BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c21602_g1_i2 len=2046 path=[7004:0-264 3711:265-300 3747:301-501
1318:502-563 4008:564-698 1409:699-754 692:755-779 717:780-1270
4711:1271-1294 4735:1295-1392 4833:1393-2045]

Length=2046
                                                                      Score     E

ref|XP_006348131.1|  PREDICTED: L-ascorbate oxidase homolog             940   0.0     
ref|XP_004232701.1|  PREDICTED: L-ascorbate oxidase homolog             937   0.0     
ref|XP_011096053.1|  PREDICTED: L-ascorbate oxidase homolog             934   0.0     
ref|XP_009782819.1|  PREDICTED: L-ascorbate oxidase homolog             918   0.0     
ref|XP_009629876.1|  PREDICTED: L-ascorbate oxidase homolog             917   0.0     
gb|KDP20733.1|  hypothetical protein JCGZ_21204                         912   0.0     
gb|EPS74059.1|  hypothetical protein M569_00695                         900   0.0     
ref|XP_004145114.1|  PREDICTED: L-ascorbate oxidase homolog             899   0.0     
gb|EYU27771.1|  hypothetical protein MIMGU_mgv1a003982mg                895   0.0     
ref|XP_008440923.1|  PREDICTED: L-ascorbate oxidase homolog             892   0.0     
emb|CDP04415.1|  unnamed protein product                                892   0.0     
ref|XP_006449754.1|  hypothetical protein CICLE_v10014825mg             886   0.0     
ref|XP_006383902.1|  multi-copper oxidase type 1 family protein         885   0.0     
ref|XP_006467415.1|  PREDICTED: L-ascorbate oxidase homolog             884   0.0     
ref|XP_002518462.1|  multicopper oxidase, putative                      877   0.0     Ricinus communis
ref|XP_011046956.1|  PREDICTED: L-ascorbate oxidase homolog             874   0.0     
ref|XP_007026108.1|  SKU5 similar 4 isoform 1                           872   0.0     
gb|KHG02352.1|  L-ascorbate oxidase                                     871   0.0     
ref|XP_010529443.1|  PREDICTED: L-ascorbate oxidase homolog             870   0.0     
gb|ABK95805.1|  unknown                                                 870   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007026110.1|  SKU5 similar 4 isoform 3                           868   0.0     
ref|XP_010539014.1|  PREDICTED: L-ascorbate oxidase homolog             868   0.0     
ref|XP_010052867.1|  PREDICTED: L-ascorbate oxidase homolog             865   0.0     
ref|XP_007213900.1|  hypothetical protein PRUPE_ppa003872mg             862   0.0     
ref|XP_008224692.1|  PREDICTED: L-ascorbate oxidase homolog             860   0.0     
ref|XP_002272880.1|  PREDICTED: L-ascorbate oxidase homolog             859   0.0     Vitis vinifera
ref|XP_006282576.1|  hypothetical protein CARUB_v10004445mg             855   0.0     
ref|XP_010448953.1|  PREDICTED: L-ascorbate oxidase homolog             853   0.0     
ref|XP_010434093.1|  PREDICTED: L-ascorbate oxidase homolog             853   0.0     
ref|XP_010439384.1|  PREDICTED: L-ascorbate oxidase homolog             853   0.0     
emb|CDX79120.1|  BnaA01g11870D                                          851   0.0     
ref|XP_006413696.1|  hypothetical protein EUTSA_v10024862mg             851   0.0     
ref|NP_193932.1|  protein SKU5 similar 4                                851   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278638.1|  PREDICTED: L-ascorbate oxidase homolog             850   0.0     
emb|CDX82897.1|  BnaC01g13470D                                          850   0.0     
ref|XP_007215641.1|  hypothetical protein PRUPE_ppa003877mg             850   0.0     
ref|XP_002869849.1|  hypothetical protein ARALYDRAFT_914433             850   0.0     
ref|XP_008229964.1|  PREDICTED: L-ascorbate oxidase homolog             849   0.0     
ref|XP_004287955.1|  PREDICTED: L-ascorbate oxidase homolog             849   0.0     
gb|KHG03845.1|  L-ascorbate oxidase                                     847   0.0     
ref|XP_009135529.1|  PREDICTED: L-ascorbate oxidase homolog             847   0.0     
ref|XP_008384084.1|  PREDICTED: L-ascorbate oxidase homolog             846   0.0     
ref|XP_008371076.1|  PREDICTED: L-ascorbate oxidase homolog             843   0.0     
ref|XP_009359037.1|  PREDICTED: L-ascorbate oxidase homolog             843   0.0     
ref|XP_010244491.1|  PREDICTED: L-ascorbate oxidase homolog             835   0.0     
ref|XP_004293304.1|  PREDICTED: L-ascorbate oxidase homolog             835   0.0     
gb|KFK28784.1|  hypothetical protein AALP_AA7G047600                    835   0.0     
ref|XP_006447580.1|  hypothetical protein CICLE_v10014842mg             832   0.0     
ref|XP_010686816.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    832   0.0     
ref|XP_003549771.1|  PREDICTED: L-ascorbate oxidase homolog             828   0.0     
emb|CDP10787.1|  unnamed protein product                                828   0.0     
ref|XP_002269614.1|  PREDICTED: L-ascorbate oxidase homolog             827   0.0     Vitis vinifera
ref|XP_010046372.1|  PREDICTED: L-ascorbate oxidase homolog             826   0.0     
gb|AGJ03718.1|  multicopper oxidase                                     826   0.0     
ref|XP_002524823.1|  multicopper oxidase, putative                      825   0.0     Ricinus communis
gb|KDP22727.1|  hypothetical protein JCGZ_01829                         825   0.0     
ref|XP_007046383.1|  SKU5 similar 5 isoform 1                           824   0.0     
ref|XP_003605947.1|  L-ascorbate oxidase-like protein                   822   0.0     
ref|XP_010686815.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    822   0.0     
ref|XP_003610452.1|  L-ascorbate oxidase-like protein                   822   0.0     
ref|XP_009353293.1|  PREDICTED: L-ascorbate oxidase homolog             821   0.0     
ref|XP_010676489.1|  PREDICTED: L-ascorbate oxidase homolog             821   0.0     
ref|XP_009347125.1|  PREDICTED: L-ascorbate oxidase homolog             821   0.0     
ref|XP_008362259.1|  PREDICTED: L-ascorbate oxidase homolog             820   0.0     
ref|XP_007153964.1|  hypothetical protein PHAVU_003G080100g             820   0.0     
ref|XP_002320467.1|  hypothetical protein POPTR_0014s15260g             818   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_002301616.1|  hypothetical protein POPTR_0002s21400g             818   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_011047251.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    816   0.0     
ref|XP_004507683.1|  PREDICTED: L-ascorbate oxidase homolog             816   0.0     
ref|XP_004166771.1|  PREDICTED: L-ascorbate oxidase homolog             816   0.0     
gb|KHG04142.1|  L-ascorbate oxidase                                     816   0.0     
ref|XP_008789823.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    815   0.0     
ref|XP_003529638.1|  PREDICTED: L-ascorbate oxidase homolog             814   0.0     
ref|XP_010929557.1|  PREDICTED: L-ascorbate oxidase homolog             813   0.0     
ref|XP_008455444.1|  PREDICTED: L-ascorbate oxidase homolog             812   0.0     
ref|XP_009596487.1|  PREDICTED: L-ascorbate oxidase homolog             812   0.0     
ref|XP_004144498.1|  PREDICTED: L-ascorbate oxidase homolog             810   0.0     
ref|XP_009794442.1|  PREDICTED: L-ascorbate oxidase homolog             810   0.0     
ref|XP_010266098.1|  PREDICTED: L-ascorbate oxidase homolog             809   0.0     
ref|XP_002528421.1|  multicopper oxidase, putative                      808   0.0     Ricinus communis
ref|XP_003596958.1|  L-ascorbate oxidase-like protein                   807   0.0     
gb|KEH29685.1|  multi-copper oxidase-like protein                       807   0.0     
ref|XP_010923874.1|  PREDICTED: L-ascorbate oxidase homolog             806   0.0     
ref|XP_006855939.1|  hypothetical protein AMTR_s00037p00216460          806   0.0     
ref|XP_009413373.1|  PREDICTED: L-ascorbate oxidase homolog             805   0.0     
ref|XP_008806480.1|  PREDICTED: L-ascorbate oxidase homolog             804   0.0     
ref|XP_004487420.1|  PREDICTED: L-ascorbate oxidase homolog             803   0.0     
ref|XP_009794440.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    803   0.0     
emb|CDP19581.1|  unnamed protein product                                801   0.0     
ref|XP_009408654.1|  PREDICTED: L-ascorbate oxidase homolog             800   0.0     
gb|KDP36848.1|  hypothetical protein JCGZ_08139                         800   0.0     
ref|XP_010536445.1|  PREDICTED: L-ascorbate oxidase homolog             800   0.0     
ref|XP_011046313.1|  PREDICTED: L-ascorbate oxidase homolog             800   0.0     
ref|XP_003540295.1|  PREDICTED: L-ascorbate oxidase homolog             800   0.0     
ref|XP_009597920.1|  PREDICTED: L-ascorbate oxidase homolog             799   0.0     
ref|XP_006486657.1|  PREDICTED: L-ascorbate oxidase homolog             799   0.0     
ref|XP_004957823.1|  PREDICTED: L-ascorbate oxidase homolog             798   0.0     
ref|XP_008806482.1|  PREDICTED: L-ascorbate oxidase homolog             798   0.0     
ref|XP_004243477.1|  PREDICTED: L-ascorbate oxidase homolog             797   0.0     
ref|NP_001058365.1|  Os06g0678800                                       796   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EAZ38022.1|  hypothetical protein OsJ_22366                          795   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006422489.1|  hypothetical protein CICLE_v10028140mg             796   0.0     
ref|XP_003563038.1|  PREDICTED: L-ascorbate oxidase homolog             795   0.0     
ref|XP_006656379.1|  PREDICTED: L-ascorbate oxidase homolog             795   0.0     
ref|XP_002306213.1|  hypothetical protein POPTR_0004s18730g             795   0.0     Populus trichocarpa [western balsam poplar]
gb|EAZ02087.1|  hypothetical protein OsI_24168                          795   0.0     Oryza sativa Indica Group [Indian rice]
gb|KEH36280.1|  multi-copper oxidase-like protein                       793   0.0     
ref|XP_010918208.1|  PREDICTED: L-ascorbate oxidase homolog             793   0.0     
ref|XP_002510630.1|  multicopper oxidase, putative                      792   0.0     Ricinus communis
gb|KHG21949.1|  L-ascorbate oxidase                                     791   0.0     
gb|KEH30611.1|  multi-copper oxidase-like protein                       790   0.0     
ref|XP_009397777.1|  PREDICTED: L-ascorbate oxidase homolog             790   0.0     
ref|XP_009334388.1|  PREDICTED: L-ascorbate oxidase homolog             790   0.0     
gb|ACJ85585.1|  unknown                                                 789   0.0     Medicago truncatula
gb|KHG11003.1|  L-ascorbate oxidase                                     789   0.0     
ref|XP_008236098.1|  PREDICTED: L-ascorbate oxidase homolog             788   0.0     
ref|XP_011099705.1|  PREDICTED: L-ascorbate oxidase homolog             788   0.0     
ref|XP_002307765.1|  multi-copper oxidase type 1 family protein         788   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007041705.1|  SKU5 similar 5                                     788   0.0     
ref|XP_002460757.1|  hypothetical protein SORBIDRAFT_02g034420          788   0.0     Sorghum bicolor [broomcorn]
emb|CDX73238.1|  BnaC06g36860D                                          787   0.0     
ref|XP_006390229.1|  hypothetical protein EUTSA_v10018373mg             787   0.0     
ref|XP_002282214.1|  PREDICTED: L-ascorbate oxidase homolog             787   0.0     Vitis vinifera
ref|XP_011041276.1|  PREDICTED: L-ascorbate oxidase homolog             787   0.0     
gb|AFK35121.1|  unknown                                                 786   0.0     
ref|XP_009106271.1|  PREDICTED: L-ascorbate oxidase homolog             785   0.0     
ref|XP_007200295.1|  hypothetical protein PRUPE_ppa004000mg             785   0.0     
ref|XP_006435293.1|  hypothetical protein CICLE_v10000783mg             785   0.0     
gb|KHN03487.1|  L-ascorbate oxidase like                                785   0.0     
gb|AGT57427.1|  ascorbate oxidase                                       784   0.0     
emb|CDX87633.1|  BnaA07g32400D                                          783   0.0     
ref|XP_010028797.1|  PREDICTED: L-ascorbate oxidase homolog             783   0.0     
ref|XP_003527501.1|  PREDICTED: L-ascorbate oxidase homolog             783   0.0     
ref|XP_009402574.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    783   0.0     
gb|KDP47151.1|  hypothetical protein JCGZ_00042                         782   0.0     
ref|XP_010266952.1|  PREDICTED: L-ascorbate oxidase homolog             783   0.0     
ref|XP_008387887.1|  PREDICTED: L-ascorbate oxidase homolog             782   0.0     
ref|XP_008377105.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    782   0.0     
dbj|BAK04971.1|  predicted protein                                      783   0.0     
ref|XP_008445302.1|  PREDICTED: L-ascorbate oxidase homolog             781   0.0     
ref|XP_007221787.1|  hypothetical protein PRUPE_ppa003860mg             780   0.0     
gb|KFK34458.1|  hypothetical protein AALP_AA5G148000                    780   0.0     
ref|XP_006592035.1|  PREDICTED: L-ascorbate oxidase homolog             780   0.0     
ref|XP_011034917.1|  PREDICTED: L-ascorbate oxidase homolog             780   0.0     
ref|XP_008452926.1|  PREDICTED: L-ascorbate oxidase homolog             779   0.0     
ref|XP_004506310.1|  PREDICTED: L-ascorbate oxidase homolog             779   0.0     
gb|EMT15848.1|  L-ascorbate oxidase-like protein                        778   0.0     
ref|XP_003537754.1|  PREDICTED: L-ascorbate oxidase homolog             778   0.0     
ref|XP_006302110.1|  hypothetical protein CARUB_v10020107mg             778   0.0     
gb|KHN05478.1|  L-ascorbate oxidase like                                778   0.0     
ref|XP_007131584.1|  hypothetical protein PHAVU_011G025400g             778   0.0     
ref|XP_008382461.1|  PREDICTED: L-ascorbate oxidase homolog             777   0.0     
ref|XP_008791980.1|  PREDICTED: L-ascorbate oxidase homolog             777   0.0     
ref|XP_002300669.1|  multi-copper oxidase type 1 family protein         778   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004142986.1|  PREDICTED: L-ascorbate oxidase homolog             777   0.0     
ref|XP_004506275.1|  PREDICTED: L-ascorbate oxidase homolog             777   0.0     
ref|XP_007017955.1|  SKU5 similar 5 isoform 1                           777   0.0     
ref|XP_002438855.1|  hypothetical protein SORBIDRAFT_10g027270          777   0.0     Sorghum bicolor [broomcorn]
ref|XP_010061137.1|  PREDICTED: L-ascorbate oxidase homolog             777   0.0     
ref|XP_010471765.1|  PREDICTED: L-ascorbate oxidase homolog             776   0.0     
gb|KHF99506.1|  L-ascorbate oxidase                                     776   0.0     
ref|XP_002889063.1|  hypothetical protein ARALYDRAFT_895494             776   0.0     
