
Sbjct  81    DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK-QQLDDSVRIP  139

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  140   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  199

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTA  1114
             FLLINPED+KPVAVV+P+ TLQP+TT 
Sbjct  200   FLLINPEDEKPVAVVIPKQTLQPETTG  226



>gb|ACF87459.1| unknown [Zea mays]
 tpg|DAA53524.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
 tpg|DAA53525.1| TPA: hypothetical protein ZEAMMB73_972585 [Zea mays]
Length=286

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 2/147 (1%)
 Frame = -1

Query  1551  DQDNGQNFGMLESKDLVNGNSVNVNAQTG-NEDADDIQIASGSPLPGLKPQQLDEAIRIP  1375
             D+       +L S D V     +  +  G  E+ + I++ASGSPLPG+K QQLD+++RIP
Sbjct  113   DETTNAEAALLSSGDTVQDMDADATSTNGIQENVEVIEVASGSPLPGMK-QQLDDSVRIP  171

Query  1374  KETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKL  1195
             K TIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG+ A+SYEKI+ R+Q++FGD YKL
Sbjct  172   KATIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGKPAKSYEKITSRLQNKFGDEYKL  231

Query  1194  FLLINPEDDKPVAVVVPRITLQPDTTA  1114
             FLLINPED+KPVAVV+P+ TLQP+TT 
Sbjct  232   FLLINPEDEKPVAVVIPKQTLQPETTG  258



>ref|WP_009555773.1| putative membrane-associated Zn-dependent protease [Oscillatoriales 
cyanobacterium JSC-12]
 gb|EKQ71117.1| putative membrane-associated Zn-dependent protease [Oscillatoriales 
cyanobacterium JSC-12]
Length=507

 Score =   199 bits (505),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 136/347 (39%), Positives = 204/347 (59%), Gaps = 14/347 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP E +  ++  +FG DTFF T   PY+ G +F+GNLR +A  +Y K+++ +++R GD Y
Sbjct  140   IPAEDLSAIQG-IFGIDTFFATETIPYQEGAIFRGNLRAEADEAYAKLAENLKERVGDRY  198

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LFL+ N +D KPV +V+P  +  P    +P+   A    LVTI T L        A L+
Sbjct  199   RLFLIEN-QDGKPVVIVLPS-SRDPQPMTIPQKILAVVLVLVTISTCLE------SAGLM  250

Query  1020  SVFDNFD---LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGA  850
               FD +     +   LP A     IL VHEI+H ++AQ+  ++L +P+F+P+ Q+GSFGA
Sbjct  251   LGFDFYAEPARVTETLPLAAGIITILTVHEIAHWVLAQRYHVRLSLPFFIPTLQLGSFGA  310

Query  849   ITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESlla  670
             +TRI +I+P R  L   A AGP AG  + F +L+ G  L     L  +  PS F +  + 
Sbjct  311   LTRIQSILPNRNVLFDIAFAGPAAGGIVSFGMLMTGLLLSHKGSLFQL--PSQFFQGSIL  368

Query  669   ggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSA  490
              G    ++     +   + VNPLV+    GL+I A+N +PAG+LDGGRI  SI+GRK +A
Sbjct  369   VGTLARVVLSESLQDPIVDVNPLVVLGWLGLVITALNLLPAGQLDGGRIVQSIYGRKVAA  428

Query  489   RlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             R +  ++ LLG ++L + +A YW +LI  LQR    P S E+T+PD+
Sbjct  429   RTTIGTLILLGFASLVNQLALYWAILILFLQRDLERPCSNELTEPDD  475



>ref|WP_006457279.1| peptidase, M50 family protein [Synechococcus sp. PCC 7335]
 gb|EDX87461.1| peptidase, M50 family protein [Synechococcus sp. PCC 7335]
Length=538

 Score =   199 bits (506),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 139/384 (36%), Positives = 216/384 (56%), Gaps = 23/384 (6%)
 Frame = -1

Query  1500  NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFF  1321
              G+SV+ N   G +++D++ I    P P + P+ L             + +  FG +TFF
Sbjct  147   EGDSVDGN---GVKESDEVDIED-QPSPPIPPEDLA------------IMEGFFGINTFF  190

Query  1320  VTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPR  1141
              T   P++ G +FKGNLRG+A ++ +++S+++ D+FGD Y+ FLL++PED KPV V+ P 
Sbjct  191   RTKTVPFQEGAVFKGNLRGEAEKTSQELSQKLVDKFGDRYQSFLLLDPED-KPVVVIFPS  249

Query  1140  ITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTA  961
                 P +T +P+   A A  + TI T +      LQ+    +F + +     LP  L   
Sbjct  250   KN-GPKSTTLPQRILAVALAIATIATCM-ETAAVLQS--FDIFQSPERWREALPIGLGIL  305

Query  960   LILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPl  781
              ILG+HEI H + A+K  I+L  P+ +P+WQ+G+FGAITR  +++P R  L   A AGP 
Sbjct  306   SILGIHEIGHLIYARKHSIRLSPPFLLPAWQLGAFGAITRFESVIPNRTVLFNIAFAGPA  365

Query  780   agfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPL  601
             AG    FI L  G  L  +     +  P+ F    +  G    L+     +   + V PL
Sbjct  366   AGGIFSFICLFWGLVLSQSGSPFQL--PAEFFRGSILVGGLARLILGDALQADLVDVQPL  423

Query  600   VLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYW  421
              +    GL+I AIN +PAG+LDGGR+  SI+GRKT  R ++ ++ LL I  LF+ +A YW
Sbjct  424   FIVGWIGLIITAINLLPAGQLDGGRVVQSIYGRKTLVRSTAVTLVLLAIVGLFNPLALYW  483

Query  420   VVLIFVLQRGPIAPLSEEITDPDN  349
              VLI  LQR P  P ++++++P++
Sbjct  484   AVLIVFLQRQPERPCTDDLSEPND  507



>ref|WP_017711300.1| hypothetical protein [Prochlorothrix hollandica]
Length=526

 Score =   198 bits (503),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/344 (39%), Positives = 200/344 (58%), Gaps = 8/344 (2%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             +P + +  +K  +FG DTFF T   PY+ GV+FKGNLRG+A  SYE+++ ++Q   GD Y
Sbjct  151   VPPDDLQKIKG-IFGIDTFFATETIPYQDGVIFKGNLRGEAQVSYERMATKLQQVLGDYY  209

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +L+L+ +P  D+P A+V+P  T  P    +P+   A    LVT+FT L R    LQ    
Sbjct  210   RLYLVADP-TDRPTAIVLPS-TNAPRVLTLPQQILAVGIFLVTVFTALERG--GLQYGF-  264

Query  1020  SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITR  841
              + ++FD L   LP  L    IL  HE+ H  +A++  ++LG P+F+PSWQ+GSFGAITR
Sbjct  265   ELLESFDRLREALPIGLGLVTILVGHELGHWFMARRHQVRLGFPFFIPSWQLGSFGAITR  324

Query  840   ILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggi  661
               +++P R  L   + AGP  G  L  + L LG  LPP D    +  P+ F +  L  G 
Sbjct  325   FESVLPNRSVLFDISLAGPAVGGILALVALGLGLVLPPGDLGIAL--PTPFFQGSLLVGT  382

Query  660   aklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARls  481
                L      +   + ++PL +    GL+I A+N +P G+LDGGRI  +I+GRKT+ R +
Sbjct  383   LGRLCLGGQLQDATVMLHPLFVAGWLGLVITALNLVPLGQLDGGRIVQAIYGRKTAGRTT  442

Query  480   sasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              A+I  L +++L + V  YW +L   LQR    P  EE+T+PD+
Sbjct  443   IAAIVFLIVASLSNPVVLYWAILAVFLQRQQERPSLEELTEPDD  486



>ref|WP_017663365.1| hypothetical protein [Geitlerinema sp. PCC 7105]
Length=527

 Score =   194 bits (494),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 134/347 (39%), Positives = 203/347 (59%), Gaps = 10/347 (3%)
 Frame = -1

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
             + +P++ +  ++ ++FG DTFF T   PY+ G +FKGNLRG+   +++++SK++ DR GD
Sbjct  160   LSVPEDDLHCIQ-KIFGIDTFFATETIPYQSGAIFKGNLRGEVEATHQELSKKLHDRVGD  218

Query  1206  LYKLFLLINPEDDKPVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQA  1030
              Y+LF  +N  D+K V VV+P R   QP TT   +   A    + TI T L      L  
Sbjct  219   RYRLF-FVNDPDEKTVVVVLPSRNDPQPLTTN--QQILAVVLFVATIVTTLETGGAFLGF  275

Query  1029  NLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGA  850
             +L   F+N +     LP AL    IL VHE+ H + A + GI L  P+F+P+WQIGSFGA
Sbjct  276   DL---FENLNRWTETLPLALGIWAILLVHELGHRIAAGRYGIALSPPFFLPTWQIGSFGA  332

Query  849   ITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESlla  670
             ITR  +++P R  L   A AGP+AG  L   +L +GF L     L  +  PS F    + 
Sbjct  333   ITRFESLLPNRSTLFDIAIAGPVAGGLLSLGMLAVGFVLSHDGSLFQL--PSEFFRGSVL  390

Query  669   ggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSA  490
              G+          + + + V+PLV+    GL+INA+N IPAG+LDGGR+  +I+GR+ + 
Sbjct  391   VGLLAKAFLGEALQKSLVDVHPLVVLGWLGLVINALNLIPAGQLDGGRVMQAIYGRRIAG  450

Query  489   RlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             R + A++ +L I++  + +A YW ++I V+QR    P   EIT+PD+
Sbjct  451   RSTIATLIVLAIASFVNPLALYWAIVILVIQRDLERPSLNEITEPDD  497



>ref|WP_015199055.1| peptidase M50 [Calothrix parietina]
 ref|YP_007138400.1| peptidase M50 [Calothrix sp. PCC 6303]
 gb|AFZ02428.1| peptidase M50 [Calothrix sp. PCC 6303]
Length=493

 Score =   193 bits (491),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 140/353 (40%), Positives = 209/353 (59%), Gaps = 16/353 (5%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
              E I IP+E +  +K  VFG DTFF T   PY+ G +FKGNLRG+A  +Y ++S  +QD+
Sbjct  122   SEIIPIPEEDLTSIKG-VFGIDTFFATETIPYQNGAIFKGNLRGEAEITYNRLSSNLQDK  180

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
              G+ Y+LFL+ N  D+KPV V++P +   P    + +   AG   + TI T         
Sbjct  181   LGNKYRLFLVEN-TDNKPVVVILPSLN-DPQPATIAQNVFAGILLIATIAT------SFE  232

Query  1035  QANLLSVFDNFD----LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQ  868
              A LL  FD F      LE  LP  L   +IL +HEI H ++A++  ++LG+P+F+P+ Q
Sbjct  233   AAGLLLNFDFFSQPQRYLEV-LPIGLGIFVILIIHEIGHWVIARRYQVRLGLPFFLPAIQ  291

Query  867   IGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVF  688
             IGSFGAITR  +++P R+ L   A AGP AG  +  ++L+LG  L     L  +  PS F
Sbjct  292   IGSFGAITRFESLLPSRKVLFDIALAGPAAGGIVSILILVLGLLLSNPTSLFQL--PSEF  349

Query  687   HESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIW  508
              +  +  G    ++  +  +   ++VNPLV+    GL+I A+N +PAG+LDGGRI  +I+
Sbjct  350   FQGSILVGSLAKVILGSTLQAGIVNVNPLVIVGWVGLVITALNLMPAGQLDGGRIVQAIY  409

Query  507   GRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             GRK ++R + A+I +L + AL + +A YW ++I  LQR    P   EIT+PD+
Sbjct  410   GRKIASRATLATIAVLVLVALGNPLAMYWAIVIVFLQRDLERPSLNEITEPDD  462



>ref|WP_015191816.1| peptidase M50 [Stanieria cyanosphaera]
 ref|YP_007131109.1| peptidase M50 [Stanieria cyanosphaera PCC 7437]
 gb|AFZ34143.1| peptidase M50 [Stanieria cyanosphaera PCC 7437]
Length=497

 Score =   193 bits (491),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 208/351 (59%), Gaps = 11/351 (3%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+E +  +K  +FG DTFF T    Y+ G +FKGNLRG+A   +  ++ +++ + 
Sbjct  123   EVVPIPEEDLAKIKG-IFGIDTFFATETISYQDGAIFKGNLRGEADLVHTSLTNKLKQQL  181

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ +PE+ KPV V++P  T  P  T + +   A    L TI T L      L 
Sbjct  182   GDKYRLFLVESPEE-KPVIVILPS-TNDPQPTTLAQKNLALVLLLATIVTSLEAAGLLLG  239

Query  1032  ANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
              +L   F NF+  +  +P +L    IL VHEI H ++A++  I+L VP+F+P+WQIGSFG
Sbjct  240   FDL---FSNFNRYQEAIPLSLGLWTILAVHEIGHRILAKRYDIRLSVPFFLPTWQIGSFG  296

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITR  +++P R  L   A AGP AG  +  +LL++G  L     +  +  P+VF +  +
Sbjct  297   AITRFESLLPSRTALFDIAFAGPAAGGLISLLLLVIGLVLSHPGSMFQI--PTVFFQGSI  354

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
               G    ++  +  +   + VNPLVL    GL+I ++N +PAG+LDGGRI  +I+GRKT+
Sbjct  355   LVGALAKVVLGSTLQTNIVDVNPLVLIGWLGLVITSLNLLPAGQLDGGRIVHAIYGRKTA  414

Query  492   ARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              R + A++ LLGI ALF   + +  YW +LI  LQR    P   E+++PD+
Sbjct  415   RRATIATLILLGIVALFNPSNPIPLYWAILILFLQRELERPTMNELSEPDD  465



>ref|WP_019505679.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=502

 Score =   193 bits (491),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 206/355 (58%), Gaps = 17/355 (5%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
              E + IP E +  LK  +FG DTFF T   PY+ G +FKGNLRG+   ++ K++++++  
Sbjct  127   QEILPIPDEDLAQLK-AIFGIDTFFATETIPYQDGAIFKGNLRGEPDIAHSKMNQKLEGI  185

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
             F D Y+LFL+ +PE+ KPV V++P+ T  PDTT +    A     LV     +L ++ A 
Sbjct  186   FQDKYRLFLVESPEE-KPVVVILPK-TNDPDTTTL----AQKNLALVLFVGTILTSLEA-  238

Query  1035  QANLLSVFD---NFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
              A+LL  FD   +F      +P +L    +L  HEI H +VA +  I+L +P+F+P+WQI
Sbjct  239   -ASLLQGFDLFSDFGRYSEAIPLSLGLWAVLIAHEIGHRVVANRYNIRLSIPFFLPTWQI  297

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   + AGP     +  +LL+ G  L     L  +  P+ F 
Sbjct  298   GSFGAITRFESLLPNRTALFDISFAGPATAGIISLVLLVSGLTLSHPGSLFQL--PTEFF  355

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
                +  G    ++  +  E   + +NPLV+    GL+I A+N +PAG+LDGGRI   I+G
Sbjct  356   RGSILVGTLAKVILGSSLEAAVVDINPLVVVGWLGLVITALNLLPAGKLDGGRIVHGIYG  415

Query  504   RKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R + A++ +LG+ ALF   + +  YW VLI  LQR    P+  E+T+PD+
Sbjct  416   RKTARRTTVATLIILGLIALFNPSNPIPLYWAVLILFLQRDLERPVKNELTEPDD  470



>ref|WP_015230981.1| membrane-associated Zn-dependent protease [Dactylococcopsis salina]
 ref|YP_007173364.1| membrane-associated Zn-dependent protease [Dactylococcopsis salina 
PCC 8305]
 gb|AFZ52007.1| putative membrane-associated Zn-dependent protease [Dactylococcopsis 
salina PCC 8305]
Length=504

 Score =   192 bits (488),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 139/391 (36%), Positives = 214/391 (55%), Gaps = 30/391 (8%)
 Frame = -1

Query  1473  QTGNEDADDIQIASGSPLP-----GLKPQQLDEAIR--IPKETIDILKDQVFGFDTFFVT  1315
             Q  NE   D Q     P P     G  P+      R  IP+E +  ++  +FG DTFF T
Sbjct  96    QQANERLQDKQALDDHPEPDNNQQGETPEAETNTNRPPIPEEDLKTIQS-LFGIDTFFST  154

Query  1314  SQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRIT  1135
                PY+ G +FKGNLR    + YE+++ +++ + G+ Y+LFL+  PE+ KPV +V+P  T
Sbjct  155   ETIPYQDGAIFKGNLRADPEKVYEQLTNKLKQKLGEKYRLFLVEGPEN-KPVVIVLPS-T  212

Query  1134  LQPDTTAVPEWFAAGAFGLVTI------FTLLLRNVPALQANLLSVFDNFDLLENGLPGA  973
               P  +   E   A    +VT       F+LLL            +F N +     +P A
Sbjct  213   NDPQPSTTTEQVLAVVLMIVTAVSSVEAFSLLLG---------FDLFSNLERFREAVPFA  263

Query  972   LVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAA  793
             L   +ILG HE+ H ++AQ+ G++L +P+F+PS QIGSFG ITRI +++P R  L + A 
Sbjct  264   LGLGIILGAHEVGHRVIAQRYGVRLSLPFFIPSLQIGSFGGITRIESLLPSRSILFELAL  323

Query  792   AGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPIS  613
             AGP  G  +  ++L++G  L     L  V  P+ F +  +  G    ++  +  E + + 
Sbjct  324   AGPAVGGLVSLLMLVVGLVLSQPGSLFQV--PTQFFQGSILVGTLAKIVLGSQLEASIVD  381

Query  612   VNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF---  442
             V+PL +    GL+I A+N +PAG+LDGGRI  +I+GRKT+ R + A++ +LGI A+    
Sbjct  382   VHPLTVMGWLGLVITALNLMPAGQLDGGRIVQAIYGRKTARRTTVATLIVLGIVAITNPS  441

Query  441   SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + +  YW +LI  LQR    P   E+T+PD+
Sbjct  442   NPIPLYWGILILFLQRSLERPSLNELTEPDD  472



>ref|WP_016952522.1| peptidase M50 [Anabaena sp. PCC 7108]
Length=499

 Score =   192 bits (487),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 209/354 (59%), Gaps = 20/354 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             +A+ IP+E +  +K  +FG DTFF T   PY+ GV+FKGNLRG+    + +++K +Q+R 
Sbjct  128   DAMTIPEEDLSTIKG-IFGIDTFFATETIPYQEGVIFKGNLRGEPEEVHNRLTKSLQERL  186

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  DDKPV +V+P  T  P    +P+      F ++ +   +  N  A  
Sbjct  187   GDKYRLFLVEN-TDDKPVMIVLPSRT-DPRPMQLPQ----KVFAVILLVATIATNFEA--  238

Query  1032  ANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             A LL    NFDL  N       LP  L    IL VHEI H ++A++  ++L +P+F+P+ 
Sbjct  239   AGLLL---NFDLFSNPSRFPEALPIGLGIFTILIVHEIGHWIMARRHQVRLSLPFFLPAV  295

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITR  +++P R+ L   A AGP  G  +  I+L+ G  L     L  +  P+ 
Sbjct  296   QIGSFGAITRFESLLPNRKALFDIALAGPAFGGIVSLIMLVTGLLLSHPGSLFQL--PNQ  353

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++  A  +   ++V+PLV+    GL+I A+N +PAG+LDGGR+  +I
Sbjct  354   FFQGSILVGSLARVVLGAAVKAPLVNVHPLVIIGWLGLVITALNLMPAGQLDGGRVVQAI  413

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+ R + A++ LLG+ +L + +A YW ++I  LQR    P   E+T+PD+
Sbjct  414   YGRKTAGRATFATLILLGLVSLGNPLAMYWAIVILFLQRDLERPSLNEVTEPDD  467



>ref|WP_023064717.1| peptidase M50 family protein [Lyngbya aestuarii]
 gb|ERT09172.1| peptidase M50 family protein [Lyngbya aestuarii BL J]
Length=508

 Score =   191 bits (486),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 139/381 (36%), Positives = 215/381 (56%), Gaps = 17/381 (4%)
 Frame = -1

Query  1473  QTGNEDADDIQIASGS-PLPGLKP--QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEP  1303
              T NE  +   + SG+ P P  K      ++   IP E + I+++ +FG DTFF T   P
Sbjct  107   HTPNETEEKSSVESGAAPSPPEKKLTDTEEKPTPIPPEDLKIIQN-IFGIDTFFATETLP  165

Query  1302  YEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPD  1123
             Y+ G++FKGNLR    ++Y ++S+ ++ + GD ++LFL+ NPE  KPV +V+PR    P 
Sbjct  166   YQEGIIFKGNLRTDPEQAYTRLSEHLEQKMGDRFRLFLVENPE-GKPVVIVLPRKN-DPQ  223

Query  1122  TTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNF---DLLENGLPGALVTALIL  952
             +T +P+   A    LV++FT           +LL  FD F   +     LP AL    IL
Sbjct  224   STTIPQKVLAIILLLVSVFTTF------EAGSLLLGFDFFTEPNRYAETLPIALGLFSIL  277

Query  951   GVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagf  772
               HEI+H L+A++  +K G P+F+P+ Q+G+FGA  R  +I+P R+ L   A AGP AG 
Sbjct  278   ASHEIAHQLMAKRHHVKFGWPFFIPTIQVGTFGAFNRFESILPNRKVLFDVAFAGPAAGG  337

Query  771   slgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLW  592
              L   +L +G  L     L  +  P+ F +  +  GI    +  +    + + V+PL + 
Sbjct  338   LLSLGMLFIGLVLSHPGSLFQI--PTEFFKGSVLVGILAKTVLGSALHKSIVDVHPLTII  395

Query  591   SLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVL  412
                GL+I AIN +PAG+LDGGRI  +I+GRK + R + A+  +L I++L + +A YW V+
Sbjct  396   GWLGLVITAINLMPAGQLDGGRIMQAIYGRKIAGRSTLATFVVLAIASLVNSLALYWAVV  455

Query  411   IFVLQRGPIAPLSEEITDPDN  349
             I +LQR    P   E+T+PD+
Sbjct  456   ILILQRNLERPSLNELTEPDD  476



>ref|WP_015151797.1| putative membrane-associated Zn-dependent protease [Oscillatoria 
acuminata]
 ref|YP_007089111.1| putative membrane-associated Zn-dependent protease [Oscillatoria 
acuminata PCC 6304]
 gb|AFY85191.1| putative membrane-associated Zn-dependent protease [Oscillatoria 
acuminata PCC 6304]
Length=502

 Score =   191 bits (485),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/355 (38%), Positives = 199/355 (56%), Gaps = 22/355 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQ-VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
             E +RIP+E  D+ K Q +FG DTFF T    Y+ G +FKGNLRG    +Y+++++ +Q+R
Sbjct  131   EFVRIPEE--DLKKIQGIFGIDTFFATETISYQEGAIFKGNLRGDPEEAYDRLAQSLQER  188

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
              GD Y+LFL+ NP D+KPVA+V+P  T  P  T   +   A    + TI T L       
Sbjct  189   MGDRYRLFLVPNP-DEKPVAIVLPS-TSDPKPTTRGQKILAVVLLVATIITSL-------  239

Query  1035  QANLLSVFDNFDLLENGLPGALVTALILGV------HEISHTLVAQKAGIKLGVPYFVPS  874
                   +F  FD   N      V  L LG+      HEI+H ++AQK  ++L  P+F+P+
Sbjct  240   --ETAGLFLGFDFFTNPQRLGEVLPLTLGIWAVLLSHEIAHRIIAQKNNVRLSWPFFIPT  297

Query  873   WQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPS  694
             WQIGSFGAI R   ++P R  L   A AGP AG  +   +L++G  L     L  +  P+
Sbjct  298   WQIGSFGAINRFETLLPNRTVLFDVAFAGPAAGGLVSLAMLIVGLLLSHEGSLFQI--PA  355

Query  693   VFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFS  514
              F +  +  G    ++  +      + V+P+++    GL+I AIN +PAG+LDGGRI  S
Sbjct  356   EFFQGSVLVGTLAKVVLGSALNQPLVPVHPMMVIGWLGLVITAINLLPAGQLDGGRIVQS  415

Query  513   IWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             ++GR  + R + A+  +L I+A F+ +A YW ++I  LQRG   P   EI +PD+
Sbjct  416   VYGRTIAGRATIATAIVLAIAAFFNPLALYWAIVILFLQRGLERPSLNEIKEPDD  470



>ref|WP_015205332.1| peptidase M50 [Crinalium epipsammum]
 ref|YP_007144751.1| peptidase M50 [Crinalium epipsammum PCC 9333]
 gb|AFZ15241.1| peptidase M50 [Crinalium epipsammum PCC 9333]
Length=508

 Score =   191 bits (484),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 131/358 (37%), Positives = 210/358 (59%), Gaps = 17/358 (5%)
 Frame = -1

Query  1404  QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRM  1225
             Q++   + IP   +  ++  +FG DTFF T    Y+ G +FKGNLRG+ A ++E++S  +
Sbjct  130   QEVKAVLPIPDADLKSIQG-IFGIDTFFATETIAYQEGAIFKGNLRGEPAATHERLSASL  188

Query  1224  QDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             Q+R GD Y+LFL+ +PE  KPV VV+P  T  P  + +P+   A    L TI + L    
Sbjct  189   QERMGDRYRLFLVESPE-GKPVVVVLPS-TNDPQPSTIPQKILAVVLFLATIASSL----  242

Query  1044  PALQANLLSVFD---NFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS  874
                 A L   FD   N + ++  LP  +   ++L  HEI+H ++A++  I+L +P+F+PS
Sbjct  243   --ETAGLFLGFDLSSNVERIKETLPITIGIWVVLASHEIAHRVIAKRHNIRLSLPFFLPS  300

Query  873   WQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPS  694
             WQI SFGAITR  +++P R  L   A +GP  G  + F++L++G  L     L  +  P+
Sbjct  301   WQIASFGAITRFESLIPNRSVLFDIACSGPAIGGIISFLMLIIGLLLSHPGSLFQL--PA  358

Query  693   VFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFS  514
              F +  +  G    ++  +  + T + ++PL +    GL++ A+N +PAG+LDGGRI  +
Sbjct  359   QFFQGSILVGTLAKVILGSALQNTIVDIHPLAIIGWLGLVVTALNLMPAGQLDGGRIVQA  418

Query  513   IWGRKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I+GRKT+ R + A++ +LGI ++    + + FYWV+ I  LQRG   P   EIT+PD+
Sbjct  419   IYGRKTAQRATIATLIILGIVSIVNPGNPIIFYWVIAILFLQRGLERPSLNEITEPDD  476



>ref|WP_011317918.1| peptidase M50 [Anabaena variabilis]
 ref|YP_321589.1| peptidase M50 [Anabaena variabilis ATCC 29413]
 gb|ABA20694.1| Peptidase M50 [Anabaena variabilis ATCC 29413]
Length=493

 Score =   189 bits (481),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 141/378 (37%), Positives = 215/378 (57%), Gaps = 17/378 (4%)
 Frame = -1

Query  1464  NEDADDIQIASGSPLPGLKPQQLD---EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEG  1294
              + A +   A  SP P   PQ +    E + IP+E ++++K  +FG DTFF T    Y+ 
Sbjct  95    KQRATERLAAESSPAPENIPQPVGVVVEIMPIPEEDLNVIKG-IFGIDTFFATETIAYQE  153

Query  1293  GVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTA  1114
             G +FKGNLRG+    + ++SK +QD+ GD Y+LFL+ N  D KPV +V+P  T  P  T 
Sbjct  154   GAIFKGNLRGEPQEVHTRLSKSLQDKLGDKYRLFLVEN-TDTKPVVIVLPS-TNDPRPTT  211

Query  1113  VPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDL---LENGLPGALVTALILGVH  943
             +P+   A    + TI T L        A LL  FD F     L+  LP  +    IL  H
Sbjct  212   LPQKAFAAILAIATIGTSL------ETAGLLLNFDLFSTPARLQEALPIGVGIFAILVAH  265

Query  942   EISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslg  763
             EI H LVA++  ++L  P+F+P+ QIGSFGAITR  +++P R  L   A AGP+AG  + 
Sbjct  266   EIGHWLVARRHQVRLSWPFFLPAVQIGSFGAITRFESLLPNRSVLFDIAVAGPIAGGIVS  325

Query  762   fillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLA  583
              ++L++G  L     L  +  P+ F +  +  G    ++  +  +   ++V+PLV+    
Sbjct  326   LLMLIVGLLLSHQGSLFQL--PNQFFQGSILVGSLARVVLGSALQSPLVNVHPLVIIGWL  383

Query  582   GLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFV  403
             GL+I A+N +PAG LDGGRI  +I+GRKT+ R + A++ +L + +L + +A YW ++I  
Sbjct  384   GLVITALNLMPAGSLDGGRIIQAIYGRKTAGRATFATLIVLALVSLGNALAMYWAIVILF  443

Query  402   LQRGPIAPLSEEITDPDN  349
             LQR    P   EI++PD+
Sbjct  444   LQRDLERPNLNEISEPDD  461



>ref|WP_015215624.1| peptidase M50 [Anabaena cylindrica]
 ref|YP_007157912.1| peptidase M50 [Anabaena cylindrica PCC 7122]
 gb|AFZ59002.1| peptidase M50 [Anabaena cylindrica PCC 7122]
Length=498

 Score =   189 bits (481),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 208/361 (58%), Gaps = 24/361 (7%)
 Frame = -1

Query  1413  LKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKIS  1234
             LKP+++     IP+E +  +K  +FG DTFF T   PY+ G +FKGNLRG+    + +++
Sbjct  125   LKPEEMT----IPEEDLHTIKG-IFGIDTFFATETIPYQEGAIFKGNLRGEPEEVHNRLT  179

Query  1233  KRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
             K +Q R GD Y+LFL+ N  D KPV +V+P     P    +P+   A    L TI T   
Sbjct  180   KSLQGRLGDKYRLFLVEN-TDGKPVMIVLPSRN-DPRPMQLPQKVFAVILLLATIAT---  234

Query  1053  RNVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGV  892
                 +L+A+   +  NFDL  +       LP  L    IL  HEI H ++AQ+  ++L +
Sbjct  235   ----SLEAS--GLLLNFDLFSSPSRFPEALPIGLGICTILIAHEIGHWILAQRHQVRLSL  288

Query  891   PYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglG  712
             P+F+P+ QIGSFGAITR  +++P R+ L   A AGP  G  +  ++L+ G  L     L 
Sbjct  289   PFFLPAVQIGSFGAITRFESLLPNRKALFDIALAGPAFGGIVSLLMLVTGLLLSHPGSLF  348