ref|NP_001147597.1|  LOC100281206 precursor                             776   0.0     Zea mays [maize]
ref|XP_010923873.1|  PREDICTED: L-ascorbate oxidase homolog             776   0.0     
ref|XP_008798222.1|  PREDICTED: L-ascorbate oxidase homolog             775   0.0     
ref|XP_004157080.1|  PREDICTED: L-ascorbate oxidase homolog             775   0.0     
gb|ACL53812.1|  unknown                                                 776   0.0     Zea mays [maize]
ref|XP_010323833.1|  PREDICTED: L-ascorbate oxidase homolog             775   0.0     
ref|XP_010416527.1|  PREDICTED: L-ascorbate oxidase homolog             775   0.0     
ref|XP_007160607.1|  hypothetical protein PHAVU_001G001500g             775   0.0     
ref|XP_009418785.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    774   0.0     
ref|XP_009785141.1|  PREDICTED: L-ascorbate oxidase homolog             773   0.0     
ref|XP_010103300.1|  L-ascorbate oxidase-like protein                   774   0.0     
ref|NP_177743.1|  SKU5-like 5 protein                                   773   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_006366591.1|  PREDICTED: L-ascorbate oxidase homolog             775   0.0     
ref|XP_004500896.1|  PREDICTED: L-ascorbate oxidase homolog             773   0.0     
ref|XP_002285913.1|  PREDICTED: L-ascorbate oxidase homolog             771   0.0     Vitis vinifera
gb|AAL09733.1|  At1g76160/T23E18_10                                     771   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHF99853.1|  L-ascorbate oxidase                                     771   0.0     
ref|XP_010539810.1|  PREDICTED: L-ascorbate oxidase homolog             771   0.0     
gb|AAM97070.1|  pectinesterase, putative                                771   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428667.1|  PREDICTED: L-ascorbate oxidase homolog             770   0.0     
ref|XP_003523207.1|  PREDICTED: L-ascorbate oxidase homolog             770   0.0     
gb|KHN33820.1|  L-ascorbate oxidase like                                770   0.0     
ref|XP_010530339.1|  PREDICTED: L-ascorbate oxidase homolog             769   0.0     
ref|XP_004291312.1|  PREDICTED: L-ascorbate oxidase homolog             769   0.0     
ref|XP_006657750.1|  PREDICTED: L-ascorbate oxidase homolog             769   0.0     
ref|XP_003527461.1|  PREDICTED: L-ascorbate oxidase homolog             769   0.0     
ref|XP_008221175.1|  PREDICTED: L-ascorbate oxidase homolog             768   0.0     
emb|CDP07321.1|  unnamed protein product                                768   0.0     
ref|XP_004966212.1|  PREDICTED: L-ascorbate oxidase homolog             768   0.0     
ref|XP_006596528.1|  PREDICTED: L-ascorbate oxidase homolog             768   0.0     
emb|CAN83942.1|  hypothetical protein VITISV_013559                     768   0.0     Vitis vinifera
ref|NP_001152000.1|  L-ascorbate oxidase precursor                      768   0.0     Zea mays [maize]
ref|XP_009623446.1|  PREDICTED: L-ascorbate oxidase homolog             767   0.0     
ref|XP_007132533.1|  hypothetical protein PHAVU_011G102500g             766   0.0     
ref|XP_004505676.1|  PREDICTED: L-ascorbate oxidase homolog             765   0.0     
emb|CAA65634.1|  PS60                                                   765   0.0     Nicotiana tabacum [American tobacco]
ref|XP_003550444.1|  PREDICTED: L-ascorbate oxidase homolog             765   0.0     
ref|XP_003539859.1|  PREDICTED: L-ascorbate oxidase homolog             764   0.0     
ref|XP_011008684.1|  PREDICTED: L-ascorbate oxidase homolog             762   0.0     
gb|ACN50176.1|  pectinesterase                                          764   0.0     Annona cherimola [cherimoya]
gb|KHN21220.1|  L-ascorbate oxidase like                                764   0.0     
emb|CDY68834.1|  BnaCnng60730D                                          764   0.0     
ref|XP_009794441.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    762   0.0     
gb|KHG21048.1|  L-ascorbate oxidase                                     762   0.0     
gb|KEH40258.1|  multi-copper oxidase-like protein                       762   0.0     
emb|CDY55201.1|  BnaCnng28410D                                          763   0.0     
ref|NP_564479.1|  SKU5 similar 6                                        762   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EEC82126.1|  hypothetical protein OsI_26158                          762   0.0     Oryza sativa Indica Group [Indian rice]
gb|AAF99833.1|AC008046_5  Putative pectinesterase                       761   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290036.1|  PREDICTED: L-ascorbate oxidase homolog             761   0.0     
gb|AAL24296.1|  Unknown protein                                         761   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563398.1|  PREDICTED: L-ascorbate oxidase homolog             761   0.0     
gb|EEE67250.1|  hypothetical protein OsJ_24405                          761   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_004145593.1|  PREDICTED: L-ascorbate oxidase homolog             760   0.0     
ref|XP_004238406.1|  PREDICTED: L-ascorbate oxidase homolog             760   0.0     
ref|XP_009418784.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    761   0.0     
ref|XP_008447902.1|  PREDICTED: L-ascorbate oxidase homolog             760   0.0     
ref|XP_009630901.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    760   0.0     
gb|KFK34651.1|  hypothetical protein AALP_AA5G173600                    759   0.0     
ref|XP_007136137.1|  hypothetical protein PHAVU_009G021000g             759   0.0     
ref|XP_009128157.1|  PREDICTED: L-ascorbate oxidase homolog             759   0.0     
ref|XP_004144874.1|  PREDICTED: L-ascorbate oxidase homolog             759   0.0     
ref|XP_004231076.1|  PREDICTED: L-ascorbate oxidase homolog             758   0.0     
ref|XP_010667351.1|  PREDICTED: L-ascorbate oxidase homolog             758   0.0     
dbj|BAJ91397.1|  predicted protein                                      758   0.0     
ref|XP_010063104.1|  PREDICTED: L-ascorbate oxidase homolog             758   0.0     
ref|XP_010667350.1|  PREDICTED: L-ascorbate oxidase homolog             758   0.0     
ref|XP_006364519.1|  PREDICTED: L-ascorbate oxidase homolog             758   0.0     
ref|XP_004499321.1|  PREDICTED: L-ascorbate oxidase homolog             757   0.0     
ref|XP_002888337.1|  hypothetical protein ARALYDRAFT_475543             757   0.0     
emb|CDY35790.1|  BnaA08g04510D                                          756   0.0     
ref|XP_006342102.1|  PREDICTED: L-ascorbate oxidase homolog             756   0.0     
emb|CDY67479.1|  BnaCnng55180D                                          756   0.0     
dbj|BAK00459.1|  predicted protein                                      756   0.0     
ref|XP_009107631.1|  PREDICTED: L-ascorbate oxidase homolog             756   0.0     
ref|XP_010101299.1|  L-ascorbate oxidase-like protein                   753   0.0     
gb|EYU36818.1|  hypothetical protein MIMGU_mgv1a004264mg                752   0.0     
gb|ABK25092.1|  unknown                                                 752   0.0     Picea sitchensis
ref|XP_006307199.1|  hypothetical protein CARUB_v10008790mg             751   0.0     
gb|KHN44868.1|  L-ascorbate oxidase like                                749   0.0     
dbj|BAC83966.1|  putative PS60                                          751   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010500092.1|  PREDICTED: L-ascorbate oxidase homolog             750   0.0     
ref|XP_009630902.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    749   0.0     
ref|XP_009612547.1|  PREDICTED: L-ascorbate oxidase homolog             748   0.0     
ref|XP_009630899.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    747   0.0     
ref|XP_009803721.1|  PREDICTED: L-ascorbate oxidase homolog             747   0.0     
ref|XP_009758924.1|  PREDICTED: L-ascorbate oxidase homolog             745   0.0     
ref|NP_173603.1|  SKU5 similar 8 protein                                744   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461374.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    743   0.0     
ref|XP_009758923.1|  PREDICTED: L-ascorbate oxidase homolog             741   0.0     
gb|KCW68031.1|  hypothetical protein EUGRSUZ_F01712                     739   0.0     
ref|XP_002893186.1|  hypothetical protein ARALYDRAFT_313077             739   0.0     
gb|KDO54690.1|  hypothetical protein CISIN_1g009283mg                   734   0.0     
ref|XP_006342555.1|  PREDICTED: L-ascorbate oxidase homolog             735   0.0     
ref|XP_006469674.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    732   0.0     
ref|XP_009400332.1|  PREDICTED: L-ascorbate oxidase homolog             734   0.0     
emb|CAB08077.1|  pectinesterase                                         731   0.0     Solanum lycopersicum
ref|XP_004253203.1|  PREDICTED: L-ascorbate oxidase homolog             732   0.0     
ref|XP_011088669.1|  PREDICTED: L-ascorbate oxidase homolog             732   0.0     
gb|EYU38005.1|  hypothetical protein MIMGU_mgv1a004001mg                731   0.0     
ref|XP_006342554.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    731   0.0     
gb|ABK25324.1|  unknown                                                 724   0.0     Picea sitchensis
ref|XP_010099197.1|  L-ascorbate oxidase-like protein                   721   0.0     
ref|NP_173604.1|  SKU5 similar 7 protein                                723   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|EYU17541.1|  hypothetical protein MIMGU_mgv1a004531mg                718   0.0     
ref|XP_010480557.1|  PREDICTED: L-ascorbate oxidase homolog             715   0.0     
ref|XP_006304367.1|  hypothetical protein CARUB_v10010844mg             714   0.0     
ref|XP_010498473.1|  PREDICTED: L-ascorbate oxidase homolog             714   0.0     
ref|XP_002270831.1|  PREDICTED: L-ascorbate oxidase homolog             713   0.0     Vitis vinifera
emb|CBI18560.3|  unnamed protein product                                713   0.0     
ref|XP_004253133.1|  PREDICTED: L-ascorbate oxidase homolog             714   0.0     
ref|XP_006411628.1|  hypothetical protein EUTSA_v10024832mg             714   0.0     
ref|XP_006416260.1|  hypothetical protein EUTSA_v10007292mg             711   0.0     
gb|ABR18324.1|  unknown                                                 709   0.0     Picea sitchensis
ref|XP_003596959.1|  L-ascorbate oxidase-like protein                   705   0.0     
gb|KFK44156.1|  hypothetical protein AALP_AA1G222300                    706   0.0     
ref|XP_010459724.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    707   0.0     
gb|KFK30447.1|  hypothetical protein AALP_AA7G262200                    707   0.0     
ref|XP_010459725.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    706   0.0     
ref|NP_001053555.1|  Os04g0561900                                       706   0.0     
emb|CAH67167.1|  H0211B05.4                                             706   0.0     
ref|XP_010028301.1|  PREDICTED: L-ascorbate oxidase homolog             702   0.0     
ref|XP_002866796.1|  hypothetical protein ARALYDRAFT_490604             702   0.0     
ref|XP_010436936.1|  PREDICTED: L-ascorbate oxidase homolog             702   0.0     
ref|XP_010431777.1|  PREDICTED: L-ascorbate oxidase homolog             701   0.0     
gb|KCW55012.1|  hypothetical protein EUGRSUZ_I00988                     702   0.0     
gb|AGE09595.1|  SKU5-like protein                                       699   0.0     
ref|NP_195555.2|  protein SKU5 similar 9                                698   0.0     
ref|XP_006283464.1|  hypothetical protein CARUB_v10004509mg             698   0.0     
ref|XP_006416404.1|  hypothetical protein EUTSA_v10007361mg             697   0.0     
ref|XP_010680450.1|  PREDICTED: L-ascorbate oxidase homolog             697   0.0     
ref|XP_004987010.1|  PREDICTED: L-ascorbate oxidase homolog             696   0.0     
emb|CAN72538.1|  hypothetical protein VITISV_028749                     697   0.0     
ref|XP_009348086.1|  PREDICTED: L-ascorbate oxidase homolog             695   0.0     
ref|XP_010255119.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    694   0.0     
ref|XP_009347241.1|  PREDICTED: L-ascorbate oxidase homolog             693   0.0     
ref|XP_007213899.1|  hypothetical protein PRUPE_ppa003872mg             689   0.0     
ref|XP_008338225.1|  PREDICTED: L-ascorbate oxidase homolog             692   0.0     
ref|XP_010690287.1|  PREDICTED: L-ascorbate oxidase homolog             692   0.0     
gb|KDO85017.1|  hypothetical protein CISIN_1g009149mg                   689   0.0     
emb|CDY54804.1|  BnaA06g40970D                                          696   0.0     
ref|XP_002310162.1|  multi-copper oxidase type 1 family protein         691   0.0     
ref|XP_008440238.1|  PREDICTED: L-ascorbate oxidase homolog             691   0.0     
emb|CDY64276.1|  BnaCnng43630D                                          694   0.0     
ref|XP_010070498.1|  PREDICTED: L-ascorbate oxidase homolog             691   0.0     
ref|XP_011039228.1|  PREDICTED: L-ascorbate oxidase homolog             691   0.0     
ref|XP_009101945.1|  PREDICTED: L-ascorbate oxidase homolog             691   0.0     
ref|XP_010555198.1|  PREDICTED: L-ascorbate oxidase homolog             689   0.0     
ref|XP_009402575.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    685   0.0     
emb|CDY31468.1|  BnaC05g15770D                                          688   0.0     
ref|XP_011013814.1|  PREDICTED: L-ascorbate oxidase homolog             687   0.0     
ref|XP_004171059.1|  PREDICTED: L-ascorbate oxidase homolog             684   0.0     
ref|XP_004141928.1|  PREDICTED: L-ascorbate oxidase homolog             687   0.0     
ref|XP_010255117.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    687   0.0     
ref|XP_011085509.1|  PREDICTED: L-ascorbate oxidase homolog             685   0.0     
emb|CAB37498.1|  putative pectinesterase                                684   0.0     
ref|XP_009777142.1|  PREDICTED: L-ascorbate oxidase homolog             681   0.0     
ref|XP_006425823.1|  hypothetical protein CICLE_v10025326mg             680   0.0     
ref|XP_011099220.1|  PREDICTED: L-ascorbate oxidase homolog             678   0.0     
ref|XP_010263761.1|  PREDICTED: L-ascorbate oxidase homolog             678   0.0     
ref|XP_009594576.1|  PREDICTED: L-ascorbate oxidase homolog             678   0.0     
gb|EYU44359.1|  hypothetical protein MIMGU_mgv1a004187mg                678   0.0     
ref|XP_010227225.1|  PREDICTED: L-ascorbate oxidase homolog             678   0.0     
ref|XP_007204826.1|  hypothetical protein PRUPE_ppa003926mg             677   0.0     
ref|XP_009407426.1|  PREDICTED: L-ascorbate oxidase homolog             676   0.0     
ref|XP_002522337.1|  multicopper oxidase, putative                      676   0.0     
ref|XP_004233429.1|  PREDICTED: L-ascorbate oxidase homolog             676   0.0     
ref|XP_008241557.1|  PREDICTED: L-ascorbate oxidase homolog             676   0.0     
gb|EYU39394.1|  hypothetical protein MIMGU_mgv11b015886mg               674   0.0     
gb|KDP31876.1|  hypothetical protein JCGZ_12337                         673   0.0     
ref|XP_006402152.1|  hypothetical protein EUTSA_v10013200mg             672   0.0     
gb|EEE61490.1|  hypothetical protein OsJ_15776                          673   0.0     
gb|KHN12597.1|  L-ascorbate oxidase like                                669   0.0     
ref|XP_006360232.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0     
gb|EEC77800.1|  hypothetical protein OsI_16980                          672   0.0     
ref|XP_009366415.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0     
ref|XP_009149524.1|  PREDICTED: L-ascorbate oxidase homolog             671   0.0     
ref|XP_004232058.1|  PREDICTED: L-ascorbate oxidase homolog             669   0.0     
ref|XP_007046384.1|  SKU5 similar 5 isoform 2                           665   0.0     
ref|XP_003517277.1|  PREDICTED: L-ascorbate oxidase homolog             668   0.0     
ref|XP_004170388.1|  PREDICTED: L-ascorbate oxidase homolog             664   0.0     
ref|XP_006390228.1|  hypothetical protein EUTSA_v10018373mg             666   0.0     
ref|XP_010905243.1|  PREDICTED: L-ascorbate oxidase homolog             666   0.0     
ref|XP_003537368.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    666   0.0     
ref|XP_006338228.1|  PREDICTED: L-ascorbate oxidase homolog             665   0.0     
emb|CDP02462.1|  unnamed protein product                                665   0.0     
gb|KHN36198.1|  L-ascorbate oxidase like                                664   0.0     
ref|XP_007156841.1|  hypothetical protein PHAVU_002G021900g             663   0.0     
gb|KHN42054.1|  L-ascorbate oxidase like                                663   0.0     
ref|XP_002448327.1|  hypothetical protein SORBIDRAFT_06g025300          662   0.0     
ref|XP_010908384.1|  PREDICTED: L-ascorbate oxidase homolog             658   0.0     
gb|KEH20500.1|  multi-copper oxidase-like protein                       657   0.0     
ref|XP_007017956.1|  SKU5 similar 5 isoform 2                           653   0.0     
ref|XP_010433262.1|  PREDICTED: L-ascorbate oxidase homolog             656   0.0     
ref|XP_010558427.1|  PREDICTED: L-ascorbate oxidase homolog             655   0.0     
ref|XP_002867467.1|  hypothetical protein ARALYDRAFT_328883             655   0.0     
ref|XP_004511977.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    654   0.0     
ref|XP_009769792.1|  PREDICTED: L-ascorbate oxidase homolog             653   0.0     
ref|XP_002969915.1|  hypothetical protein SELMODRAFT_410532             652   0.0     
ref|XP_010547509.1|  PREDICTED: L-ascorbate oxidase homolog             651   0.0     
ref|XP_010263764.1|  PREDICTED: L-ascorbate oxidase homolog             650   0.0     
ref|XP_009619786.1|  PREDICTED: L-ascorbate oxidase homolog             650   0.0     
ref|XP_004300548.1|  PREDICTED: L-ascorbate oxidase homolog             650   0.0     
ref|XP_007047152.1|  SKU5 similar 17 isoform 1                          649   0.0     
ref|XP_002981392.1|  hypothetical protein SELMODRAFT_178788             649   0.0     
ref|XP_008663511.1|  PREDICTED: L-ascorbate oxidase homolog             649   0.0     
gb|AFK91526.1|  laccase-like protein                                    644   0.0     
ref|XP_006848556.1|  hypothetical protein AMTR_s00169p00049950          646   0.0     
ref|XP_009112343.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0     
gb|KHG25743.1|  L-ascorbate oxidase                                     645   0.0     
emb|CDY18626.1|  BnaA09g07690D                                          645   0.0     
ref|XP_003550083.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0     
ref|NP_194538.1|  SKU5 similar 10 protein                               645   0.0     
ref|XP_008792598.1|  PREDICTED: L-ascorbate oxidase homolog             645   0.0     
ref|XP_007047153.1|  SKU5 similar 17 isoform 2                          645   0.0     
emb|CDX81353.1|  BnaC09g07640D                                          642   0.0     
gb|KHG07318.1|  L-ascorbate oxidase                                     641   0.0     
ref|XP_007155969.1|  hypothetical protein PHAVU_003G247700g             641   0.0     
ref|XP_004509174.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    641   0.0     
ref|XP_004511976.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    642   0.0     
gb|KCW70295.1|  hypothetical protein EUGRSUZ_F03538                     639   0.0     
ref|XP_010109886.1|  L-ascorbate oxidase-like protein                   641   0.0     
gb|EMT20871.1|  L-ascorbate oxidase-like protein                        638   0.0     
ref|XP_009115829.1|  PREDICTED: L-ascorbate oxidase homolog             640   0.0     
ref|XP_010438504.1|  PREDICTED: L-ascorbate oxidase homolog             640   0.0     
ref|XP_010478973.1|  PREDICTED: L-ascorbate oxidase homolog             635   0.0     
gb|EMT08995.1|  L-ascorbate oxidase-like protein                        639   0.0     
emb|CDY43557.1|  BnaC02g16540D                                          638   0.0     
gb|KFK28370.1|  hypothetical protein AALP_AA8G506600                    638   0.0     
ref|XP_006393891.1|  hypothetical protein EUTSA_v10003952mg             638   0.0     
ref|XP_010088984.1|  L-ascorbate oxidase-like protein                   637   0.0     
ref|XP_004509176.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    637   0.0     
ref|XP_009402576.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    632   0.0     
ref|XP_003611825.1|  L-ascorbate oxidase-like protein                   636   0.0     
ref|XP_002268020.2|  PREDICTED: L-ascorbate oxidase homolog             636   0.0     
gb|KEH30610.1|  multi-copper oxidase-like protein                       632   0.0     
ref|XP_009381277.1|  PREDICTED: L-ascorbate oxidase homolog             636   0.0     
ref|XP_010028303.1|  PREDICTED: L-ascorbate oxidase homolog             635   0.0     
gb|EPS57861.1|  hypothetical protein M569_16956                         632   0.0     
emb|CBI18561.3|  unnamed protein product                                637   0.0     
emb|CDY01453.1|  BnaA07g12260D                                          634   0.0     
ref|NP_569041.1|  protein SKU5 similar 17                               634   0.0     
dbj|BAB08634.1|  pectinesterase like protein                            633   0.0     
ref|XP_006393890.1|  hypothetical protein EUTSA_v10003952mg             632   0.0     
ref|XP_010484570.1|  PREDICTED: L-ascorbate oxidase homolog             632   0.0     
ref|XP_006396009.1|  hypothetical protein EUTSA_v10004223mg             627   0.0     
ref|XP_002866726.1|  predicted protein                                  631   0.0     
gb|AAM61328.1|  pectinesterase-like protein                             631   0.0     
ref|XP_009103469.1|  PREDICTED: L-ascorbate oxidase homolog             631   0.0     
ref|XP_006280268.1|  hypothetical protein CARUB_v10026189mg             631   0.0     
gb|KCW55614.1|  hypothetical protein EUGRSUZ_I01478                     627   0.0     
gb|ACN28536.1|  unknown                                                 625   0.0     
ref|XP_002967301.1|  hypothetical protein SELMODRAFT_86988              630   0.0     
ref|XP_010444713.1|  PREDICTED: L-ascorbate oxidase homolog             630   0.0     
ref|XP_002522339.1|  multicopper oxidase, putative                      628   0.0     
ref|XP_002960418.1|  hypothetical protein SELMODRAFT_229918             627   0.0     
gb|ACF85744.1|  unknown                                                 621   0.0     
ref|XP_008241558.1|  PREDICTED: L-ascorbate oxidase homolog             623   0.0     
gb|EMS58962.1|  L-ascorbate oxidase-like protein                        625   0.0     
ref|XP_006285663.1|  hypothetical protein CARUB_v10007118mg             620   0.0     
ref|XP_006435292.1|  hypothetical protein CICLE_v10000783mg             616   0.0     
ref|XP_011099223.1|  PREDICTED: L-ascorbate oxidase homolog             620   0.0     
gb|KDP31875.1|  hypothetical protein JCGZ_12336                         620   0.0     
ref|XP_006850531.1|  hypothetical protein AMTR_s00159p00040990          616   0.0     
ref|XP_006466655.1|  PREDICTED: L-ascorbate oxidase homolog             615   0.0     
ref|XP_009127358.1|  PREDICTED: L-ascorbate oxidase homolog             615   0.0     
ref|XP_007203632.1|  hypothetical protein PRUPE_ppa003976mg             615   0.0     
ref|XP_006425822.1|  hypothetical protein CICLE_v10027285mg             615   0.0     
gb|KDO79346.1|  hypothetical protein CISIN_1g009171mg                   615   0.0     
ref|XP_006838146.1|  hypothetical protein AMTR_s00106p00093220          614   0.0     
ref|XP_010464737.1|  PREDICTED: L-ascorbate oxidase homolog             614   0.0     
ref|XP_006657409.1|  PREDICTED: L-ascorbate oxidase homolog             614   0.0     
ref|XP_004301852.1|  PREDICTED: L-ascorbate oxidase homolog             613   0.0     
gb|EMS52588.1|  L-ascorbate oxidase-like protein                        625   0.0     
ref|XP_007017957.1|  SKU5 similar 5 isoform 3                           608   0.0     
ref|XP_011013815.1|  PREDICTED: L-ascorbate oxidase homolog             610   0.0     
ref|XP_004509178.1|  PREDICTED: L-ascorbate oxidase homolog             609   0.0     
ref|XP_009594575.1|  PREDICTED: L-ascorbate oxidase homolog             609   0.0     
emb|CDY12788.1|  BnaC07g16450D                                          606   0.0     
ref|XP_011039229.1|  PREDICTED: L-ascorbate oxidase homolog             605   0.0     
ref|XP_009765874.1|  PREDICTED: L-ascorbate oxidase homolog             605   0.0     
ref|XP_009348089.1|  PREDICTED: L-ascorbate oxidase homolog             604   0.0     
gb|KEH20499.1|  multi-copper oxidase-like protein                       603   0.0     
ref|XP_010103298.1|  L-ascorbate oxidase-like protein                   606   0.0     
ref|XP_003524640.1|  PREDICTED: L-ascorbate oxidase homolog             601   0.0     
ref|XP_009347247.1|  PREDICTED: L-ascorbate oxidase homolog             602   0.0     
ref|XP_009411781.1|  PREDICTED: L-ascorbate oxidase homolog             602   0.0     
gb|EYU44358.1|  hypothetical protein MIMGU_mgv1a004238mg                602   0.0     
ref|XP_009368021.1|  PREDICTED: L-ascorbate oxidase homolog             600   0.0     
dbj|BAH20248.1|  AT1G41830                                              595   0.0     
ref|XP_002310164.1|  multi-copper oxidase type 1 family protein         598   0.0     
ref|NP_001058771.1|  Os07g0119400                                       598   0.0     
ref|XP_007208285.1|  hypothetical protein PRUPE_ppa003733mg             598   0.0     
ref|XP_004137383.1|  PREDICTED: L-ascorbate oxidase homolog             597   0.0     
ref|XP_004165665.1|  PREDICTED: LOW QUALITY PROTEIN: L-ascorbate ...    595   0.0     
gb|KDO79340.1|  hypothetical protein CISIN_1g0092422mg                  592   0.0     
gb|KHM99211.1|  L-ascorbate oxidase like                                593   0.0     
ref|XP_008438536.1|  PREDICTED: L-ascorbate oxidase homolog             594   0.0     
ref|XP_010044914.1|  PREDICTED: L-ascorbate oxidase homolog             594   0.0     
ref|XP_003550084.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    593   0.0     
ref|XP_004164922.1|  PREDICTED: L-ascorbate oxidase homolog             593   0.0     
emb|CDP02461.1|  unnamed protein product                                592   0.0     
ref|XP_004955371.1|  PREDICTED: L-ascorbate oxidase homolog             590   0.0     
ref|XP_009140476.1|  PREDICTED: L-ascorbate oxidase homolog             590   0.0     
ref|XP_004149634.1|  PREDICTED: L-ascorbate oxidase homolog             590   0.0     
ref|XP_010548381.1|  PREDICTED: L-ascorbate oxidase homolog             588   0.0     
emb|CDX72617.1|  BnaC07g46390D                                          588   0.0     
ref|XP_010680456.1|  PREDICTED: L-ascorbate oxidase homolog             587   0.0     
ref|XP_008789824.1|  PREDICTED: L-ascorbate oxidase homolog isofo...    581   0.0     
ref|XP_009138463.1|  PREDICTED: L-ascorbate oxidase homolog             585   0.0     
emb|CAN72539.1|  hypothetical protein VITISV_028750                     583   0.0     
emb|CDY29530.1|  BnaA06g14400D                                          587   0.0     
ref|XP_008457817.1|  PREDICTED: L-ascorbate oxidase homolog             584   0.0     
ref|XP_009339220.1|  PREDICTED: L-ascorbate oxidase homolog             583   0.0     
ref|XP_008219320.1|  PREDICTED: L-ascorbate oxidase homolog             582   0.0     
emb|CDY42716.1|  BnaA03g53690D                                          581   0.0     
ref|XP_004149637.1|  PREDICTED: L-ascorbate oxidase homolog             582   0.0     
ref|XP_009376274.1|  PREDICTED: L-ascorbate oxidase homolog             581   0.0     
ref|XP_008219429.1|  PREDICTED: L-ascorbate oxidase homolog             580   0.0     
ref|XP_004164925.1|  PREDICTED: L-ascorbate oxidase homolog             580   0.0     
ref|XP_007155970.1|  hypothetical protein PHAVU_003G247800g             580   0.0     
ref|XP_010437285.1|  PREDICTED: L-ascorbate oxidase homolog             579   0.0     
ref|XP_008219577.1|  PREDICTED: L-ascorbate oxidase homolog             579   0.0     
ref|XP_004148037.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0     
ref|XP_009420229.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0     
ref|XP_009412658.1|  PREDICTED: L-ascorbate oxidase homolog             577   0.0     
ref|XP_008219681.1|  PREDICTED: L-ascorbate oxidase homolog             578   0.0     
ref|XP_007208287.1|  hypothetical protein PRUPE_ppa003715mg             577   0.0     
ref|XP_006296162.1|  hypothetical protein CARUB_v10025315mg             576   0.0     
emb|CDX75611.1|  BnaA01g00910D                                          576   0.0     
ref|XP_006445540.1|  hypothetical protein CICLE_v10018007mg             577   0.0     
ref|XP_010034521.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0     
ref|XP_008374029.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0     
ref|XP_003538519.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0     
ref|XP_001777221.1|  predicted protein                                  575   0.0     
ref|XP_010271079.1|  PREDICTED: L-ascorbate oxidase homolog             575   0.0     
ref|XP_002880518.1|  hypothetical protein ARALYDRAFT_320180             575   0.0     
gb|EMT24760.1|  L-ascorbate oxidase-like protein                        574   0.0     