Query  711   VVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDG  532
              +  P+ F +  +  G    ++  A  +   ++V+PLV+    GL+I A+N +PAG+LDG
Sbjct  349   QL--PNQFFQGSILVGSLARVVLGAAVKAPLVNVHPLVIIGWLGLVITALNLMPAGQLDG  406

Query  531   GRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
             GRI  +I+GRKT+ R + A++ LL + +L + +A YW ++IF LQR    P   E+T+PD
Sbjct  407   GRIVQAIYGRKTAGRATFATLALLALVSLGNTLAMYWAIVIFFLQRDAERPSLNEVTEPD  466

Query  351   N  349
             +
Sbjct  467   D  467



>ref|WP_015171010.1| peptidase M50 [Geitlerinema sp. PCC 7407]
 ref|YP_007108495.1| peptidase M50 [Geitlerinema sp. PCC 7407]
 gb|AFY65443.1| peptidase M50 [Geitlerinema sp. PCC 7407]
Length=497

 Score =   189 bits (479),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 134/361 (37%), Positives = 213/361 (59%), Gaps = 13/361 (4%)
 Frame = -1

Query  1410  KPQQLDEAIR-IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKIS  1234
             +PQ+ + A   +P E +  ++  +FG +TFF T   PY+ GV+FKGNLRG+ A ++E++S
Sbjct  111   QPQEPEPAFTPVPAEDLQKMRG-LFGIETFFATETIPYQDGVIFKGNLRGEPAATHERLS  169

Query  1233  KRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
               + ++ GD Y+LFL+ N +D KPV +V+P     P      + FA   F L T+ T L 
Sbjct  170   SALTEQLGDRYRLFLVEN-QDQKPVVIVLPSANDPPKGGLAQKVFAVPLF-LATVATCLE  227

Query  1053  RNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS  874
             R    L  ++LS   +   L++ LP  L    ++ +HE+ H + A++  I+L  PYF+P+
Sbjct  228   RGGLQLGVDVLS---DPQRLQDALPLGLGILAVILLHEVGHWVTARRYKIRLSWPYFIPA  284

Query  873   WQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadgl------G  712
             WQ+GSFGAITR  +++P R  L   A AGP  G  L  ++L++G  L    GL       
Sbjct  285   WQLGSFGAITRFESLLPNRTVLFDIAFAGPAVGALLSLVMLVVGLLLSIPSGLPQPLPGY  344

Query  711   VVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDG  532
                 P+ F E  +  G    ++  A  + T ++++PL+     GL+I A+N +PAG+LDG
Sbjct  345   FETVPTEFFEGSILVGTLARVILGAELKDTVVNIHPLMAVGWLGLVITALNLLPAGQLDG  404

Query  531   GRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
             GRI  +I+GR+ +ARL+  ++ LL I++L + +A YW VL+  LQR P  P  EE+T+P+
Sbjct  405   GRIVQAIYGRRVAARLTVGTLILLAIASLANPLALYWGVLVLFLQRQPERPTLEELTEPN  464

Query  351   N  349
             +
Sbjct  465   D  465



>ref|WP_009784378.1| Peptidase M50 [Lyngbya sp. PCC 8106]
 gb|EAW37138.1| Peptidase M50 [Lyngbya sp. PCC 8106]
Length=509

 Score =   188 bits (478),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 129/352 (37%), Positives = 204/352 (58%), Gaps = 14/352 (4%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
             D+   IP + + I+++ +FG DTFF T   PY+ G++FKGNLR    ++Y ++S+ ++ +
Sbjct  137   DKPTPIPPDDLKIIQN-IFGIDTFFATETLPYQEGIIFKGNLRTDPEQAYTRLSENLEQK  195

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
              GD ++LFL+ NPE  KPV +V+PR    P +T +P+   A    LV++FT         
Sbjct  196   MGDRFRLFLVENPE-GKPVVIVLPRKN-DPQSTTIPQKVLAIILLLVSVFTTF------E  247

Query  1035  QANLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
               +LL  FD F   +     LP A+    IL +HEI+H L+A++  +K   P+F+P+ Q+
Sbjct  248   AGSLLLGFDFFTEPNRYAEILPIAIGLCSILALHEIAHQLIAKRHHVKFSWPFFIPTIQV  307

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             G+FGA  R  +I+P R+ L   A AGP AG  L   +L +G  L     L  +  P+ F 
Sbjct  308   GTFGAFNRFESILPNRKVLFDVAFAGPAAGGLLSLAMLFIGLVLSHPGSLFQI--PTEFF  365

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  GI    +  +    + + V+PL +    GL+I AIN +PAG+LDGGRI  +I+G
Sbjct  366   KGSVLVGILAKTVLGSALHQSIVDVHPLTIIGWLGLVITAINLMPAGQLDGGRIMQAIYG  425

Query  504   RKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RK + R + A+  +L I++L + +A YW V+I +LQR    P   E+T+PD+
Sbjct  426   RKVAGRSTLATFIVLAIASLVNSLALYWAVVILILQRNLERPSLNELTEPDD  477



>ref|WP_009545030.1| MULTISPECIES: peptidase M50 [Cyanothece]
 ref|YP_001803683.1| hypothetical protein cce_2267 [Cyanothece sp. ATCC 51142]
 gb|ACB51617.1| unknown [Cyanothece sp. ATCC 51142]
Length=502

 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 131/357 (37%), Positives = 208/357 (58%), Gaps = 11/357 (3%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             +P+ + + I IP E + ++K  +FG DTFF T    Y+ G +F+GNLRG    SY+K+S+
Sbjct  122   EPKNVGDVIPIPDEDLQLIKG-IFGIDTFFATETISYQEGAIFRGNLRGDPDESYQKMSE  180

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
             ++++ FG+ Y+LFL +   + KPV +++P  T  P  T + +   A    + T+ T L  
Sbjct  181   KLKNNFGEKYRLFL-VEGTEGKPVVIILPS-TDDPQPTTLLQKNLALVLFVATVVTTLEA  238

Query  1050  NVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
                 L  +L   F+N++  +  +P +L    +L  HEI H +VA++  I++ VP+F+P+W
Sbjct  239   ASILLGFDL---FNNWNRYQEAVPISLALWSVLISHEIGHRIVAKRYNIRMSVPFFLPTW  295

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITR  +++P R  L   A AGP  G  L FILL++G  L     L  V  P+ 
Sbjct  296   QIGSFGAITRFESLIPTRNALFDTALAGPACGGILSFILLIVGLTLSHDGSLFQV--PTQ  353

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++     + + + V+PL +    GL+I A+N +PAG+LDGGRI  +I
Sbjct  354   FFQGSILVGSLAKVIIGDQLQNSIVDVHPLTVVGWLGLVITALNLMPAGQLDGGRIIQAI  413

Query  510   WGRKTSARlssasigllgisaLFS---DVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+ R +  ++ +LGI  +FS    +  YW V+I  LQR    P   E+T+PD+
Sbjct  414   YGRKTARRTTIITLVILGIVTIFSPANPIPLYWAVIILFLQRDLERPSLNELTEPDD  470



>ref|WP_008277029.1| Peptidase M50 [Cyanothece sp. CCY0110]
 gb|EAZ89860.1| Peptidase M50 [Cyanothece sp. CCY0110]
Length=502

 Score =   188 bits (477),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 135/380 (36%), Positives = 212/380 (56%), Gaps = 18/380 (5%)
 Frame = -1

Query  1479  NAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPY  1300
              AQ   +D D+         PG +P+ + + I IP E + ++K  +FG DTFF T    Y
Sbjct  106   EAQKAEKDNDNSS-------PGAEPKNVGDVIPIPDEDLQVIKG-IFGIDTFFATETISY  157

Query  1299  EGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDT  1120
             + G +F+GNLRG    SY K+S++++  FG+ Y+LFL +   + KPV +++P  T  P  
Sbjct  158   QEGAIFRGNLRGDPDESYHKLSEKLKANFGEKYRLFL-VEGTEGKPVVIILPS-TDDPQP  215

Query  1119  TAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHE  940
             T + +   A    + T+ T L      L  +L   F N++  +  +P +L    +L  HE
Sbjct  216   TTLLQKNLALVLFVATVVTTLEAASILLGFDL---FSNWNRYQETIPISLALWGVLLSHE  272

Query  939   ISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgf  760
             I H +VA++  I + +P+F+P+WQIGSFGAITR  +++P R  L   A AGP  G  L F
Sbjct  273   IGHRIVAKQYNINMSLPFFLPTWQIGSFGAITRFESLIPSRNALFDVALAGPACGGILSF  332

Query  759   illllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAG  580
             I+L++G  L     L  V  P+ F +  +  G    ++     + + + V+PL +    G
Sbjct  333   IMLIVGLSLSHEGSLFQV--PTQFFQGSILVGSLAKVIIGEQLQNSIVDVHPLTVVGWLG  390

Query  579   LLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFS---DVAFYWVVLI  409
             L+I A+N +PAG+LDGGRI  +I+GRKT+ R +  ++ +LGI  +FS    +  YW V+I
Sbjct  391   LVITALNLMPAGQLDGGRIIQAIYGRKTARRTTIITLVILGIVTIFSPANPIPLYWAVII  450

Query  408   FVLQRGPIAPLSEEITDPDN  349
               LQR    P   E+T+PD+
Sbjct  451   VFLQRDLERPSLNELTEPDD  470



>ref|XP_002958157.1| hypothetical protein VOLCADRAFT_119887 [Volvox carteri f. nagariensis]
 gb|EFJ40782.1| hypothetical protein VOLCADRAFT_119887 [Volvox carteri f. nagariensis]
Length=531

 Score =   188 bits (478),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 143/358 (40%), Positives = 205/358 (57%), Gaps = 23/358 (6%)
 Frame = -1

Query  1386  IRIPKETIDILKDQVFGFDTFFVTSQEPY-EGGVLFKGNLRGQ-AARSYEKISKRMQDRF  1213
             +++PK+ ID LK  VFGFDTF+VTS + Y   GV+FKGN+RG+  A SY+K+  R+Q  F
Sbjct  141   VKMPKDVIDKLKTSVFGFDTFWVTSVDNYGHDGVVFKGNVRGRDPAVSYQKMRDRLQAAF  200

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRI---TLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVP  1042
                Y+LFLL + +D+KP  VV+P+I   +L    T V  + AAGA  L+  F        
Sbjct  201   SGAYQLFLLED-KDEKPTVVVLPQIWLASLFALATTVTSFNAAGA-PLLEFFI-------  251

Query  1041  ALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS--WQ  868
                A   +     D ++  LPG L     LG H+  H   A++ G++L +P+++P+    
Sbjct  252   ---APFSTAITQQDFVD-ALPGVLAFFFALGSHDFGHYQAARRHGLELYLPFYLPAGFGL  307

Query  867   IGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg--lGVVVDPS  694
             +GSFG+ITR+ N VP RE LL  A +GPL G ++   +LLLG  L  A      V VD +
Sbjct  308   LGSFGSITRVRNFVPSREALLDLAVSGPLLGSAVSGAMLLLGLVLTRAAAGIGTVGVDTA  367

Query  693   VFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFS  514
                +S L   +A L +G          VN LVL   AGL+ NA+N IPAGELDG ++   
Sbjct  368   ALADSTLVALLAGLFVGPEGLAQPVTEVNFLVLAGWAGLIANALNLIPAGELDGAKMVLG  427

Query  513   IWGRKT-SARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKY  343
              WGR+T SA     +  L   +   + ++FYWV+L+  LQRGPI+P  EE++ P N++
Sbjct  428   CWGRRTASAVSVFTTGALGFSAITGNALSFYWVLLLLFLQRGPISPCCEELSVPKNEF  485



>ref|WP_015159790.1| putative membrane-associated Zn-dependent protease [Chamaesiphon 
minutus]
 ref|YP_007097171.1| putative membrane-associated Zn-dependent protease [Chamaesiphon 
minutus PCC 6605]
 gb|AFY93644.1| putative membrane-associated Zn-dependent protease [Chamaesiphon 
minutus PCC 6605]
Length=499

 Score =   187 bits (476),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 131/357 (37%), Positives = 208/357 (58%), Gaps = 23/357 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             + + IP+  +  +K  +FG DTF+ T    Y+ G +FKGNLRG+AA  + ++++++Q + 
Sbjct  125   DMLTIPEADLSSIKG-IFGIDTFYATETLAYQQGAIFKGNLRGEAAVVHRRLTEKLQTKL  183

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LF++ +PE ++PV VV+P  +  P    VP+   A    + TI T       +L+
Sbjct  184   GDKYRLFMVPDPE-ERPVVVVLPS-SNDPQGATVPQQILAVVMFIATIAT-------SLE  234

Query  1032  ANLLSVFDNFDLLENG------LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             A  + VF  FD  E+       LP  L    IL  HE+ H ++A+   +K+G+P+F+P+ 
Sbjct  235   A--MGVFLGFDFYEHPDRVREILPLVLGVWTILISHELGHQILARMRQVKIGLPFFLPTG  292

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFG+ITR  ++VP R  L   A AGP  G  L   +L++G  L  A     +  PS 
Sbjct  293   QIGSFGSITRFESLVPDRSTLFDIALAGPAIGGLLSLAMLIVGLLLSHAGSGLEI--PSQ  350

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++  +      +S++PLV+    GL+INA+N +PAG+LDGGRI  +I
Sbjct  351   FLQGSILVGAIAKIVLGSTAHQATLSIHPLVIIGWLGLVINALNLMPAGQLDGGRIVQAI  410

Query  510   WGRKTSARlssasigllgisaLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+ R +  ++ +LG  A F+    V FYW++L+  LQRG   P  +EIT+P++
Sbjct  411   YGRKTAQRSTLITLVILGFVAFFNPANLVIFYWLILVGFLQRGLERPSLDEITEPND  467



>ref|WP_013191411.1| peptidase M50 [Trichormus azollae]
 ref|YP_003721517.1| peptidase M50 ['Nostoc azollae' 0708]
 gb|ADI64394.1| peptidase M50 ['Nostoc azollae' 0708]
Length=492

 Score =   186 bits (473),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 133/354 (38%), Positives = 204/354 (58%), Gaps = 20/354 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             + I IP+E ++ +K  +FG DTFF T   PY+ G + KGNLRG+    +  + + +Q+R 
Sbjct  122   QPITIPEEDLNTIKG-IFGIDTFFATETIPYQEGAILKGNLRGEPEEVHNHLMRSLQERL  180

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D KPV +V+P  T  P    +P+      F ++ +   +  N+ A  
Sbjct  181   GDKYRLFLMEN-TDGKPVMIVLPSRT-DPKPIQLPQ----KVFAVILLVATIATNLEA--  232

Query  1032  ANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             A LL    NFDL+ N       LP  L    IL  HEI H  + +K  +KL  P+F+P+ 
Sbjct  233   AGLLL---NFDLVANPGRFSEALPIGLGIFTILIAHEIGHWFLGRKHQVKLSWPFFLPAV  289

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITR  +++P R+ L   A AGP  G  +  I+L+ G  L     L  +  P+ 
Sbjct  290   QIGSFGAITRFESLLPNRKALFDIALAGPAFGGIVSLIMLVTGLLLSQPGSLFQL--PNK  347

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++  +  +G  ++V+PLV+    GL+I A+N +PAG+LDGGRI  +I
Sbjct  348   FFQGSILVGSLARVVLGSAVQGPFVNVHPLVIIGWLGLVITALNLMPAGQLDGGRIVQAI  407

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+AR + A++ LL + +L + +A YW ++IF LQR    P   E+++PD+
Sbjct  408   YGRKTAARATIATLILLALVSLGNTLAMYWAIVIFFLQRDAERPSLNEVSEPDD  461



>ref|WP_015224241.1| peptidase M50 [Halothece sp. PCC 7418]
 ref|YP_007166577.1| peptidase M50 [Halothece sp. PCC 7418]
 gb|AFZ42363.1| peptidase M50 [Halothece sp. PCC 7418]
Length=504

 Score =   187 bits (474),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 136/382 (36%), Positives = 220/382 (58%), Gaps = 26/382 (7%)
 Frame = -1

Query  1479  NAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPY  1300
             N++  + D  + + ASG+  P            IP+E +  ++  +FG DTFF T   PY
Sbjct  112   NSEEDSPDNAEAEAASGATKP-----------PIPEEDLKTIQG-LFGIDTFFSTETIPY  159

Query  1299  EGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRIT-LQPD  1123
             + G +FKGNLR    + Y+++S+++    G+ Y+LFL+ +PE+ KPV +V+P     QP 
Sbjct  160   QDGAIFKGNLRADPDQVYQQLSQKLHAALGEKYRLFLVESPEN-KPVVIVLPSTNDPQPS  218

Query  1122  TTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLLENGLPGALVTALILGV  946
             TT+  +   A    +VT  T    +V A    L   +F+N++  +  +P A+  A+ILG 
Sbjct  219   TTS--QQILAIVLMVVTAVT----SVEAFSLLLGFDLFNNWERFQEAVPFAVGLAIILGS  272

Query  945   HEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfsl  766
             HE+ H ++AQ+ GI+L +P+F+PS QIGSFG ITRI +++P R  L + A AGP  G  +
Sbjct  273   HEVGHRVIAQRYGIRLSLPFFIPSLQIGSFGGITRIESLLPSRTVLFELALAGPAVGGLV  332

Query  765   gfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSL  586
               ++L+ G  L     L  V  P+ F +  +  G    ++  +  + + + V+PL +   
Sbjct  333   SLLMLVAGLILSQPGSLFQV--PTQFFQGSILVGSLAKVVLGSQLQESVVDVHPLTVVGW  390

Query  585   AGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLF---SDVAFYWVV  415
              GL+I A+N +PAG+LDGGRI  +I+GRKT+ R + A++ +LGI A+    + +  YW +
Sbjct  391   LGLVITALNLMPAGQLDGGRIVQAIYGRKTARRTTVATLIVLGIVAITNPSNPIPLYWGI  450

Query  414   LIFVLQRGPIAPLSEEITDPDN  349
             LI  LQR    P   E+T+PD+
Sbjct  451   LILFLQRSLERPSLNELTEPDD  472



>ref|WP_010996272.1| hypothetical protein [Nostoc sp. PCC 7120]
 ref|NP_486154.1| hypothetical protein alr2114 [Nostoc sp. PCC 7120]
 dbj|BAB73813.1| alr2114 [Nostoc sp. PCC 7120]
Length=493

 Score =   186 bits (472),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 133/351 (38%), Positives = 207/351 (59%), Gaps = 14/351 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+E ++++K  +FG DTFF T    Y+ G +FKGNLRG+    + ++SK +QD+ 
Sbjct  122   EIMPIPEEDLNVIKG-IFGIDTFFATETIAYQEGAIFKGNLRGEPQAVHTRLSKSLQDKL  180

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             G+ Y+LFL+ N  D KPV +V+P  T  P  T +P+   A    + TI T L        
Sbjct  181   GEKYRLFLVEN-TDTKPVVIVLPS-TNDPRPTTLPQKVFAAILAIATIGTSLE------T  232

Query  1032  ANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             A LL  FD F     L+  LP  +   +IL  HEI H LVA++  ++L  P+F+P+ QIG
Sbjct  233   AGLLLNFDLFSTPARLQEALPIGVGIFVILVAHEIGHWLVARRHQVRLSWPFFLPAVQIG  292

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFGAITR  +++P R  L   A AGP+AG ++  ++L++G  L     L  +  P+ F +
Sbjct  293   SFGAITRFESLLPNRSVLFDIAVAGPIAGGTVSLLMLIVGLLLSHQGSLFQL--PNQFFQ  350

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G    ++  +  +   ++V+PLV+    GL+I A+N +PAG LDGGRI  +I+GR
Sbjct  351   GSILVGSLARVVLGSALQSPLVNVHPLVIIGWLGLVITALNLMPAGSLDGGRIIQAIYGR  410

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             KT+ R + A++ +L + +L + +A YW ++I  LQR    P   EI++PD+
Sbjct  411   KTAGRATFATLIVLALVSLGNALAMYWAIVILFLQRDLERPNLNEISEPDD  461



>ref|WP_006508506.1| putative membrane-associated Zn-dependent protease [Xenococcus 
sp. PCC 7305]
 gb|ELS04412.1| putative membrane-associated Zn-dependent protease [Xenococcus 
sp. PCC 7305]
Length=497

 Score =   185 bits (470),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/353 (38%), Positives = 203/353 (58%), Gaps = 13/353 (4%)
 Frame = -1

Query  1395  DEAIRIPKETIDILK-DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQD  1219
             +E + IP E  D++K  ++FG DTFF T    Y+ G +F+GNLRG+  +S+  ++K++Q 
Sbjct  122   EELVPIPNE--DLIKIKEIFGIDTFFATETISYQEGAIFRGNLRGEPEKSHSVLTKKLQA  179

Query  1218  RFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPA  1039
             +  D Y+LFL+ +PED KPV VV+P  T  P TT + +   A    + T+ T L  +   
Sbjct  180   KLDDKYRLFLVESPED-KPVIVVLPS-TNDPQTTTLAQKNLALVLAIATLVTGLEASSLL  237

Query  1038  LQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
             L  +L   F NF   +  +P  L    IL  HEI H ++A++  ++L +P+F+P+WQIGS
Sbjct  238   LGFDL---FSNFGRYQEAVPLTLGLWFILIAHEIGHAVIAKRYDVRLSIPFFLPTWQIGS  294

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAITR  +++P R  L   + AGP  G  L   LL LG        L  +  P+    +
Sbjct  295   FGAITRFESLLPNRNVLFDVSFAGPAIGGILSLFLLTLGLIFSHPGSLFQL--PTELFSA  352

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              +  G    ++  +      + VNPLV+    GL+I A+N +PAG+LDGGRI  +I+GR+
Sbjct  353   SVLVGTLAKVILGSQLHEVIVDVNPLVIVGWLGLVITALNLLPAGQLDGGRIVHAIYGRR  412

Query  498   TSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              + R + AS+ +LGI ALF   + +  YWVVL+  LQR    P   EI++PD+
Sbjct  413   IARRTTIASLIILGIVALFNPANPIPLYWVVLVLFLQRDLERPALNEISEPDD  465



>ref|WP_040935682.1| peptidase M50, partial [Prochloron didemni]
Length=479

 Score =   184 bits (466),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 19/361 (5%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             K + + E I I  E + I+K  +FG DTFF T    Y+ G +F+GNLRG+A   + ++S+
Sbjct  98    KERIVPEPIPIDPEDLKIIKG-IFGIDTFFATESISYQEGAIFRGNLRGEADSVHRRLSE  156

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
             ++   FGD Y LFL+ +PE+ KPV +V+P R   QP T       A     LV +   + 
Sbjct  157   KLNKSFGDKYHLFLVESPEE-KPVVIVLPSRNDPQPAT------LAQKNLALVLLVATIA  209

Query  1053  RNVPALQANLLSVFDNFDLL---ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYF  883
              ++ A  A+LL  FD F  L      LP  L   LIL  HEI H  +AQ+  I +G+P+F
Sbjct  210   TSLEA--ASLLQGFDWFGELGRFSEVLPVTLGLGLILAAHEIGHRAIAQQYNITMGLPFF  267

Query  882   VPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVV  703
             +PSWQIGSFGAITR  +I+P R  L   A AGP  G  +  ++L+LG  L     +  + 
Sbjct  268   IPSWQIGSFGAITRFESILPHRTALFDIAFAGPAVGGIMSLLILILGLILSHPGSIFEI-  326

Query  702   DPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRI  523
              PS F +S +  GI   ++  +  +   + VN L +    GL I A+N +PAG+LDGGRI
Sbjct  327   -PSEFFQSSILIGILGKIILGSQLQEPLVDVNLLTVIGWLGLNITALNLMPAGQLDGGRI  385

Query  522   SFSIWGRKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
                I+GRKT+ R + A++ LLG+  +F   + +  YW ++I  LQR    P   E+T+PD
Sbjct  386   VQGIYGRKTARRSTIATLILLGLVVIFNPGNSIVLYWAIIILFLQRELERPSLNELTEPD  445

Query  351   N  349
             +
Sbjct  446   D  446



>ref|WP_040944195.1| peptidase M50 [Prochloron didemni]
Length=499

 Score =   184 bits (467),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 140/361 (39%), Positives = 204/361 (57%), Gaps = 19/361 (5%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             K + + E I I  E + I+K  +FG DTFF T    Y+ G +F+GNLRG+A   + ++S+
Sbjct  118   KERIVPEPIPIDPEDLKIIKG-IFGIDTFFATESISYQEGAIFRGNLRGEADSVHRRLSE  176

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
             ++   FGD Y LFL+ +PE+ KPV +V+P R   QP T       A     LV +   + 
Sbjct  177   KLNKSFGDKYHLFLVESPEE-KPVVIVLPSRNDPQPAT------LAQKNLALVLLVATIA  229

Query  1053  RNVPALQANLLSVFDNFDLL---ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYF  883
              ++ A  A+LL  FD F  L      LP  L   LIL  HEI H  +AQ+  I +G+P+F
Sbjct  230   TSLEA--ASLLQGFDWFGELGRFSEVLPVTLGLGLILAAHEIGHRAIAQQYNITMGLPFF  287

Query  882   VPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVV  703
             +PSWQIGSFGAITR  +I+P R  L   A AGP  G  +  ++L+LG  L     +  + 
Sbjct  288   IPSWQIGSFGAITRFESILPHRTALFDIAFAGPAVGGIMSLLILILGLILSHPGSIFEI-  346

Query  702   DPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRI  523
              PS F +S +  GI   ++  +  +   + VN L +    GL I A+N +PAG+LDGGRI
Sbjct  347   -PSEFFQSSILIGILGKVILGSQLQQPLVEVNLLTVIGWLGLNITALNLMPAGQLDGGRI  405

Query  522   SFSIWGRKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
                I+GRKT+ R + A++ LLG+  +F   + +  YW ++I  LQR    P   E+T+PD
Sbjct  406   VQGIYGRKTARRSTIATLILLGVVVIFNPGNSIVLYWAIIILFLQRELERPSLNELTEPD  465

Query  351   N  349
             +
Sbjct  466   D  466



>ref|WP_017322887.1| peptidase M50 [cyanobacterium PCC 7702]
Length=499

 Score =   184 bits (467),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 130/356 (37%), Positives = 202/356 (57%), Gaps = 24/356 (7%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP++ ++ +K  +FG DTFF T   PY+ GV+FKGNLR +A  +Y+++++ +Q+R 
Sbjct  128   EIVPIPEQDLNAIKG-IFGIDTFFATETIPYQEGVIFKGNLRQEAETAYKRLTENLQERL  186

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D KPV +++P        T   + FA           +LL    A  
Sbjct  187   GDKYRLFLVEN-TDGKPVVIILPSRNDPRPMTIAQKVFA----------VILLIATVATS  235

Query  1032  ANLLSVFDNFDLLENGLPGALVTAL--------ILGVHEISHTLVAQKAGIKLGVPYFVP  877
                  +  NFD   N  PG    AL        IL  HEI H L+A++  ++L  PYF+P
Sbjct  236   LEAAGILLNFDFFAN--PGRFREALPIASGILAILAAHEIGHWLLARRHQVRLSWPYFLP  293

Query  876   SWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDP  697
             + QIGSFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     +  +  P
Sbjct  294   AVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGIVSLLMLVTGLLLSHPGSMFQL--P  351

Query  696   SVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISF  517
             + F +  +  G    ++  +  +   + V+PL +    GL+I AIN +PAG+LDGGRI  
Sbjct  352   NEFFQGSILVGSLARVVLGSALQSKVVDVHPLAIVGWIGLVITAINLMPAGQLDGGRIVQ  411

Query  516   SIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +I+GRK + R + A++ +LG+ AL + +A YW+++I  LQRG   P   EI++PD+
Sbjct  412   AIYGRKIAGRTTIATLIVLGLVALGNPLAMYWLIVILFLQRGLERPSLNEISEPDD  467



>ref|WP_035985423.1| peptidase M50 [Leptolyngbya sp. KIOST-1]
Length=493

 Score =   184 bits (466),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 123/363 (34%), Positives = 200/363 (55%), Gaps = 20/363 (6%)
 Frame = -1

Query  1419  PGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEK  1240
             P   P   D AI IP E +  ++  +FG DT+F T   PY+ G +F+GNLRG+ A +  +
Sbjct  113   PSAAPGDTDTAIPIPAEDLAQIEG-IFGLDTYFRTETIPYDQGAIFRGNLRGEPAATQAQ  171

Query  1239  ISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTL  1060
             +++ + DR GD Y+LFL+ N E  KP  VV+P  T  P  T   +W  AG   + T+FT 
Sbjct  172   LAQSLADRLGDRYRLFLVENLE-QKPTVVVLPAST-DPAQTTPAQWALAGVLAIATLFT-  228

Query  1059  LLRNVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKL  898
                    L+A   ++   FDL+++       LP  +    IL  HE  H + A++  I+L
Sbjct  229   ------GLEAG--AILQGFDLMQDAARWRAALPFLVALLAILLTHEAGHWVSARRYNIRL  280

Query  897   GVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg  718
               P+ +P+WQIG+FG++TR  +++P R  L   A AGP AG  +   +L+ G  L     
Sbjct  281   SPPFLIPAWQIGAFGSLTRFESLLPNRSVLFDIALAGPAAGGLISLAMLMGGLLLSHPGS  340

Query  717   lGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGEL  538
                +  PS F +  +  G    ++  +  +   + ++PL +    GL+I A+N +PAG+L
Sbjct  341   AFQI--PSGFFQGSVLIGALARVVLGSALQAPLVDIHPLTIMGWLGLVITALNLMPAGQL  398

Query  537   DGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITD  358
             DGGR+  +I+GR+T  R +  ++ +L + AL + +A YW  +I +LQR P  P   +I++
Sbjct  399   DGGRMVQAIYGRRTLNRTTLFTLVVLALVALANPLALYWAGVILILQRTPERPCLNDISE  458

Query  357   PDN  349
             P++
Sbjct  459   PND  461



>ref|WP_012412293.1| peptidase M50 [Nostoc punctiforme]
 ref|YP_001869295.1| peptidase M50 [Nostoc punctiforme PCC 73102]
 gb|ACC84352.1| peptidase M50 [Nostoc punctiforme PCC 73102]
Length=493

 Score =   183 bits (465),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 200/347 (58%), Gaps = 14/347 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E ++ +K  +FG DTFF T    Y+ GV+FKGNLRG+    + +++  +Q R G+ Y
Sbjct  127   IPEEDLNAIKG-IFGIDTFFATETIAYQDGVIFKGNLRGEPEEVHNRLTASLQQRLGEQY  185

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LFL+ N  D KPV +V+P           P   +  AF  V +   +  N+ A  A LL
Sbjct  186   RLFLVEN-TDGKPVVIVLPS-----RNDPRPMLLSQKAFAGVLLIATIATNLEA--AGLL  237