>ref|XP_006348131.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=548

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/522 (85%), Positives = 490/522 (94%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             VY GNPYRYYTWKITYG+IYPLGVKQ+ ILINGQFPGPQIDCVTNDNLII+VYNYL+EPF
Sbjct  27    VYAGNPYRYYTWKITYGNIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPF  86

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNSWQDGVYG+TCPI P KNFTY LQAKDQIGSYFYFPSL MHKAAGGYG
Sbjct  87    LISWNGIQQRRNSWQDGVYGSTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYG  146

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+YSRP IPVPFAPPA DFTVLAGD  KRS+RQL+YILDSGH+LPLPDGL+INGRGWN
Sbjct  147   AIRVYSRPRIPVPFAPPAHDFTVLAGDLYKRSHRQLKYILDSGHDLPLPDGLIINGRGWN  206

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVD G+TYRFRISNVGIATSINFRIQGH +KLVEVEGSHT+Q+T+T+LDIHLGQSY
Sbjct  207   GYTFTVDQGKTYRFRISNVGIATSINFRIQGHTMKLVEVEGSHTLQTTYTSLDIHLGQSY  266

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTA+Q PKDYYVVVSSRFT+RVLTTTAVLHYSNS+T+VSGPPPGGPTTQINWSL+Q 
Sbjct  267   SVLVTANQPPKDYYVVVSSRFTTRVLTTTAVLHYSNSWTKVSGPPPGGPTTQINWSLYQA  326

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+IKP+RTIMLANSAPYINGKQRYAVN VS+ +PDTPL
Sbjct  327   RSIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYAVNSVSYTDPDTPL  386

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+F IGGVFNLGSI D P  G+AY+ T VM AN+RS+VEI+FQNWE+TVQSWHIDGY
Sbjct  387   KLADHFNIGGVFNLGSISDQPYNGNAYIGTPVMSANFRSYVEIIFQNWENTVQSWHIDGY  446

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT +SR  YNLRDT+ARCTVQVYP+SWTAIYMALDNVGMWNIRSE+W+R
Sbjct  447   SFFVVGMDGGQWTPSSRAHYNLRDTIARCTVQVYPKSWTAIYMALDNVGMWNIRSENWSR  506

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             +YLGQQFYLRVY+  NS+RDELPIPKNA+LCG+ARG  TRPL
Sbjct  507   RYLGQQFYLRVYSPANSWRDELPIPKNAILCGKARGHRTRPL  548



>ref|XP_004232701.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=548

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/522 (85%), Positives = 489/522 (94%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             +Y  NPYRYYTWKITYGDIYPLGVKQ+ ILINGQFPGPQIDCVTNDNLII+VYNYL+EPF
Sbjct  27    IYADNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLSEPF  86

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNSWQDGVYGTTCPI P KNFTY LQAKDQIGSYFYFPSL MHKAAGGYG
Sbjct  87    LISWNGIQQRRNSWQDGVYGTTCPILPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYG  146

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+YSRP IPVPFAPPA DFTVLAGD  KRS+RQL+YILDSGH+LPLPDGL+INGRGWN
Sbjct  147   AIRVYSRPRIPVPFAPPAHDFTVLAGDLYKRSHRQLKYILDSGHDLPLPDGLIINGRGWN  206

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVD G+TYRFRISNVGIATSINFRIQGH +KLVEVEGSHT+Q+T+T+LDIHLGQSY
Sbjct  207   GYTFTVDQGKTYRFRISNVGIATSINFRIQGHTMKLVEVEGSHTLQTTYTSLDIHLGQSY  266

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTA+Q PKDYY+VVSSRFT+RVLTTTAVLHYSNS+T+VSGPPPGGPTTQINWSL+Q 
Sbjct  267   SVLVTANQPPKDYYIVVSSRFTTRVLTTTAVLHYSNSWTKVSGPPPGGPTTQINWSLYQA  326

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+IKP+RTIMLANSAPYINGKQRYAVN VS+ +PDTPL
Sbjct  327   RSIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYAVNSVSYTDPDTPL  386

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+F IGGVFNLGSI D P  G+AY+ T VM AN+RS+VEI+FQNWE+TVQSWHIDGY
Sbjct  387   KLADHFNIGGVFNLGSISDQPYNGNAYIGTPVMAANFRSYVEIIFQNWENTVQSWHIDGY  446

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT A+R  YNLRDT+ARCTVQVYP+SWTAIYMALDNVGMWNIRSE+W+R
Sbjct  447   SFFVVGMDGGQWTPANRAHYNLRDTIARCTVQVYPKSWTAIYMALDNVGMWNIRSENWSR  506

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             +YLGQQFYLRVY+  NS+RDELPIPKNA+LCG+ARG  TRPL
Sbjct  507   RYLGQQFYLRVYSPANSWRDELPIPKNAILCGKARGHRTRPL  548



>ref|XP_011096053.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=541

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/545 (81%), Positives = 503/545 (92%), Gaps = 4/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MR+++S+ +++  +L+L    + V G NPYR+YTWK+TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MRDFTSLITVLSLLLVL----HAVNGDNPYRFYTWKVTYGDIYPLGVKQQGILINGQFPG  56

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             P IDCVTNDNLII+VYNYLNEPFL+SWNGLQQRRNSWQDG++GT+CPIPP KNFTY LQA
Sbjct  57    PTIDCVTNDNLIISVYNYLNEPFLISWNGLQQRRNSWQDGMFGTSCPIPPGKNFTYALQA  116

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIG+YFYFPSL +HKAAGGYG+I++YSRP IPVP+  PA D  VLAGDW KRS+RQL+
Sbjct  117   KDQIGTYFYFPSLALHKAAGGYGSIKVYSRPRIPVPYPTPAGDHVVLAGDWFKRSHRQLK  176

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
             Y LD GHNLP PDGL+INGRGWNGYTF VD G+TYRFRISNVG+ATSINFRIQGH +KL+
Sbjct  177   YFLDGGHNLPFPDGLIINGRGWNGYTFNVDQGKTYRFRISNVGLATSINFRIQGHTMKLI  236

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+T+++LD+HLGQSYSVLVTA+Q  KDYYVVVSSRFTS+VLTTTAVLHY NS
Sbjct  237   EVEGSHTLQTTYSSLDVHLGQSYSVLVTANQPAKDYYVVVSSRFTSKVLTTTAVLHYRNS  296

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             F +VSG PPGGPTT+I+WSL Q RS+R NL+ASGPRPNPQGSYHYG+IKPARTI+LANSA
Sbjct  297   FAKVSGYPPGGPTTEIDWSLNQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIILANSA  356

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             PYINGKQRYAVNGVS+V+PDTPLKLADYF IGGVF++GSIPD P WG+ YLATSVM A+Y
Sbjct  357   PYINGKQRYAVNGVSYVSPDTPLKLADYFNIGGVFSVGSIPDRPNWGNGYLATSVMHADY  416

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             RSFVEIVFQNWE+TVQSWHIDGYSFFVVGMDGGQWT+ASR+RYNLRDTVARCTVQVYP+S
Sbjct  417   RSFVEIVFQNWENTVQSWHIDGYSFFVVGMDGGQWTQASRSRYNLRDTVARCTVQVYPKS  476

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIY+ALDNVGMWNIRSEDWARQYLGQQFYLRVYTS+ S+RDELPIP+NALLCGRARGR
Sbjct  477   WTAIYIALDNVGMWNIRSEDWARQYLGQQFYLRVYTSSKSWRDELPIPRNALLCGRARGR  536

Query  1790  HTRPL  1804
             HTRPL
Sbjct  537   HTRPL  541



>ref|XP_009782819.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=544

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/522 (86%), Positives = 487/522 (93%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             VY  NPYRYYTWKITYGDIYPLGVKQ+ ILINGQFPGPQIDCVTNDNLII+VYNYLNEPF
Sbjct  23    VYCDNPYRYYTWKITYGDIYPLGVKQQGILINGQFPGPQIDCVTNDNLIISVYNYLNEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNGLQQRRNSWQDGVYGTTCPIPP KNFTY LQAKDQIGSYFYFPSL MHKAAGGYG
Sbjct  83    LISWNGLQQRRNSWQDGVYGTTCPIPPGKNFTYTLQAKDQIGSYFYFPSLAMHKAAGGYG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+YSRP IPVPF PPA DFTVLAGD  KRS+RQL+YILDSGHNLPLPDGL+INGRGWN
Sbjct  143   AIRVYSRPRIPVPFPPPAHDFTVLAGDLYKRSHRQLKYILDSGHNLPLPDGLIINGRGWN  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVD G+TYRFRISNVGIATSINFRIQGH +KLVEVEGSHT+Q+++T+LDIHLGQSY
Sbjct  203   GYTFTVDQGKTYRFRISNVGIATSINFRIQGHTMKLVEVEGSHTLQTSYTSLDIHLGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTA+Q P DYYVVVSSRFT RVLTTTAVLHYSNS+T+VSGP PGGPTTQINWS++Q 
Sbjct  263   SVLVTANQPPNDYYVVVSSRFTRRVLTTTAVLHYSNSWTKVSGPVPGGPTTQINWSIYQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+IKP+RTI+LANSAPYINGKQRYAVN VS+V+PDTPL
Sbjct  323   RSIRWNLTASGPRPNPQGSYHYGLIKPSRTIILANSAPYINGKQRYAVNSVSYVDPDTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVFNLG I D P  G+ YL T VM AN+RS+VEIVFQNWE++VQSWHIDGY
Sbjct  383   KLADYFKIGGVFNLGGISDQPYNGNGYLGTPVMAANFRSYVEIVFQNWENSVQSWHIDGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGM+GGQWT ASR+ YNLRDTVARCT QVYP+SWTAIYMALDNVGMWNIRSEDW+R
Sbjct  443   SFFVVGMNGGQWTPASRSHYNLRDTVARCTTQVYPKSWTAIYMALDNVGMWNIRSEDWSR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             +YLGQQFYLRVY+ +NS+RDELPIPKNALLCGRAR  HTRPL
Sbjct  503   RYLGQQFYLRVYSPSNSWRDELPIPKNALLCGRARHHHTRPL  544



>ref|XP_009629876.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/545 (84%), Positives = 501/545 (92%), Gaps = 1/545 (0%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MRE S+V S IL +L+L      VY  NPYRYYTWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MREKSNVHSAILTILVLLTLQR-VYCDNPYRYYTWKITYGDIYPLGVKQQGILINGQFPG  59

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQIDCVTNDNLII+VYNYLNEPFL+SWNGLQQRRNSWQ+GVYGTTCPIPP KNFTY LQA
Sbjct  60    PQIDCVTNDNLIISVYNYLNEPFLISWNGLQQRRNSWQNGVYGTTCPIPPGKNFTYTLQA  119

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL MHKAAGGYGAIR+YSRP IPVPF PPA DFTVLAGD  KRS+RQL+
Sbjct  120   KDQIGSYFYFPSLAMHKAAGGYGAIRVYSRPRIPVPFPPPAHDFTVLAGDLYKRSHRQLK  179

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
             YILDSGHNLPLPDGL+INGRGWNGYTFTVD G+TYRFRISNVG ATSINFRIQGH +KLV
Sbjct  180   YILDSGHNLPLPDGLIINGRGWNGYTFTVDQGKTYRFRISNVGTATSINFRIQGHTMKLV  239

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+T+T+LDIHLGQSYSVLVTA+Q PKDYYVVVSSRFT RVLTTTAVLHYSNS
Sbjct  240   EVEGSHTLQTTYTSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTRRVLTTTAVLHYSNS  299

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             +T+VSGP PGGPTTQINWS++Q RS+R NL+ASGPRPNPQGSYHYG+IKP+RTI+LANSA
Sbjct  300   WTQVSGPVPGGPTTQINWSIYQARSIRWNLTASGPRPNPQGSYHYGLIKPSRTIILANSA  359

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             PYINGKQRYAVN VS+V+PDTPLKLADYFKIGGVFNLGSI D P  G+ YL T VM AN+
Sbjct  360   PYINGKQRYAVNSVSYVDPDTPLKLADYFKIGGVFNLGSISDQPYNGNGYLGTPVMAANF  419

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             RS+VEIVFQNWE++VQSWHIDGYSFFVVGM+GGQWT ASR+ YNLRDTVARCT QVYP+S
Sbjct  420   RSYVEIVFQNWENSVQSWHIDGYSFFVVGMNGGQWTPASRSHYNLRDTVARCTTQVYPKS  479

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIYMALDNVGMWNIRSEDW+R+YLGQQFYLRVY+S+NS+RDELPIPKNALLCGRAR  
Sbjct  480   WTAIYMALDNVGMWNIRSEDWSRRYLGQQFYLRVYSSSNSWRDELPIPKNALLCGRARHH  539

Query  1790  HTRPL  1804
              TRPL
Sbjct  540   RTRPL  544



>gb|KDP20733.1| hypothetical protein JCGZ_21204 [Jatropha curcas]
Length=541

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/524 (82%), Positives = 480/524 (92%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             +GV G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINV+NYL E
Sbjct  18    HGVNGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVFNYLRE  77

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQRRNSWQDGVYGT CPI P +NFTY+LQ KDQIGS+FYFPSL MHKAAGG
Sbjct  78    PFLISWNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSFFYFPSLGMHKAAGG  137

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G+IRI+SRPLIPVPF  PA DFTVLAGDW KR++  L  ILD+GH+LP PDGLLINGRG
Sbjct  138   FGSIRIWSRPLIPVPFPTPAGDFTVLAGDWYKRNHYLLRRILDAGHDLPFPDGLLINGRG  197

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTVDPG+TYRFRISNVG+ATSINFRIQGHK+KLVEVEGSHT+Q+T+++LDIHLGQ
Sbjct  198   WNGYTFTVDPGKTYRFRISNVGLATSINFRIQGHKMKLVEVEGSHTLQNTYSDLDIHLGQ  257

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTADQQPKDYY+VVS+RFT RVL TTA+LHYSNS++RV+GP P GPTTQI+WSL 
Sbjct  258   SYSVLVTADQQPKDYYIVVSTRFTPRVLATTAILHYSNSWSRVAGPIPRGPTTQIDWSLN  317

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+RRNL+ASGPRPNPQGSYHYGMIK +RTIMLANSAP+IN KQR+AVN VSF+  DT
Sbjct  318   QARSIRRNLTASGPRPNPQGSYHYGMIKTSRTIMLANSAPFINRKQRFAVNSVSFIPSDT  377

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYFKI GVFNL SIP SP WG+ YL TSVM AN+R F+EIVFQNWEDTVQSWHID
Sbjct  378   PLKLADYFKIPGVFNLESIPTSPTWGNPYLQTSVMSANFREFIEIVFQNWEDTVQSWHID  437

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             G+SFFVVGMDGGQWT ASR  YNLRD VARCT QVYPRSWTA+YMALDNVGMWNIRSE+W
Sbjct  438   GHSFFVVGMDGGQWTPASRVGYNLRDAVARCTTQVYPRSWTAVYMALDNVGMWNIRSENW  497

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVYT +NS+RDELPIP+NALLCGRARGRHTRPL
Sbjct  498   ARQYLGQQFYLRVYTPSNSWRDELPIPRNALLCGRARGRHTRPL  541



>gb|EPS74059.1| hypothetical protein M569_00695 [Genlisea aurea]
Length=541

 Score =   900 bits (2327),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/522 (80%), Positives = 478/522 (92%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
              +G NPYR++ W ++YGDIYPLGVKQ+ ILINGQFPGP I CVTNDNLIINV+N LNEPF
Sbjct  20    AFGDNPYRFFYWNVSYGDIYPLGVKQQGILINGQFPGPSISCVTNDNLIINVFNSLNEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNGLQQRRNSWQDGV+GTTCPIPP KNFTY LQAKDQIG+YFYFPSL +HK+AGGYG
Sbjct  80    LISWNGLQQRRNSWQDGVFGTTCPIPPGKNFTYALQAKDQIGTYFYFPSLGLHKSAGGYG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             +I+IYSRP IPVP+  P  D  VLAGDW KR +RQL+YILD G +LP PDG++INGRGWN
Sbjct  140   SIKIYSRPKIPVPYPTPDGDHVVLAGDWFKREHRQLKYILDGGRDLPFPDGIIINGRGWN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY+FTV  G+TYRFRISNVG+ TSINFRIQGH +KLVEVEGSHTVQ+T+++LD+HLGQSY
Sbjct  200   GYSFTVQQGKTYRFRISNVGLTTSINFRIQGHTMKLVEVEGSHTVQNTYSSLDVHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ PKDYYV VSSRFT+++LTTTAVLHY NS  +VSGPPPGGPT +++WSL Q 
Sbjct  260   SVLVTADQPPKDYYVAVSSRFTAKILTTTAVLHYQNSLAQVSGPPPGGPTVEVDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RSLR NL+ASGPRPNPQGSYHYG+IKPARTI+LANSAPYI+GK R+AVNGVS+V+PDTPL
Sbjct  320   RSLRWNLTASGPRPNPQGSYHYGLIKPARTIILANSAPYIDGKLRFAVNGVSYVSPDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVF++GSI +SP WG+AYL+TSVM+A++RSFVEIVFQNWED++QSWHIDGY
Sbjct  380   KLADYFKISGVFSVGSISESPNWGNAYLSTSVMNADFRSFVEIVFQNWEDSLQSWHIDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT+ASR RYNLRDTVARCTVQVYP+SWTAIYMALDNVGMWNIRSE+WAR
Sbjct  440   SFFVVGMDGGQWTQASRLRYNLRDTVARCTVQVYPKSWTAIYMALDNVGMWNIRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT + S+RDELPIP+NALLCGRARGR TRPL
Sbjct  500   QYLGQQFYLRVYTPSTSFRDELPIPRNALLCGRARGRRTRPL  541



>ref|XP_004145114.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004153223.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004158002.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=542

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/545 (80%), Positives = 482/545 (88%), Gaps = 3/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MREY  +CSLI+ VL      N V   NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MREYRVLCSLIILVLFAV---NEVNADNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPG  57

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQID VTNDNLIINVYNYL EPFL+SWNGLQQRRNSWQDGVYGTTC IPP +NFTY LQA
Sbjct  58    PQIDAVTNDNLIINVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQA  117

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPS   HKAAG +G IRI+SRP IPVPFAPPA DFTVLAGDW K ++  + 
Sbjct  118   KDQIGSYFYFPSTAFHKAAGAFGGIRIWSRPGIPVPFAPPAGDFTVLAGDWYKTNHYIMR  177

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              +LDSG N+P PDGLLINGRGWNGYTF VDPG+TYRFRISNVGI+ SINFRIQGH +KLV
Sbjct  178   QVLDSGKNIPSPDGLLINGRGWNGYTFNVDPGKTYRFRISNVGISASINFRIQGHLMKLV  237

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+T+++LDIHLGQSYSVLVTA+Q PKDYYVVVSSRFTS +LTTTAVLHYSNS
Sbjct  238   EVEGSHTLQNTYSSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTSPILTTTAVLHYSNS  297

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             + +VSGP PGGPTT+I WSL Q RS+R NL+ASGPRPNPQGSYHYG+IK +RTI+LANSA
Sbjct  298   WQKVSGPVPGGPTTEIAWSLQQARSIRWNLTASGPRPNPQGSYHYGLIKTSRTIVLANSA  357

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQR+AVN VSFV  DTPLKLADYFKI GVFNL +IP +P WG+AYL TSVM +N+
Sbjct  358   PVINGKQRFAVNSVSFVQADTPLKLADYFKIPGVFNLNNIPTNPTWGNAYLQTSVMGSNF  417

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R ++EIVFQNWE+TVQSWHI GYSFFVVGMDGGQWT ASR+RYNLRDTVARCT QVYP+S
Sbjct  418   REYIEIVFQNWENTVQSWHISGYSFFVVGMDGGQWTPASRSRYNLRDTVARCTTQVYPKS  477

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIYMALDNVGMWN+RSE WARQYLGQQFYLRVYTS+ S+RDELPIP+NALLCGRA GR
Sbjct  478   WTAIYMALDNVGMWNVRSESWARQYLGQQFYLRVYTSSTSFRDELPIPRNALLCGRASGR  537

Query  1790  HTRPL  1804
             HTRPL
Sbjct  538   HTRPL  542



>gb|EYU27771.1| hypothetical protein MIMGU_mgv1a003982mg [Erythranthe guttata]
Length=551

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/520 (83%), Positives = 480/520 (92%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G NPYRYYTW+ITYGDIYPLGVKQ+ ILINGQFPGP IDCVTNDNLII+VYNYLNEPFLL
Sbjct  32    GDNPYRYYTWRITYGDIYPLGVKQQGILINGQFPGPTIDCVTNDNLIISVYNYLNEPFLL  91

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP KNFTY +QAKDQIG+YFYFPSL +HKAAGGYG+I
Sbjct  92    SWNGIQQRRNSWQDGVYGTNCPIPPGKNFTYAIQAKDQIGTYFYFPSLALHKAAGGYGSI  151

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             ++YSRP IPVPF PPA D+ VL GDW KRS+RQL+YILDSGHNLP PDGL+INGRGWNGY
Sbjct  152   KVYSRPQIPVPFPPPAGDYVVLTGDWFKRSHRQLKYILDSGHNLPSPDGLIINGRGWNGY  211

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTV+PG+TYRFRISNVG+ TS+NFRI+GH +KL+EVEGSHTVQ+T+T+LD+H+GQSYSV
Sbjct  212   TFTVEPGKTYRFRISNVGLTTSVNFRIEGHSMKLIEVEGSHTVQNTYTSLDVHVGQSYSV  271

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LV A+Q  KDYYVVVSSRFTS VLTTTA+LHY NSFT+VSG PPGGPTTQI+WS+ Q RS
Sbjct  272   LVEANQPSKDYYVVVSSRFTSPVLTTTAILHYRNSFTKVSGFPPGGPTTQIDWSINQARS  331

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +RRNL+ASGPRPNPQGSYHYG IKPARTI+LANSAP INGK RYAVN VS+V+PDTPLKL
Sbjct  332   IRRNLTASGPRPNPQGSYHYGEIKPARTIILANSAPNINGKLRYAVNSVSYVSPDTPLKL  391

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
              DYFKIGGV++LGSI D P +G+ YLATSVM+ANYRSF+E+VFQNWE+T+QSWHIDGYSF
Sbjct  392   VDYFKIGGVYSLGSISDKPNYGNGYLATSVMNANYRSFIEVVFQNWENTLQSWHIDGYSF  451

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGG WT+ASR RYNLRDTVARCTVQVYP+SWTAIY+ALDNVGMWNIRSEDWARQY
Sbjct  452   FVVGMDGGGWTQASRLRYNLRDTVARCTVQVYPKSWTAIYVALDNVGMWNIRSEDWARQY  511

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVYT + S+RDELPIP+NALLCGRARG  TRP 
Sbjct  512   LGQQFYLRVYTPSTSFRDELPIPRNALLCGRARGHRTRPF  551



>ref|XP_008440923.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34061.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=542

 Score =   892 bits (2306),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/545 (79%), Positives = 479/545 (88%), Gaps = 3/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MREY  +CSLI+ VL      N     NPYR++TWK+TYG+IYPLGV+Q+ ILINGQFPG
Sbjct  1     MREYRVLCSLIILVLFAVNEANA---DNPYRFFTWKVTYGNIYPLGVRQQGILINGQFPG  57

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQID VTNDNLIINVYNYL EPFL+SWNGLQQRRNSWQDGVYGTTC IPP +NFTY LQA
Sbjct  58    PQIDAVTNDNLIINVYNYLKEPFLISWNGLQQRRNSWQDGVYGTTCAIPPMRNFTYTLQA  117

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPS   HKAAG +G IRI+SRP IPVPF  PA DFTVLAGDW K ++  L 
Sbjct  118   KDQIGSYFYFPSTAFHKAAGAFGGIRIWSRPGIPVPFPSPAGDFTVLAGDWYKTNHYILR  177

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              +LDSG NLP PDGLLINGRGWNGYTF VDPG+TYRFRISNVGI+ SINFRIQGH +KLV
Sbjct  178   RVLDSGKNLPSPDGLLINGRGWNGYTFNVDPGKTYRFRISNVGISASINFRIQGHLMKLV  237

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+T+++LDIHLGQSYSVLVTA+Q PKDYYVVVSSRFTS +LTTTAVLHYSNS
Sbjct  238   EVEGSHTLQNTYSSLDIHLGQSYSVLVTANQPPKDYYVVVSSRFTSPILTTTAVLHYSNS  297

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             + +VSGP PGGPTT+I WSL Q RS+R NL+ASGPRPNPQGSYHYG+IK +RTI+LANSA
Sbjct  298   WQKVSGPVPGGPTTEIAWSLQQARSIRWNLTASGPRPNPQGSYHYGLIKTSRTIVLANSA  357

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQR+AVNGVSFV  DTPLKLADYFKI GVFNL SIP +P WG+AYL TSVM +N+
Sbjct  358   PVINGKQRFAVNGVSFVQADTPLKLADYFKIPGVFNLNSIPTNPTWGNAYLQTSVMGSNF  417

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R ++EIVFQNWE+TVQSWHI GYSFFVVGMDGGQWT ASR RYNLRDTVARCT QVYP++
Sbjct  418   REYIEIVFQNWENTVQSWHISGYSFFVVGMDGGQWTPASRGRYNLRDTVARCTTQVYPKA  477

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIYMALDNVGMWN+RSE WARQYLGQQFYLRVYTS+ S+RDELPIP+NALLCGRA GR
Sbjct  478   WTAIYMALDNVGMWNVRSESWARQYLGQQFYLRVYTSSTSFRDELPIPRNALLCGRASGR  537

Query  1790  HTRPL  1804
             HTRPL
Sbjct  538   HTRPL  542



>emb|CDP04415.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   892 bits (2305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/545 (80%), Positives = 489/545 (90%), Gaps = 0/545 (0%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MR+   +CSLI + ++L   LNG Y  NPYR+YTWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MRDCKILCSLITSCILLVSVLNGAYADNPYRFYTWKITYGDIYPLGVKQQGILINGQFPG  60

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             P IDCVTNDNLII+VYNYLNEPFL+SWNG+Q R+NSWQDGV GTTCPIPP KNFTY+LQA
Sbjct  61    PHIDCVTNDNLIISVYNYLNEPFLISWNGIQHRKNSWQDGVQGTTCPIPPGKNFTYILQA  120

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIG+YFYFPSL +HKAAGG+G+I+IYSRP IPVPF PPA DF VLAGDW K+S+RQL 
Sbjct  121   KDQIGTYFYFPSLGLHKAAGGFGSIKIYSRPQIPVPFPPPAGDFIVLAGDWFKKSHRQLR  180

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
             YILDSGH+LP PDGLLINGRGWNGYTFTV+ G+TYRFRISNVGIATSINFRIQGH +KLV
Sbjct  181   YILDSGHSLPFPDGLLINGRGWNGYTFTVEQGKTYRFRISNVGIATSINFRIQGHSMKLV  240

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+ +T+LDIHLGQS SVLVTA+Q  +DYY+VVSSRFTS VLTTTAVLHY NS
Sbjct  241   EVEGSHTLQNYYTSLDIHLGQSCSVLVTANQPARDYYIVVSSRFTSHVLTTTAVLHYKNS  300

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             FTRVSGPPPGGPT  I  SL Q RS+R NL+AS PRPNPQGSYHYG+IKP+RTI+LANSA
Sbjct  301   FTRVSGPPPGGPTIDIASSLSQARSIRWNLTASAPRPNPQGSYHYGLIKPSRTIILANSA  360

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             PYINGK RYAVN VS+V  DTP KLADYFKIGGVFNLGS+PD P WG+AY AT+VM A+Y
Sbjct  361   PYINGKLRYAVNSVSYVPADTPPKLADYFKIGGVFNLGSMPDKPSWGNAYFATAVMHADY  420

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R+F+EIVFQNWE+TVQSWHIDG++FFVVGMDGGQWT ASR++YNLRDTV+RCT QVYPRS
Sbjct  421   RAFIEIVFQNWENTVQSWHIDGFNFFVVGMDGGQWTPASRSKYNLRDTVSRCTTQVYPRS  480

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIY+ALDNVGMWNIRSE+W RQYLGQQFYLRVYT +NS RDE PIP+NALLCGRA GR
Sbjct  481   WTAIYLALDNVGMWNIRSENWERQYLGQQFYLRVYTPSNSLRDEYPIPRNALLCGRASGR  540

Query  1790  HTRPL  1804
             HTRPL
Sbjct  541   HTRPL  545



>ref|XP_006449754.1| hypothetical protein CICLE_v10014825mg [Citrus clementina]
 gb|ESR62994.1| hypothetical protein CICLE_v10014825mg [Citrus clementina]
Length=543

 Score =   886 bits (2289),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/524 (83%), Positives = 473/524 (90%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGVYG +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYL E
Sbjct  20    NGVYGDSPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLRE  79