Query  1020  SVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGA  850
               FD F   +  +  LP       IL  HEI H L+A++  I+L  P+F+P+ QIGSFGA
Sbjct  238   LNFDLFANPERFQEALPIGTGIFAILVAHEIGHWLLAKRHQIRLSWPFFLPAVQIGSFGA  297

Query  849   ITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESlla  670
             ITR  +++P R+ L   A AGP AG  +  ++L+ G  L     L  +  P+ F +  + 
Sbjct  298   ITRFESLLPNRKVLFDIALAGPAAGGIVSLLMLVTGLLLSHPGSLFQL--PNQFFQGSIL  355

Query  669   ggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSA  490
              G    ++  +  + + +SV+PLV+    GL+I A+N +PAG+LDGGRI  +I+GRKT+ 
Sbjct  356   VGSLARVVLGSALQSSLVSVHPLVIIGWLGLIITALNLMPAGQLDGGRIVQAIYGRKTAG  415

Query  489   RlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             R + A++ LL + +L + +A YW ++IF LQR    P   EIT+PD+
Sbjct  416   RATIATLILLALVSLGNMIAMYWAIVIFFLQRDQERPSLNEITEPDD  462



>ref|XP_001690234.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09972.1| predicted protein [Chlamydomonas reinhardtii]
Length=410

 Score =   181 bits (460),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 198/352 (56%), Gaps = 12/352 (3%)
 Frame = -1

Query  1371  ETIDILKDQVFGFDTFFVTSQEPY-EGGVLFKGNLRGQ-AARSYEKISKRMQDRFGDLYK  1198
             + ID LK QVFGFDTF+VTS + Y   G +FKGN+RG+  A SY+K+  R+Q  F   Y+
Sbjct  12    DVIDKLKTQVFGFDTFWVTSVDNYGHDGAVFKGNVRGRDPAVSYQKMRDRLQTAFNGAYE  71

Query  1197  LFLLINPEDDKPVAVVVPR-ITLQPDTTAVPEWFAAGAFGLVT-IFTLLLRNVPALQ---  1033
             LFLL + E+ KP  VV+P+   L    +   E + A  F L T + T     VP L+   
Sbjct  72    LFLLEDKEE-KPTVVVMPQGRGLDTQISRFTEIWLAALFALATGVTTFNSAGVPLLEFFI  130

Query  1032  ANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW--QIGS  859
             A   ++    D ++  LPG L     LG H+  H   A++ G++L +P+++P+    +GS
Sbjct  131   APFSTIVTQQDFVD-ALPGVLAFFFALGSHDFGHYQAAKRQGLELYLPFYIPAGFGLLGS  189

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FG+ITR+ N VP RE LL  A +GPL G ++   +LLLGF L  A    + VD   F +S
Sbjct  190   FGSITRVRNFVPNREALLDLAVSGPLLGTAVSGSMLLLGFLLTAAGLTNIGVDTPAFADS  249

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              L   +A + +G          VN LVL   AGL+ NA+  IPAGELDG ++    WGR+
Sbjct  250   TLVALLAGVFVGPDGLSQPVTEVNFLVLAGWAGLIANALQLIPAGELDGAKMVLGCWGRR  309

Query  498   T-SARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNK  346
               SA     +  L   +   + ++FYWV+L+  LQRGPI P  EE++ P N+
Sbjct  310   AGSAVSVFTTGALGFSAITGNALSFYWVLLVLFLQRGPITPCFEELSAPKNE  361



>ref|WP_016874597.1| peptidase M50 [Chlorogloeopsis fritschii]
Length=496

 Score =   183 bits (465),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 135/363 (37%), Positives = 203/363 (56%), Gaps = 20/363 (6%)
 Frame = -1

Query  1419  PGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEK  1240
             P +  Q   E + IP+E + I+K  +FG DTFF T    Y+ GV+FKGNLRG +   Y++
Sbjct  116   PAVTVQLQPEIVPIPEEDLSIIKS-IFGIDTFFATETIAYQEGVIFKGNLRGDSEVVYKR  174

Query  1239  ISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTL  1060
             +++ +Q+R  D Y+LFL+ N  D KPV +V+P        T   + FA           +
Sbjct  175   LTENLQERLADKYRLFLVEN-TDGKPVVIVLPSRNDPRPMTLAQKVFA----------VI  223

Query  1059  LLRNVPALQANLLSVFDNFDLLENG------LPGALVTALILGVHEISHTLVAQKAGIKL  898
             LL    A       +  NFD + N       LP A     IL  HEI H L A++  ++L
Sbjct  224   LLVATIATSLEAAGILLNFDFVANPERFPEVLPIAAGILAILVAHEIGHWLFARRHQVRL  283

Query  897   GVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadg  718
               PYF+P+ QIGSFGAITR  + +P R+ L   A AGP AG  +  ++L+ G  L  +  
Sbjct  284   SWPYFLPAVQIGSFGAITRFESQIPNRKVLFDVALAGPAAGGIVSLLMLVAGLLLSHSGS  343

Query  717   lGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGEL  538
             +  +  P+ F +  +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+L
Sbjct  344   MFQL--PNEFFQGSILVGSLARVVLGSALQSQLVDVHPLVIIGWLGLVITALNLMPAGQL  401

Query  537   DGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITD  358
             DGGRI  +I+GRKT+ R + A++ LLG+ AL + +A YWV++I  LQRG   P   E+T+
Sbjct  402   DGGRIVQAIYGRKTAGRTTFATLILLGLVALGNPLAMYWVIVILFLQRGLERPSLNELTE  461

Query  357   PDN  349
             PD+
Sbjct  462   PDD  464



>ref|WP_040938706.1| peptidase M50 [Prochloron didemni]
Length=499

 Score =   183 bits (464),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 139/361 (39%), Positives = 204/361 (57%), Gaps = 19/361 (5%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             K + + E I I  E + I+K  +FG DTFF T    Y+ G +F+GNLRG+A   + ++S+
Sbjct  118   KERIVPEPIPIDPEDLKIIKG-IFGIDTFFATESISYQEGAIFRGNLRGEADSVHRRLSE  176

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
             ++   FGD Y LFL+ +PE+ KPV +V+P R   QP T       A     LV +   + 
Sbjct  177   KLNKSFGDKYHLFLVESPEE-KPVVIVLPSRNDPQPAT------LAQKNLALVLLVATIA  229

Query  1053  RNVPALQANLLSVFDNFDLL---ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYF  883
              ++ A  A+LL  FD F  L      LP  L   LIL  HE+ H  +AQ+  I +G+P+F
Sbjct  230   TSLEA--ASLLQGFDWFGELGRFSEVLPVTLGLGLILAAHEMGHRAIAQQYNITMGLPFF  287

Query  882   VPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVV  703
             +PSWQIGSFGAITR  +I+P R  L   A AGP  G  +  ++L+LG  L     +  + 
Sbjct  288   IPSWQIGSFGAITRFESILPHRTALFDIAFAGPAVGGIMSLLILILGLILSHPGSIFEI-  346

Query  702   DPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRI  523
              PS F +S +  GI   ++  +  +   + VN L +    GL I A+N +PAG+LDGGRI
Sbjct  347   -PSEFFQSSILIGILGKIILGSQLQQPLVEVNLLTVIGWLGLNITALNLMPAGQLDGGRI  405

Query  522   SFSIWGRKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
                I+GRKT+ R + A++ LLG+  +F   + +  YW ++I  LQR    P   E+T+PD
Sbjct  406   VQGIYGRKTARRSTIATLILLGLVVIFNPGNSIVLYWAIIILFLQRELERPSLNELTEPD  465

Query  351   N  349
             +
Sbjct  466   D  466



>ref|WP_006278268.1| Peptidase M50 [Cylindrospermopsis raciborskii]
 gb|EFA68849.1| Peptidase M50 [Cylindrospermopsis raciborskii CS-505]
Length=494

 Score =   182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 132/386 (34%), Positives = 210/386 (54%), Gaps = 14/386 (4%)
 Frame = -1

Query  1497  GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFV  1318
             G  V +  +     A++     G    G  P    E I IP+E ++ +K  +FG DTFF 
Sbjct  89    GQDVILKTKATERIANETSPGVGQTEKGSPPVVKLEPITIPEEDLNTIKG-IFGIDTFFA  147

Query  1317  TSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRI  1138
             T   PY+ GV+FKGNLRG A   +++++K +  + GD Y+LFL+ N  D KPV +++P  
Sbjct  148   TETIPYQEGVVFKGNLRGDAQEVHKRLTKNLAGQLGDKYRLFLVEN-TDGKPVVIILPS-  205

Query  1137  TLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDL---LENGLPGALV  967
                  +   P       F ++ +   +  ++      LL  FD F     +   LP AL 
Sbjct  206   ----RSDPRPMQLGQKVFAVILLLATIATSLET--GGLLLNFDLFTTPSRITEALPIALG  259

Query  966   TALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAG  787
                IL  HE+ H L A+K  ++L  P+F+P+ QIGSFGAITR  +++P R+ L   A AG
Sbjct  260   ILAILVAHELGHWLFAKKHQVQLTWPFFLPAVQIGSFGAITRFQSLLPDRKALFDIALAG  319

Query  786   PlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVN  607
             P  G  +  ++L+ G  L     L  +  P+ F +  +  G    ++  +  +   ++++
Sbjct  320   PGFGGLVSLVMLVTGLLLSHPGSLFQI--PNKFFQGSILVGSLARVILGSTLQAPIVNIH  377

Query  606   PLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAF  427
             PLV+    GL+I A+N +PAG+LDGGRI  +I+GRKT+   + A++ +L + +L + +AF
Sbjct  378   PLVIIGWLGLVITALNLMPAGQLDGGRIVQAIYGRKTARTTTIATLVVLALVSLGNTMAF  437

Query  426   YWVVLIFVLQRGPIAPLSEEITDPDN  349
             YW ++IF LQR    P   EIT+PD+
Sbjct  438   YWAIVIFFLQRDGERPSLNEITEPDD  463



>ref|WP_009341443.1| Peptidase M50 [Raphidiopsis brookii]
 gb|EFA74362.1| Peptidase M50 [Raphidiopsis brookii D9]
Length=498

 Score =   182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 130/354 (37%), Positives = 204/354 (58%), Gaps = 20/354 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E I IP+E ++ +K  +FG DTFF T   PY+ G +FKGNLRG A   +++++K +  + 
Sbjct  128   EPITIPEEDLNTIKG-IFGIDTFFATETIPYQEGAVFKGNLRGDAQEVHKRLTKNLAGQL  186

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D KPV +++P  +  P    + +   AG   L TI T       +L+
Sbjct  187   GDKYRLFLVEN-TDGKPVVIILPSRS-DPRPMQLGQKVFAGILLLATIAT-------SLE  237

Query  1032  ANLLSVFDNFDL------LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             A    +  NFDL      +   LP A+    IL  HE+ H L A+K  ++L  P+F+P+ 
Sbjct  238   AG--GLLLNFDLFTTPSRITEALPIAVGILAILVAHELGHWLFAKKHQVQLTWPFFLPAV  295

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITR  +++P R+ L   A AGP  G  +  ++L+ G  L     L  +  P+ 
Sbjct  296   QIGSFGAITRFGSLLPDRKALFDIALAGPGFGGLVSLVMLVTGLLLSHPGSLFQI--PNK  353

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++  +  +   ++++PLV+    GL+I A+N +PAG+LDGGRI  +I
Sbjct  354   FFQGSILVGSLARVILGSTLQAPIVNIHPLVIIGWLGLIITALNLMPAGQLDGGRIVQAI  413

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+   + A++ +L + +L + +AFYW ++IF LQR    P   EIT+PD+
Sbjct  414   YGRKTARTTTIATLVVLALVSLGNTMAFYWAIVIFFLQRDAERPSLNEITEPDD  467



>ref|WP_029634567.1| peptidase M50 [[Scytonema hofmanni] UTEX B 1581]
Length=493

 Score =   182 bits (463),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 139/370 (38%), Positives = 213/370 (58%), Gaps = 22/370 (6%)
 Frame = -1

Query  1437  ASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQA  1258
             AS +P   L  +   E   IP+E ++ +K  +FG DTFF T    Y+ G +FKGNLRG+ 
Sbjct  107   ASETPQNALNAELKLEDPPIPEEELNAIKG-IFGLDTFFATEAIAYQQGAIFKGNLRGEP  165

Query  1257  ARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGL  1078
                + +++  +Q+R GD Y+LFL+ N +D KPV +V+P  +  P  + + +   AG   L
Sbjct  166   EEVHNRLTISLQERLGDKYRLFLVEN-QDGKPVIIVLPS-SNDPRPSTISQKIFAGILFL  223

Query  1077  VTIFTLLLRNVPALQANLLSVFDNFDLLEN------GLP-GALVTALILGVHEISHTLVA  919
              TI T        L+A    +   FDL EN       LP G  + A++L +HEI H LVA
Sbjct  224   ATIAT-------CLEAA--GLLLRFDLFENPSRFPETLPIGGGILAILL-IHEIGHWLVA  273

Query  918   QKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgf  739
             ++  I+L +P+F+P+ QIGSFGAITR  +++P R  L   A AGP AG     + L++G 
Sbjct  274   RRHQIRLSLPFFLPAVQIGSFGAITRFESLLPNRSVLFDIAIAGPAAGGITSLVTLIIGL  333

Query  738   flppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAIN  559
              L     L  +  P+ F +  +  G    ++  +  + + + ++PLV+    GL+I AIN
Sbjct  334   LLSHQGSLFQL--PNEFFQGSILVGSLARIILGSALQSSVVDIHPLVVIGWLGLVITAIN  391

Query  558   SIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAP  379
              +PAG LDGGRI   I+GRKT+ R++ A++ +LGI++L + +A YW ++I  LQR    P
Sbjct  392   LMPAGVLDGGRIVQGIYGRKTAGRVTVATLIVLGIASLANPLAMYWAIVILFLQRDLERP  451

Query  378   LSEEITDPDN  349
                EIT+PD+
Sbjct  452   SLNEITEPDD  461



>ref|WP_016863256.1| peptidase M50 [Fischerella muscicola]
Length=495

 Score =   182 bits (463),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 129/359 (36%), Positives = 210/359 (58%), Gaps = 15/359 (4%)
 Frame = -1

Query  1413  LKPQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKI  1237
             ++P Q+  E + IP+E ++ +K  +FG DTFF T    Y+ G +FKGNLRG+A   + ++
Sbjct  117   VEPVQVKLEVLPIPEEDLNAIKG-IFGLDTFFATETIAYQEGAIFKGNLRGEAEMVHNRL  175

Query  1236  SKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLL  1057
             + ++Q+  GD Y+L+L+ N  D KPV +V+P           P   +   F ++ +   +
Sbjct  176   TTKLQETVGDKYRLYLVEN-TDGKPVVIVLPS-----RNDPRPMSLSQKVFAIILLIATV  229

Query  1056  LRNVPALQANLLSVFD---NFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPY  886
             + ++ A  + +L  FD   NF  L+  LP  L   ++L  HEI H L+A++  ++L  PY
Sbjct  230   VTSLEA--SGILQGFDLFANFSRLQETLPIGLGILVVLLTHEIGHWLLARRHNVRLSWPY  287

Query  885   FVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVV  706
             F+P+ QIGSFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     +  +
Sbjct  288   FLPAVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGIVSVLMLITGLLLSHQGSMFQL  347

Query  705   VDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGR  526
               P+ F +  +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+LDGGR
Sbjct  348   --PNEFFQGSILVGSLAKVVLGSALQSPLVDVHPLVVIGWLGLVITALNLMPAGQLDGGR  405

Query  525   ISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I  +I+GRKT+ R + A++ LLG+ AL + +A YW ++I  LQR    P   EIT+PD+
Sbjct  406   IVQAIYGRKTAGRATFATLILLGLVALGNPLAMYWAIVILFLQRDLERPSLNEITEPDD  464



>ref|WP_036003298.1| peptidase M50 [Leptolyngbya sp. JSC-1]
Length=504

 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 126/348 (36%), Positives = 199/348 (57%), Gaps = 14/348 (4%)
 Frame = -1

Query  1383  RIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDL  1204
             ++P E +  +K  +FG DTFF T   PY+ GV+FKGNLRG   +S+ +++  +Q+R GD 
Sbjct  136   QMPAEDLQAVKG-IFGIDTFFATETIPYQNGVIFKGNLRGDPEQSHAQLTTLLQERLGDR  194

Query  1203  YKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL  1024
             Y+LF L+   +DKPV VV+P     P  T + +   A    L T+ T L          L
Sbjct  195   YRLF-LVEGVEDKPVVVVLPTAN-DPKPTTLAQKILALILALATVATCLEVG------GL  246

Query  1023  LSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
             +  FD F   +      P  +    +L  HE+ H L+A++ GI+L  P+F+P+WQIGSFG
Sbjct  247   MQGFDFFSEPNRFAEVWPIGVGIIAVLAAHEMGHRLLARRYGIQLSPPFFIPTWQIGSFG  306

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             ++ R  +++P R  L   A AGP+AG  + F +L++G  L        V  P+ F +  +
Sbjct  307   SLMRFESVLPNRSVLFDIAFAGPVAGGLIAFGMLIVGLLLSKPGSFFQV--PTEFFQGSI  364

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
               G    ++     +   + V+PLV+    GL+I AIN +PAG+LDGGRI  +I+GRKT+
Sbjct  365   LVGTLARVVLGDAVQAAIVDVHPLVILGWLGLVITAINLMPAGQLDGGRIVQAIYGRKTA  424

Query  492   ARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              R + A++ +LG++AL + ++ YW ++I  LQR    P   E+++PD+
Sbjct  425   GRTTVATLIVLGLAALVNPLSLYWAIVILFLQRDLERPALNELSEPDD  472



>ref|WP_008231554.1| Zinc metalloprotease [Richelia intracellularis]
 emb|CCH66278.1| Zinc metalloprotease [Richelia intracellularis HH01]
Length=501

 Score =   182 bits (462),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/360 (36%), Positives = 206/360 (57%), Gaps = 21/360 (6%)
 Frame = -1

Query  1407  PQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             P QL  + I IP E ++ +K  +FG DTFFVT+   Y  G +F+GNLRG+  +++  +S 
Sbjct  123   PSQLQPKLISIPGEDLNSIKG-IFGIDTFFVTNTTAYLEGAIFEGNLRGEPGKTHNILSN  181

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
              ++ RF + Y+LFL+ N  D KPV +V+P     P      +   AG   + TI T +  
Sbjct  182   TLKKRFDEKYRLFLVEN-RDGKPVVIVLPSKN-DPQPMTFTQQVFAGILFIATIITCM--  237

Query  1050  NVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVP  889
                     ++ +   FDL  N       +P A+   +IL  HEI+H +VA    ++L +P
Sbjct  238   -------EVVGIILYFDLFSNPRRYMETIPIAVGVMVILLAHEIAHKIVANWYQVRLSLP  290

Query  888   YFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGV  709
             YF+P+ QIGSFGAITR  +++P R+ L   A AGP  G  L  ++L++G  L     L  
Sbjct  291   YFLPAVQIGSFGAITRFESLLPNRKVLFDIAIAGPAVGGILSLVILVIGLLLSHPGSLFQ  350

Query  708   VVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGG  529
             +  P+ F +  +  G    ++  +  + + + V+PLV+    GL+I+AIN +PAG LDGG
Sbjct  351   L--PNTFFQGSILVGSLARVILGSNVQSSVVDVSPLVIIGWLGLVISAINLMPAGHLDGG  408

Query  528   RISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RI  +I+GRKT+ R + A++ LL + +L + +A YWV++I  LQR    P  +EI++PD+
Sbjct  409   RIVQAIYGRKTANRTTFATVILLALISLGNSLAMYWVIVILFLQRNLERPSLDEISEPDD  468



>gb|AHJ28239.1| Zinc metalloprotease [Nodularia spumigena CCY9414]
Length=497

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 136/360 (38%), Positives = 206/360 (57%), Gaps = 32/360 (9%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             EA+ IP+E +  +K  +FG DTFF T    Y+ G +FKGN+RG+    + +++  +Q + 
Sbjct  126   EALPIPEEDLSAIKS-IFGIDTFFTTETISYQEGAIFKGNMRGEPEEIHNRLTASLQAKL  184

Query  1212  GDLYKLFLLINPEDDKPVAVVVPR------ITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
             GD Y+LFL ++  + KPV +V+P       ++LQ  + AV    A  A  L T   LL  
Sbjct  185   GDKYRLFL-VDSTEGKPVVIVLPSRNDPRPMSLQQKSFAVILLIATIATCLETAGLLL--  241

Query  1050  NVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVP  889
                           NFDL  N       +P A     IL  HEI H L+A++  I+L  P
Sbjct  242   --------------NFDLFSNPERFAAAVPIATGILAILATHEIGHWLLARRHQIRLSWP  287

Query  888   YFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGV  709
             +F+P+ QIGSFGAITR  +++P R+ L   A AGP AG  L  ++LL+G  L     L  
Sbjct  288   FFLPAVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGILSLLMLLVGLLLSHPGSLFQ  347

Query  708   VVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGG  529
             +  P+ F +  +  G    ++  +  + + +SV+PLV+    GL+INA+N +PAG+LDGG
Sbjct  348   L--PNQFFQGSILVGSLARVVLGSALQSSVVSVHPLVVIGWLGLVINALNLMPAGQLDGG  405

Query  528   RISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RI  +I+GRKT+ R ++A++ LLG+ +L + +A YW V+IF LQR    P   EI++PD+
Sbjct  406   RIVQAIYGRKTAGRATAATLILLGLISLGNSLAIYWAVVIFFLQRDLERPTLNEISEPDD  465



>ref|WP_006197075.1| Peptidase M50 [Nodularia spumigena]
 gb|EAW44757.1| Peptidase M50 [Nodularia spumigena CCY9414]
Length=504

 Score =   182 bits (461),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 136/360 (38%), Positives = 206/360 (57%), Gaps = 32/360 (9%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             EA+ IP+E +  +K  +FG DTFF T    Y+ G +FKGN+RG+    + +++  +Q + 
Sbjct  133   EALPIPEEDLSAIKS-IFGIDTFFTTETISYQEGAIFKGNMRGEPEEIHNRLTASLQAKL  191

Query  1212  GDLYKLFLLINPEDDKPVAVVVPR------ITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
             GD Y+LFL ++  + KPV +V+P       ++LQ  + AV    A  A  L T   LL  
Sbjct  192   GDKYRLFL-VDSTEGKPVVIVLPSRNDPRPMSLQQKSFAVILLIATIATCLETAGLLL--  248

Query  1050  NVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVP  889
                           NFDL  N       +P A     IL  HEI H L+A++  I+L  P
Sbjct  249   --------------NFDLFSNPERFAAAVPIATGILAILATHEIGHWLLARRHQIRLSWP  294

Query  888   YFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGV  709
             +F+P+ QIGSFGAITR  +++P R+ L   A AGP AG  L  ++LL+G  L     L  
Sbjct  295   FFLPAVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGILSLLMLLVGLLLSHPGSLFQ  354

Query  708   VVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGG  529
             +  P+ F +  +  G    ++  +  + + +SV+PLV+    GL+INA+N +PAG+LDGG
Sbjct  355   L--PNQFFQGSILVGSLARVVLGSALQSSVVSVHPLVVIGWLGLVINALNLMPAGQLDGG  412

Query  528   RISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RI  +I+GRKT+ R ++A++ LLG+ +L + +A YW V+IF LQR    P   EI++PD+
Sbjct  413   RIVQAIYGRKTAGRATAATLILLGLISLGNSLAIYWAVVIFFLQRDLERPTLNEISEPDD  472



>ref|WP_015138383.1| putative membrane-associated Zn-dependent protease [Nostoc sp. 
PCC 7524]
 ref|YP_007075534.1| putative membrane-associated Zn-dependent protease [Nostoc sp. 
PCC 7524]
 gb|AFY47937.1| putative membrane-associated Zn-dependent protease [Nostoc sp. 
PCC 7524]
Length=492

 Score =   181 bits (460),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 133/362 (37%), Positives = 208/362 (57%), Gaps = 24/362 (7%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             +P  + E + IP+  +  +K  +FG DTFF T    Y+ G +FKGNLRG+    + +++ 
Sbjct  115   QPAVVVEIMPIPEADLSAIKS-IFGIDTFFATETIAYQDGAIFKGNLRGEPQEIHHRLTA  173

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
              ++ + GD Y+LFL+ N  D KPV +V+P  +  P  T +P+   AG  GL TI T L  
Sbjct  174   SLKQKLGDQYRLFLVEN-TDGKPVVIVLPS-SNDPRPTTLPQKAFAGILGLATIATSL--  229

Query  1050  NVPALQANLLSVFDNFDLLENGLPGALVTALILGV--------HEISHTLVAQKAGIKLG  895
                        +  NFDLL  G P  L  AL +G+        HEI H L+A++  ++L 
Sbjct  230   -------ETAGLLLNFDLL--GTPARLPEALPIGLGIFAILIAHEIGHWLLARRYQVRLS  280

Query  894   VPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadgl  715
              P+F+P+ QIGSFGAITR  +++P R  L   A AGP+AG ++  ++L+ G  L     L
Sbjct  281   WPFFLPAVQIGSFGAITRFESLLPNRTALFDIAVAGPVAGGAVSLLMLIAGLLLSHQGSL  340

Query  714   GVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELD  535
               +  P+ F +  +  G    ++  +  +   ++V+PLV+    GL+I A+N +PAG+LD
Sbjct  341   FQL--PNQFFQGSILVGSLARVVLGSALQSPVVNVHPLVVIGWLGLVITALNLMPAGQLD  398

Query  534   GGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDP  355
             GGRI  +I+GRKT++R + A++ LL + AL + +A YW ++I  LQR    P   EI++P
Sbjct  399   GGRIVQAIYGRKTASRATIATLILLALVALGNTLAMYWAIVIVFLQRDLERPSLNEISEP  458

Query  354   DN  349
             D+
Sbjct  459   DD  460



>ref|WP_028091274.1| peptidase M50 [Dolichospermum circinale]
Length=494

 Score =   181 bits (460),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 132/355 (37%), Positives = 198/355 (56%), Gaps = 20/355 (6%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
              E   IP+  + +++  +FG DTFF T   PY+ GV+FKGNLRG+    + +++K +Q+R
Sbjct  122   SEPTPIPEADLSLIRG-IFGIDTFFATETIPYQEGVVFKGNLRGEPEAVHNRLTKSLQER  180

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
               D Y+LFL+ N  D KPV +V+P  T    T    + FA           +LL    A 
Sbjct  181   LNDKYRLFLVEN-TDGKPVMIVLPSRTDPQRTQLGQKVFA----------VILLIATMAT  229

Query  1035  QANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS  874
                +  +  NFDLL N       LP AL   +I   HE+ H L+A++  ++L  P+F+P+
Sbjct  230   SLEVGGILQNFDLLSNPERFAEALPIALGLFVIFISHEVGHWLLARRHQVRLSWPFFLPA  289

Query  873   WQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPS  694
              Q+GSFGAITR  ++VP R  L   A AGP  G     +LL++G  L     L  +  P+
Sbjct  290   VQVGSFGAITRFESLVPNRNALFDIALAGPAFGGITSLLLLVVGLLLSHPGSLFQL--PN  347

Query  693   VFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFS  514
              F +  +  G    ++  +      ++++PLV+    GL+I A+N +PAG+LDGGRI  +
Sbjct  348   QFFQGSILVGSLARVVLGSALHSPVVNIHPLVIIGWLGLVITALNLMPAGQLDGGRIVQA  407

Query  513   IWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I+GRKT+ R + A+I LL I +L + +A YW +LI  LQR    P   EIT+PD+
Sbjct  408   IYGRKTAGRTTFATIVLLAIVSLGNPLAMYWAILILFLQRDLERPSLNEITEPDD  462



>ref|WP_026731300.1| peptidase M50 [Fischerella sp. PCC 9605]
Length=495

 Score =   181 bits (460),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 133/361 (37%), Positives = 207/361 (57%), Gaps = 21/361 (6%)
 Frame = -1

Query  1410  KPQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKIS  1234
             +P QL  E + IP++ ++ +K  +FG DTFF T   PY+ G +FKGNLRG A   + +++
Sbjct  118   EPAQLKLETVPIPEQDLNAIKS-IFGIDTFFATETIPYQEGAIFKGNLRGDAEVVHNRLT  176

Query  1233  KRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
               +Q+  GD Y+L+L+ N  D+KPV +V+P     P    + +   AG   + TI T   
Sbjct  177   ANLQENLGDKYRLYLVEN-TDNKPVVIVLPSRN-DPRPMTLSQKVFAGILLVATIAT---  231

Query  1053  RNVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGV  892
                 +L+A    +  NFDL  N       LP      +IL  HEI H L+A++  ++L  
Sbjct  232   ----SLEAA--GILQNFDLFANVGRIGETLPIGAGILVILLAHEIGHWLLARRHQVRLSW  285

Query  891   PYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglG  712
             PYF+P+ QIGSFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     + 
Sbjct  286   PYFLPAVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGIVSLLMLVTGLLLSHQGSMF  345

Query  711   VVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDG  532
              +  P+ F +  +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+LDG
Sbjct  346   QL--PNQFFQGSILVGSLARVVLGSALQSPLVDVHPLVVIGWLGLVITALNLMPAGQLDG  403

Query  531   GRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
             GRI  +I+GRKT+ R + A++ LLG+ AL + +A YW ++I  LQR    P   EI++PD
Sbjct  404   GRIVQAIYGRKTAGRTTFATLILLGLVALANPLAMYWAIVILFLQRDLERPSLNEISEPD  463

Query  351   N  349
             +
Sbjct  464   D  464



>ref|WP_026148516.1| peptidase M50 [Leptolyngbya boryana]
Length=487

 Score =   181 bits (459),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 127/357 (36%), Positives = 206/357 (58%), Gaps = 26/357 (7%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E++ IP E +  +K  +FG DT+F+T    Y+ G +FKGNLRG    ++ K+++ ++ + 
Sbjct  116   ESLSIPNEDLQAIKS-IFGIDTYFLTETISYQDGAIFKGNLRGDPDSTHAKLTENLKAQV  174

Query  1212  GDLYKLFLLINPEDDKPVAVVVPR------ITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
             GD Y+LFL+ N +++KPV VV+P       +TL     ++  + A  A  L T       
Sbjct  175   GDRYRLFLIEN-QEEKPVVVVLPSKNDPKPLTLTQTLLSIVLFLATIAASLET-------  226

Query  1050  NVPALQANLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFV  880
                     +L  FD +   +     LP ++    +L  HE  H +VA++  IKL +P+F+
Sbjct  227   ------GGILLGFDFYGSPERYAEVLPFSIGILAVLLAHEFGHWIVAKRYQIKLNLPFFI  280