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNGLQQRRNSWQDGVYGTTCPIPP KNFTY+LQAKDQIGSYFYFPS   HKAAG 
Sbjct  80    PFLISWNGLQQRRNSWQDGVYGTTCPIPPGKNFTYVLQAKDQIGSYFYFPSFLFHKAAGA  139

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI+SRP IPVPF PPA DFTVLAGDW + ++  L  +LDSGHNLP PDGLLINGRG
Sbjct  140   FGGIRIWSRPRIPVPFPPPAGDFTVLAGDWYRSNHYVLRRLLDSGHNLPFPDGLLINGRG  199

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTV+PGRTYRFRISNVG+ TSINFRIQGH +KLVEVEGSHT+Q+T+  LDIHLGQ
Sbjct  200   WNGYTFTVEPGRTYRFRISNVGLTTSINFRIQGHSMKLVEVEGSHTLQNTYAALDIHLGQ  259

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             +YSVLVT DQ P+DYY+VVSSRFT RVLTTTA+LHYSNS   VSGP PGGPTT+I WSL 
Sbjct  260   TYSVLVTMDQAPQDYYIVVSSRFTPRVLTTTAILHYSNSRRGVSGPIPGGPTTEIAWSLN  319

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NL+ASGPRPNPQGSYHYGMIK +RTI LANSAPY+NGKQRYA+NGVSFV  DT
Sbjct  320   QARSIRWNLTASGPRPNPQGSYHYGMIKISRTITLANSAPYMNGKQRYAINGVSFVPADT  379

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYFKI GVF LGS+P SP WG+AYL TSVM +N+R FVEIVFQNWEDTVQS+HID
Sbjct  380   PLKLADYFKIPGVFTLGSMPTSPNWGNAYLQTSVMASNFREFVEIVFQNWEDTVQSYHID  439

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSFFVVGMDGGQWT ASRTRYNLRDTVAR T QVYPRSWTAIYMALDNVGMWNIRSE+W
Sbjct  440   GYSFFVVGMDGGQWTPASRTRYNLRDTVARSTTQVYPRSWTAIYMALDNVGMWNIRSENW  499

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  NS+RDELPIPKNALLCGRARGRHTRPL
Sbjct  500   ARQYLGQQFYLRVYSPANSWRDELPIPKNALLCGRARGRHTRPL  543



>ref|XP_006383902.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|ERP61699.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=544

 Score =   885 bits (2288),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/525 (81%), Positives = 468/525 (89%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N V   +PYR+ TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTN+NLII+VYNYL E
Sbjct  20    NDVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLRE  79

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQRRNSWQDGVYGT+CPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAG 
Sbjct  80    PFLISWNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGA  139

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI+SRP IPVPF  PA DFTVLAGDW KR++ QL  +LD GHNLP PDGLLINGRG
Sbjct  140   FGGIRIWSRPRIPVPFPAPAGDFTVLAGDWYKRNHYQLRRVLDGGHNLPFPDGLLINGRG  199

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTVDPG+TYRFRISNVG+ TSINFRIQGHK+KLVEVEGSHT+Q+T+++LDIHLGQ
Sbjct  200   WNGYTFTVDPGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNTYSDLDIHLGQ  259

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTADQ  KDYY+VVSSRFT  VL TTAVLHYSNS+ RVSGP PGGPTTQI+WSL 
Sbjct  260   SYSVLVTADQPAKDYYIVVSSRFTKPVLATTAVLHYSNSWQRVSGPIPGGPTTQIDWSLN  319

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS R NL+ASGPRPNPQGSYHYG+IK +RTI LANS P IN KQRYAVNGVS++  DT
Sbjct  320   QARSFRWNLTASGPRPNPQGSYHYGLIKTSRTITLANSGPIINRKQRYAVNGVSYIPADT  379

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLK+ADYF I GVF+LGS+P SP WG +AYL T+VM AN+R F+EIVFQNWEDTVQSWHI
Sbjct  380   PLKIADYFNIPGVFSLGSMPSSPSWGNNAYLQTAVMSANFREFIEIVFQNWEDTVQSWHI  439

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DG+SFFVVGMDGGQWT ASR RYNLRDTVARCT QVYP+SWTAIYMALDNVGMWNIRSE+
Sbjct  440   DGHSFFVVGMDGGQWTPASRARYNLRDTVARCTTQVYPKSWTAIYMALDNVGMWNIRSEN  499

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVY+  +S+RDELPIPKNALLCGRARGRHTRPL
Sbjct  500   WARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARGRHTRPL  544



>ref|XP_006467415.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO78277.1| hypothetical protein CISIN_1g009127mg [Citrus sinensis]
Length=543

 Score =   884 bits (2284),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/524 (83%), Positives = 472/524 (90%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             +GVYG +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYL E
Sbjct  20    HGVYGDSPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLRE  79

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNGLQQRRNSWQDGVYGTTCPIPP KNFTY+LQAKDQIGSYFYFPS   HKAAG 
Sbjct  80    PFLISWNGLQQRRNSWQDGVYGTTCPIPPGKNFTYVLQAKDQIGSYFYFPSFLFHKAAGA  139

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI+SRP IPVPF PPA DFTVLAGDW + ++  L  +LDSGHNLP PDGLLINGRG
Sbjct  140   FGGIRIWSRPRIPVPFPPPAGDFTVLAGDWYRSNHYVLRRLLDSGHNLPFPDGLLINGRG  199

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTV+PGRTYRFRISNVG+ TSINFRIQGH +KLVEVEGSHT+Q+T+  LDIHLGQ
Sbjct  200   WNGYTFTVEPGRTYRFRISNVGLTTSINFRIQGHSMKLVEVEGSHTLQNTYAALDIHLGQ  259

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             +YSVLVT DQ P+DYY+VVSSRFT RVLTTTA+LHYSNS   VSGP PGGPTT+I WSL 
Sbjct  260   TYSVLVTMDQAPQDYYIVVSSRFTPRVLTTTAILHYSNSRRGVSGPIPGGPTTEIAWSLN  319

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NL+ASGPRPNPQGSYHYGMIK +RTI LANSAPY+NGKQRYA+N VSFV  DT
Sbjct  320   QARSIRWNLTASGPRPNPQGSYHYGMIKISRTITLANSAPYMNGKQRYAINSVSFVPADT  379

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYFKI GVF LGS+P SP WG+AYL TSVM AN+R FVEIVFQNWEDTVQS+HID
Sbjct  380   PLKLADYFKIPGVFTLGSMPTSPNWGNAYLQTSVMAANFREFVEIVFQNWEDTVQSYHID  439

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSFFVVGMDGGQWT ASRTRYNLRDTVAR T QVYPRSWTAIYMALDNVGMWNIRSE+W
Sbjct  440   GYSFFVVGMDGGQWTPASRTRYNLRDTVARSTTQVYPRSWTAIYMALDNVGMWNIRSENW  499

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  NS+RDELPIPKNALLCGRARGRHTRPL
Sbjct  500   ARQYLGQQFYLRVYSPANSWRDELPIPKNALLCGRARGRHTRPL  543



>ref|XP_002518462.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF43849.1| multicopper oxidase, putative [Ricinus communis]
Length=541

 Score =   877 bits (2265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/522 (81%), Positives = 472/522 (90%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINV+NYL EPF
Sbjct  20    VNGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDVVTNDNLIINVFNYLREPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNSWQDGVYGT CPI P +NFTY+LQ KDQIGSYFYFPSL MHKAAGG+G
Sbjct  80    LISWNGIQQRRNSWQDGVYGTNCPILPGRNFTYILQVKDQIGSYFYFPSLGMHKAAGGFG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR++SRP IPVPF PP+ DFTVLAGDW KR++ QL  ILD+GH+LP PDGLLINGRGWN
Sbjct  140   GIRVWSRPRIPVPFPPPSGDFTVLAGDWYKRNHYQLRRILDAGHDLPFPDGLLINGRGWN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVDP +TYRFRISNVG++TSINFRIQGHK+KLVEVEGSHT+Q+T++ LDIHLGQSY
Sbjct  200   GYTFTVDPVKTYRFRISNVGLSTSINFRIQGHKMKLVEVEGSHTLQNTYSALDIHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  KDYY+VVS+RFT+RVLTTTA+LHYSNS   VSGP PGGPTTQI+WSL Q 
Sbjct  260   SVLVTADQPAKDYYIVVSTRFTARVLTTTAILHYSNSRDGVSGPIPGGPTTQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RSLR NL+ASGPRPNPQGSYHYG+IK +RTI LANSAP IN KQR+AVN VSF+ PDTPL
Sbjct  320   RSLRWNLTASGPRPNPQGSYHYGLIKTSRTITLANSAPLINRKQRFAVNSVSFIPPDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVFNLGSIP  P WG+AYL TSVM AN+R F+EI+FQNWED+VQSWHIDG+
Sbjct  380   KLADYFKIPGVFNLGSIPSYPTWGNAYLQTSVMSANFREFIEIIFQNWEDSVQSWHIDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT ASR RYNLRD VARCT QVYP+SWTA+YMALDNVGMWNIRSE+WAR
Sbjct  440   SFFVVGMDGGQWTTASRARYNLRDAVARCTTQVYPKSWTAVYMALDNVGMWNIRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRVY+  NS+RDELPIP+NALLCGRARGRHTRPL
Sbjct  500   QYLGQQLYLRVYSPANSWRDELPIPRNALLCGRARGRHTRPL  541



>ref|XP_011046956.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=543

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/524 (82%), Positives = 470/524 (90%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV   +PYR+ TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTN+NLII+VYNYL E
Sbjct  20    NGVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLRE  79

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQRRNSWQDGVYGT CPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAG 
Sbjct  80    PFLISWNGIQQRRNSWQDGVYGTNCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGA  139

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI+SRP IPVPF PPA DFTVLAGDW KR++ QL  ILD GHNLP PDGLLINGRG
Sbjct  140   FGGIRIWSRPRIPVPFPPPAGDFTVLAGDWYKRNHYQLRRILDGGHNLPFPDGLLINGRG  199

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTVDPG+TYRFRISNVG+ TSINFRIQGHK+KLVEVEGSHT+Q+T+++LDIHLGQ
Sbjct  200   WNGYTFTVDPGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNTYSDLDIHLGQ  259

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTADQ  KDYY+VVSSRFT  VLTTTA+LHYSNS+ RVSGP PGGPTTQI+WSL 
Sbjct  260   SYSVLVTADQPAKDYYIVVSSRFTKPVLTTTAILHYSNSWQRVSGPIPGGPTTQIDWSLN  319

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS R NL+ASGPRPNPQGSYHYG+IK +RTI LANS P IN KQRYAVNGVS++  DT
Sbjct  320   QARSFRWNLTASGPRPNPQGSYHYGLIKTSRTITLANSGPIINRKQRYAVNGVSYIPADT  379

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLK+ADYF I GVF+LGS+P SP WG+AYL T+VM AN+R F+EIVFQNWEDTVQSWHID
Sbjct  380   PLKIADYFNIPGVFSLGSMPSSPSWGNAYLQTAVMPANFREFIEIVFQNWEDTVQSWHID  439

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             G+SFFVVGMDGGQWT ASR RYNLRDTVARCT QVYP+SWTAIYMALDNVGMWNIRSE+W
Sbjct  440   GHSFFVVGMDGGQWTPASRARYNLRDTVARCTTQVYPKSWTAIYMALDNVGMWNIRSENW  499

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  +S+RDELPIPKNALLCGRARGRHTRPL
Sbjct  500   ARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARGRHTRPL  543



>ref|XP_007026108.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 ref|XP_007026109.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28730.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
 gb|EOY28731.1| SKU5 similar 4 isoform 1 [Theobroma cacao]
Length=542

 Score =   872 bits (2252),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/524 (82%), Positives = 461/524 (88%), Gaps = 1/524 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYLNEP
Sbjct  19    GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEP  78

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+QQRRNSWQDGV+GT CPI P KNFTY+LQ KDQIGS+FYFPSL  HKAAGGY
Sbjct  79    FLISWNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGY  138

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI+SRP IPVPF  PA DFTVLAGDW KR++  L  +LDSG NLP PDGLLINGRGW
Sbjct  139   GGIRIWSRPKIPVPFPTPAGDFTVLAGDWYKRNHYVLRRLLDSGRNLPFPDGLLINGRGW  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NGYTFTVDPGRTYRFR+SNVG+ TSINFRIQGH LKL+EVEGSHT+Q+T+++ DIHLGQS
Sbjct  199   NGYTFTVDPGRTYRFRVSNVGLTTSINFRIQGHNLKLIEVEGSHTLQNTYSSFDIHLGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
              S LVTADQ  KDYYVVVSSRFTSRVLTTTAVLHYSNS   VSGP PG  T QI  SL Q
Sbjct  259   CSFLVTADQVSKDYYVVVSSRFTSRVLTTTAVLHYSNSKQGVSGPVPGASTIQIAPSLLQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I P+RTIMLANSAP+INGKQRYAVNGVS+V  DTP
Sbjct  319   ERSIRWNLTASGPRPNPQGSYHYGLITPSRTIMLANSAPWINGKQRYAVNGVSYVPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             LKLADYFKI GVFNLGSIP  P  G +AY  TSVM AN+R ++EIVFQNWEDTVQSWHID
Sbjct  379   LKLADYFKIPGVFNLGSIPTWPPSGNNAYFQTSVMAANFREYIEIVFQNWEDTVQSWHID  438

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSFFVVGMDGGQWT  SR  YNLRDTVARCT QVYPRSWTAIYMALDNVGMWNIRSE+W
Sbjct  439   GYSFFVVGMDGGQWTPGSRANYNLRDTVARCTTQVYPRSWTAIYMALDNVGMWNIRSENW  498

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  NS+RDELPIPKNA LCGRARGRHTRPL
Sbjct  499   ARQYLGQQFYLRVYSPANSWRDELPIPKNAPLCGRARGRHTRPL  542



>gb|KHG02352.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   871 bits (2250),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/524 (81%), Positives = 462/524 (88%), Gaps = 1/524 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNEP
Sbjct  19    GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNEP  78

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIGS++YFPSL  HKAAGGY
Sbjct  79    FLISWNGVQQRRNSWQDGVSGTNCPIRPGKNFTYVLQVKDQIGSFYYFPSLLFHKAAGGY  138

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             GAIRI+SRP IPVPF  PA DFTVLAGDW KR++  L  +LDSGHNLP PD LLINGRGW
Sbjct  139   GAIRIWSRPKIPVPFPSPAGDFTVLAGDWYKRNHYVLRRLLDSGHNLPFPDRLLINGRGW  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NGYTFTVDPGRTYRFR+SNVG+ TSINFRIQGHKLKL+EVEGSHT+Q+T+T+ DIHLGQS
Sbjct  199   NGYTFTVDPGRTYRFRVSNVGLTTSINFRIQGHKLKLIEVEGSHTLQNTYTSFDIHLGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
              S LVTADQ P+DYYVV S+RFT RVLTTTAVLHYSNS   VSGP PG PT QI  S+ Q
Sbjct  259   CSFLVTADQIPQDYYVVASTRFTRRVLTTTAVLHYSNSKRGVSGPVPGAPTIQIAPSVMQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I P+RTIML+NSAPYINGKQRYAVNGVS+V  DTP
Sbjct  319   ARSIRWNLTASGPRPNPQGSYHYGLITPSRTIMLSNSAPYINGKQRYAVNGVSYVPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             LK+ADYFKI GVFNLGSIP  P  G +AY  TSVM AN+R +VEIVFQNWEDTVQSWHID
Sbjct  379   LKIADYFKIPGVFNLGSIPTWPPSGNNAYFQTSVMAANFREYVEIVFQNWEDTVQSWHID  438

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSFFVVGM+GGQWT ASR+ YNLRDTVARCT QVYPRSWTAIYMALDNVGMWNIRSE+W
Sbjct  439   GYSFFVVGMNGGQWTPASRSSYNLRDTVARCTTQVYPRSWTAIYMALDNVGMWNIRSENW  498

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  NS+RDELPIPKNALLC RARGRHTRP 
Sbjct  499   ARQYLGQQFYLRVYSPANSWRDELPIPKNALLCDRARGRHTRPF  542



>ref|XP_010529443.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/525 (79%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLNE
Sbjct  17    NGVFGENPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLNE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNGLQQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGSYFYFPSL  HKAAG 
Sbjct  77    PFLISWNGLQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSYFYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF+PP  DF +LAGDW K ++  L  +L++G NLP PDG+LINGRG
Sbjct  137   FGAIRVWSRPQIPVPFSPPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPFPDGILINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATSINFRIQGH +KLVEVEGSHTVQ+ +++LDIHLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGLATSINFRIQGHTMKLVEVEGSHTVQNVYSSLDIHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVT +Q P+DYY+VVSSRFT +VLTTTAVLHYSNS   VSGP P GPT  I  SLF
Sbjct  257   SYSVLVTTNQAPQDYYIVVSSRFTRKVLTTTAVLHYSNSGRGVSGPVPSGPTLDIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R++RRNL+ASGPRPNPQGSYHYGMIKP RTI+++NSAPYINGKQRYA NGVSFV PDT
Sbjct  317   QARTIRRNLTASGPRPNPQGSYHYGMIKPGRTIIVSNSAPYINGKQRYAANGVSFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+   L TSVM AN+R F+EIVFQNWE+TVQSWHI
Sbjct  377   PLKLADYFKISGVFNLGSIPTSPSGGNGGSLQTSVMAANFREFIEIVFQNWENTVQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGYSFFVVGM+GGQWT  SR +YNL D VAR TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   DGYSFFVVGMEGGQWTAGSRAKYNLHDAVARSTVQVYPRAWTAIYIALDNVGMWNIRSEE  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             W RQYLGQQFYLRV+TS+ SYRDE PIPKNALLCGRARGRHTRP+
Sbjct  497   WGRQYLGQQFYLRVWTSSTSYRDEYPIPKNALLCGRARGRHTRPI  541



>gb|ABK95805.1| unknown [Populus trichocarpa]
Length=544

 Score =   870 bits (2247),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/546 (79%), Positives = 480/546 (88%), Gaps = 3/546 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M +Y + C+ ++  L+     NGV   +PYR+ TWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MGDYRAFCASLVVFLLFLG--NGVNCEDPYRFITWKITYGDIYPLGVKQQGILINGQFPG  58

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQID VTN+NLII+VYNYL EPFL+SWNG+QQRRNSWQDGVYGT+CPIPP KNFTY LQ 
Sbjct  59    PQIDAVTNENLIISVYNYLREPFLISWNGIQQRRNSWQDGVYGTSCPIPPGKNFTYALQV  118

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGS+FYFPSL  HKAAG +G IRI+SRP IPVPF PPA DFTVLAGDW KR++ QL 
Sbjct  119   KDQIGSFFYFPSLGFHKAAGAFGGIRIWSRPRIPVPFPPPAGDFTVLAGDWYKRNHYQLR  178

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILD GHNLP PDGLLINGRGWNGYTFTVDPG+TYRFRISNVG+ TSINFRIQGHK+KLV
Sbjct  179   RILDGGHNLPFPDGLLINGRGWNGYTFTVDPGKTYRFRISNVGLTTSINFRIQGHKMKLV  238

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+T+++LDIHLGQSYSVLVTADQ  KDYY+VVSSRFT  VL TTAVLHYSNS
Sbjct  239   EVEGSHTLQNTYSDLDIHLGQSYSVLVTADQPAKDYYIVVSSRFTKPVLATTAVLHYSNS  298

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             + RVSGP PGGPTTQI+WSL Q RS R NL+ASGPRPNPQGSYHYG+IK +RTI LANS 
Sbjct  299   WQRVSGPIPGGPTTQIDWSLNQARSFRWNLTASGPRPNPQGSYHYGLIKTSRTITLANSG  358

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDAN  1426
             P IN KQRYAVNGVS++  DTPLK+ADYF I GVF+LGS+P SP WG +AYL T+VM AN
Sbjct  359   PIINRKQRYAVNGVSYIPADTPLKIADYFNIPGVFSLGSMPSSPSWGNNAYLQTAVMSAN  418

Query  1427  YRSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPR  1606
             +R F+EIVFQNWEDTVQSWHIDG+SFFVVGMDGGQWT ASR RYNLRDTVARCT QVYP+
Sbjct  419   FREFIEIVFQNWEDTVQSWHIDGHSFFVVGMDGGQWTPASRARYNLRDTVARCTTQVYPK  478

Query  1607  SWTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARG  1786
             SWTAIYMALDNVGMWNIRSE+WARQYLGQQFYLRVY+  +S+RDELPIPKNALLCGRARG
Sbjct  479   SWTAIYMALDNVGMWNIRSENWARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARG  538

Query  1787  RHTRPL  1804
             RHTRPL
Sbjct  539   RHTRPL  544



>ref|XP_007026110.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
 gb|EOY28732.1| SKU5 similar 4 isoform 3 [Theobroma cacao]
Length=543

 Score =   868 bits (2243),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/525 (82%), Positives = 461/525 (88%), Gaps = 2/525 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             GV G NPYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYLNEP
Sbjct  19    GVNGENPYRYITWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLNEP  78

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+QQRRNSWQDGV+GT CPI P KNFTY+LQ KDQIGS+FYFPSL  HKAAGGY
Sbjct  79    FLISWNGVQQRRNSWQDGVFGTNCPIRPGKNFTYVLQVKDQIGSFFYFPSLLFHKAAGGY  138

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI+SRP IPVPF  PA DFTVLAGDW KR++  L  +LDSG NLP PDGLLINGRGW
Sbjct  139   GGIRIWSRPKIPVPFPTPAGDFTVLAGDWYKRNHYVLRRLLDSGRNLPFPDGLLINGRGW  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NGYTFTVDPGRTYRFR+SNVG+ TSINFRIQGH LKL+EVEGSHT+Q+T+++ DIHLGQS
Sbjct  199   NGYTFTVDPGRTYRFRVSNVGLTTSINFRIQGHNLKLIEVEGSHTLQNTYSSFDIHLGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
              S LVTADQ  KDYYVVVSSRFTSRVLTTTAVLHYSNS   VSGP PG  T QI  SL Q
Sbjct  259   CSFLVTADQVSKDYYVVVSSRFTSRVLTTTAVLHYSNSKQGVSGPVPGASTIQIAPSLLQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I P+RTIMLANSAP+INGKQRYAVNGVS+V  DTP
Sbjct  319   ERSIRWNLTASGPRPNPQGSYHYGLITPSRTIMLANSAPWINGKQRYAVNGVSYVPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             LKLADYFKI GVFNLGSIP  P  G +AY  TSVM AN+R ++EIVFQNWEDTVQSWHID
Sbjct  379   LKLADYFKIPGVFNLGSIPTWPPSGNNAYFQTSVMAANFREYIEIVFQNWEDTVQSWHID  438

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTV-QVYPRSWTAIYMALDNVGMWNIRSED  1669
             GYSFFVVGMDGGQWT  SR  YNLRDTVARCT  QVYPRSWTAIYMALDNVGMWNIRSE+
Sbjct  439   GYSFFVVGMDGGQWTPGSRANYNLRDTVARCTTQQVYPRSWTAIYMALDNVGMWNIRSEN  498

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVY+  NS+RDELPIPKNA LCGRARGRHTRPL
Sbjct  499   WARQYLGQQFYLRVYSPANSWRDELPIPKNAPLCGRARGRHTRPL  543



>ref|XP_010539014.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=543

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/526 (79%), Positives = 460/526 (87%), Gaps = 2/526 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYL E
Sbjct  18    NGVFGDNPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNLIISVYNYLKE  77

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNGLQQR+NSW DGV GTTCPIPP KNFTY++Q KDQIGSYFYFPSL  HKAAG 
Sbjct  78    PFLLSWNGLQQRKNSWHDGVIGTTCPIPPGKNFTYIIQVKDQIGSYFYFPSLAFHKAAGA  137

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF+PP  DF +L+GDW K ++  L  +L++G NLP PDGLLINGRG
Sbjct  138   FGAIRVWSRPRIPVPFSPPDGDFWILSGDWYKTNHYVLRRLLEAGRNLPFPDGLLINGRG  197

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATSINFRIQGH +KLVEVEGSHTVQ+ +++LDIHLGQ
Sbjct  198   WGGNTFTVQPGKTYRFRISNVGLATSINFRIQGHAMKLVEVEGSHTVQNVYSSLDIHLGQ  257

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVT +Q P+DYY+VVSSRFT +VLTTTA+LHYSNS   VSGP P GPT  I  SLF
Sbjct  258   SYSVLVTTNQAPQDYYIVVSSRFTRKVLTTTAILHYSNSRRGVSGPVPSGPTLNIASSLF  317

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R++RRNL+ASGPRPNPQGSYHYGMIKP RTIM++NSAPYINGKQ+YAVNGVSFV PDT
Sbjct  318   QARTIRRNLTASGPRPNPQGSYHYGMIKPGRTIMISNSAPYINGKQKYAVNGVSFVAPDT  377

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWG--SAYLATSVMDANYRSFVEIVFQNWEDTVQSWH  1486
             PLKLADYFKI GVFNLGSIP SP  G  +  L TSVM AN+R F+EIVFQNWE+TVQSWH
Sbjct  378   PLKLADYFKISGVFNLGSIPTSPSGGNNAGSLQTSVMAANFREFIEIVFQNWENTVQSWH  437

Query  1487  IDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSE  1666
             IDGYSFFVVGMDGGQWT  SR +YNL D VAR TVQVYPR+WTAIYMALDNVGMWNIRSE
Sbjct  438   IDGYSFFVVGMDGGQWTTGSRAKYNLHDAVARSTVQVYPRAWTAIYMALDNVGMWNIRSE  497

Query  1667  DWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             +W RQYLGQQFYLRV+TS+ SYRDE PIPKNALLCGRA GRHTRP 
Sbjct  498   NWGRQYLGQQFYLRVWTSSTSYRDEYPIPKNALLCGRASGRHTRPF  543



>ref|XP_010052867.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW76996.1| hypothetical protein EUGRSUZ_D01344 [Eucalyptus grandis]
Length=544

 Score =   865 bits (2234),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/523 (81%), Positives = 464/523 (89%), Gaps = 0/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             G  G NPYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+VYNYL EP
Sbjct  22    GANGDNPYRFFTWKVTYGDIYPLGVKQKGILINGQFPGPHIDAITNDNVIISVYNYLKEP  81

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+QQRRNSWQDGVYGT CPI P +NFTY++Q KDQIGSYFYFPS+ + KAAGG+
Sbjct  82    FLISWNGIQQRRNSWQDGVYGTNCPILPGRNFTYVMQVKDQIGSYFYFPSIGLQKAAGGF  141

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G+IRI+SRPLIPVPF PPA DF VLAGDW K  + +L  +LD GHNLP PDGLLINGRGW
Sbjct  142   GSIRIWSRPLIPVPFPPPAGDFMVLAGDWFKIDHNRLRLLLDVGHNLPFPDGLLINGRGW  201

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NGYTFTVDPG+TYRFRISNVGI TSINFRIQGHK+KLVEVEGSHT+Q+T+  LDIHLGQS
Sbjct  202   NGYTFTVDPGKTYRFRISNVGITTSINFRIQGHKMKLVEVEGSHTLQNTYDALDIHLGQS  261

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLV ADQQP+DYYVVVSSRFT RVLTTTAVLHYSNS   VSGP P GP   I WSL Q
Sbjct  262   YSVLVMADQQPQDYYVVVSSRFTPRVLTTTAVLHYSNSRQGVSGPVPAGPPNHIAWSLSQ  321

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYGMIK +RTIMLANSAP INGKQRYAVNG SFV  DTP
Sbjct  322   ARSIRWNLTASGPRPNPQGSYHYGMIKTSRTIMLANSAPIINGKQRYAVNGASFVPADTP  381

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLAD+F I GVFNLGS+P SP  GS YL TSVM  N+R +VEIVFQNWE+TVQSWHIDG
Sbjct  382   LKLADHFNIAGVFNLGSMPTSPNSGSGYLQTSVMSTNFREYVEIVFQNWENTVQSWHIDG  441

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFV+GMDGGQWT ASR+RYNLRDTVARCT QV+P+SWTAIYMALDNVGMWNIRSEDWA
Sbjct  442   YSFFVMGMDGGQWTPASRSRYNLRDTVARCTTQVFPKSWTAIYMALDNVGMWNIRSEDWA  501

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFY+RVYT++NSYRDELPIPKNALLCGRARGR TRPL
Sbjct  502   RQYLGQQFYMRVYTNSNSYRDELPIPKNALLCGRARGRRTRPL  544



>ref|XP_007213900.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
 gb|EMJ15099.1| hypothetical protein PRUPE_ppa003872mg [Prunus persica]
Length=543

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/525 (80%), Positives = 462/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19    NGVNGEDPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SW+G+QQRRNSWQDGVYGT CPI P KNFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79    PFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEY-ILDSGHNLPLPDGLLINGR  769
             +G IRI+SRP IPVPF  PA DFTVLAGDW K ++  L    L+ G NLP PDGLLINGR
Sbjct  139   FGGIRIWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSYLEFGRNLPSPDGLLINGR  198

Query  770   GWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLG  949
             GWNGYTFTVD GRTYRFRISNVG+ TSINFRIQGHKLKLVEVEGSHT+Q+ + +LDIHLG
Sbjct  199   GWNGYTFTVDQGRTYRFRISNVGLTTSINFRIQGHKLKLVEVEGSHTLQNIYDSLDIHLG  258