Query  879   PSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVD  700
             P+WQIGSFGAIT+  +++P R  L   + AGPLAG ++ F +L+ G  +        V  
Sbjct  281   PTWQIGSFGAITKFASLLPNRSTLFDISVAGPLAGGAVAFGMLIAGLLMSHEGSGFKV--  338

Query  699   PSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRIS  520
             P+ F E  +  G    ++  A  + + + V+PLV+    GL++ AIN +PAG+LDGGRI 
Sbjct  339   PTQFFEGSILVGTLARVIMGAEIQRSIVEVSPLVVLGWIGLVVTAINVMPAGQLDGGRIV  398

Query  519   FSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +I+GRK +AR + A+I +LG+++  + +A YW ++I VLQR P  P   E+T+PD+
Sbjct  399   QAIYGRKIAARATVATIIILGLASFVNPLALYWAIVIVVLQRTPERPSLNELTEPDD  455



>ref|WP_008230103.1| Zinc metalloprotease [Richelia intracellularis]
 emb|CCH65800.1| Zinc metalloprotease [Richelia intracellularis HM01]
Length=501

 Score =   181 bits (459),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 131/360 (36%), Positives = 208/360 (58%), Gaps = 21/360 (6%)
 Frame = -1

Query  1407  PQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             P QL  + I IP E ++ +K  +FG DTFFVT+   Y  G +F+GNLRG+  +++  +S 
Sbjct  123   PSQLQPKLISIPGEDLNSIKG-IFGIDTFFVTNTTAYLEGAIFEGNLRGEPGKTHNILSN  181

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
              ++ RF + Y+LFL+ N  D KPV +V+P     P      +   AG   + TI T +  
Sbjct  182   TLKKRFDEKYRLFLVEN-RDGKPVVIVLPSKN-DPQPMTFTQQVFAGILFIATIVTCM--  237

Query  1050  NVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVP  889
                     ++ +   FDL  N       +P A+   +IL  HEI+H +VA    I+L +P
Sbjct  238   -------EVVGILLYFDLFSNPGRYMETIPIAVGVMVILLAHEIAHKIVANWYQIRLSLP  290

Query  888   YFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGV  709
             YF+P+ QIGSFG+ITR  +++P R+ L   A AGP  G SL  ++L++G  L     L  
Sbjct  291   YFLPAVQIGSFGSITRFESLLPNRKVLFDIAIAGPAVGGSLSLVILVIGLLLSHPGSLFQ  350

Query  708   VVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGG  529
             +  P+ F +  +  G    ++  +  + + + V+PLV+    GL+I++IN +PAG+LDGG
Sbjct  351   L--PNTFFQGSILVGSLARVILGSNVQSSVVDVSPLVIIGWLGLVISSINLMPAGQLDGG  408

Query  528   RISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RI  +I+GRKT+ R + A++ LL + +L + +A YWV++I  LQR    P  +EI++PD+
Sbjct  409   RIVQAIYGRKTANRTTFATVILLALISLGNSLAMYWVIVILFLQRNLERPSLDEISEPDD  468



>ref|WP_012307010.1| membrane-associated Zn-dependent proteases 1 [Synechococcus sp. 
PCC 7002]
 ref|YP_001734643.1| membrane-associated Zn-dependent proteases 1 [Synechococcus sp. 
PCC 7002]
 gb|ACA99387.1| Predicted membrane-associated Zn-dependent proteases 1 [Synechococcus 
sp. PCC 7002]
Length=498

 Score =   181 bits (458),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 129/335 (39%), Positives = 196/335 (59%), Gaps = 10/335 (3%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF T   PY+ G +FKGNLRG+   +++K+++++ DR GD Y+LFL+ +PE  K
Sbjct  139   IFGIDTFFATEAIPYQEGAIFKGNLRGEPEEAHQKLTEKLGDRLGDKYRLFLVEDPEG-K  197

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PV V++P  +  P TT++ +   A    LV      L  +  L+      F N+      
Sbjct  198   PVIVILPS-SNDPKTTSLAQKNVALVL-LVATLATTLEAIGVLKG--FDFFSNWQRYTEV  253

Query  984   LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLL  805
             LP +L   LILGVHE+ H + ++K  +KL +P+F+P+WQI SFGAITR  +++P R  L 
Sbjct  254   LPLSLGMWLILGVHELGHWVTSRKYNVKLSIPFFLPNWQIASFGAITRFESLLPNRTALF  313

Query  804   KFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEG  625
               A AGP AG  +  +LLL GF L   D L  V  PS F +  +  G    +      + 
Sbjct  314   DIAFAGPAAGGLISLLLLLGGFGLSNPDSLFKV--PSQFFQGSVLVGTLARIFLGDGLQQ  371

Query  624   TPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaL  445
               ++++PL +    GL+I A+N +PAG LDGGRI  +I+GRKT+ R + A++ +LG+ AL
Sbjct  372   AIVAIHPLTILGWLGLVITALNLLPAGCLDGGRIIQAIYGRKTARRTTIATLVVLGLVAL  431

Query  444   F---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             F   + +  YW ++I  LQR    P   E+ +P++
Sbjct  432   FNPANPIPLYWALIIIFLQREAERPSLNELLEPND  466



>ref|WP_021833683.1| Peptidase M50 [Crocosphaera watsonii]
 emb|CCQ57932.1| Peptidase M50 [Crocosphaera watsonii WH 0005]
 emb|CCQ70931.1| Peptidase M50 [Crocosphaera watsonii WH 0402]
Length=506

 Score =   181 bits (459),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 201/355 (57%), Gaps = 11/355 (3%)
 Frame = -1

Query  1404  QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRM  1225
             + + + I IP E + ++K  +F  DTFF T    Y+ G +F+GNLRG+   SY+K+S+++
Sbjct  128   KNISDLIPIPDEDLQLIKG-IFSIDTFFATETISYQEGAIFRGNLRGETEESYQKLSEKL  186

Query  1224  QDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             +D FG+ Y+LFL +   + KPV +++P  +  P  T + +   A    + T+FT L    
Sbjct  187   KDSFGEKYRLFL-VEGSEGKPVVIILPS-SDDPQPTTLVQKNLALVLLVGTVFTTLEAAS  244

Query  1044  PALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
               L  +L   F+N+      LP  L    I   HE+ H + A++  IK+ VP+F+P+WQI
Sbjct  245   ILLGFDL---FNNWGRYIETLPIGLALWGIFIFHEVGHRVAAKRYDIKMSVPFFLPTWQI  301

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   A AGP  G  L FILL++G  L     L  V  P+ F 
Sbjct  302   GSFGAITRFESLIPTRNALFDVALAGPACGGILSFILLIIGLVLSHDGSLFQV--PTQFF  359

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G    ++     +   + V+PL +    GL++ A+N +PAG+LDGGRI  +I+G
Sbjct  360   QGSILVGSLAKVVLGEQLQNAIVDVHPLTVVGWLGLVVTALNLMPAGQLDGGRIIQAIYG  419

Query  504   RKTSARlssasigllgisaLFS---DVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R +  ++ +LGI  +FS    +  YW V+I  LQR    P   E+T+PD+
Sbjct  420   RKTARRATIITLVILGIVTIFSPANPIPLYWAVVILFLQRDLERPSLNELTEPDD  474



>ref|WP_017311834.1| peptidase M50 [Fischerella sp. PCC 9339]
Length=495

 Score =   180 bits (457),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 130/361 (36%), Positives = 212/361 (59%), Gaps = 15/361 (4%)
 Frame = -1

Query  1419  PGLKPQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYE  1243
             P ++P Q+  E + IP+E ++ +K  +FG DTFF T    Y+ G +FKGNLRG++   + 
Sbjct  115   PTVEPLQVQPEVLSIPEEDLNAIKG-IFGLDTFFATETIAYQEGAIFKGNLRGESEMVHN  173

Query  1242  KISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFT  1063
             +++ ++Q+  GD Y+L+L+ N  D KPV +V+P           P   +   F ++ +  
Sbjct  174   RLTTKLQEIIGDKYRLYLVEN-TDGKPVVIVLPS-----RNDPRPMSLSQKVFAIILLIA  227

Query  1062  LLLRNVPALQANLLSVFD---NFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGV  892
              ++ ++ A  + +L  FD   +F  L+  LP  L   ++L  HEI H L+A++  I+L  
Sbjct  228   TVVTSLEA--SGILQGFDLFADFARLQQTLPLGLGILVVLLSHEIGHWLLARRHKIRLSW  285

Query  891   PYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglG  712
             PYF+P+ QIGSFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     + 
Sbjct  286   PYFLPAVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGIVSVVMLITGLLLSHQGSMF  345

Query  711   VVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDG  532
              +  P+ F +  +  G    ++  +  +   + V+PLV+    GL+I A+N IPAG+LDG
Sbjct  346   QL--PNQFFQGSILVGSLAKVVLGSALQSPLVDVHPLVIIGWLGLVITALNLIPAGQLDG  403

Query  531   GRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPD  352
             GRI  +I+GRKT+ R + A++ LLG+ AL + +A YW ++I  LQR    P  +EIT+PD
Sbjct  404   GRIVQAIYGRKTAGRATFATLILLGLVALGNPLAMYWAIVILFLQRDLERPSLDEITEPD  463

Query  351   N  349
             +
Sbjct  464   D  464



>ref|WP_021830770.1| Peptidase M50 [Crocosphaera watsonii]
 emb|CCQ51488.1| Peptidase M50 [Crocosphaera watsonii WH 8502]
Length=506

 Score =   181 bits (458),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 201/355 (57%), Gaps = 11/355 (3%)
 Frame = -1

Query  1404  QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRM  1225
             + + + I IP E + ++K  +F  DTFF T    Y+ G +F+GNLRG+   SY+K+S+++
Sbjct  128   KNISDLIPIPDEDLQLIKG-IFSIDTFFATETISYQEGAIFRGNLRGETEESYQKLSEKL  186

Query  1224  QDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             +D FG+ Y+LFL +   + KPV +++P  +  P  T + +   A    + T+FT L    
Sbjct  187   KDSFGEKYRLFL-VEGSEGKPVVIILPS-SDDPQPTTLVQKNLALVLLVGTVFTTLEAAS  244

Query  1044  PALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
               L  +L   F+N+      LP  L    I   HE+ H + A++  IK+ VP+F+P+WQI
Sbjct  245   ILLGFDL---FNNWGRYIETLPIGLALWGIFIFHEVGHRVAAKRYDIKMSVPFFLPTWQI  301

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   A AGP  G  L FILL++G  L     L  V  P+ F 
Sbjct  302   GSFGAITRFESLIPTRNALFDVALAGPACGGILSFILLIIGLVLSHDGSLFQV--PTQFF  359

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G    ++     +   + V+PL +    GL++ A+N +PAG+LDGGRI  +I+G
Sbjct  360   QGSILVGSLAKVVLGEQLQNAIVDVHPLTVVGWLGLVVTALNLMPAGQLDGGRIIQAIYG  419

Query  504   RKTSARlssasigllgisaLFS---DVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R +  ++ +LGI  +FS    +  YW V+I  LQR    P   E+T+PD+
Sbjct  420   RKTARRATIITLVILGIVTIFSPANPIPLYWAVVILFLQRDLERPSLNELTEPDD  474



>ref|WP_021835009.1| Peptidase M50 [Crocosphaera watsonii]
 emb|CCQ60889.1| Peptidase M50 [Crocosphaera watsonii WH 0401]
Length=506

 Score =   181 bits (458),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 129/355 (36%), Positives = 201/355 (57%), Gaps = 11/355 (3%)
 Frame = -1

Query  1404  QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRM  1225
             + + + I IP E + ++K  +F  DTFF T    Y+ G +F+GNLRG+   SY+K+S+++
Sbjct  128   KNISDLIPIPDEDLQLIKG-IFSIDTFFATETISYQEGAIFRGNLRGETEESYQKLSEKL  186

Query  1224  QDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             +D FG+ Y+LFL +   + KPV +++P  +  P  T + +   A    + T+FT L    
Sbjct  187   KDSFGEKYRLFL-VEGSEGKPVVIILPS-SDDPQPTTLVQKNLALVLLVGTVFTTLEAAS  244

Query  1044  PALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
               L  +L   F+N+      LP  L    I   HE+ H + A++  IK+ VP+F+P+WQI
Sbjct  245   ILLGFDL---FNNWGRYIETLPIGLALWGIFIFHEVGHRVAAKRYDIKMSVPFFLPTWQI  301

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   A AGP  G  L FILL++G  L     L  V  P+ F 
Sbjct  302   GSFGAITRFESLIPTRNALFDVALAGPACGGILSFILLIIGLVLSHDGSLFQV--PTQFF  359

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G    ++     +   + V+PL +    GL++ A+N +PAG+LDGGRI  +I+G
Sbjct  360   QGSILVGSLAKVVLGEQLQNAIVDVHPLTVVGWLGLVVTALNLMPAGQLDGGRIIQAIYG  419

Query  504   RKTSARlssasigllgisaLFS---DVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R +  ++ +LGI  +FS    +  YW V+I  LQR    P   E+T+PD+
Sbjct  420   RKTARRATIITLVILGIVTIFSPANPIPLYWAVVILFLQRDLERPSLNELTEPDD  474



>ref|WP_039740188.1| peptidase M50 [Hassallia byssoidea]
 gb|KIF37251.1| peptidase M50 [Hassallia byssoidea VB512170]
Length=492

 Score =   180 bits (457),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 131/348 (38%), Positives = 204/348 (59%), Gaps = 14/348 (4%)
 Frame = -1

Query  1383  RIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDL  1204
             RIP+E ++ +K  +FG DTFF T    Y+ G +FKGNLRG+    + +++  +++R GD 
Sbjct  125   RIPEEELNAIKG-IFGLDTFFATEAIAYQQGAIFKGNLRGEPEEVHNRLTISLEERLGDK  183

Query  1203  YKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL  1024
             Y+LFL+ NP D K V +V+P  +  P  + + +   AG   L TI T L        A L
Sbjct  184   YRLFLVENP-DGKSVIIVLPS-SNDPRPSTLSQKIFAGILFLATIATSLE------AAGL  235

Query  1023  LSVFDNFD---LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
             L  FD F+        LP A     IL +HE+ H L+A++  I+L +P+F+P+ QIGSFG
Sbjct  236   LLRFDFFENPSRFAEALPIAAGILTILLIHELGHWLLARRHQIRLSLPFFLPAVQIGSFG  295

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITR  +++P R+ L   A AGP AG     + L++G  L     L  +  P+ F +  +
Sbjct  296   AITRFESLLPNRKVLFDIAIAGPAAGGIASLVTLIIGLLLSHQGSLFQL--PNEFFQGSI  353

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
               G    ++  +  + + + ++PLV+    GL+I AIN +PAG LDGGRI  +I+GRKT+
Sbjct  354   LVGSLARIILGSALQSSVVDIHPLVVIGWLGLVITAINLMPAGVLDGGRIVQAIYGRKTA  413

Query  492   ARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              R++ A++ +LGI++L + +A YW ++I  LQR    P   EI++PD+
Sbjct  414   GRVTVATLIVLGIASLANPLAMYWAIVILFLQRDLERPSLNEISEPDD  461



>ref|WP_039201805.1| peptidase M50 [Aphanizomenon flos-aquae]
 gb|KHG41419.1| peptidase M50 [Aphanizomenon flos-aquae 2012/KM/D3]
Length=491

 Score =   180 bits (457),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 204/359 (57%), Gaps = 20/359 (6%)
 Frame = -1

Query  1407  PQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKR  1228
             P+   E   IP+  + +++  +FG DTFF T   PY+ GV+FKGNLRG+    + +++K 
Sbjct  115   PELQLEPTPIPEADLSLIRG-IFGIDTFFATETIPYQEGVVFKGNLRGEPEAVHNRLTKS  173

Query  1227  MQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRN  1048
             +Q+R  D Y+LFL+ N  D KPV +++P  T         + FA   F + TI T L   
Sbjct  174   LQERLEDKYRLFLVEN-TDGKPVIIILPSRTDPQRAQLAQKAFAVILF-IATIATSL---  228

Query  1047  VPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPY  886
                    +  +  NFDL  N       LP AL  ++IL  HE+ H L+A++  +KL  P+
Sbjct  229   ------EVGGILQNFDLFSNPERFAEALPIALGLSVILISHEVGHWLLARRHQVKLSWPF  282

Query  885   FVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVV  706
             F+P+ QIGSFGAITR  ++VP R+ L   A AGP  G     +LL++G  L     L  +
Sbjct  283   FLPAVQIGSFGAITRFESLVPSRKALFDIALAGPAFGGITSLLLLVIGLLLSHPGSLFQL  342

Query  705   VDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGR  526
               P+ F +  +  G    ++  +  +   ++++PLV+    GL+I A+N +PAG+LDGGR
Sbjct  343   --PNQFFQGSILVGSLARVVLGSALQSPVVNIHPLVIIGWLGLVITALNLMPAGQLDGGR  400

Query  525   ISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I  +I+GRKT+ R + A+I LL I +L + +A YW ++I  LQR    P   EI++PD+
Sbjct  401   IVQAIYGRKTAGRTTFATIVLLAIVSLGNPLAMYWAIVILFLQRDLERPSLNEISEPDD  459



>ref|WP_015218252.1| peptidase M50 [Cyanobacterium aponinum]
 ref|YP_007160565.1| peptidase M50 [Cyanobacterium aponinum PCC 10605]
 gb|AFZ52521.1| peptidase M50 [Cyanobacterium aponinum PCC 10605]
Length=528

 Score =   181 bits (459),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 142/409 (35%), Positives = 227/409 (56%), Gaps = 23/409 (6%)
 Frame = -1

Query  1563  NSLADQDNGQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAI  1384
             NS +D DN       + K+  +    N++ +   ++ +D++ ++ +P+   K  QL+   
Sbjct  106   NSESDSDNN------DKKETEDQEKNNLSLE--KQEDEDVKESNFTPV---KLAQLEPEF  154

Query  1383  R-IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGD  1207
               I +E +  +K  +FG DTFF     PY+ GV+FKGNLRG+A  S+  +++++ ++FGD
Sbjct  155   NPIQEEDLKEIK-TIFGIDTFFAIDTIPYQEGVIFKGNLRGEAEYSHRHLTEKLTEKFGD  213

Query  1206  LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQAN  1027
              Y+LFL+  PE +KPV +++P     P    + +   A    L TIFT +      L  +
Sbjct  214   KYRLFLVETPE-EKPVVIILPSAN-DPKPLTLAQKNLALVLFLATIFTSMEAIALLLGFD  271

Query  1026  LLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
             L+  +D +  +   LP       IL  HEI+H ++A++  +K+ +P+F+PS QIGSFGAI
Sbjct  272   LVGSWDRYPEV---LPLTGGLWFILLAHEIAHRIIAERNKVKVSLPFFLPSLQIGSFGAI  328

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TR  +++P R  L   A AGP A F +   +LLLGF L   +    +  P+ F    +  
Sbjct  329   TRFESLIPNRSVLFDVAFAGPAASFVVSLGILLLGFILSAPNSSFEI--PTSFFRGSILV  386

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
             G    L   +  E   I V+P  +    GL+I AIN +PAG+LDGGRI  +I+GRKT  R
Sbjct  387   GGLAKLFFQSGLEADTIGVHPFTILGWLGLVITAINLLPAGQLDGGRIIQAIYGRKTCRR  446

Query  486   lssasigllgisaLFSDV---AFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +  ++ +LGI ++F+ V    FYW ++I  LQR    P   E+T+PD+
Sbjct  447   TTVGTLIILGIVSIFNPVNSLPFYWAIIILFLQRDLERPSLNELTEPDD  495



>ref|WP_015221535.1| peptidase M50 [Cyanobacterium stanieri]
 ref|YP_007163864.1| peptidase M50 [Cyanobacterium stanieri PCC 7202]
 gb|AFZ46215.1| peptidase M50 [Cyanobacterium stanieri PCC 7202]
Length=510

 Score =   180 bits (457),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 136/393 (35%), Positives = 220/393 (56%), Gaps = 33/393 (8%)
 Frame = -1

Query  1500  NGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFF  1321
             N  + N   +  N++   +Q    +P+P +    +DE      + I+ +K  +F  DTFF
Sbjct  110   NPENSNSEEEKNNQEESSLQ----NPIPEINFTPIDE------QDIETIKG-IFNIDTFF  158

Query  1320  VTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPR  1141
              T   PY+ G +FKGNLR +   +++K+S++++++ GD Y+LFL+  P D KPV +++P 
Sbjct  159   STETIPYQEGAIFKGNLRTEPEIAHQKLSEKLEEKLGDKYRLFLVETP-DGKPVVIILPS  217

Query  1140  ITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN------GLP  979
                    T V +  A   F + T FT       +++A  +SV   FDL++N       LP
Sbjct  218   SNDPKPLTLVQKNLALVLF-VATAFT-------SIEA--ISVLLGFDLIDNWSRYPESLP  267

Query  978   GALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKF  799
               L   LIL VHE+ H ++A+K  IK+ +P+F+P+ QIG+FGAITR  +++P R  L   
Sbjct  268   LTLGLWLILFVHEMGHRIMAEKHNIKVSLPFFLPNIQIGTFGAITRFESLIPNRSVLFDI  327

Query  798   AAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTP  619
             A AGP  G  L  I+L  G  +   +    +  PS+F +  +  G    L+  +      
Sbjct  328   AFAGPALGGGLSLIMLFFGLVMSGGNTGLQI--PSLFFQGSILVGGLAKLILGSTLSQAT  385

Query  618   ISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFS  439
             I+++PL++    GL+I A+N +PAG+LDGGRI  +I+GRK + R +  ++ +LGI +LF+
Sbjct  386   IAIHPLMILGWLGLVITALNCLPAGQLDGGRIIQAIYGRKIARRATILTLIVLGIVSLFN  445

Query  438   DV---AFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              V    FYW ++I  LQR    P   E+T+PD+
Sbjct  446   TVNSLPFYWAIVILFLQRDLERPSLNELTEPDD  478



>ref|WP_027404901.1| peptidase M50 [Aphanizomenon flos-aquae]
Length=492

 Score =   180 bits (456),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 133/359 (37%), Positives = 204/359 (57%), Gaps = 20/359 (6%)
 Frame = -1

Query  1407  PQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKR  1228
             P+   E   IP+  + +++  +FG DTFF T   PY+ GV+FKGNLRG+    + +++K 
Sbjct  116   PELQLEPTPIPEADLSLIRG-IFGIDTFFATETIPYQEGVVFKGNLRGEPEAVHNRLTKS  174

Query  1227  MQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRN  1048
             +Q+R  D Y+LFL+ N  D KPV +++P  T         + FA   F + TI T L   
Sbjct  175   LQERLEDKYRLFLVEN-TDGKPVIIILPSRTDPQRAQLAQKAFAVILF-IATIATSL---  229

Query  1047  VPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPY  886
                    +  +  NFDL  N       LP AL  ++IL  HE+ H L+A++  +KL  P+
Sbjct  230   ------EVGGILQNFDLFSNPERFAEALPIALGLSVILISHEVGHWLLARRHQVKLSWPF  283

Query  885   FVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVV  706
             F+P+ QIGSFGAITR  ++VP R+ L   A AGP  G     +LL++G  L     L  +
Sbjct  284   FLPAVQIGSFGAITRFESLVPSRKALFDIALAGPAFGGITSLLLLVIGLLLSHPGSLFQL  343

Query  705   VDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGR  526
               P+ F +  +  G    ++  +  +   ++++PLV+    GL+I A+N +PAG+LDGGR
Sbjct  344   --PNQFFQGSILVGSLARVVLGSALQSPVVNIHPLVVIGWLGLVITALNLMPAGQLDGGR  401

Query  525   ISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I  +I+GRKT+ R + A+I LL I +L + +A YW ++I  LQR    P   EI++PD+
Sbjct  402   IVQAIYGRKTAGRTTFATIVLLAIVSLGNPLAMYWAIVILFLQRDLERPSLNEISEPDD  460



>dbj|GAL92581.1| peptidase M50 [Microcystis aeruginosa NIES-44]
Length=496

 Score =   180 bits (456),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 125/352 (36%), Positives = 205/352 (58%), Gaps = 13/352 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             + I IP+E + +++  +FG DTFF T    ++ G +FKGNLRG+    + ++++++ D F
Sbjct  122   DVIPIPEEDLKVIQS-IFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLNQKLSDHF  180

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL +   ++KPV +++P+ T +P     P   A     LV +   ++ ++ A  
Sbjct  181   GDKYRLFL-VEGTEEKPVVIILPK-TNEPS----PATLAQKNLSLVLLVATIVTSLEAAG  234

Query  1032  ANL-LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSF  856
               L   +F N+   +  +P +L    +L  HEI H ++A++  I+L +PYF+P+WQIGSF
Sbjct  235   ILLGFDLFSNWQRYQEAIPLSLGLWSVLIAHEIGHLIIAKRHNIRLSLPYFLPTWQIGSF  294

Query  855   GAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESl  676
             GAITR  +++P R  L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S 
Sbjct  295   GAITRFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSS  352

Query  675   laggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKT  496
             +  G    ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK 
Sbjct  353   ILVGSLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKI  412

Query  495   SARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + R + A++ +LGI +L    + +  YW +L+  LQR    P   E+T+PD+
Sbjct  413   ARRTTVATLVILGIISLVNPSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_015206519.1| putative membrane-associated Zn-dependent protease [Cylindrospermum 
stagnale]
 ref|YP_007145943.1| putative membrane-associated Zn-dependent protease [Cylindrospermum 
stagnale PCC 7417]
 gb|AFZ23263.1| putative membrane-associated Zn-dependent protease [Cylindrospermum 
stagnale PCC 7417]
Length=494

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 139/387 (36%), Positives = 220/387 (57%), Gaps = 17/387 (4%)
 Frame = -1

Query  1497  GNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFV  1318
             G    +  +  ++ A D   ++  P P +   +L EA+ IP E +  +K  +FG DTFF 
Sbjct  89    GQDAILRQRATDKLAADASSSANPPEPRVIELKL-EALAIPDEDLSAIKG-IFGIDTFFA  146

Query  1317  TSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRI  1138
             T    Y+ GV+FKGNLRG+A   + +++K +Q+R G+ Y+LFL+ N E  KPV +++P  
Sbjct  147   TETIAYQEGVVFKGNLRGEAEEVHNRLTKSLQERLGEKYRLFLVENTE-AKPVVIILPSR  205

Query  1137  TLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNF----DLLENGLPGAL  970
             +  P    +P+      F ++ +   L   + A  A LL  FD F       E    G+ 
Sbjct  206   S-DPRPMLLPQ----KVFAVILLVATLATCLEA--AGLLQNFDLFATPERFKETLAIGSG  258

Query  969   VTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAA  790
             + A IL  HEI H L+A+   + L  P+F+P+ QIGSFGAITR  +++P R+ L   A A
Sbjct  259   IFA-ILVAHEIGHWLLARSHQVTLSWPFFLPAVQIGSFGAITRFESLLPNRKALFDIALA  317

Query  789   GPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISV  610
             GP AG  +  ++L+ G  L     L  +  P+ F +  +  G    ++  +  +   +S+
Sbjct  318   GPAAGGIVSLLMLITGLLLSHPGSLFQL--PNQFFQGSILVGSLARVVLGSALQSAVVSI  375

Query  609   NPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVA  430
             +PLV+    GL+I A+N +PAG+LDGGRI  +I+GRKT+ R + A++ LLGI +L + +A
Sbjct  376   HPLVVIGWLGLIITALNLMPAGQLDGGRIVQAIYGRKTAGRATIATLLLLGIVSLANPLA  435

Query  429   FYWVVLIFVLQRGPIAPLSEEITDPDN  349
              YW+++I +LQR    P   EIT+PD+
Sbjct  436   MYWLIVILLLQRDQERPSLNEITEPDD  462



>ref|WP_013320498.1| peptidase M50 [Cyanothece sp. PCC 7822]
 ref|YP_003885663.1| peptidase M50 [Cyanothece sp. PCC 7822]
 gb|ADN12388.1| peptidase M50 [Cyanothece sp. PCC 7822]
Length=514

 Score =   179 bits (455),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 128/353 (36%), Positives = 202/353 (57%), Gaps = 11/353 (3%)
 Frame = -1

Query  1398  LDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQD  1219
             + E + IP+E + +++  +FG DTFFVT    Y+ G +FKGNLRG+    + ++S++++ 
Sbjct  138   IAEVLPIPEEDLKVMQG-IFGIDTFFVTETISYQEGAIFKGNLRGEPDLVHARLSEKLES  196

Query  1218  RFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPA  1039
              F D Y+LFL +   + KPV +++P  +  P  + + +   A    + TI T L  +   
Sbjct  197   HFQDKYRLFL-VEGSEGKPVVIILPS-SDDPQPSTLAQKNLALVLLIATIATSLEASSIL  254

Query  1038  LQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
             L  +L   F+N    +  +P +L    IL  HEI H L+A++  I+L +P+F+P+WQIGS
Sbjct  255   LGFDL---FNNLGRYQEAIPLSLGIWGILAAHEIGHRLIAKRYNIRLSIPFFLPTWQIGS  311

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAITR  ++VP R  L     AGP  G  +  I L++G  L     L  V  P+ F + 
Sbjct  312   FGAITRFESLVPNRNVLFDITFAGPALGGLVSLIFLVIGLVLSHQGSLFQV--PTRFFQG  369

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              +  G    ++     + + I V+PL +    GL+INA+N +PAG+LDGGRI  +I+GRK
Sbjct  370   SILVGSLARVVLGDALQNSLIDVHPLTIIGWLGLIINALNLLPAGQLDGGRIVQAIYGRK  429

Query  498   TSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             T+ R + A++ +LGI AL    + V  YW +LI  LQR    P   E+++PD+
Sbjct  430   TARRATIATLVILGIVALVNPANPVPLYWAILILFLQRDLERPTLNELSEPDD  482



>ref|WP_024546216.1| peptidase M50 [Synechococcus sp. NKBG15041c]
Length=495

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 130/341 (38%), Positives = 193/341 (57%), Gaps = 22/341 (6%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF T   PY+ G +FKGNLRG    ++ K+++++ DR GD Y+LFL+ +PE  K
Sbjct  136   IFGIDTFFSTEAIPYQEGAIFKGNLRGDPEEAHHKLTEKLGDRLGDKYRLFLVEDPEG-K  194

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PV V++P     P  T + +   A A  + T+ T L           + V   FDL  N 
Sbjct  195   PVVVILPSRN-DPKATTLAQKNIALALFVATLVTTL---------EAIGVLKGFDLFSNW  244

Query  984   ------LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVP  823
                   +P +L   LILGVHE+ H   +QK  +KL +P+F+P+WQI SFGAITR  +++P
Sbjct  245   QRYTEVVPLSLGMWLILGVHELGHWWASQKHTVKLSIPFFLPNWQIASFGAITRFESLLP  304

Query  822   KREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllg  643
              R  L   A AGP AG     ILL++G  L   + L  +  PS F +  +  G     L 
Sbjct  305   NRTALFDIAFAGPAAGGVFSLILLIIGLGLSNPNSLFQI--PSQFFQGSILVGTLARFLL  362

Query  642   daLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigl  463
                 + T ++++PL +    GL+I A+N +PAG LDGGRI  +I+GRKT+ R + A++ +
Sbjct  363   GDGLQQTLVAIHPLTVLGWLGLVITALNLLPAGCLDGGRIIQAIYGRKTARRTTIATLIV  422

Query  462   lgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             LG+ ALF   + +  YW ++I  LQR    P   E+ +P++
Sbjct  423   LGLIALFNPANPIPLYWALIIIFLQREAERPSLNELLEPND  463



>ref|WP_028082085.1| peptidase M50 [Dolichospermum circinale]
Length=494

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 130/355 (37%), Positives = 197/355 (55%), Gaps = 20/355 (6%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
              E   IP+  + +++  +FG DTFF T   PY+ GV+FKGNLRG+    + +++K +Q+R
Sbjct  122   SEPTPIPEADLSLIRG-IFGIDTFFATETIPYQEGVVFKGNLRGEPEAVHNRLTKSLQER  180

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
               D Y+LFL+ N  D KPV +V+P  T    T    + FA           +LL    A 
Sbjct  181   LNDKYRLFLVEN-TDGKPVIIVLPSRTDPQRTQLGQKVFA----------VILLIATMAT  229

Query  1035  QANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS  874
                +  +  NFDLL +       LP AL   +I   HE+ H L+A++  ++L  P+F+P+
Sbjct  230   SLEVGGILQNFDLLSHPERFAEALPIALGLFVIFISHEVGHWLLARRHQVRLSWPFFLPA  289

Query  873   WQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPS  694
              Q+GSFGAITR  ++VP R  L   A AGP  G     +LL++G  L     L  +  P+
Sbjct  290   VQVGSFGAITRFESLVPNRNALFDIALAGPAFGGITSLLLLVVGLLLSHPGSLFQL--PN  347

Query  693   VFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFS  514
              F +  +  G    ++  +      ++++PLV+    GL+I A+N +PAG+LDGGRI  +
Sbjct  348   QFFQGSILVGSLARVVLGSALHSPVVNIHPLVIIGWLGLVITALNLMPAGQLDGGRIVQA  407

Query  513   IWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I+GRKT+ R +  +I LL I +L + +A YW +LI  LQR    P   EIT+PD+
Sbjct  408   IYGRKTAGRTTFVTIVLLAIVSLGNPLAMYWAILILFLQRDLERPSLNEITEPDD  462



>emb|CDN13196.1| Zinc metalloprotease [Richelia intracellularis]
Length=491

 Score =   179 bits (453),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 134/381 (35%), Positives = 216/381 (57%), Gaps = 24/381 (6%)
 Frame = -1

Query  1473  QTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEG  1294
             Q+  E   + ++ S   L  L+P+     I IP E ++ +K  +FG DTFFVT    Y  
Sbjct  97    QSQEERQQEDEVQSQETLEQLQPK----LISIPGEDLNNIKG-IFGIDTFFVTKTTAYLE  151

Query  1293  GVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTA  1114
             G +F+GNLRG+   ++ +++  +++   + Y+LFL+ N  D KPV +++P        T 
Sbjct  152   GAIFEGNLRGEPEATHNRLTASLKEGLDEKYRLFLVEN-RDGKPVVILLPSKNDPRPMTV  210

Query  1113  VPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN------GLPGALVTALIL  952
             V + FA G   L TI T +  +          +  NFDL  N       +P A+   +IL
Sbjct  211   VQKGFA-GILFLATIATCMETS---------GILLNFDLFANPGRYMETVPIAIGVLIIL  260

Query  951   GVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagf  772
               HE++H +VA +  ++L +PYF+P+ Q+GSFGAITR  +++P R+ L   A AGP AG 
Sbjct  261   LTHEVAHRVVANRYQVRLSLPYFLPALQLGSFGAITRFESLLPNRKILFDIALAGPAAGG  320

Query  771   slgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLW  592
              L  ILL++G  L     L  +  P+ F +  +  G    ++  +  + + + +NPLV+ 
Sbjct  321   ILSLILLVVGLLLSHPGSLFQL--PNEFFQGSILVGSLARVILGSTVQSSVVDINPLVIV  378

Query  591   SLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVL  412
                GL+++AIN +PAG+LDGGRI  +I+GRKT+ R + A++ LL + +L + +A YWV++
Sbjct  379   GWLGLVLSAINLMPAGQLDGGRIVQAIYGRKTAGRTTFATVILLALVSLANPLAMYWVIV  438

Query  411   IFVLQRGPIAPLSEEITDPDN  349
             I  LQR    P   EI++PD+
Sbjct  439   ILFLQRNLERPSLNEISEPDD  459



>ref|WP_037219960.1| peptidase M50 [Richelia intracellularis]
Length=499

 Score =   179 bits (454),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 134/381 (35%), Positives = 216/381 (57%), Gaps = 24/381 (6%)
 Frame = -1

Query  1473  QTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEG  1294
             Q+  E   + ++ S   L  L+P+     I IP E ++ +K  +FG DTFFVT    Y  
Sbjct  105   QSQEERQQEDEVQSQETLEQLQPK----LISIPGEDLNNIKG-IFGIDTFFVTKTTAYLE  159

Query  1293  GVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTA  1114
             G +F+GNLRG+   ++ +++  +++   + Y+LFL+ N  D KPV +++P        T 
Sbjct  160   GAIFEGNLRGEPEATHNRLTASLKEGLDEKYRLFLVEN-RDGKPVVILLPSKNDPRPMTV  218

Query  1113  VPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN------GLPGALVTALIL  952
             V + FA G   L TI T +  +          +  NFDL  N       +P A+   +IL
Sbjct  219   VQKGFA-GILFLATIATCMETS---------GILLNFDLFANPGRYMETVPIAIGVLIIL  268

Query  951   GVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagf  772
               HE++H +VA +  ++L +PYF+P+ Q+GSFGAITR  +++P R+ L   A AGP AG 
Sbjct  269   LTHEVAHRVVANRYQVRLSLPYFLPALQLGSFGAITRFESLLPNRKILFDIALAGPAAGG  328

Query  771   slgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLW  592
              L  ILL++G  L     L  +  P+ F +  +  G    ++  +  + + + +NPLV+ 
Sbjct  329   ILSLILLVVGLLLSHPGSLFQL--PNEFFQGSILVGSLARVILGSTVQSSVVDINPLVIV  386

Query  591   SLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVL  412
                GL+++AIN +PAG+LDGGRI  +I+GRKT+ R + A++ LL + +L + +A YWV++
Sbjct  387   GWLGLVLSAINLMPAGQLDGGRIVQAIYGRKTAGRTTFATVILLALVSLANPLAMYWVIV  446

Query  411   IFVLQRGPIAPLSEEITDPDN  349
             I  LQR    P   EI++PD+
Sbjct  447   ILFLQRNLERPSLNEISEPDD  467



>ref|WP_030006587.1| peptidase M50 [Synechococcus sp. NKBG042902]
Length=498

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 198/335 (59%), Gaps = 10/335 (3%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF T   PY+ G +FKGNLRG+   ++ K+++++ DR GD Y+LFL+ +PE  K
Sbjct  139   IFGIDTFFATEAIPYQEGAIFKGNLRGEPEEAHRKLTEKLGDRLGDKYRLFLVEDPEG-K  197

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PV V++P  +  P TT++ +   A    + T+ T L   +  L+      F ++    + 
Sbjct  198   PVIVILPS-SNDPKTTSLAQKNVALVLFVATLATTL-EAIGVLKG--FDFFSDWQRYTDV  253

Query  984   LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLL  805
             LP +L   LILGVHE+ H + ++K  +KL +P+F+P+WQI SFGAITR  +++P R  L 
Sbjct  254   LPLSLGMWLILGVHELGHWVTSRKYNVKLSIPFFLPNWQIASFGAITRFESLLPNRTALF  313

Query  804   KFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEG  625
               A AGP AG  +  +LLL GF L   D L  V  PS F +  +  G    +      + 
Sbjct  314   DIAFAGPAAGGLISLLLLLGGFGLSNPDSLFKV--PSQFFQGSVLVGTLARIFLGDGLQQ  371

Query  624   TPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaL  445
               ++++PL +    GL+I A+N +PAG LDGGRI  +I+GRKT+ R + A++ +LG+ AL
Sbjct  372   AIVAIHPLTILGWLGLVITALNLLPAGCLDGGRIVQAIYGRKTARRTTIATLVVLGLVAL  431

Query  444   F---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             F   + +  YW ++I  LQR    P   E+ +P++
Sbjct  432   FNPANPIPLYWALIIIFLQREAERPSLNELLEPND  466



>ref|WP_015130229.1| peptidase M50 [Calothrix sp. PCC 7507]
 ref|YP_007067260.1| peptidase M50 [Calothrix sp. PCC 7507]
 gb|AFY34426.1| peptidase M50 [Calothrix sp. PCC 7507]
Length=494

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 133/354 (38%), Positives = 205/354 (58%), Gaps = 20/354 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             EA  IP++ ++ +K  +FG DTFF T    Y+ G +FKGNLRG+    + ++S  +Q+R 
Sbjct  123   EAPPIPEDDLNAIKS-IFGIDTFFATETIAYQEGAIFKGNLRGEPEAIHNRLSASLQERL  181

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D KPV +V+P     P  T+  +   AG   + TI T       +L+
Sbjct  182   GDQYRLFLIEN-TDGKPVVIVLPSRN-DPRPTSASQKAFAGILLVATIAT-------SLE  232

Query  1032  ANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
             A+   +  NFDL          LP A     IL  HEI H L+A++  ++L  P+F+P+ 
Sbjct  233   AS--GILLNFDLFSQPERFLEALPIASGILAILVGHEIGHWLLARRHQVRLSWPFFLPAV  290

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITR  +++P R+ L   A AGP  G  L  ++L+ G  L     L  V  P+ 
Sbjct  291   QIGSFGAITRFESLLPNRKALFDIALAGPATGGILSLLMLIAGLLLSHQGSLFQV--PNQ  348

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++  +  +   ++V+PLV+    GL+I A+N +PAG+LDGGRI  +I
Sbjct  349   FFQGSILVGSLARVVLGSALQSPLVNVHPLVIIGWLGLVITALNLMPAGQLDGGRIIQAI  408

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+ R + A++ LLGI +L +++A YW ++I +LQR    P   E+++PD+
Sbjct  409   YGRKTAGRATLATLILLGIVSLANNLAMYWAIVILLLQRDLERPSLNEVSEPDD  462



>ref|WP_015078547.1| peptidase M50 [Anabaena sp. 90]
 ref|YP_006995196.1| peptidase M50 [Anabaena sp. 90]
 gb|AFW93383.1| peptidase M50 [Anabaena sp. 90]
Length=495

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 131/350 (37%), Positives = 200/350 (57%), Gaps = 20/350 (6%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+  + +++  +FG DTFF T   PY+ GV+FKGNLRG+    + +++K +++R  D Y
Sbjct  128   IPEADLSLIRG-IFGIDTFFATETIPYQEGVVFKGNLRGEPEAVHNRLTKTLRERLDDKY  186

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LFL +   D KPV +V+P  T  P  T +    A  AF ++     LL    A    + 
Sbjct  187   RLFL-VEDTDSKPVMIVLPSRT-DPQRTQL----AQKAFAVI-----LLIATIATSLEVG  235

Query  1020  SVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
              +  NFDL  N       LP AL   +IL  HE+ H L+A++  +KL  P+F+P+ QIGS
Sbjct  236   GILQNFDLFSNPERFAETLPIALGLLVILISHEVGHWLLARRHQVKLSWPFFLPAVQIGS  295

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAITR  ++VP R  L   A AGP  G     +LL++G  L     L  +  P+ F + 
Sbjct  296   FGAITRFESLVPSRNALFDIALAGPAFGGITSLLLLVIGLLLSHPGSLFQL--PNQFFQG  353

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              +  G    ++  +  +   ++++PLV+    GL+I A+N +PAG+LDGGRI  +I+GRK
Sbjct  354   SILVGSLARVVLGSALQSPLVNIHPLVIVGWLGLVITALNLMPAGQLDGGRIVQAIYGRK  413

Query  498   TSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             T+ R + A+I LL I +L + +A YW ++I  LQR    P   EI++PD+
Sbjct  414   TAGRTTFATIVLLAIVSLGNPLAMYWAIVILFLQRDLERPSLNEISEPDD  463



>ref|WP_007306071.1| Peptidase M50 [Crocosphaera watsonii]
 gb|EAM50235.1| Peptidase M50 [Crocosphaera watsonii WH 8501]
Length=506

 Score =   179 bits (454),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 201/355 (57%), Gaps = 11/355 (3%)
 Frame = -1

Query  1404  QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRM  1225
             + + + I IP E + ++K  +F  DTFF T    Y+ G +F+GNLRG+   SY+K+S+++
Sbjct  128   KNISDLIPIPDEDLQLIKG-IFSIDTFFATETISYQEGAIFRGNLRGETEESYQKLSEKL  186

Query  1224  QDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             +D FG+ Y+LFL +   + KPV +++P  +  P  T + +   A    + T+FT L    
Sbjct  187   KDSFGEKYRLFL-VEGSEGKPVVIILPS-SDDPQPTTLVQKNLALVLLVGTVFTTLEAAS  244

Query  1044  PALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
               L  +L   F+N+      LP  L    I   HE+ H + A++  IK+ VP+F+P+W+I
Sbjct  245   ILLGFDL---FNNWGRYIETLPIGLALWGIFIFHEVGHRVAAKRYDIKMSVPFFLPTWRI  301

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   A AGP  G  L FILL++G  L     L  V  P+ F 
Sbjct  302   GSFGAITRFESLIPTRNALFDVALAGPACGGILSFILLIIGLVLSHDGSLFQV--PTQFF  359

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G    ++     +   + V+PL +    GL++ A+N +PAG+LDGGRI  +I+G
Sbjct  360   QGSILVGSLAKVVLGEQLQNAIVDVHPLTVVGWLGLVVTALNLMPAGQLDGGRIIQAIYG  419

Query  504   RKTSARlssasigllgisaLFS---DVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R +  ++ +LGI  +FS    +  YW V+I  LQR    P   E+T+PD+
Sbjct  420   RKTARRATIITLVILGIVTIFSPANPIPLYWAVVILFLQRDLERPSLNELTEPDD  474



>ref|WP_017750019.1| peptidase M50 [Scytonema hofmanni]
Length=498

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 125/360 (35%), Positives = 203/360 (56%), Gaps = 14/360 (4%)
 Frame = -1

Query  1419  PGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEK  1240
             P    Q   E + IP+E + +++  +FG DTFF T    Y+ G +FKGNLRG A + + +
Sbjct  119   PATAAQLQLEVMPIPEEDLSVIRS-IFGIDTFFATETIAYQEGAIFKGNLRGDAEKVHTQ  177

Query  1239  ISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTL  1060
             +S+ +Q+R G+ Y+LFL+ N  D KPV +V+P     P    +P+      FG++ +   
Sbjct  178   LSESLQERLGNKYRLFLVEN-TDGKPVMIVLPSRN-DPRPMTIPQ----KIFGVILVLAT  231

Query  1059  LLRNVPALQANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVP  889
             ++ ++      LL  FD F         LP +     IL  HEI H L+A++  ++L +P
Sbjct  232   IVTSLET--GGLLLNFDFFSTPGRFPEALPISTGIITILVAHEIGHWLLARRHQVRLSLP  289

Query  888   YFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGV  709
             YF+P+ QIGSFGAITR  +++P R+ L   A AGP  G  +  ++L+ G  L     L  
Sbjct  290   YFLPAVQIGSFGAITRFESLIPNRKVLFDIALAGPATGGIISLLMLVTGLLLSHPGSLFQ  349

Query  708   VVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGG  529
             +  P+ F  S +  G    ++  +  +   + ++PLV+    GL+I A+N +PAG+LDGG
Sbjct  350   L--PNEFFSSSILVGTLARVILGSALQSPTVDIHPLVVVGWLGLVITALNLMPAGQLDGG  407

Query  528   RISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RI  +I+GRK + R + A++ LL + +L + +A YW ++I  LQR    P   E+++PD+
Sbjct  408   RIVQAIYGRKIAGRATIATLILLALVSLGTPLAMYWAIVILFLQRDLERPSLNELSEPDD  467



>ref|WP_011243844.1| hypothetical protein [Synechococcus elongatus]
 ref|YP_172244.1| hypothetical protein syc1534_d [Synechococcus elongatus PCC 6301]
 dbj|BAD79724.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=541

 Score =   179 bits (455),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 195/344 (57%), Gaps = 3/344 (1%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             +P + +  +K  +FG DTFF T   PY+ G +FKGNLRG+A     ++++ +++R GD Y
Sbjct  140   LPADDLQQIKG-IFGVDTFFATETIPYQEGAIFKGNLRGEAMVVQPRLAQLLKERLGDRY  198

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LF LIN   D+P  VV+P    +P      ++  A      T++T  LR    L  N L
Sbjct  199   RLF-LINDPSDRPAVVVLPSTACEPPKVLPAQYVLAVLLAGFTLWTCFLRGAEQLYPN-L  256

Query  1020  SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITR  841
              +    + L++  P A+  A +LG  E++H  +A +   +L  PYF+PS ++G +GA  R
Sbjct  257   DILLAPERLKDAAPLAIGLAALLGSRELAHRWMADRYQARLSPPYFLPSAELGGYGAYFR  316

Query  840   ILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggi  661
             + +I+  R +L   AAAGPL G  L  ++ ++G  L        +  PS   +S +  G+
Sbjct  317   LQSILRNRTELFDIAAAGPLVGGGLSLLVFVVGLLLSGTADTTGLPLPSQLLQSSVLIGL  376

Query  660   aklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARls  481
                 +     + T + V+PL +    GL++NA+N IP G+L GGR+  +++GRK + RL 
Sbjct  377   LARTVLGNAVQQTQLLVHPLAIVGWTGLIVNALNLIPIGQLSGGRLVQAVYGRKVAGRLG  436

Query  480   sasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + ++ +L I+A  + +AFYW VL+ + QR P  P +EE+++PD+
Sbjct  437   TFALLILAIAAFTNVIAFYWGVLVLLFQRQPERPSAEELSEPDD  480



>ref|WP_011378522.1| MULTISPECIES: hypothetical protein [Synechococcus]
 ref|YP_401593.1| hypothetical protein Synpcc7942_2576 [Synechococcus elongatus 
PCC 7942]
 gb|ABB58606.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD56941.1| hypothetical protein M744_03300 [Synechococcus sp. UTEX 2973]
Length=504

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 117/344 (34%), Positives = 195/344 (57%), Gaps = 3/344 (1%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             +P + +  +K  +FG DTFF T   PY+ G +FKGNLRG+A     ++++ +++R GD Y
Sbjct  132   LPADDLQQIKG-IFGVDTFFATETIPYQEGAIFKGNLRGEAMVVQPRLAQLLKERLGDRY  190

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LF LIN   D+P  VV+P    +P      ++  A      T++T  LR    L  N L
Sbjct  191   RLF-LINDPSDRPAVVVLPSTACEPPKVLPAQYVLAVLLAGFTLWTCFLRGAEQLYPN-L  248

Query  1020  SVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITR  841
              +    + L++  P A+  A +LG  E++H  +A +   +L  PYF+PS ++G +GA  R
Sbjct  249   DILLAPERLKDAAPLAIGLAALLGSRELAHRWMADRYQARLSPPYFLPSAELGGYGAYFR  308

Query  840   ILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggi  661
             + +I+  R +L   AAAGPL G  L  ++ ++G  L        +  PS   +S +  G+
Sbjct  309   LQSILRNRTELFDIAAAGPLVGGGLSLLVFVVGLLLSGTADTTGLPLPSQLLQSSVLIGL  368

Query  660   aklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARls  481
                 +     + T + V+PL +    GL++NA+N IP G+L GGR+  +++GRK + RL 
Sbjct  369   LARTVLGNAVQQTQLLVHPLAIVGWTGLIVNALNLIPIGQLSGGRLVQAVYGRKVAGRLG  428

Query  480   sasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + ++ +L I+A  + +AFYW VL+ + QR P  P +EE+++PD+
Sbjct  429   TFALLILAIAAFTNVIAFYWGVLVLLFQRQPERPSAEELSEPDD  472



>ref|WP_011610276.1| peptidase M50 [Trichodesmium erythraeum]
 ref|YP_720353.1| peptidase M50 [Trichodesmium erythraeum IMS101]
 gb|ABG49880.1| peptidase M50 [Trichodesmium erythraeum IMS101]
Length=500

 Score =   179 bits (453),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 124/359 (35%), Positives = 201/359 (56%), Gaps = 18/359 (5%)
 Frame = -1

Query  1410  KPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             K ++  E + I  E +  +KD +FG DTFF+T   PY+ G +FKGNLRG   + Y K+S 
Sbjct  123   KKEETLEFLPISTEDLQKVKD-IFGIDTFFITETIPYQEGAIFKGNLRGDIEKVYTKLSA  181

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLL  1054
             ++ ++ GD Y+LFLL +PE  KPV +++P +    P TT+           ++ +  LL 
Sbjct  182   KLAEKLGDRYRLFLLESPE-AKPVVILLPSKNDPLPATTSQK---------ILAVILLLA  231

Query  1053  RNVPALQA-NLLSVFDNFD---LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPY  886
                 + +A  LL  FD F+     +  LP  +   ++LG HEI+H ++A+   ++   P+
Sbjct  232   TIATSFEAGGLLLGFDFFNQPMRYQEALPIVIGLWIVLGGHEIAHQVLAKLHNVRFSWPF  291

Query  885   FVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVV  706
             F+P+WQIGSFG++ R  +I+P R+ L   A AGP  G  +   +LL G  L     L  +
Sbjct  292   FLPAWQIGSFGSVNRFESILPNRKVLFDVAFAGPAVGGIISLAMLLGGLLLSHEGSLFQM  351

Query  705   VDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGR  526
               PS F ++ +  G    ++       + + ++PL +    GL+I AIN +PAG+LDGGR
Sbjct  352   --PSEFFKASVLVGTLARVILGPAVHQSIVDIHPLAIIGWLGLVITAINLMPAGQLDGGR  409

Query  525   ISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I  +I+GRK + R +  +  +L  ++L + +A YW ++I VLQR    P   E+ +PD+
Sbjct  410   ILQAIYGRKVAGRATLFTFIVLVFASLVNPLALYWAIIILVLQRNLERPCLNELVEPDD  468



>ref|WP_041032880.1| peptidase M50 [Tolypothrix campylonemoides]
 gb|KIJ78708.1| peptidase M50 [Tolypothrix campylonemoides VB511288]
Length=498

 Score =   178 bits (452),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 198/351 (56%), Gaps = 22/351 (6%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E ++I+K  +FG DTFF T    Y+ G +FKGNLRG+    + +++  +++R GD Y
Sbjct  132   IPEEDLNIIKG-IFGIDTFFTTETIAYQEGAIFKGNLRGEPEAVHNRLTASLRERLGDKY  190

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPE-WFAAGAFGLVTIFTLLLRNVPALQANL  1024
             +LFL+ N  D KPV +V+P     P    +P+  FAA          +LL    A     
Sbjct  191   RLFLVEN-TDGKPVVIVLPSRN-DPRPMTLPQKAFAA----------ILLVGTIATSFET  238

Query  1023  LSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
               +  NFD   N       LP A    ++L  HEI H L+A++  I+L +PYF+P+ QIG
Sbjct  239   GGLLLNFDFFTNPGRFQEALPIAAGVLVVLAAHEIGHWLLARRHQIRLSLPYFLPAVQIG  298

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     L  +  P+ F  
Sbjct  299   SFGAITRFESLLPNRKVLFDIALAGPAAGGIVSLLMLVAGLLLSHQGSLFQL--PNQFFS  356

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+LDGGRI  +I+GR
Sbjct  357   GSILVGTLARVILGSGLQSPLVDVHPLVVIGWLGLIITALNLMPAGQLDGGRIVQAIYGR  416

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             KT+ R + A++ +LG+ +L +  A YW ++I  LQR    P   EIT+PD+
Sbjct  417   KTAGRTTLATLIVLGLVSLGNSFAMYWAIVILFLQRDLERPSLNEITEPDD  467



>ref|WP_012595338.1| MULTISPECIES: peptidase M50 [Cyanothece]
 ref|YP_002372225.1| peptidase M50 [Cyanothece sp. PCC 8801]
 ref|YP_003137784.1| peptidase M50 [Cyanothece sp. PCC 8802]
 gb|ACK66069.1| peptidase M50 [Cyanothece sp. PCC 8801]
 gb|ACV00949.1| peptidase M50 [Cyanothece sp. PCC 8802]
Length=501

 Score =   178 bits (451),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 126/352 (36%), Positives = 200/352 (57%), Gaps = 13/352 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+E + ++K  +F  DTFF T    Y+ G +FKGNLRG+A   YE++S++++  F
Sbjct  127   EVLPIPEEDLKLIKS-IFSIDTFFATETISYQEGAIFKGNLRGEADAVYERLSEKLKGHF  185

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
              D Y+LFL +   + KPV +V+P  ++ P     P   A     LV +   ++  + A+ 
Sbjct  186   VDKYRLFL-VEGTEGKPVVIVLPS-SVDPK----PSTLAQKNLALVLLVATIVTTLEAVG  239

Query  1032  ANL-LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSF  856
               L   +F N+   +  +P +L    +L  HEI H L+A++  ++L  P+F+P+WQ+G+F
Sbjct  240   LLLGFDLFSNWTRYQEAIPLSLGIWGVLFAHEIGHRLLAKRHNLRLSFPFFLPTWQLGAF  299

Query  855   GAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESl  676
             GAITR  +++P R  L   A AGP  G  +  ILL+ G  L     L  V  P+ F +  
Sbjct  300   GAITRFESLIPNRSALFDVAFAGPALGGIISLILLITGLILSQPGSLFQV--PTPFFQGS  357

Query  675   laggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKT  496
             +  G    ++     + + I V+PL +    GL+INA+N +PAG+LDGGRI  +I+GRKT
Sbjct  358   ILVGSLAKVVLGEQLQQSIIDVHPLTIIGWLGLMINALNLLPAGQLDGGRIVQAIYGRKT  417

Query  495   SARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + R + A++ +LGI  L    + +  YW V+I  LQR    P   E+T+PD+
Sbjct  418   ARRATIATLAVLGIVTLINPENSIPLYWAVVIIFLQRDLERPSLNELTEPDD  469



>ref|WP_040054451.1| peptidase M50 [Candidatus Atelocyanobacterium thalassa]
 gb|KFF41756.1| putative membrane-associated Zn-dependent protease [Candidatus 
Atelocyanobacterium thalassa isolate SIO64986]
Length=487

 Score =   177 bits (450),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 134/349 (38%), Positives = 207/349 (59%), Gaps = 15/349 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP + I  +K  +F  DTFF T    YEGGV+FKGNLRG +  +++ +S ++Q +F   Y
Sbjct  117   IPDQDIQTIKS-IFSIDTFFSTEAVLYEGGVIFKGNLRGDSDTTHKLLSNKLQTQFSGKY  175

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
              LFL +   ++KPV +V+P I      T + +  A   F L TI T L R      +NLL
Sbjct  176   CLFL-VEGTEEKPVVIVLPNINDSKSMTILQKNLAIVLF-LATIVTSLERT-----SNLL  228

Query  1020  S--VFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAI  847
                +F+N++  +  +P  L   +IL  HE+ H LVA   GIKL  P+F+P W+  SFGAI
Sbjct  229   GFDIFNNWNRYQEIIPITLALWMILVFHEVGHYLVANFYGIKLSWPFFLPIWEFSSFGAI  288

Query  846   TRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllag  667
             TR  +++P R+ L   + AGP+ G  L  + L+ G  L  +  L  +   S F +S+L G
Sbjct  289   TRFESLIPNRKTLFDISLAGPVFGGILSILFLISGLILSHSGSLLQITTQS-FQKSILIG  347

Query  666   giaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSAR  487
              +AK++LG+ L + + IS+NPLV+    GL+I A+N +PAG+LDGGRI  +I+GR T+ +
Sbjct  348   ILAKVILGEQL-QNSIISINPLVIVGWLGLVITALNLMPAGQLDGGRIIQAIYGRDTAKK  406

Query  486   lssasigllgisaLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +  ++ +LGI  +F+    +  YW+++I  LQR    P   E+T+P++
Sbjct  407   STVITLVILGIITIFNPNNLIPLYWIMVILFLQRDIGKPSLNELTEPND  455



>gb|KIE09820.1| peptidase M50 [Tolypothrix bouteillei VB521301]
Length=498

 Score =   177 bits (450),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 127/367 (35%), Positives = 204/367 (56%), Gaps = 14/367 (4%)
 Frame = -1

Query  1440  IASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQ  1261
             I + S  P    Q   E + IP+E + ++K  +FG DTFF T    Y+ G +FKGNLRG 
Sbjct  112   ITNNSTSPATVAQVELEVMPIPEEDLSVIKS-IFGIDTFFTTETIAYQEGAIFKGNLRGD  170

Query  1260  AARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFG  1081
             A + + ++S+ + +R G+ Y+LFL+ N  D KPV +V+P     P    VP+      FG
Sbjct  171   AEKVHTQLSESLHERLGNKYRLFLVEN-TDGKPVMIVLPSRN-DPRPMTVPQRI----FG  224

Query  1080  LVTIFTLLLRNVPALQANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKA  910
             ++ +   +  ++      LL  FD F      +  LP +     IL  HEI H L+A++ 
Sbjct  225   VILVLATIATSLET--GGLLLNFDFFSTPARFQEALPISAGIITILVAHEIGHWLLARRH  282

Query  909   GIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflp  730
              ++L  PYF+P+ QIGSFGAITR  +++P R+ L   + AGP  G  +  ++L+ G  L 
Sbjct  283   QVRLSWPYFLPAVQIGSFGAITRFESLIPNRKVLFDISLAGPATGGIISLLMLVTGLLLS  342

Query  729   padglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIP  550
                 L  +  P+ F  S +  G    ++  +  +   + ++PLV+    GL+I A+N +P
Sbjct  343   HPGSLFQL--PNEFFSSSILVGTLSRVILGSTLQSAIVDIHPLVVIGWLGLVITALNLMP  400

Query  549   AGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSE  370
             AG+LDGGRI  +I+GRK + R + A++ +L + +L + +A YW ++I  LQR    P   
Sbjct  401   AGQLDGGRIVQAIYGRKIAGRATVATLIVLALVSLGTPLAMYWAIVILFLQRDLERPSLN  460

Query  369   EITDPDN  349
             EI++PD+
Sbjct  461   EISEPDD  467



>ref|WP_015956910.1| peptidase M50 [Cyanothece sp. PCC 7424]
 ref|YP_002380197.1| peptidase M50 [Cyanothece sp. PCC 7424]
 gb|ACK73329.1| peptidase M50 [Cyanothece sp. PCC 7424]
Length=505

 Score =   177 bits (450),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 202/351 (58%), Gaps = 11/351 (3%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+E +  ++  +FG DTFF+T    Y+ G +FKGNLRG+A   + ++++++Q  F
Sbjct  131   EVLPIPEEDLKAIQG-IFGIDTFFITDTISYQEGAIFKGNLRGEADTVHSRLTEKLQSLF  189

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
              D Y+LFL +   + KPV +++P  T  P  T + +   A    + TI T L  +   L 
Sbjct  190   KDKYRLFL-VEGSEGKPVVIILPS-TDDPQPTTLAQKNLALVLLISTIATTLEASSILLG  247

Query  1032  ANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFG  853
              +L   F+N    +  +P +L    IL  HEI H L+A++  I+L VP+F+P+WQ+GSFG
Sbjct  248   FDL---FNNLGRYQEAIPLSLGIWGILAAHEIGHRLLAKQYNIRLSVPFFIPTWQLGSFG  304

Query  852   AITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESll  673
             AITR  +++P R  L   A AGP  G     +LL++G  L   D L  V  P+ F +  +
Sbjct  305   AITRFESLLPNRNALFDVAFAGPALGGVASLLLLVVGLVLSHQDSLFQV--PTRFFQGSI  362

Query  672   aggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTS  493
               G    ++     + + I V+PL +    GL+INA+N +PAG+LDGGRI  +I+GRKT+
Sbjct  363   LVGSLARVILGDELQQSLIHVHPLTIIGWLGLVINALNLLPAGQLDGGRIVQAIYGRKTA  422

Query  492   ARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              R + A++ +LGI AL    + V  YW +LI  LQR    P   E+T+ D+
Sbjct  423   RRATIATLIVLGIVALTNPANPVPLYWAILILFLQRDLERPSLNELTETDD  473



>ref|WP_016865864.1| peptidase M50 [Fischerella muscicola]
Length=496

 Score =   177 bits (449),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 128/351 (36%), Positives = 205/351 (58%), Gaps = 14/351 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+  ++ +K  +FG DTFF T    Y+ G +FKGNLRG+A   + ++S ++Q+  
Sbjct  125   EILPIPEADLNAIKG-IFGLDTFFATETIAYQEGAIFKGNLRGEAEMVHNRLSAKLQETL  183

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+L+L+ N  D+KPV +V+P     P   +V +      F ++ + + +  ++ A  
Sbjct  184   GDKYRLYLVEN-TDEKPVVIVLPSRN-DPRPMSVSQ----KVFAIILLVSTVATSLEA--  235

Query  1032  ANLLSVFD---NFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             + +L  FD   NF  L   LP  L   +IL  HEI H L+A++  I+L  PY +P+ QIG
Sbjct  236   SGILQGFDLFANFARLSETLPIGLGILVILLAHEIGHWLLARRHNIRLSWPYLLPAVQIG  295

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     +  +  P+ F +
Sbjct  296   SFGAITRFESLLPNRKVLFDIALAGPAAGGIVSVLMLIAGLLLSHPGSMFQL--PNQFFQ  353

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+LDGGRI  +I+GR
Sbjct  354   GSILVGSLARVVLGSALQSPLVDVHPLVVIGWLGLVITALNLMPAGQLDGGRIVQAIYGR  413

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             KT+ R + A++ LLG+ AL + +A YW ++I  LQR    P   EI++PD+
Sbjct  414   KTAGRTTFATLILLGLVALGNPLAMYWAIVILFLQRDLERPSLNEISEPDD  464



>ref|WP_015187728.1| peptidase M50 [Gloeocapsa sp. PCC 7428]
 ref|YP_007127012.1| peptidase M50 [Gloeocapsa sp. PCC 7428]
 gb|AFZ29852.1| peptidase M50 [Gloeocapsa sp. PCC 7428]
Length=495

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 203/354 (57%), Gaps = 9/354 (3%)
 Frame = -1

Query  1407  PQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISK  1231
             P QL  E + I    +  ++  +FG DTFF T   PY+ G++F+GNLRG+    ++K++ 
Sbjct  118   PAQLQPEVVPIADADLTAIRS-IFGVDTFFATETIPYQEGIIFRGNLRGEPEAVFQKLNS  176

Query  1230  RMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLR  1051
              +Q + GD Y+LFL+ N  D KPV +V+P     P  T VP+   A A  + TI T L  
Sbjct  177   NLQQQLGDRYRLFLVEN-LDGKPVVIVLPSRN-DPQPTTVPQTILAIALLVATIATCLEA  234

Query  1050  NVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
                 L  +    F N+      LP A     +L  HE+ H L+A++  ++L  P+F+P+ 
Sbjct  235   GGILLGFDF---FTNWQRFSEPLPIAAGILAVLLTHELGHRLIARRYQVRLSPPFFLPTL  291

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIG+FGAITR  +I+P R+ L   A AGP  G  L F++L+LG  L  ++ L  V  P+ 
Sbjct  292   QIGAFGAITRFQSILPNRKVLFDVAFAGPAFGGVLSFVILILGLLLSRSESLFQV--PTE  349

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F +  +  G    ++  +  +   ++V+PL +    GL+I A+N +PAG+LDGGRI  +I
Sbjct  350   FFQGSILVGTIARVILGSALQQNIVAVHPLTVIGWLGLVITALNLMPAGQLDGGRIVQAI  409

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+ R + A++ +L I++  + +A YW V+I  LQR    P   E+++PD+
Sbjct  410   YGRKTAGRATIATLIVLAIASFANPLALYWAVVIVFLQRDLERPSQNELSEPDD  463



>ref|WP_017304876.1| hypothetical protein [Spirulina subsalsa]
Length=502

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 136/371 (37%), Positives = 203/371 (55%), Gaps = 24/371 (6%)
 Frame = -1

Query  1443  QIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRG  1264
             ++ +GSP       +  + I IP E +  +K  +FG D+FF T    Y+ G +FKGNLRG
Sbjct  118   RVETGSP-------RTPDLIPIPDEDLQKIKG-IFGIDSFFATETISYQEGAIFKGNLRG  169

Query  1263  QAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAF  1084
             +  + YEK+S  +    G+ Y+LFL+ +PE  KPV +V+P  T  P     P   A    
Sbjct  170   EPEKVYEKLSNHLTQALGEKYRLFLVDSPEG-KPVVIVLPS-TNDPR----PATLAQKNL  223

Query  1083  GLVTIFTLLLRNVPALQANLLSVFDNFDLL---ENGLPGALVTALILGVHEISHTLVAQK  913
              LV +   L  ++ A  A LL  FD F  L      LP +     IL  HE  H L A++
Sbjct  224   ALVLLIATLATSLEA--AALLLGFDWFSDLGRYNEALPISAGLWFILAAHEGGHWLFARR  281

Query  912   AGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgffl  733
               ++L VPY +PSWQIG FG+ITR  +++P R  L   A AGP  G  + F++L+ G  L
Sbjct  282   HNLRLSVPYLLPSWQIGCFGSITRFESLIPHRSALFDVAIAGPALGGIISFLMLITGLLL  341

Query  732   ppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSI  553
                  L  +  P+ F +  +  G    ++  +  E + I V+PL +    GL+I A+N +
Sbjct  342   SHPGSLFKI--PTEFFQGSVLVGTLAKVVLGSALEASIIDVHPLTMIGWLGLVITALNLM  399

Query  552   PAGELDGGRISFSIWGRKTSARlssasigllgisaLFS---DVAFYWVVLIFVLQRGPIA  382
             PAG+LDGGR+  +I+GRKT+ R + A++ +LG+ A+FS    +  YW +LI  LQR    
Sbjct  400   PAGQLDGGRVIQAIYGRKTARRTTIATLIILGLVAIFSPGNPIPLYWGILILFLQRDLER  459

Query  381   PLSEEITDPDN  349
             P   E+T+PD+
Sbjct  460   PTLNELTEPDD  470



>gb|KIJ81862.1| peptidase M50 [Scytonema tolypothrichoides VB-61278]
Length=499

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 136/380 (36%), Positives = 209/380 (55%), Gaps = 17/380 (4%)
 Frame = -1

Query  1470  TGNEDADDIQIAS---GSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPY  1300
             T   +AD  Q AS    S LP    Q   E + IP+E ++++K  +FG DTFF T    Y
Sbjct  99    TQRLEADAQQQASPTNNSNLPEGNAQLKPEVLAIPEEDLNMIKG-IFGLDTFFSTETIAY  157

Query  1299  EGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDT  1120
             + G +FKGNLRG     + ++S  +Q+R GD Y+LFL+ N  D KPV +V+P     P  
Sbjct  158   QEGAIFKGNLRGDPEEVHNRLSASLQERLGDKYRLFLVEN-TDGKPVLIVLPSRN-DPRP  215

Query  1119  TAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNF---DLLENGLPGALVTALILG  949
               +P+   A    + TI T L        A LL  FD F   +  +  LP       +L 
Sbjct  216   MTLPQKVFAVILLVATIATSLE------TAGLLLNFDFFSNPERFQEILPIGAGILTVLI  269

Query  948   VHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfs  769
              HEI H L+A++  I+L +PYF+P+ QIGSFGAITR  +++P R+ L   + AGP AG  
Sbjct  270   AHEIGHWLLARRHQIRLSLPYFLPAIQIGSFGAITRFESLLPNRKVLFDISLAGPAAGGI  329

Query  768   lgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWS  589
             +  ++L+ G  L     L  +  P+ F    +  G    ++  +  +   + ++PLV+  
Sbjct  330   VSLLMLVAGLLLSHKGSLFQL--PNEFFSGSILVGTLARVILGSALQSPMVDIHPLVVIG  387

Query  588   LAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLI  409
               GL++ A+N +PAG+LDGGRI  +I+GRK + R + A++ +L + +L + +A YW ++I
Sbjct  388   WLGLVVTALNLMPAGQLDGGRIVQAIYGRKIAGRATIATLIVLALVSLVNPLAMYWAIVI  447

Query  408   FVLQRGPIAPLSEEITDPDN  349
               LQR    P   EI++PD+
Sbjct  448   LFLQRDLERPSLNEISEPDD  467



>ref|WP_012627821.1| peptidase M50 [Cyanothece sp. PCC 7425]
 ref|YP_002483107.1| peptidase M50 [Cyanothece sp. PCC 7425]
 gb|ACL44746.1| peptidase M50 [Cyanothece sp. PCC 7425]
Length=499

 Score =   177 bits (448),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 126/333 (38%), Positives = 196/333 (59%), Gaps = 9/333 (3%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF T   PY+ GV+ KGNLRG+ A  + ++S+ +Q    D Y+LFL+ N ++DK
Sbjct  143   IFGVDTFFATETVPYQDGVICKGNLRGEPATVHRRLSENLQTVLADQYRLFLVAN-QEDK  201

Query  1164  PVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             PV V++P R   QP TT   +   A    L T+ T  L     LQ    S ++  + L  
Sbjct  202   PVVVILPSRNDPQPTTTL--QKVLAVVLILATMAT-CLETSAILQG--FSFYNQPERLPE  256

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
              LP AL    +L VHE+ H  +A++  +KL  P+F+P+WQIGSFGA+ R  +++P R+ L
Sbjct  257   ALPIALGLLSVLAVHELGHRWLARRHQVKLSPPFFLPTWQIGSFGALIRFESLLPNRQAL  316

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
                A AGP  G  L  +LL++G  L        V  P++F +S +  G    ++     +
Sbjct  317   FDIALAGPATGGLLALLLLVVGLVLSHPGSGFQV--PALFFQSSILVGTLARVVLGDALQ  374

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
              + +SV+PLV+    GL+I A+N +PAG+LDGGR+  +I+GRK + R +  ++ LL I+A
Sbjct  375   ESLVSVHPLVVLGWLGLVITALNLMPAGQLDGGRVVQAIYGRKVAGRATIITLILLAIAA  434

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + + +A YW ++I +LQR    P  EE+++ D+
Sbjct  435   VANALALYWAIVILLLQRDLERPSLEELSELDD  467



>ref|WP_002800641.1| putative peptidase M [Microcystis aeruginosa]
 emb|CCI36485.1| putative peptidase M [Microcystis aeruginosa PCC 9701]
Length=496

 Score =   176 bits (446),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 122/352 (35%), Positives = 202/352 (57%), Gaps = 13/352 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             + I IP+E + +++  +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + F
Sbjct  122   DVIPIPEEDLKVIQS-IFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLTQKLSNHF  180

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL +   ++KPV +++P+ T  P     P   A     LV +   ++ ++ A  
Sbjct  181   GDKYRLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAG  234

Query  1032  ANL-LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSF  856
               L   +F N+      +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSF
Sbjct  235   ILLGFDLFSNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSF  294

Query  855   GAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESl  676
             GAITR  +++P R  L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S 
Sbjct  295   GAITRFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSS  352

Query  675   laggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKT  496
             +       ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK 
Sbjct  353   ILVSFLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKI  412

Query  495   SARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + R + A++ +LGI +L    + +  YW +L+  LQR    P   E+T+PD+
Sbjct  413   ARRTTVATLVILGIISLVNPSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_015120567.1| putative membrane-associated Zn-dependent protease [Rivularia 
sp. PCC 7116]
 ref|YP_007057552.1| putative membrane-associated Zn-dependent protease [Rivularia 
sp. PCC 7116]
 gb|AFY57005.1| putative membrane-associated Zn-dependent protease [Rivularia 
sp. PCC 7116]
Length=495

 Score =   176 bits (446),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 133/403 (33%), Positives = 216/403 (54%), Gaps = 27/403 (7%)
 Frame = -1

Query  1539  GQNFGMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETID  1360
             G+    +  ++++   +    A+  +++  D  IA  +P          E I IP+E + 
Sbjct  82    GRQLRAMGQEEMIKKKASERIAEEASQEKADPLIAGNTP-------SQPEIIPIPEEDLS  134

Query  1359  ILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLIN  1180
              ++  +FG DT+F T    Y+ G +FKGNLRG+    + ++S  ++++ GD Y+LFLL N
Sbjct  135   TIRS-IFGIDTYFATETIAYQEGAIFKGNLRGEPEEVHNRLSASLKEKVGDQYRLFLLEN  193

Query  1179  PEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFD  1000
             PE  +P  +V+P     P + +  +   AG   L +I T       +L+A    +   FD
Sbjct  194   PEG-RPTVIVLPSRN-DPRSMSPGQKAFAGILLLASIAT-------SLEAG--GILLGFD  242

Query  999   LLEN------GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRI  838
                N       LP  L    +L  HE+ H ++A + G+KL +PY +PS QIGSFGAITR 
Sbjct  243   FFSNPARYQESLPITLGFFTVLLAHEVGHRVIADRHGVKLSLPYLLPSVQIGSFGAITRF  302

Query  837   LNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggia  658
              +++P R+ L   A AGP  G  + F++L+LG  L        +  P+ F +  +  GI 
Sbjct  303   ESLLPNRKALFDIALAGPAVGGIVSFLMLILGLLLSHEGSFFQL--PNEFFQGSILVGIL  360

Query  657   klllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlss  478
               +      + + + VNPLV+    GL+++A N +PAG+LDGGRI  +I+GRK + R + 
Sbjct  361   ARVFLGNTLQSSLVDVNPLVIIGWLGLVVSAFNLMPAGQLDGGRIVQAIYGRKIAGRTTF  420

Query  477   asigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             A++ +LG+  L + +A YW ++I  LQR    P   EIT+PD+
Sbjct  421   ATLIILGLVGLGNALALYWAIVILFLQRDLERPSLNEITEPDD  463



>ref|WP_017315960.1| peptidase M50 [Mastigocladopsis repens]
Length=499

 Score =   176 bits (446),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 129/354 (36%), Positives = 195/354 (55%), Gaps = 20/354 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+E ++I+K  +FG DTFF T    Y+ G +FKGNLRG+    + +++  +Q+R 
Sbjct  128   EVLPIPEEDLNIIKG-IFGIDTFFTTETIGYQEGAIFKGNLRGEPEAVHNRLTTSLQERL  186

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D +PV +V+P        T   + FA           +LL    A  
Sbjct  187   GDKYRLFLVEN-TDGRPVVIVLPSRNDPRPMTLAQKVFA----------VILLVGTIATS  235

Query  1032  ANLLSVFDNFDLLENG------LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSW  871
                  +  NFD   N       LP +     +L  HEI H L+A++  I+L +PYF+P+ 
Sbjct  236   LEAGGLLLNFDFFTNPERFPEVLPISAGVLAVLVAHEIGHWLLARRHQIRLSLPYFLPAV  295

Query  870   QIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSV  691
             QIGSFGAITR  + +P R+ L   A AGP AG  L   +L+ G  L     L  +  P+ 
Sbjct  296   QIGSFGAITRFESFLPNRKVLFDIALAGPAAGGILSLFMLVTGLLLSHKGSLFQL--PNE  353

Query  690   FHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSI  511
             F    +  G    ++  +      ++V+PLV+    GL+I A+N +PAG+LDGGRI  +I
Sbjct  354   FFSGSILVGTLARVILGSALHSPVVNVHPLVVIGWLGLVITALNLMPAGQLDGGRIVQAI  413

Query  510   WGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +GRKT+ R + A++ +LG+ +L + +A YW ++I  LQR    P   EIT+PD+
Sbjct  414   YGRKTAGRATLATLIVLGLVSLGTSLAMYWAIVILFLQRDLERPSLNEITEPDD  467



>ref|WP_002782685.1| putative peptidase M [Microcystis aeruginosa]
 emb|CCI12436.1| putative peptidase M [Microcystis aeruginosa PCC 9806]
Length=496

 Score =   176 bits (445),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 121/348 (35%), Positives = 200/348 (57%), Gaps = 13/348 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E + +++  +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y
Sbjct  126   IPEEDLKVIQS-IFGIDTFFATETISFQEGAIFKGNLRGEPDLVHSRLTQKLSNHFGDKY  184

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-  1024
             +LFL +   ++KPV +++P+ T  P     P   A     LV +   ++ ++ A    L 
Sbjct  185   RLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLG  238

Query  1023  LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAIT  844
               +F N+      +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAIT
Sbjct  239   FDLFSNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAIT  298

Query  843   RILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllagg  664
             R  +++P R  L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +   
Sbjct  299   RFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVS  356

Query  663   iaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARl  484
                 ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R 
Sbjct  357   FLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRT  416

Query  483   ssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + A++ +LGI +L    + +  YW +L+  LQR    P   E+T+PD+
Sbjct  417   TVATLVILGIISLVNPSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_038531645.1| peptidase M50 [Synechocystis sp. PCC 6714]
Length=492

 Score =   176 bits (445),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 202/353 (57%), Gaps = 11/353 (3%)
 Frame = -1

Query  1398  LDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQD  1219
             L+E   IP E + I+K  +F  D+FF T    Y+ G +FKGNLR +A  ++ K+S +++ 
Sbjct  116   LEETSPIPPEDLAIIKG-IFSIDSFFTTETIAYQEGAIFKGNLRTEAEDAFAKLSGKLKQ  174

Query  1218  RFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPA  1039
               G+ Y+LFL +   +D+PV V++P  T  P  + + +   A    + TI T L  +   
Sbjct  175   LMGEKYRLFL-VEGSEDRPVVVILPS-TNDPQPSTLAQKNLAVVLLVATIVTTLEASAAL  232

Query  1038  LQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
             L  +L+   DN+  +   +P A+   +IL  HE+ H   A+K G++L  P+F+P+WQIGS
Sbjct  233   LGFDLV---DNWQRVGETVPLAIAVGIILLAHELGHLWQAKKWGVRLSWPFFLPNWQIGS  289

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAITR  +++P R  L   A AGP  G  +  + L++G  L   + L  +  P  F + 
Sbjct  290   FGAITRFESLLPSRNALFDVAIAGPAMGGLVSLLFLIVGLSLSGGNNLFQL--PVQFLQG  347

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              L  G    L+  +  + + IS++PL +    GL+INA+N +PAG+LDGGRI  +I+GRK
Sbjct  348   SLLVGTLAKLILGSALKSSVISIHPLTVLGWLGLVINALNLLPAGQLDGGRIVQAIYGRK  407

Query  498   TSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              + R + A++ +LG  +LF   + +  YW +++  LQR    P   E+T+PD+
Sbjct  408   VARRTTIATLVILGAVSLFNPANPIPLYWAIVVLFLQRQLERPSLNELTEPDD  460



>ref|WP_023074940.1| peptidase m50 [Leptolyngbya sp. Heron Island J]
 gb|ESA34143.1| peptidase m50 [Leptolyngbya sp. Heron Island J]
Length=500

 Score =   176 bits (445),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 133/334 (40%), Positives = 196/334 (59%), Gaps = 6/334 (2%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
             +++FG DTFF T   PY  GV FKGNLRG+   + + +  ++++RF D Y+LFL IN  D
Sbjct  142   EEIFGVDTFFKTETVPYAAGVFFKGNLRGEPDATVKTLVAQLENRFDDRYRLFL-INGPD  200

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLE  991
             ++P  +V+P  +  P    + +   A A  + T  T L     AL  +  ++F+  D   
Sbjct  201   ERPAIIVLPSSS-DPKAADIRQQLLAVALAIATFITSL--ETGALLKDF-TLFEQPDRWP  256

Query  990   NGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRED  811
               LP AL    IL VHEI H   A++  IKL  P+ +P+WQ+GSFGA+TR  +++P R  
Sbjct  257   QVLPTALAVLAILVVHEIGHRWQARRYTIKLSPPFALPAWQLGSFGALTRFESLLPNRTV  316

Query  810   LLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLK  631
             L   A AGP AG  L  ++L++G  L         +    F ES+L G +A+ +LGDAL+
Sbjct  317   LFDIAFAGPAAGGLLSLVMLVVGLVLSHPGSPY-QLPVEFFQESVLVGTLARTVLGDALQ  375

Query  630   EGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgis  451
                 I V+PLVL    GL+I A+N +PAG +DGGRI  +I+GRK + R ++ ++ LL I 
Sbjct  376   TNDLIDVDPLVLMGWLGLVITALNVMPAGRIDGGRIVQAIYGRKIAGRATAVTLILLIIV  435

Query  450   aLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             AL + +A YW  LI  LQRG   P  ++I++PD+
Sbjct  436   ALANPLALYWGALILFLQRGEERPCIDDISEPDD  469



>gb|AIE75167.1| Zinc metalloprotease [Synechocystis sp. PCC 6714]
Length=503

 Score =   176 bits (445),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 125/353 (35%), Positives = 202/353 (57%), Gaps = 11/353 (3%)
 Frame = -1

Query  1398  LDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQD  1219
             L+E   IP E + I+K  +F  D+FF T    Y+ G +FKGNLR +A  ++ K+S +++ 
Sbjct  127   LEETSPIPPEDLAIIKG-IFSIDSFFTTETIAYQEGAIFKGNLRTEAEDAFAKLSGKLKQ  185

Query  1218  RFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPA  1039
               G+ Y+LFL +   +D+PV V++P  T  P  + + +   A    + TI T L  +   
Sbjct  186   LMGEKYRLFL-VEGSEDRPVVVILPS-TNDPQPSTLAQKNLAVVLLVATIVTTLEASAAL  243

Query  1038  LQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
             L  +L+   DN+  +   +P A+   +IL  HE+ H   A+K G++L  P+F+P+WQIGS
Sbjct  244   LGFDLV---DNWQRVGETVPLAIAVGIILLAHELGHLWQAKKWGVRLSWPFFLPNWQIGS  300

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAITR  +++P R  L   A AGP  G  +  + L++G  L   + L  +  P  F + 
Sbjct  301   FGAITRFESLLPSRNALFDVAIAGPAMGGLVSLLFLIVGLSLSGGNNLFQL--PVQFLQG  358

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              L  G    L+  +  + + IS++PL +    GL+INA+N +PAG+LDGGRI  +I+GRK
Sbjct  359   SLLVGTLAKLILGSALKSSVISIHPLTVLGWLGLVINALNLLPAGQLDGGRIVQAIYGRK  418

Query  498   TSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              + R + A++ +LG  +LF   + +  YW +++  LQR    P   E+T+PD+
Sbjct  419   VARRTTIATLVILGAVSLFNPANPIPLYWAIVVLFLQRQLERPSLNELTEPDD  471



>ref|WP_017720928.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=510

 Score =   176 bits (445),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 211/393 (54%), Gaps = 14/393 (4%)
 Frame = -1

Query  1527  GMLESKDLVNGNSVNVNAQTGNEDADDIQIASGSPLPGLKPQQLDEAIRIPKETIDILKD  1348
             GML+SK+           +    D  DI      P  G +     E   IP E +  ++ 
Sbjct  100   GMLKSKEEPAPAGEKAAEEAAGTDRRDI------PAAGTRNVAQPEVAPIPGEELKTIQG  153

Query  1347  QVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDD  1168
              +FG DTFF T   PY+ G +FKGNLRG+A    +++S  +QDR G+ Y+LFL+ +PE  
Sbjct  154   -IFGVDTFFATETIPYQEGAIFKGNLRGEAEAVRDRLSAALQDRLGERYRLFLVASPE-G  211

Query  1167  KPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLEN  988
             KP  +V+P  +  P   AVP+   A A  L TI   L      L  +    F+N   L  
Sbjct  212   KPTVIVLPS-SNDPQPLAVPQKVLAAALLLATIACSLETGGLLLGFDF---FENMSRLAE  267

Query  987   GLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDL  808
              LP +     +L  HE+ H +VA++  ++   P+F+P+WQ+GSFGA+ R  +++P R+ L
Sbjct  268   VLPVSAGIWAVLVAHEMGHQIVARRNHVRFSWPFFIPTWQVGSFGALNRFESLLPNRQVL  327

Query  807   LKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaLKE  628
                A AGP AG  +   +LL+G  L     L  +  P+ F +  +  G    ++  +  +
Sbjct  328   FDVAFAGPAAGGLVSLAMLLVGLLLSGEGSLFEI--PADFFQGSVLVGTLAKVVLGSALQ  385

Query  627   GTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgisa  448
                ++V+PL +    GL+I+A+N +PAG+LDGGRI  +I+GRK +   + A++ +L I +
Sbjct  386   KPVVNVHPLAVIGWLGLVISALNLMPAGQLDGGRIVQAIYGRKIAGGATVATLIVLAIVS  445

Query  447   LFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             LF+ +A YW + I  LQR    P   ++T+PD+
Sbjct  446   LFNPLALYWAIAILFLQRNLERPCLNDLTEPDD  478



>ref|WP_004163219.1| putative peptidase M [Microcystis aeruginosa]
 emb|CCI21450.1| putative peptidase M [Microcystis aeruginosa PCC 9809]
Length=496

 Score =   175 bits (444),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 121/348 (35%), Positives = 200/348 (57%), Gaps = 13/348 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E + +++  +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y
Sbjct  126   IPEEDLKVIQS-IFGIDTFFATETISFQEGAIFKGNLRGEPDLVHSRLTQKLSNHFGDKY  184

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-  1024
             +LFL +   ++KPV +++P+ T  P     P   A     LV +   ++ ++ A    L 
Sbjct  185   RLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLG  238

Query  1023  LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAIT  844
               +F N+      +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAIT
Sbjct  239   FDLFGNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAIT  298

Query  843   RILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllagg  664
             R  +++P R  L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +   
Sbjct  299   RFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVS  356

Query  663   iaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARl  484
                 ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R 
Sbjct  357   FLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRT  416

Query  483   ssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + A++ +LGI +L    + +  YW +L+  LQR    P   E+T+PD+
Sbjct  417   TVATLVILGIISLVNPSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_006513808.1| putative membrane-associated Zn-dependent protease [Leptolyngbya 
sp. PCC 7375]
 gb|EKU99358.1| putative membrane-associated Zn-dependent protease [Leptolyngbya 
sp. PCC 7375]
Length=515

 Score =   175 bits (444),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 142/370 (38%), Positives = 206/370 (56%), Gaps = 25/370 (7%)
 Frame = -1

Query  1434  SGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAA  1255
             SG+P     PQ     + IP E +  + + +FG DTFF T   PY+ GV FKGNLRG+A 
Sbjct  132   SGAPDATAPPQM---PLAIPTEDLAAI-ESIFGIDTFFRTETVPYQAGVFFKGNLRGEAE  187

Query  1254  RSYEKISKRMQDRF-GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGL  1078
              +   ++ ++++RF  D Y+LFL+  PED +P  + +P  T  P    + +   A A  +
Sbjct  188   TTINALNAQLKNRFEDDRYRLFLINGPED-RPAIIALPSKT-DPKPADIRQKGLAVALAI  245

Query  1077  VTIFTLLLRNVPALQANLLSVFDNFDLLENG------LPGALVTALILGVHEISHTLVAQ  916
              T  T L            ++  +FDL E        LP AL    IL +HEI H   A+
Sbjct  246   ATFITSLETG---------ALLKDFDLFEQPGRWPEVLPTALAIFAILVIHEIGHRWQAK  296

Query  915   KAGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgff  736
             +  IKL  P+ +P+WQ+GSFGA+TR  +++P R  L   A AGP AG  L   +LL+G  
Sbjct  297   RYDIKLSPPFALPAWQLGSFGALTRFESVLPNRTVLFDIAFAGPAAGGLLSLAMLLVGLG  356

Query  735   lpp-adglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAIN  559
             L        + VD   F ES+L G +A+ +LGD L+    I V+PLVL    GL+I A+N
Sbjct  357   LSHPGSLYQLPVD--FFQESILVGTLARAILGDTLQTNDLIDVDPLVLMGWLGLVITALN  414

Query  558   SIPAGELDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAP  379
              +PAG +DGGRI  +I+GRK + R ++ ++ LL   AL + +A YW  LI  LQRG   P
Sbjct  415   VMPAGRIDGGRIVQAIYGRKIAGRATAVTLILLIFVALANPLALYWGALILFLQRGEERP  474

Query  378   LSEEITDPDN  349
               ++I++PD+
Sbjct  475   CIDDISEPDD  484



>ref|WP_009457225.1| MULTISPECIES: peptidase M50 [Fischerella]
 gb|EHC12929.1| peptidase M50 [Fischerella sp. JSC-11]
Length=495

 Score =   174 bits (442),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 131/364 (36%), Positives = 208/364 (57%), Gaps = 21/364 (6%)
 Frame = -1

Query  1419  PGLKPQQLD-EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYE  1243
             P ++P Q+  E + IP+  ++ +K  +FG DTFF T    Y+ G +FKGNLRG+A   + 
Sbjct  115   PTVEPTQVKLEVLPIPEADLNAIKS-IFGLDTFFATETIAYQEGAIFKGNLRGEAEMVHN  173

Query  1242  KISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFT  1063
             +++ ++Q+  GD Y+L+L+ N E  KPV +V+P     P   +V +   A    + T+ T
Sbjct  174   RLTAKLQEALGDKYRLYLVENTEG-KPVVIVLPSRN-DPRPMSVSQKVFAIILLVSTVAT  231

Query  1062  LLLRNVPALQANLLSVFDNFDLLEN------GLPGALVTALILGVHEISHTLVAQKAGIK  901
                    +L+A+   +   FDL  N       LP  L   +IL  HEI H L+A++  I+
Sbjct  232   -------SLEAS--GILQGFDLFANVARLPETLPIGLGILVILLAHEIGHWLLARRHNIR  282

Query  900   LGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppad  721
             L  PYF+P+ QIGSFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L    
Sbjct  283   LSWPYFLPAVQIGSFGAITRFESLLPNRKVLFDIALAGPAAGGIVSVLMLIAGLLLSHPG  342

Query  720   glGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGE  541
              +  +  P+ F +  +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+
Sbjct  343   SMFQL--PNQFFQGSILVGSLARVVLGSALQSPLVDVHPLVVIGWLGLVITALNLMPAGQ  400

Query  540   LDGGRISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEIT  361
             LDGGRI  +I+GRK + R + A++ LLG+ AL + +A YW ++I  LQR    P   EI+
Sbjct  401   LDGGRIVQAIYGRKIAGRTTFATLILLGLVALGNPLAMYWAIVILFLQRDLERPSLNEIS  460

Query  360   DPDN  349
             +PD+
Sbjct  461   EPDD  464



>ref|WP_002760286.1| putative peptidase M [Microcystis aeruginosa]
 emb|CCH97678.1| putative peptidase M [Microcystis aeruginosa PCC 9717]
Length=496

 Score =   174 bits (441),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 122/348 (35%), Positives = 200/348 (57%), Gaps = 13/348 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E + +++  +FG DTFF T    ++ G +FKGNLRG     + ++++++ + FGD Y
Sbjct  126   IPEEDLKVIQS-IFGIDTFFATETISFQEGAIFKGNLRGDPDIVHSRLTQKLSNNFGDKY  184

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-  1024
             +LFL +   ++KPV +++P+ T  P     P   A     LV +   ++ ++ A    L 
Sbjct  185   RLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLG  238

Query  1023  LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAIT  844
               +F N+      +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAIT
Sbjct  239   FDLFGNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAIT  298

Query  843   RILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllagg  664
             R  +++P R  L   A AGP  G  +  ILL++G  L  +D L  +  PS F +S +   
Sbjct  299   RFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSDSLFQI--PSTFFQSSILVS  356

Query  663   iaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARl  484
                 ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R 
Sbjct  357   FLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRT  416

Query  483   ssasigllgisaLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + A++ +LGI +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  417   TVATLVILGIISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_008196986.1| putative peptidase M [Microcystis sp. T1-4]
 emb|CCI30618.1| putative peptidase M [Microcystis sp. T1-4]
Length=496

 Score =   174 bits (440),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 127/371 (34%), Positives = 209/371 (56%), Gaps = 21/371 (6%)
 Frame = -1

Query  1449  DIQIASGSPLPGLKPQQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNL  1270
             +IQ A  + +P + P        IP+E + +++  +FG DTFF T    ++ G +FKGNL
Sbjct  111   EIQAAVTAIVPDVMP--------IPEEDLKVIQS-IFGIDTFFATETISFQEGAIFKGNL  161

Query  1269  RGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAG  1090
             RG+    + ++++++ + FGD Y+LFL +   ++KPV +++P+ T  P     P   A  
Sbjct  162   RGEPDLVHSRLTQKLSNNFGDKYRLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQK  215

Query  1089  AFGLVTIFTLLLRNVPALQANL-LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQK  913
                LV +   ++ ++ A    L   +F N+      +P +L    +L  HEI H ++A++
Sbjct  216   NLSLVLLVATIVTSLEAAGILLGFDLFGNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKR  275

Query  912   AGIKLGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgffl  733
               ++L +PYF+P+WQIGSFGAITR  +++P R  L   A AGP  G  +  ILL++G  L
Sbjct  276   HNVRLSLPYFLPTWQIGSFGAITRFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTL  335

Query  732   ppadglGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSI  553
               +  L  +  PS F +S +  G    ++         ISV+PL +    GL+I A+N +
Sbjct  336   SNSASLFQI--PSNFFQSSILVGSLARIVLGDELRNAVISVHPLTVIGWLGLVITALNLL  393

Query  552   PAGELDGGRISFSIWGRKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIA  382
             PAG+LDGGRI  +I+GRK + R + A++ +LGI +L    + +  YW +L+  LQR    
Sbjct  394   PAGQLDGGRIVQAIYGRKIARRTTVATLVILGIISLVNPSNPIPLYWTILVAFLQRELER  453

Query  381   PLSEEITDPDN  349
             P   E+T+PD+
Sbjct  454   PSLNELTEPDD  464



>ref|WP_015144804.1| putative membrane-associated Zn-dependent protease [Pleurocapsa 
minor]
 ref|YP_007082062.1| putative membrane-associated Zn-dependent protease [Pleurocapsa 
sp. PCC 7327]
 gb|AFY78505.1| putative membrane-associated Zn-dependent protease [Pleurocapsa 
sp. PCC 7327]
Length=504

 Score =   174 bits (440),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 133/367 (36%), Positives = 204/367 (56%), Gaps = 18/367 (5%)
 Frame = -1

Query  1428  SPLPGLKPQQL-DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAAR  1252
             +P  G +P+ +  E + IP++ + ++K  +FG DTFF T    Y+ G +FKGNLRG+   
Sbjct  117   APKTGEQPEAIVPEILPIPEDDLKLIKG-IFGIDTFFATETISYQEGAIFKGNLRGEPET  175

Query  1251  SYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVT  1072
              + ++S+++++ FG+ Y+LF+ +   + KPV +V+P  T  P  T + +   A    + T
Sbjct  176   VHARLSEKLKENFGEKYRLFM-VEGTEGKPVVIVLPS-TNDPQPTTLAQKNLALVLLIAT  233

Query  1071  IFTLLLRNVPALQANLLSVFDNFDLL---ENGLPGALVTALILGVHEISHTLVAQKAGIK  901
             I T L        A LL  FD F  L      +P +L    IL  HEI H + A++  I+
Sbjct  234   IATSLE------SAGLLLGFDLFSNLGRYREAIPLSLGLWAILVAHEIGHRIAAKRYNIR  287

Query  900   LGVPYFVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppad  721
             L VP+F+P+WQIGSFGAITR  +++P R  L   A AGP  G  +   +L+ G  L    
Sbjct  288   LSVPFFLPTWQIGSFGAITRFESLLPNRTALFDVALAGPAFGGIVSLAMLVAGLILSRPG  347

Query  720   glGVVVDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGE  541
              L  V  PS F +  +  G    ++     +   + V+PL +    GL+I ++N +PAG+
Sbjct  348   SLFQV--PSQFFQGSILVGSLARVVLGEQLQKAIVDVHPLTILGWLGLVITSLNLLPAGQ  405

Query  540   LDGGRISFSIWGRKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSE  370
             LDGGRI  +I+GRK + R S A++ LLG+ AL    + +  YW VLI  LQR    P   
Sbjct  406   LDGGRIVQAIYGRKIARRTSIATLVLLGLVALINPANPIPLYWAVLILFLQRDLERPSLN  465

Query  369   EITDPDN  349
             E+T+PD+
Sbjct  466   ELTEPDD  472



>dbj|BAP18401.1| peptidase M50 [cyanobacterium endosymbiont of Epithemia turgida 
isolate EtSB Lake Yunoko]
Length=494

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 139/375 (37%), Positives = 212/375 (57%), Gaps = 23/375 (6%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IPKE + ++K  +FG DTFF T    Y+ G +FKGNLRG+    Y  +S++++ RF D Y
Sbjct  134   IPKEDLRLIKG-IFGIDTFFATETISYQEGAIFKGNLRGEPDTVYHHLSEKLKARFFDKY  192

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LFL +   + KPV +V+P I     TT V +  A   F + TI T       +L+A+  
Sbjct  193   RLFL-VEGTEKKPVVIVLPSIVDPRPTTLVQKNIALVLF-VATILT-------SLEAS--  241

Query  1020  SVFDNFDLLENG------LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
              +   FDL  N       +P +L    +L  HEISH L+A+   ++L VP+F+P+WQIGS
Sbjct  242   GILLGFDLFSNWSRYLEVIPLSLGLWTVLIAHEISHRLLAKHHNVRLSVPFFLPTWQIGS  301

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAIT   +++P R  L   A AG  AG+    +LL +G  L     L  V  P+ F + 
Sbjct  302   FGAITHFESLLPNRNVLFDMAFAGSAAGWGFSLVLLTVGLVLSHPGSLFQV--PTQFFQG  359

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              +  G    ++     + + I V+PL +    GL+INA+N +PAG+LDGGRI  +I+GRK
Sbjct  360   SILVGSLARVVFGEELQKSLIDVHPLAIIGWLGLVINALNLLPAGQLDGGRIVQAIYGRK  419

Query  498   TSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgi  328
             T+ + +  S+ +LGI  L    + +  YWV++I  L+R    P   E+T+PD+   ALG+
Sbjct  420   TARKTTIVSLIVLGIVTLINPQNSLPLYWVIVILFLRRDLERPSLNELTEPDDTRAALGL  479

Query  327   avlllgllVCLPYPF  283
              ++ L L+  +P+ F
Sbjct  480   LIIFLMLMTLIPWFF  494



>ref|WP_002735685.1| peptidase M50 family protein [Microcystis aeruginosa]
 gb|ELP53533.1| peptidase M50 family protein [Microcystis aeruginosa TAIHU98]
Length=496

 Score =   173 bits (438),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 199/348 (57%), Gaps = 13/348 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             I ++ I +++  +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y
Sbjct  126   ISEQDIKVIQS-IFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLTQKLSNHFGDKY  184

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-  1024
             +LFL +   ++KPV +++P+ T  P     P   A     LV +   ++ ++ A    L 
Sbjct  185   RLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLG  238

Query  1023  LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAIT  844
               +F N+      +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAIT
Sbjct  239   FDLFSNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAIT  298

Query  843   RILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllagg  664
             R  +++P R  L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +   
Sbjct  299   RFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVS  356

Query  663   iaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARl  484
                 ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R 
Sbjct  357   FLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRT  416

Query  483   ssasigllgisaLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + A++ +LGI +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  417   TVATLVILGIISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_017293559.1| hypothetical protein [Geminocystis herdmanii]
Length=525

 Score =   173 bits (439),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 122/341 (36%), Positives = 198/341 (58%), Gaps = 22/341 (6%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF+T   PY+ GV+ KGNLRG A   +  ++++++ + G+ Y+LFL+  PE  K
Sbjct  164   IFGIDTFFITETIPYQEGVILKGNLRGDAELIHSNLTEKLKTKLGEKYRLFLVETPE-GK  222

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENG  985
             PV +++P  T  P TT + +   A    L TIFT       +++A  +++   FDL+ N 
Sbjct  223   PVVIILPS-TNDPKTTTLAQKNLALVLLLATIFT-------SMEA--IALLLGFDLVGNW  272

Query  984   ------LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVP  823
                   LP  +   +IL  HE+ H ++  K  +K+ +P+F+P+ QIGSFGAITR  +++P
Sbjct  273   NRYVEVLPLCIGLWVILLSHEMGHQIIGAKNNVKISLPFFLPTIQIGSFGAITRFESLIP  332

Query  822   KREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllg  643
              R  L   + AGP  GF++   +LLLG  +    G   +  P+ F +  +  GI   L  
Sbjct  333   NRSVLFDISFAGPATGFAVSLGMLLLGLGMSTMGGTFEI--PTNFFQGSILVGILAKLFF  390

Query  642   daLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigl  463
             ++  +G  ++VNPL +    GL+I A+N +PAG+LDGGRI  +I+GRKT  R +  ++ +
Sbjct  391   NSALQGDSVAVNPLTILGWLGLVITALNLLPAGQLDGGRIIQAIYGRKTCRRATIGTLIV  450

Query  462   lgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             L I ++    + + FYW ++I  LQR    P   E+T+P++
Sbjct  451   LAIVSILNPINSLPFYWAIVILFLQRDLERPSLNELTEPND  491



>ref|WP_006098521.1| peptidase, M50 family protein [Coleofasciculus chthonoplastes]
 gb|EDX78085.1| peptidase, M50 family protein [Coleofasciculus chthonoplastes 
PCC 7420]
Length=511

 Score =   173 bits (439),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 141/403 (35%), Positives = 214/403 (53%), Gaps = 24/403 (6%)
 Frame = -1

Query  1518  ESKDLVNGNSVN--VNAQTGNEDADDIQ----IASGSPLPGLKPQQLDEAIRIPKETIDI  1357
             E +D V     N  ++ ++   D+ D+      ++ +P P        E I I  E +  
Sbjct  88    EGQDAVLQKRANQLLHEKSDPNDSQDVSRQEDTSATAPSPESSSPAGTEVIPISPEDLKT  147

Query  1356  LKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARS-YEKISKRMQDRFGDLYKLFLLIN  1180
             ++  +FG DTFF T   PY+ GV+FKGNLRG    + + ++S  ++ R  D Y+LFL+ +
Sbjct  148   IQG-IFGIDTFFATETIPYQEGVIFKGNLRGGEPEAVHSRLSASLEQRLDDRYRLFLVED  206

Query  1179  PEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNF-  1003
             PE  KPV +V+P  +  P    +P+   AG   + TI T L        A  L  FD F 
Sbjct  207   PEG-KPVVIVLPS-SNDPQPLTIPQKILAGVLLVATIVTSLE------AAGFLLNFDLFT  258

Query  1002  --DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNI  829
               + ++  LP  L    +L VHE+ H   A++  ++L  P+F+PS QIGSFGAITR  ++
Sbjct  259   APERVKETLPLGLGICTVLAVHELGHLWAARRHQVRLSFPFFIPSLQIGSFGAITRFESL  318

Query  828   VPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiakll  649
             VP R+ L   A AGP AG      LLLLG  L        V  P+ F +  +  G    +
Sbjct  319   VPNRKALFDIALAGPAAGGIASVFLLLLGLVLSHQGSTFQV--PAQFFQGSVLVGGLARI  376

Query  648   lgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasi  469
             +     +   + V+PL +    GL+I+A+N +PAG+LDGGR+  +I+GRKT+ R + A++
Sbjct  377   ILGNSLQAPLVDVHPLTIMGWLGLVISALNLMPAGQLDGGRVVQAIYGRKTARRTTIATL  436

Query  468   gllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +LGI AL    + +  YW ++I  LQR    P   EIT+PD+
Sbjct  437   VILGIVALANPSNPLILYWAIIILFLQRSLERPSLNEITEPDD  479



>ref|WP_010872254.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440944.1| hypothetical protein sll0862 [Synechocystis sp. PCC 6803]
 ref|YP_005382812.1| hypothetical protein SYNGTI_1050 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005385981.1| hypothetical protein SYNPCCP_1049 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005408688.1| hypothetical protein SYNPCCN_1049 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005651003.1| hypothetical protein SYNGTS_1050 [Synechocystis sp. PCC 6803]
 ref|YP_007450827.1| hypothetical protein MYO_110590 [Synechocystis sp. PCC 6803]
 dbj|BAA17624.1| sll0862 [Synechocystis sp. PCC 6803]
 dbj|BAK49798.1| hypothetical protein SYNGTS_1050 [Synechocystis sp. PCC 6803]
 dbj|BAL28797.1| hypothetical protein SYNGTI_1050 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31966.1| hypothetical protein SYNPCCN_1049 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35135.1| hypothetical protein SYNPCCP_1049 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM51367.1| hypothetical protein BEST7613_2436 [Bacillus subtilis BEST7613]
 gb|AGF51313.1| hypothetical protein MYO_110590 [Synechocystis sp. PCC 6803]
Length=503

 Score =   173 bits (438),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 202/353 (57%), Gaps = 11/353 (3%)
 Frame = -1

Query  1398  LDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQD  1219
             L+E   IP E + I+K  +F  D+FF T    Y+ G +FKGNLR +A  ++ K+S ++++
Sbjct  127   LEETSPIPPEDLAIIKG-IFSIDSFFATETIAYQEGAIFKGNLRTEAEDAFGKLSGKLKE  185

Query  1218  RFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPA  1039
               G+ Y+LFL +   +D+PV V++P  T  P  + + +   A    + TI T L  +   
Sbjct  186   LMGEKYRLFL-VEGSEDRPVVVILPS-TNDPQPSTLAQKNLAVVLLVATIVTTLEASAAL  243

Query  1038  LQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGS  859
             L  +L+   DN+  +   +P A+   +IL  HE+ H   A+K G++L  P+ +P+WQIGS
Sbjct  244   LGFDLV---DNWQRVGETVPLAIAVGIILLAHELGHLWQAKKWGVRLSWPFLLPNWQIGS  300

Query  858   FGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHES  679
             FGAITR  +++P R  L   A AGP  G  +  + L++G  L   + L  +  P  F + 
Sbjct  301   FGAITRFESLLPSRNALFDVAIAGPAIGGLVSLLFLIVGLNLSGGNNLFQL--PVQFLQG  358

Query  678   llaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRK  499
              L  G    L+  +  + + IS++PL +    GL+INA+N +PAG+LDGGRI  +I+GRK
Sbjct  359   SLLVGTLAKLILGSALKSSVISIHPLTVLGWLGLVINALNLLPAGQLDGGRIVQAIYGRK  418

Query  498   TSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              + R + A++ +LG  +LF   + +  YW +++  LQR    P   E+T+PD+
Sbjct  419   VARRTTIATLVILGAVSLFNPANPIPLYWAIVVLFLQRQLERPSLNELTEPDD  471



>ref|WP_016516802.1| Zn-dependent proteases [Microcystis aeruginosa]
 gb|EPF18882.1| Zn-dependent proteases [Microcystis aeruginosa SPC777]
Length=496

 Score =   173 bits (438),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 117/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDLVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + +++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVSTLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_002744090.1| peptidase M50 family protein [Microcystis aeruginosa]
 emb|CAO90903.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS47822.1| peptidase M50 family protein [Microcystis aeruginosa DIANCHI905]
Length=496

 Score =   172 bits (437),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_002750360.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa]
 emb|CCH92165.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa PCC 9432]
Length=496

 Score =   172 bits (437),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_024970168.1| peptidase M50 [Microcystis aeruginosa]
Length=496

 Score =   172 bits (436),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_015181376.1| membrane-associated Zn-dependent protease [Microcoleus sp. PCC 
7113]
 ref|YP_007120622.1| membrane-associated Zn-dependent protease [Microcoleus sp. PCC 
7113]
 gb|AFZ17216.1| putative membrane-associated Zn-dependent protease [Microcoleus 
sp. PCC 7113]
Length=513

 Score =   172 bits (437),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 128/355 (36%), Positives = 198/355 (56%), Gaps = 18/355 (5%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQ-AARSYEKISKRMQDR  1216
             E + IP + + +L+  +F  DTFF T   PY+ GV+FKGN+RG      Y +++  +++R
Sbjct  138   EVVPIPADDLKLLQG-IFSIDTFFATETIPYQEGVIFKGNMRGTDPEEVYSRLASSVEER  196

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
              GD Y+LFL+ +PE  +PV +V+P  +  P    VP+   A    + TI T L       
Sbjct  197   LGDRYRLFLVESPEG-RPVVIVLPS-SNDPQPATVPQKILAVVLVVATIATSLE------  248

Query  1035  QANLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
              A LL  FD F   +     LP AL    +   HE+ H   A +  +KLG+P+F+PSWQI
Sbjct  249   AAGLLLNFDFFKNPERFSEVLPFALGIWTVFAAHELGHWWQAIRHKVKLGLPFFIPSWQI  308

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   + AGP AG  +  ++L++GF L        +  P  F 
Sbjct  309   GSFGAITRFESLIPHRAALFDISFAGPAAGGIVSLLMLIVGFILSHQGSTFQI--PVQFF  366

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G    +   +  +G  + V+PL +    GL++ A+N +PAG+LDGGR+  +I+G
Sbjct  367   QGSILVGSLARVFLGSALQGNLVDVHPLTIIGWLGLVVTALNVMPAGQLDGGRVVQAIYG  426

Query  504   RKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R + A++ +LGI AL    + +  YW ++I  LQRG   P   EIT+ ++
Sbjct  427   RKTARRTTIATLIVLGIVALVNPANPIVLYWAIVILFLQRGLERPTLNEITELND  481



>ref|WP_017651298.1| peptidase M50 [Microchaete sp. PCC 7126]
Length=494

 Score =   172 bits (436),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 128/347 (37%), Positives = 202/347 (58%), Gaps = 14/347 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP + +  ++  +FG DTFF T    Y+ G +FKGNLRG+    + ++S+ +Q+R G+ Y
Sbjct  127   IPDDDLQKIRS-IFGIDTFFATEAIAYQEGAIFKGNLRGEPEAIHARLSQSLQERLGEQY  185

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LFL+ N  D KPV +V+P           P   A  AF  + +   +  ++ A  A +L
Sbjct  186   RLFLIENI-DGKPVVIVLPS-----RNDPRPMSLAQKAFAAILLLATIGTSLEA--AGIL  237

Query  1020  SVFDNFDLLENGLPGALVTALILGV---HEISHTLVAQKAGIKLGVPYFVPSWQIGSFGA  850
               FD F   E  L    +++ IL +   HEI H L+A++  ++L  P+F+P+ QIGSFGA
Sbjct  238   LNFDLFSQPERFLEVLPISSGILAILVSHEIGHWLLARRHQVRLSWPFFLPAVQIGSFGA  297

Query  849   ITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESlla  670
             ITR  +++P R+ L   A AGP  G  +  ++L+LG  L     L  V  PS F +  + 
Sbjct  298   ITRFESLLPNRKALFDIALAGPAVGGIISLLMLILGLLLSHPGSLFQV--PSEFFQGSIL  355

Query  669   ggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSA  490
              G    ++  +  +   I+V+PLV+    GL+I A+N +PAG+LDGGRI  +I+GRKT+ 
Sbjct  356   VGSLARVVLGSALQSALINVHPLVIIGWLGLVITALNLMPAGQLDGGRIIQAIYGRKTAG  415

Query  489   RlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             R + A++ LLGI +L +++A YW ++I +LQR    P   EI++PD+
Sbjct  416   RATFATLILLGIVSLANNLAMYWAIVILLLQRDLERPSLNEISEPDD  462



>ref|WP_015132568.1| peptidase M50 [Leptolyngbya sp. PCC 7376]
 ref|YP_007069616.1| peptidase M50 [Leptolyngbya sp. PCC 7376]
 gb|AFY36782.1| peptidase M50 [Leptolyngbya sp. PCC 7376]
Length=503

 Score =   172 bits (436),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 125/338 (37%), Positives = 197/338 (58%), Gaps = 16/338 (5%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF T   PY+ G +FKGNLRG    +++K++ ++ DR GD Y+LFL+ +PE+ +
Sbjct  144   IFGIDTFFSTESIPYQDGAIFKGNLRGDPELTHQKLTTKLGDRLGDKYRLFLVEDPEN-R  202

Query  1164  PVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFD---NFDLL  994
             PV +V+P  T  P TT + +        L  +  L           +L  FD   N    
Sbjct  203   PVVIVLPS-TNDPKTTTLVQ------KNLALVLLLAALATTLEALGILQGFDLSSNISRY  255

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
             +  LP +L   ++LG HEI+H +V++K  +KL VP+F+P+WQIG+FG+ITR  +++P R 
Sbjct  256   KEVLPLSLGLWVVLGAHEIAHWVVSKKYDVKLSVPFFLPNWQIGAFGSITRFESLLPTRT  315

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP+AG  L  ++L+ GF L   + L  +  PS F +  +  G    L     
Sbjct  316   ALFDIAIAGPIAGGLLSILMLVSGFALSQPNSLFQI--PSQFFQGSILVGTLARLFMGDA  373

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ++++PL +    GL+I+A+N +PAG LDGGR+  +I+GRKT+ R + A++ +LG+
Sbjct  374   IQEAVVAIHPLTILGWLGLVISALNLMPAGCLDGGRVIQAIYGRKTARRTTLATLVVLGL  433

Query  453   saLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              ALF   + +  YW ++I  LQR    P   E+ +PD+
Sbjct  434   VALFNPSNPIPLYWALIIAFLQRDAERPSLNELLEPDD  471



>ref|WP_002790809.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa]
 emb|CCI27626.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa PCC 9808]
Length=496

 Score =   172 bits (435),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLNQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_002765755.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa]
 emb|CCI00760.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa PCC 9443]
Length=496

 Score =   172 bits (435),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDLVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   L+ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATLVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLILSNSASLFQI--PSNFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_015156024.1| peptidase M50 [Chroococcidiopsis thermalis]
 ref|YP_007093351.1| peptidase M50 [Chroococcidiopsis thermalis PCC 7203]
 gb|AFY89482.1| peptidase M50 [Chroococcidiopsis thermalis PCC 7203]
Length=509

 Score =   172 bits (435),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 129/359 (36%), Positives = 197/359 (55%), Gaps = 22/359 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP E +  ++  +FG DTFF T   PY+ GV+FKGNLRG+    Y +++  +Q+R 
Sbjct  130   EVMPIPDEDLTTIRG-IFGIDTFFATESIPYQDGVIFKGNLRGEPEAVYNRLNTTLQERM  188

Query  1212  G--------DLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLL  1057
             G          Y+LFL+ N  D +PV +V+P     P  + V +   A    L TI T L
Sbjct  189   GVSETAPEKPRYRLFLVEN-VDGRPVVIVLPSRN-DPRPSTVGQKIFALVLFLATIATSL  246

Query  1056  LRNVPALQANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPY  886
                     A +L  FD F         LP AL    +L  HEI H ++AQ+  ++L  P+
Sbjct  247   E------TAGILQGFDFFTTPGRFPEALPIALGILAVLAAHEIGHRVLAQRYQVRLSPPF  300

Query  885   FVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVV  706
             F+P+ QIG+FGAITRI +++P R  L   A AGP+AG  +  ++L  G  L     +  V
Sbjct  301   FLPTLQIGAFGAITRIESLLPNRTALFDIAIAGPVAGGVVSLLMLFAGLILSHPGSMYQV  360

Query  705   VDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGR  526
               PS F +  +  G    ++  +      + V+PL +    GL+I A+N +PAG+LDGGR
Sbjct  361   --PSQFFQGSILVGALSKVVLGSAVNQALVDVHPLTIIGWLGLVITALNLMPAGQLDGGR  418

Query  525   ISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +  +I+GRKT+ R + A++ +L I++L + +A YW V+I  LQR    P   E+T+P++
Sbjct  419   VVQAIYGRKTAGRTTFATVIVLAIASLANPLALYWAVVILFLQRDLERPSLNELTEPND  477



>ref|WP_002785935.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa]
 emb|CCI20684.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa PCC 9807]
Length=496

 Score =   171 bits (434),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDLVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLALVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +       ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLILSNSASLFQI--PSSFFQSSILVSFLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLFSD---VAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L +    +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNSSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_012264351.1| putative peptidase M [Microcystis aeruginosa]
 ref|YP_001655813.1| putative peptidase M [Microcystis aeruginosa NIES-843]
 dbj|BAG00621.1| putative peptidase M [Microcystis aeruginosa NIES-843]
Length=496

 Score =   171 bits (434),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 120/348 (34%), Positives = 198/348 (57%), Gaps = 13/348 (4%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E + +++  +F  DTFF T    ++ G +FKGNLRG     + ++++++ + FGD Y
Sbjct  126   IPEEDLKVIQS-IFAIDTFFATETISFQEGAIFKGNLRGDPDIVHSRLTQKLSNNFGDKY  184

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-  1024
             +LFL +   ++KPV +++P+ T  P     P   A     LV +   ++ ++ A    L 
Sbjct  185   RLFL-VEGTEEKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLG  238

Query  1023  LSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAIT  844
               +F N+      +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAIT
Sbjct  239   FDLFGNWQRYREAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAIT  298

Query  843   RILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllagg  664
             R  +++P R  L   A AGP  G  +  ILL++G  L  +  L  +  PS F +S +   
Sbjct  299   RFESLLPNRSVLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PSTFFQSSILVS  356

Query  663   iaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARl  484
                 ++     +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R 
Sbjct  357   FLARIVLGDELQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRT  416

Query  483   ssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             + A++ +LGI +L    + +  YW +L+  LQR    P   E+T+PD+
Sbjct  417   TVATLVILGIISLVNPSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_039716438.1| peptidase M50 [Scytonema millei]
 gb|KIF18936.1| peptidase M50 [Scytonema millei VB511283]
Length=509

 Score =   171 bits (434),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 128/359 (36%), Positives = 197/359 (55%), Gaps = 22/359 (6%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP E +  ++  +FG DTFF T   PY+ GV+FKGNLRG+    Y +++  +Q+R 
Sbjct  130   EVMPIPDEDLTAIRG-IFGIDTFFATESIPYQDGVIFKGNLRGEPEAVYNRLNATLQERM  188

Query  1212  GD--------LYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLL  1057
             G          Y+LFL+ N  D +PV +++P     P  + V +   A    L TI T L
Sbjct  189   GTSETAPEKPRYRLFLVEN-VDGRPVVIILPSRN-DPRPSTVGQKIFALVLFLATIATSL  246

Query  1056  LRNVPALQANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPY  886
                     A +L  FD F         LP AL    +L  HEI H ++AQ+  ++L  P+
Sbjct  247   E------TAGILQGFDFFTTPARFPEALPIALGILAVLAAHEIGHRVLAQRYQVRLSPPF  300

Query  885   FVPSWQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVV  706
             F+P+ QIG+FGAITRI +++P R  L   A AGP+AG  +  ++L  G  L     +  V
Sbjct  301   FLPTLQIGAFGAITRIESLLPNRTALFDIAIAGPVAGGVVSLLMLFAGLILSHPGSMYQV  360

Query  705   VDPSVFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGR  526
               PS F +  +  G    ++  +      + V+PL +    GL+I A+N +PAG+LDGGR
Sbjct  361   --PSQFFQGSILVGALSKVVLGSAVNQALVDVHPLTIIGWLGLVITALNLMPAGQLDGGR  418

Query  525   ISFSIWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             +  +I+GRKT+ R + A++ +L I++L + +A YW V+I  LQR    P   E+T+P++
Sbjct  419   VVQAIYGRKTAGRTTFATVIVLAIASLANPLALYWAVVILFLQRDLERPSLNELTEPND  477



>ref|XP_002316224.2| hypothetical protein POPTR_0010s19810g, partial [Populus trichocarpa]
 gb|EEF02395.2| hypothetical protein POPTR_0010s19810g, partial [Populus trichocarpa]
Length=181

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 110/151 (73%), Gaps = 17/151 (11%)
 Frame = -1

Query  1287  LFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVP  1108
             LFKGNLRGQAA+SYEK + +M ++F D Y LFL INPEDDKPVAVVVPR   +P      
Sbjct  1     LFKGNLRGQAAKSYEKSTNKMHNKFRDQYNLFLQINPEDDKPVAVVVPR---RP-CCQKQ  56

Query  1107  EWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHT  928
             + FAAG+FGLVT+F+LLL NVPALQA          LL +GLPGALVTALILG HE+S  
Sbjct  57    QCFAAGSFGLVTVFSLLLHNVPALQA---------FLLHDGLPGALVTALILGSHELSRI  107

Query  927   LVAQKAGIKLGVPYFVPSWQIGSFGAITRIL  835
             LVA+   +KLGVPYFVP++      ++T++L
Sbjct  108   LVAKSNDVKLGVPYFVPTF----LSSLTKLL  134


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/32 (91%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  633  KEGTPISVNPLVLWSLAGLLINAINSIPAGEL  538
            KEGTPISVNPLV+W+ AGLLINAINSIPAGEL
Sbjct  140  KEGTPISVNPLVIWAWAGLLINAINSIPAGEL  171



>ref|XP_004170486.1| PREDICTED: uncharacterized LOC101217814, partial [Cucumis sativus]
Length=135

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 112/124 (90%), Gaps = 0/124 (0%)
 Frame = -1

Query  633  KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
            KEGTPIS+NPLV+W+ AGLLINAINSIPAGELDGGRI+FSIWGRK S+R++  SI LLG+
Sbjct  9    KEGTPISLNPLVIWAWAGLLINAINSIPAGELDGGRIAFSIWGRKASSRITGVSIVLLGL  68

Query  453  saLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNKYialgiavlllgllVCLPYPFPFN  274
            ++LFSDVAFYWV LIF LQRGPIAPLSEEITDPD KYI LG+ VL LGLLVCLP+PFPF+
Sbjct  69   ASLFSDVAFYWVALIFFLQRGPIAPLSEEITDPDEKYIGLGVLVLFLGLLVCLPFPFPFS  128

Query  273  NEAV  262
             EA+
Sbjct  129  EEAI  132



>ref|WP_018396897.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=503

 Score =   171 bits (432),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/350 (37%), Positives = 195/350 (56%), Gaps = 17/350 (5%)
 Frame = -1

Query  1380  IPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLY  1201
             IP+E +  ++  +FG DTFF T   PY+ G +FKGNLR Q   +++++S ++ ++ G+ Y
Sbjct  133   IPEEDLKQIQS-IFGIDTFFATETIPYQEGAIFKGNLRSQPNEAHDRLSAKLHEKLGEKY  191

Query  1200  KLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLL  1021
             +LFL+ +PE  +P  +V+P           P         +V + T L  ++ A  A LL
Sbjct  192   RLFLVESPEG-RPTIIVLPS-----SNDPQPATLTQKNLAIVLLVTTLATSLEA--AGLL  243

Query  1020  SVFDNFDLL---ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGA  850
               FD F  L      LP A     IL  HEI H + AQ+  ++L  PY +PSWQIGSFG+
Sbjct  244   LGFDWFSDLGRFREALPIAAGLGSILVAHEIGHRIFAQRYNVRLSWPYLIPSWQIGSFGS  303

Query  849   ITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESlla  670
             ITR  +++P R  L   A AGP  G  L FILL+LG  L     L  +  P+ F +  + 
Sbjct  304   ITRFESLIPNRSVLFDVAIAGPAFGGLLSFILLILGLILSQPGSLFQL--PTTFFQGSVL  361

Query  669   ggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSA  490
              G     +     + + + V+PL +    GL+INA+N +PAG+LDGGR+  +I+GRKT+ 
Sbjct  362   VGTLAKTILGDALQNSIVDVHPLTIIGWLGLVINALNLMPAGQLDGGRVVQAIYGRKTAR  421

Query  489   RlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             R + A++ +LGI A+    + +  YW ++I  LQR    P   E+T+PD+
Sbjct  422   RTTIATLVILGIVAIVVPGNPIPLYWGIIILFLQRDLERPSLNELTEPDD  471



>ref|WP_027846599.1| peptidase M50 [Mastigocoleus testarum]
Length=505

 Score =   170 bits (431),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 200/351 (57%), Gaps = 14/351 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E I IP+E ++ +K  +FG DTFF T    Y+ G +F+GN+RG+    +E+++  ++   
Sbjct  134   EIIPIPEEDLNAIKG-IFGIDTFFSTQTIAYQEGAIFRGNIRGEPEVVHERLTANLKKSL  192

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D KPV +++P    +P +  +    A   FG++  F  +  ++ A  
Sbjct  193   GDKYRLFLVEN-TDGKPVVIILPSRN-EPRSMTL----AQKIFGVILFFATIATSMEA--  244

Query  1032  ANLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             A +L  FD F   +  +  L  A     IL  HEI H   A++  ++L +PYF+P+ QIG
Sbjct  245   AGILLSFDFFASPERYQETLTIAGGIIAILISHEIGHWFFARRYDVRLSLPYFIPAVQIG  304

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFG+ITR  +I+P R+ L   A AGP     +  +LL++GF L        +  P+ F +
Sbjct  305   SFGSITRFESILPSRKVLFDIALAGPATSGIVSLVLLIVGFLLSQQGSYFEL--PNQFFQ  362

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G    ++  +  E   + V+PLV+    GL+I A+N +PAG+LDGGRI  +I+GR
Sbjct  363   GSILVGTLAKVILGSALESPLVGVHPLVIIGWLGLVITALNLMPAGQLDGGRIVQAIYGR  422

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             KT+ R +  ++ +LG+ +L + +A YW ++I  LQR    P   EIT+PD+
Sbjct  423   KTAQRTTIVTLIVLGLVSLGNPLAIYWAIVILFLQRDLERPSLNEITEPDD  473



>ref|WP_026722695.1| peptidase M50 [Fischerella sp. PCC 9431]
Length=499

 Score =   170 bits (431),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 203/351 (58%), Gaps = 14/351 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+  ++ +K  +FG DTFF T    Y+ G +FKGNLRG+    + +++ ++Q+  
Sbjct  129   EVMPIPEADLNAIKG-IFGLDTFFATETIAYQEGAIFKGNLRGEPEMVHNRLTAKLQETI  187

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+L+L+ N  D KPV +V+P           P   +   F ++ +   ++ ++ A  
Sbjct  188   GDKYRLYLVEN-TDGKPVVIVLPS-----RNDPRPMSLSQKVFAIILLVATVVTSLEA--  239

Query  1032  ANLLSVFD---NFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             + +L  FD   +F  L+  LP  L   ++L  HEI H L+A++  I+L  PYF+P+ QIG
Sbjct  240   SGILQGFDLFADFGRLQETLPIGLGLLVVLLAHEIGHWLLARRHNIRLSWPYFLPAVQIG  299

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFGAITR  +++P R+ L   A AGP AG  +  ++L+ G  L     +  +  P+ F +
Sbjct  300   SFGAITRFESLLPNRKVLFDIALAGPAAGGIVSLLMLITGLLLSHQGSMFQL--PNQFFQ  357

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G    ++  +  +   + V+PLV+    GL+I A+N +PAG+LDGGRI  +I+GR
Sbjct  358   GSILVGSLAKVVLGSALQSPLVDVHPLVVIGWLGLVITALNLMPAGQLDGGRIVQAIYGR  417

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             KT+ R + A++ LLG+ AL + +A YW ++I  LQR    P   EI++PD+
Sbjct  418   KTAGRATFATLILLGLVALGNPLAMYWAIVILFLQRDLERPSLNEISEPDD  468



>ref|WP_019493774.1| peptidase M50 [Calothrix sp. PCC 7103]
Length=491

 Score =   170 bits (430),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 124/352 (35%), Positives = 198/352 (56%), Gaps = 14/352 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP + +  +K  +FG DTFF T   PY+ G +FKGNLRG+   ++ ++++ ++ R 
Sbjct  121   ETLSIPDDDLSAIKS-IFGIDTFFATETIPYQDGAVFKGNLRGEPEETHNRLTESLKSRV  179

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD Y+LFL+ N  D +PV +V+P           P   A   F ++ +   L   + A  
Sbjct  180   GDKYRLFLVEN-ADGRPVVIVLPS-----RNDPRPMSIAQKVFAVILLTATLGTCLEA--  231

Query  1032  ANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
             A LL  FD F      +  LP      +IL  HEI H + A++  ++L +P+F+P+ QIG
Sbjct  232   AGLLLGFDFFSYPARYQETLPIGGGIFIILIAHEIGHWVAARRHQVRLSLPFFLPAVQIG  291

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             SFGAITR  +++  R+ L   + AGP  G  L  +LL+ G  L     L  +  P+ F +
Sbjct  292   SFGAITRFESLLLNRKVLFDISLAGPATGGILSLVLLIAGLLLSKQSSLFQI--PNEFFQ  349

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G    ++  A  +   + VNPLV+    GL++NA+N +PAG+LDGGRI  +I+GR
Sbjct  350   GSILVGTLSKVVLGAALQSPTVPVNPLVIIGWLGLVVNALNLMPAGQLDGGRIIQAIYGR  409

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDNK  346
             K ++R + A++ +L + +L + +A YW ++I  LQR    P   EIT+PD++
Sbjct  410   KIASRATIATLIVLALVSLGNPLAMYWAIVIVFLQRDLERPSLNEITEPDDQ  461



>ref|WP_035148897.1| peptidase M50 [Calothrix sp. 336/3]
 gb|KFB81516.1| peptidase M50 [Calothrix sp. 336/3]
Length=493

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 124/353 (35%), Positives = 200/353 (57%), Gaps = 18/353 (5%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E + IP+  +  +K  +FG DTFF T   PY+ GV+FKGNLRG+    + +++  +Q+R 
Sbjct  122   ELMAIPEADLTAIKG-IFGIDTFFATETIPYQEGVIFKGNLRGEPEAIHNRLTSSLQERL  180

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             G+ Y+LFL+ N +D K V +++P        T   + FA        +F L+      L+
Sbjct  181   GEQYRLFLVEN-QDGKAVVIILPSRNDPQPMTVFQKIFA--------VFLLVATAGTCLE  231

Query  1032  -ANLLSVFDNF----DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQ  868
              A LL  FD F      LE    G  V A+++  HE+ H  +AQ+  ++L +P+F+P+ Q
Sbjct  232   AAGLLLNFDFFVTPSRYLETLPIGGGVLAILIA-HELGHWFMAQRYNVRLSLPFFLPAVQ  290

Query  867   IGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVF  688
             IGSFGAITR  +++P R+ L   + AGP  G  +   +L+ G  L  +     +  P  F
Sbjct  291   IGSFGAITRFESLLPNRKALFDISFAGPAVGGVVSLGMLITGLLLSHSGSFFQL--PKEF  348

Query  687   HESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIW  508
              +  +  G    ++  +  + + + ++PLV+    GL+I A+N +PAG+LDGGRI  +I+
Sbjct  349   FQGSILVGTLARIVLGSALQSSVVDIHPLVIVGWVGLVITALNLMPAGQLDGGRIVQAIY  408

Query  507   GRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             GRK + R + A++ LLG++ L S +  YW+++I  LQR P  P   EIT+PD+
Sbjct  409   GRKIANRAAIATLILLGLAGLGSSLPLYWLIVIVFLQRTPERPSLNEITEPDD  461



>ref|WP_022608739.1| putative membrane-associated Zn-dependent protease 1 [Rubidibacter 
lacunae]
 gb|ERN40202.1| putative membrane-associated Zn-dependent protease 1 [Rubidibacter 
lacunae KORDI 51-2]
Length=504

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 127/355 (36%), Positives = 197/355 (55%), Gaps = 17/355 (5%)
 Frame = -1

Query  1395  DEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDR  1216
             + A  IP E +  ++  +FG DTFF T   PY+ G +FKGNLR     +Y+++  +++DR
Sbjct  129   ESATPIPNEDLKAVQG-IFGIDTFFATETIPYQDGAIFKGNLRSDPDVAYQQLVDKLRDR  187

Query  1215  FGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPAL  1036
              G+ Y+LFL+ +PE+ +PVA+V+P       +T  P        GLV    +        
Sbjct  188   LGEKYRLFLVESPEN-RPVAIVLP-------STNDPRSLTVWQKGLVLALAIAAIATSCE  239

Query  1035  QANLLSVFDNFDLLENG---LPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
                LL  FD F         LP  L    IL  HE+ H  +A++ G+KL  P+F+PS+QI
Sbjct  240   AFGLLVGFDFFTTPHRYGEILPLVLGLWAILVAHELGHFWMAKRHGLKLSWPFFIPSFQI  299

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             G+FGAITR+ ++VP R  L   A AGP AG  L  +++++G  L        +  P+ F 
Sbjct  300   GAFGAITRLESLVPTRSVLFDVAIAGPAAGGLLSLLMVVMGLVLSHPGSAYQL--PTEFF  357

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +S +  G    ++     + + + ++PL +    GL I ++N +PAG+LDGGRI  +I+G
Sbjct  358   KSSVLVGSLARVVLGEQLQTSIVDIHPLTVVGWLGLAIASLNLLPAGQLDGGRIVQAIYG  417

Query  504   RKTSARlssasigllgisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RKT+ R + A++ +LGI A+F   + +  YW VLI  LQR    P   E+T+PD+
Sbjct  418   RKTARRTTVATLIVLGIVAVFNPGNPIPLYWGVLILFLQRNLERPSLNELTEPDD  472



>ref|WP_015112975.1| peptidase M50 [Nostoc sp. PCC 7107]
 ref|YP_007049909.1| peptidase M50 [Nostoc sp. PCC 7107]
 gb|AFY42759.1| peptidase M50 [Nostoc sp. PCC 7107]
Length=493

 Score =   169 bits (427),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 127/355 (36%), Positives = 200/355 (56%), Gaps = 16/355 (5%)
 Frame = -1

Query  1401  QLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQ  1222
             +L E + IP+  +  ++  +FG DTFF T    Y+ G +F GNLRG+    + ++S +++
Sbjct  120   ELKEVLSIPEADLSAIRS-IFGIDTFFATETIAYQEGAIFNGNLRGEPQEVHNRLSDKLR  178

Query  1221  DRFGDLYKLFLLINPEDDKPVAVVVP-RITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             +R G+ Y+LF L+   D KPV +V+P R   +P TT    +  AG   + T+ T L    
Sbjct  179   ERLGEQYRLF-LVESTDGKPVVIVLPSRNDPRPTTTGQKAF--AGILLIATLATCL----  231

Query  1044  PALQANLLSVFDNFDL---LENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPS  874
                 A LL  FD F         LP  L   +IL  HEI H ++A++  ++L  P+F+P+
Sbjct  232   --ETAGLLLNFDLFATPARFTQALPIGLGIFVILIAHEIGHWVIARRYQVRLSWPFFLPA  289

Query  873   WQIGSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPS  694
              QIGSFG+ITR  +++P R  L     AGP AG  L  I+L++G  L     L  +  P+
Sbjct  290   VQIGSFGSITRFESLLPNRTALFDITLAGPAAGGILSLIMLIVGLLLSHPGSLFQL--PN  347

Query  693   VFHESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFS  514
              F +  +  G    ++  +  +   ++V+PLV+    GL+I A+N +PAG LDGGRI  +
Sbjct  348   QFFQGSILVGSLARVVLGSALQSPLVNVHPLVIIGWLGLVITALNLMPAGSLDGGRIVQA  407

Query  513   IWGRKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             I+GRKT+ R + A++ LL + +L + +A YW ++I  LQR    P   EI++PD+
Sbjct  408   IYGRKTARRATFATLILLALVSLGNTLAMYWAIVIVFLQRDLERPSLNEISEPDD  462



>ref|WP_002776361.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa]
 emb|CCI06777.1| Similar to tr|Q8YV67|Q8YV67 [Microcystis aeruginosa PCC 7941]
Length=496

 Score =   169 bits (427),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 118/338 (35%), Positives = 192/338 (57%), Gaps = 12/338 (4%)
 Frame = -1

Query  1350  DQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPED  1171
               +FG DTFF T    ++ G +FKGNLRG+    + ++++++ + FGD Y+LFL +   +
Sbjct  135   QSIFGIDTFFATETISFQEGAIFKGNLRGEPDIVHSRLTQKLSNHFGDKYRLFL-VEGTE  193

Query  1170  DKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANL-LSVFDNFDLL  994
             +KPV +++P+ T  P     P   A     LV +   ++ ++ A    L   +F N+   
Sbjct  194   EKPVVIILPK-TNDPS----PATLAQKNLSLVLLVATIVTSLEAAGILLGFDLFSNWQRY  248

Query  993   ENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPKRE  814
                +P +L    +L  HEI H ++A++  ++L +PYF+P+WQIGSFGAITR  +++P R 
Sbjct  249   REAIPLSLGLWSVLIAHEIGHLIIAKRHNVRLSLPYFLPTWQIGSFGAITRFESLLPNRS  308

Query  813   DLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgdaL  634
              L   A AGP  G  +  ILL++G  L  +  L  +  P  F +S +  G    ++    
Sbjct  309   VLFDIAFAGPALGGLVSLILLIVGLTLSNSASLFQI--PITFFQSSILVGSLARIVLGDE  366

Query  633   KEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigllgi  454
              +   ISV+PL +    GL+I A+N +PAG+LDGGRI  +I+GRK + R + A++ +LGI
Sbjct  367   LQNAVISVHPLTVIGWLGLVITALNLLPAGQLDGGRIVQAIYGRKIARRTTVATLVILGI  426

Query  453   saLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              +L    + +  YW +L+  LQR    P   E+T+PD+
Sbjct  427   ISLVNPSNPIPLYWTILVAFLQRELERPSLNELTEPDD  464



>ref|WP_012954612.1| putative membrane-associated Zn-dependent protease [Candidatus 
Atelocyanobacterium thalassa]
 ref|YP_003422306.1| putative membrane-associated Zn-dependent protease [Candidatus 
Atelocyanobacterium thalassa]
 gb|ADB95925.1| predicted membrane-associated Zn-dependent protease [Candidatus 
Atelocyanobacterium thalassa isolate ALOHA]
Length=484

 Score =   168 bits (426),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 188/340 (55%), Gaps = 10/340 (3%)
 Frame = -1

Query  1359  ILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLIN  1180
             ++   +F  DTFF T   PYE G++F+GNLRG    +Y+ +S +++  F + Y LFL + 
Sbjct  120   LIMKNIFSIDTFFSTESIPYEEGIIFRGNLRGDPDATYKLLSSKLRTHFDEKYCLFL-VE  178

Query  1179  PEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQANLLSVFDNFD  1000
               + KPV +V+P        T + +  A   F L T+ T L +    L  +L   FDN++
Sbjct  179   GNEGKPVVIVLPNTNNHKAMTTLQKNLAIVLF-LATVVTSLEKTSILLGFDL---FDNWN  234

Query  999   LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPK  820
                  +P  L   +I+  HEI H LVA    IKL  P+F+P W+IGSFGAITR  +++P 
Sbjct  235   RFHEVIPITLALWIIIAFHEIGHLLVASFYNIKLSWPFFLPIWEIGSFGAITRFESLIPN  294

Query  819   REDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgd  640
             R+ L   + AGP     +  +LL+ G        L  +   S F +S+L   +AK +LGD
Sbjct  295   RKTLFDISFAGPAFSGIISIVLLVCGLIFSHPGSLLQMTTQS-FQKSILISVLAKFILGD  353

Query  639   aLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigll  460
              LK    I +NPL +    GL+I A+N +PAG+LDGGRI  SI+GR+T  + +  ++ +L
Sbjct  354   QLKNSI-IDINPLFIIGWLGLIITALNLMPAGQLDGGRILQSIYGRETVRKSTIITLIIL  412

Query  459   gisaLF---SDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             GI  +    + +  YW++ I  LQR    P   E+T+P+N
Sbjct  413   GIVTILNPTNPIPLYWIMFILFLQRDTEKPSLNELTEPNN  452



>ref|WP_006626236.1| peptidase M50 [Arthrospira platensis]
 gb|EKD05752.1| peptidase M50 [Arthrospira platensis C1]
Length=497

 Score =   168 bits (426),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 126/352 (36%), Positives = 197/352 (56%), Gaps = 16/352 (5%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E   I  E + +++  +FG DTFF T   PY+ GV+FKGNLR      + ++S+ +Q++ 
Sbjct  126   ETTAINPEDLKVIQG-IFGIDTFFATETFPYQEGVIFKGNLRSDPEEVHGRLSRSLQEKM  184

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD ++LFL+ NP D KPV +V+P  +  P      +   A    ++T+ T+        Q
Sbjct  185   GDRFRLFLIENP-DGKPVVIVLPS-SKDPQPATDGQKILALVLLVITVATI-------FQ  235

Query  1032  A-NLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
             A  LL  FD F   +     LP A+    +L  HEI+H ++A +  +K  +P+F+P+ QI
Sbjct  236   AGGLLLGFDFFGEHNRYGEVLPIAIGIGSVLAAHEIAHQVIANRHQVKFSLPFFIPTVQI  295

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             G+FGA  R  +++P R+ L   A AGP AG  L  ++LL G  L     L  V  P+ F 
Sbjct  296   GTFGAFNRFESLLPNRKVLFDVALAGPAAGGLLSLLMLLAGLILSHQGSLFQV--PTSFF  353

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G+   L+     + + + V+PL +    GL+I AIN +PAG+LDGGRI  SI+G
Sbjct  354   QGSVLVGLLSKLILGNALKQSIVDVHPLTIIGWLGLVITAINLMPAGQLDGGRIIQSIFG  413

Query  504   RKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RK + R + A+  +L I++L + +A YW  +I +LQR    P   E+T+PD+
Sbjct  414   RKVAGRSTFATFIVLAIASLVNPLALYWAAVILILQRNLERPSLNELTEPDD  465



>gb|EHJ12119.1| Peptidase M50, partial [Crocosphaera watsonii WH 0003]
Length=353

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 112/306 (37%), Positives = 174/306 (57%), Gaps = 8/306 (3%)
 Frame = -1

Query  1404  QQLDEAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRM  1225
             + + + I IP E + ++K  +F  DTFF T    Y+ G +F+GNLRG+   SY+K+S+++
Sbjct  36    KNISDLIPIPDEDLQLIKG-IFSIDTFFATETISYQEGAIFRGNLRGETEESYQKLSEKL  94

Query  1224  QDRFGDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNV  1045
             +D FG+ Y+LFL +   + KPV +++P  +  P  T + +   A    + T+FT L    
Sbjct  95    KDSFGEKYRLFL-VEGSEGKPVVIILPS-SDDPQPTTLVQKNLALVLLVGTVFTTLEAAS  152

Query  1044  PALQANLLSVFDNFDLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
               L  +L   F+N+      LP  L    I   HE+ H + A++  IK+ VP+F+P+WQI
Sbjct  153   ILLGFDL---FNNWGRYIETLPIGLALWGIFIFHEVGHRVAAKRYDIKMSVPFFLPTWQI  209

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             GSFGAITR  +++P R  L   A AGP  G  L FILL++G  L     L  V  P+ F 
Sbjct  210   GSFGAITRFESLIPTRNALFDVALAGPACGGILSFILLIIGLVLSHDGSLFQV--PTQFF  267

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G    ++     +   + V+PL +    GL++ A+N +PAG+LDGGRI  +I+G
Sbjct  268   QGSILVGSLAKVVLGEQLQNAIVDVHPLTVVGWLGLVVTALNLMPAGQLDGGRIIQAIYG  327

Query  504   RKTSAR  487
             RKT+ R
Sbjct  328   RKTARR  333



>ref|WP_008050062.1| Peptidase M50 [Arthrospira sp. PCC 8005]
 emb|CCE15971.1| Peptidase M50 [Arthrospira sp. PCC 8005]
 emb|CDM94509.1| Peptidase M50 [Arthrospira sp. PCC 8005]
Length=497

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 126/352 (36%), Positives = 197/352 (56%), Gaps = 16/352 (5%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E   I  E + +++  +FG DTFF T   PY+ GV+FKGNLR      + ++S+ +Q++ 
Sbjct  126   ETTAINPEDLKVIQG-IFGIDTFFATETFPYQEGVIFKGNLRSDPEEVHGRLSRSLQEKM  184

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD ++LFL+ NP D KPV +V+P  +  P      +   A    ++T+ T+        Q
Sbjct  185   GDRFRLFLIENP-DGKPVVIVLPS-SKDPQPATDGQKILALVLLVITVATI-------FQ  235

Query  1032  A-NLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQI  865
             A  LL  FD F   +     LP A+    +L  HEI+H ++A +  +K  +P+F+P+ QI
Sbjct  236   AGGLLLGFDFFGEHNRYGEVLPIAIGIGSVLAAHEIAHQVIANRHQVKFSLPFFIPTVQI  295

Query  864   GSFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFH  685
             G+FGA  R  +++P R+ L   A AGP AG  L  ++LL G  L     L  V  P+ F 
Sbjct  296   GTFGAFNRFESLLPNRKVLFDVALAGPAAGGLLSLLMLLAGLILSHQGSLFQV--PTSFF  353

Query  684   ESllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWG  505
             +  +  G+   L+     + + + V+PL +    GL+I AIN +PAG+LDGGRI  SI+G
Sbjct  354   QGSVLVGLLSKLILGNALKQSIVDVHPLTIIGWLGLVITAINLMPAGQLDGGRIIQSIFG  413

Query  504   RKTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             RK + R + A+  +L I++L + +A YW  +I +LQR    P   E+T+PD+
Sbjct  414   RKVAGRSTFATFIVLAIASLVNPLALYWAAVILILQRNLERPSLNELTEPDD  465



>ref|WP_006670066.1| peptidase M50 [Arthrospira maxima]
 gb|EDZ93169.1| peptidase M50 [Arthrospira maxima CS-328]
Length=497

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 124/351 (35%), Positives = 195/351 (56%), Gaps = 14/351 (4%)
 Frame = -1

Query  1392  EAIRIPKETIDILKDQVFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRF  1213
             E   I  E + +++  +FG DTFF T   PY+ GV+FKGNLR      + ++S+ +Q++ 
Sbjct  126   ETTAINPEDLKVIQG-IFGIDTFFATETFPYQEGVIFKGNLRSDPEEVHGRLSRSLQEKM  184

Query  1212  GDLYKLFLLINPEDDKPVAVVVPRITLQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQ  1033
             GD ++LFL+ NP D KPV +V+P  +  P      +   A    ++T+ T+         
Sbjct  185   GDRFRLFLIENP-DGKPVVIVLPS-SKDPQPATDGQKILALVLLVITVATIF------QA  236

Query  1032  ANLLSVFDNF---DLLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIG  862
               LL  FD F   +     LP A+    +L  HEI+H ++A +  +K  +P+F+P+ QIG
Sbjct  237   GGLLLGFDFFGEHNRYGEVLPIAIGIGSVLAAHEIAHQVIANRHQVKFSLPFFIPTVQIG  296

Query  861   SFGAITRILNIVPKREDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHE  682
             +FGA  R  +++P R+ L   A AGP AG  L  ++LL G  L     L  V  P+ F +
Sbjct  297   TFGAFNRFESLLPNRKVLFDVALAGPAAGGLLSLLMLLAGLILSHQGSLFQV--PTSFFQ  354

Query  681   SllaggiaklllgdaLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGR  502
               +  G+   L+     + + + V+PL +    GL+I AIN +PAG+LDGGRI  SI+GR
Sbjct  355   GSVLVGLLSKLILGNALKQSIVDVHPLTIIGWLGLVITAINLMPAGQLDGGRIIQSIFGR  414

Query  501   KTSARlssasigllgisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
             K + R + A+  +L I++L + +A YW  +I +LQR    P   E+T+PD+
Sbjct  415   KVAGRSTFATFIVLAIASLVNPLALYWAAVILILQRNLERPSLNELTEPDD  465



>ref|WP_006620010.1| peptidase M50 [Arthrospira platensis]
 gb|KDR57864.1| peptidase M50 [Arthrospira platensis str. Paraca]
Length=499

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 124/337 (37%), Positives = 188/337 (56%), Gaps = 17/337 (5%)
 Frame = -1

Query  1344  VFGFDTFFVTSQEPYEGGVLFKGNLRGQAARSYEKISKRMQDRFGDLYKLFLLINPEDDK  1165
             +FG DTFF T   PY+ GV+FKGNLR      + ++S  +Q++ GD ++LFL+ NP D K
Sbjct  143   IFGIDTFFATETFPYQEGVIFKGNLRSDPEEVHGRLSSSLQEKMGDRFRLFLIENP-DGK  201

Query  1164  PVAVVVPRIT-LQPDTTAVPEWFAAGAFGLVTIFTLLLRNVPALQA-NLLSVFDNFD---  1000
             PV +V+P     QP         A G   ++ +  L++      QA  LL  FD F    
Sbjct  202   PVVIVLPSSNDPQP---------ATGGQKILALVLLVITVATIFQAGGLLLGFDFFSEPR  252

Query  999   LLENGLPGALVTALILGVHEISHTLVAQKAGIKLGVPYFVPSWQIGSFGAITRILNIVPK  820
                  LP A+    +L  HEI+H ++A +  +K  +P+F+P+ QIG+FGA  R  +++P 
Sbjct  253   RYGEVLPIAIGIGSVLAAHEIAHQVIANRHQVKFSLPFFIPTVQIGTFGAFNRFESVLPN  312

Query  819   REDLLKFAAAGPlagfslgfillllgfflppadglGVVVDPSVFHESllaggiaklllgd  640
             R+ L   A AGP AG  L  ++LLLG  L     L  V  P+ F +  +  G+    +  
Sbjct  313   RKVLFDVALAGPAAGGLLSLLMLLLGLILSHQGSLFQV--PTSFFQGSVLVGLLSKFILG  370

Query  639   aLKEGTPISVNPLVLWSLAGLLINAINSIPAGELDGGRISFSIWGRKTSARlssasigll  460
                + + + V+PL +    GL+I AIN +PAG+LDGGRI  SI+GRK + R + A+  +L
Sbjct  371   NALQQSIVDVHPLTIIGWLGLVITAINLMPAGQLDGGRIIQSIFGRKVAGRSTFATFIVL  430

Query  459   gisaLFSDVAFYWVVLIFVLQRGPIAPLSEEITDPDN  349
              I++L + +A YW  +I +LQR    P   E+T+PD+
Sbjct  431   AIASLVNPLALYWAAVILILQRNLERPSLNELTEPDD  467



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6330540990048