Query  950   QSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSL  1129
             QSYSVLVTADQ  +DYYVVVSSRFT RVLTTTAVLHYSNS   VSGP P GP+TQ+ WSL
Sbjct  259   QSYSVLVTADQPAQDYYVVVSSRFTPRVLTTTAVLHYSNSRKGVSGPLPWGPSTQVAWSL  318

Query  1130  FQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPD  1309
              Q RS+R NL+ASGPRPNPQGSYHYG+IKPARTIMLANSAPYINGKQR+AVN VS+V PD
Sbjct  319   SQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPYINGKQRFAVNSVSYVQPD  378

Query  1310  TPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             TPLKLADYFKI GVF++GSIP +P  GS YL TSVM AN+R +VEIVFQNWEDTVQSWHI
Sbjct  379   TPLKLADYFKIPGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWEDTVQSWHI  438

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGYSFFV+GMDGGQWT ASR RYNLRDTVAR T QVYPRSWTAIY+ALDNVGMWN+RSE+
Sbjct  439   DGYSFFVMGMDGGQWTPASRARYNLRDTVARSTTQVYPRSWTAIYVALDNVGMWNVRSEN  498

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVY+  NS+RDE PIP+NALLCGRARGR TRPL
Sbjct  499   WARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRARGRRTRPL  543



>ref|XP_008224692.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=543

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/525 (80%), Positives = 460/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G +PYR +TWKITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19    NGVNGEDPYRLFTWKITYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SW+G+QQRRNSWQDGVYGT CPI P KNFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79    PFLISWDGIQQRRNSWQDGVYGTNCPILPGKNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE-YILDSGHNLPLPDGLLINGR  769
             +G IRI+SRP IPVPF  PA DFTVLAGDW K ++  L    L+ G NLP PDGLLINGR
Sbjct  139   FGGIRIWSRPKIPVPFPNPAGDFTVLAGDWYKTNHYILRRSFLEFGRNLPSPDGLLINGR  198

Query  770   GWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLG  949
             GWNGYTFTVD GRTYRFRISNVG+ TSINFRIQGHKLKLVEVEGSHT+Q+ + +LDIHLG
Sbjct  199   GWNGYTFTVDQGRTYRFRISNVGLTTSINFRIQGHKLKLVEVEGSHTLQNIYDSLDIHLG  258

Query  950   QSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSL  1129
             QSYSVLVTADQ  +DYYVVVSSRFT RVLTTTAVLHYSNS   VSGP P GP+TQ+ WSL
Sbjct  259   QSYSVLVTADQPVQDYYVVVSSRFTPRVLTTTAVLHYSNSRKGVSGPLPWGPSTQVAWSL  318

Query  1130  FQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPD  1309
              Q RS+R NL+ASGPRPNPQGSYHYG+IKPARTIMLANSAPYINGKQR+AVN VS+V PD
Sbjct  319   SQARSIRSNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPYINGKQRFAVNSVSYVQPD  378

Query  1310  TPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             TPLKLADYFKI GVF++GSIP +P  GS YL TSVM AN+R +VEIVFQNWEDTVQSWHI
Sbjct  379   TPLKLADYFKIPGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWEDTVQSWHI  438

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGYSFFV+GMDGGQWT ASR RYNLRDTVA  T QVYPRSWTAIY+ALDNVGMWN+RSE+
Sbjct  439   DGYSFFVMGMDGGQWTPASRARYNLRDTVALSTTQVYPRSWTAIYVALDNVGMWNVRSEN  498

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVY+  NS+RDE PIP+NALLCGRARGR TRPL
Sbjct  499   WARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRARGRRTRPL  543



>ref|XP_002272880.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI23230.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   859 bits (2219),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/523 (80%), Positives = 463/523 (89%), Gaps = 0/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             GV+G +PYR+YTWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLII+VYNYL EP
Sbjct  18    GVHGEDPYRFYTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIISVYNYLREP  77

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SW+GLQQRRNSWQDG+YGT CPIPP +N TY LQ KDQIGS+FYFPSL  HKAAGG+
Sbjct  78    FLISWSGLQQRRNSWQDGMYGTNCPIPPGRNMTYALQVKDQIGSFFYFPSLAFHKAAGGF  137

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  P+ DFTVLAGDW KR +  L+ ILD GHNLP PDGLLINGRGW
Sbjct  138   GGIRILSRPRIPVPFPAPSGDFTVLAGDWFKRDHAVLKGILDRGHNLPFPDGLLINGRGW  197

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NGYTF VD G+TYRFRISNVG+ TSINFRIQGHK+KLVEVEGSHT+Q+T++ LDIHLGQS
Sbjct  198   NGYTFQVDQGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNTYSALDIHLGQS  257

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTTA+LHYS S   +SGPPPGGPT Q++WSL Q
Sbjct  258   YSVLVTADQPPQDYYVVVSSRFTSPVLTTTAILHYSWSTKGLSGPPPGGPTIQVDWSLNQ  317

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I  +RTI LANSAP INGKQRYAVN VSFV   TP
Sbjct  318   ARSIRWNLTASGPRPNPQGSYHYGLITTSRTITLANSAPMINGKQRYAVNSVSFVPASTP  377

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GVFNLGSIP  P WG+ YL TSVM A++RS+VEIVFQNWED VQSWHIDG
Sbjct  378   LKLADYFKIPGVFNLGSIPSYPTWGNGYLQTSVMHADFRSYVEIVFQNWEDIVQSWHIDG  437

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFV+GMDGGQWT ASR  YNLRDTVARCTVQVYP++WTAIYMALDNVGMWN+RSE+WA
Sbjct  438   YSFFVMGMDGGQWTPASRASYNLRDTVARCTVQVYPKAWTAIYMALDNVGMWNVRSENWA  497

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRV++  NS+RDELPIPKNALLCGRA GRHTRPL
Sbjct  498   RQYLGQQFYLRVFSPANSWRDELPIPKNALLCGRASGRHTRPL  540



>ref|XP_006282576.1| hypothetical protein CARUB_v10004445mg, partial [Capsella rubella]
 gb|EOA15474.1| hypothetical protein CARUB_v10004445mg, partial [Capsella rubella]
Length=582

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 461/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  58    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  117

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS+FYFPSL  HKAAG 
Sbjct  118   PFLMSWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFFYFPSLAFHKAAGA  177

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G NLP+PDG+LINGRG
Sbjct  178   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGVLINGRG  237

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KLVEVEGSHTVQ+ +T+LD+HLGQ
Sbjct  238   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHAMKLVEVEGSHTVQNIYTSLDVHLGQ  297

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+V+SSRFT RVLTTTA+LHYSNS   VSGP P GPT  I  SL+
Sbjct  298   SYSVLVTANQAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPVPNGPTLSIASSLY  357

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKP RTI+LANSAP+INGKQRYAVNG SFV PDT
Sbjct  358   QARTIKRNLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRYAVNGASFVAPDT  417

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  GS  YL +SVM AN+R ++EIVFQNWE+++QSWHI
Sbjct  418   PLKLADYFKIPGVFNLGSIPTSPSGGSGGYLQSSVMAANFREYIEIVFQNWENSIQSWHI  477

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGG WT+ SR +YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE 
Sbjct  478   SGYSFFVVGMDGGLWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSES  537

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  538   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  582



>ref|XP_010448953.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ I+INGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G NLP+PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KL+EVEGSHTVQ+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTVQNIYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA++ P+DYY+V+SSRFT RVLTTTA+LHYSNS   VSGP P GPT  +  SLF
Sbjct  257   SYSVLVTANKAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPIPNGPTLNMASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKPARTI+LANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPARTIILANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+  YL TSVM AN+R ++EIVFQNWE+++QSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPSGGNGGYLQTSVMAANFREYIEIVFQNWENSIQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT+ SR +YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWN+RSE 
Sbjct  437   SGYSFFVVGMDGGQWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNVRSES  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_010434093.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   853 bits (2205),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ I+INGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G NLP+PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KL+EVEGSHTVQ+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTVQNIYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA++ P+DYY+V+SSRFT RVLTTTA+LHYSNS   VSGP P GPT  I  SLF
Sbjct  257   SYSVLVTANKAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPIPNGPTLNIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKPARTI+LANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPARTIILANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+  YL +SVM AN+R ++EIVFQNWE+++QSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPSGGNGGYLQSSVMAANFREYIEIVFQNWENSIQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT+ SR +YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE 
Sbjct  437   SGYSFFVVGMDGGQWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSES  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_010439384.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ I+INGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGIMINGQFPGPHIDAVTNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G NLP+PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPMPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KL+EVEGSHTVQ+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTVQNIYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA++ P+DYY+V+SSRFT RVLTTTA+LHYSNS   VSGP P GPT  I  SLF
Sbjct  257   SYSVLVTANKAPQDYYIVISSRFTRRVLTTTAILHYSNSRRGVSGPIPNGPTLNIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKPARTI+LANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPARTIILANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+  YL +SVM AN+R ++EIVFQNWE+++QSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPSGGNGGYLQSSVMAANFREYIEIVFQNWENSIQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT+ SR +YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWN+RSE 
Sbjct  437   SGYSFFVVGMDGGQWTQGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNVRSES  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>emb|CDX79120.1| BnaA01g11870D [Brassica napus]
Length=541

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLRE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NS+QDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G N+P PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNVPFPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG AT++NFRIQGH +KLVEVEGSHT+Q+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGTATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+VVSSRFT +VLTTT++LHYSNS   VSGP P GPT  I  SLF
Sbjct  257   SYSVLVTANQAPQDYYIVVSSRFTRKVLTTTSILHYSNSRRGVSGPAPSGPTLNIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKPARTIMLANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP +P  G+  YL TSVM AN+R F+EIVFQNWE++VQSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTNPPGGNGGYLTTSVMGANFREFIEIVFQNWENSVQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT+ SR++YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGMDGGQWTQGSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_006413696.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
 gb|ESQ55149.1| hypothetical protein EUTSA_v10024862mg [Eutrema salsugineum]
Length=541

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYG+IYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGNIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIRI+SRP IPVPF  P  DF +LAGDW K ++  L  +L++G NLP PDG+LINGRG
Sbjct  137   FGAIRIWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPFPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+AT++NFRIQGH +KLVEVEGSHT+Q+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVHPGKTYRFRISNVGVATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+VVSSRFT +VLTTT++LHYSNS  RVSGP P GPT  I  SL+
Sbjct  257   SYSVLVTANQAPQDYYIVVSSRFTRKVLTTTSILHYSNSRRRVSGPVPSGPTLSIASSLY  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKP RTI+LANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+  YL +SVM AN+R F+EIVFQNWE++VQSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPSGGNGGYLQSSVMAANFREFIEIVFQNWENSVQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT  SR++YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGMDGGQWTTRSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|NP_193932.1| protein SKU5 similar 4 [Arabidopsis thaliana]
 emb|CAA18104.1| pectinesterase like protein [Arabidopsis thaliana]
 emb|CAB79156.1| pectinesterase like protein [Arabidopsis thaliana]
 gb|AAL91224.1| pectinesterase-like protein [Arabidopsis thaliana]
 gb|AAP68338.1| At4g22010 [Arabidopsis thaliana]
 gb|AEE84542.1| protein SKU5 similar 4 [Arabidopsis thaliana]
Length=541

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 462/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17    NGVLGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVVGTTCPIPPGKNFTYVIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF+PP  DF +LAGDW K ++  L  +L++G NLP PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFSPPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPNPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KLVEVEGSHTVQ+ +T+LDIHLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHTMKLVEVEGSHTVQNIYTSLDIHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+V+SSRFT +VLTTT++LHYSNS   VSGP P GPT  I  SL+
Sbjct  257   SYSVLVTANQAPQDYYIVISSRFTRKVLTTTSILHYSNSRKGVSGPVPNGPTLDIASSLY  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R++RRNL+ASGPRPNPQGSYHYG+IKP RTI+LANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIRRNLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+  YL +SVM AN+R F+E+VFQNWE++VQSWH+
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPSGGNGGYLQSSVMAANFREFIEVVFQNWENSVQSWHV  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT  SR +YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGMDGGQWTPGSRAKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRA+GRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRAKGRHTRPF  541



>ref|XP_010278638.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=541

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/518 (80%), Positives = 460/518 (89%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TWK+TYGDIYPLGVKQR ILINGQFPGPQIDCVTNDNLI++VYNYL+EPFL+SW
Sbjct  24    DPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDCVTNDNLIVSVYNYLDEPFLISW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G I+I
Sbjct  84    NGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLGFHKAAGGFGGIKI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP+IPVPF PPA DFTVLAGDW K  +  L  ILD GHNLP PDGLLINGR WNGYTF
Sbjct  144   NSRPMIPVPFPPPAGDFTVLAGDWFKNDHAALRAILDGGHNLPFPDGLLINGRAWNGYTF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFRISNVG+ TSINFRI GHK+KLVEVEGSHT+Q+T+++LDIHLGQSYSVLV
Sbjct  204   TVDQGKTYRFRISNVGLTTSINFRIAGHKMKLVEVEGSHTLQNTYSSLDIHLGQSYSVLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+ VS+RFTS VLTTTA+LHYSNS+ RVSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQPAQDYYIAVSTRFTSPVLTTTAILHYSNSYVRVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I  +RTI LAN+AP INGKQRYAVN VSFV  DTPLK+AD
Sbjct  324   WNLTASGPRPNPQGSYHYGLINTSRTIRLANNAPVINGKQRYAVNSVSFVPADTPLKVAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             Y+KI GVF LGSIPD P  G  YL TSVM A++R++VEIVF+NWEDTVQSWHIDGYSFFV
Sbjct  384   YYKIPGVFYLGSIPDHPTGGGGYLQTSVMPADFRTYVEIVFENWEDTVQSWHIDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG W+ ASR  YNLRDTVARCT QVYP+SWTAIYMALDNVGMWNIRSE+WARQYLG
Sbjct  444   VGMDGGSWSPASRNGYNLRDTVARCTTQVYPKSWTAIYMALDNVGMWNIRSENWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  504   QQFYLRVYSPANSWRDEYPIPKNALLCGRASGRRTRPL  541



>emb|CDX82897.1| BnaC01g13470D [Brassica napus]
Length=541

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/525 (76%), Positives = 462/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17    NGVLGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLRE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NS+QDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G N+P PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNIPFPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG AT++NFRIQGH +KLVEVEGSHT+Q+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGTATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+VVSSRFT +VLTTT++LHYSNS   VSGP P GPT  I  SLF
Sbjct  257   SYSVLVTANQAPQDYYIVVSSRFTRKVLTTTSILHYSNSRRGVSGPAPSGPTLNIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKPARTIMLANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP +P  G+  YL TSVM AN+R F+EIVFQNWE++VQSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTNPPGGNGGYLTTSVMAANFREFIEIVFQNWENSVQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT+ SR++YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGMDGGQWTQGSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_007215641.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
 gb|EMJ16840.1| hypothetical protein PRUPE_ppa003877mg [Prunus persica]
Length=542

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/545 (75%), Positives = 471/545 (86%), Gaps = 3/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M  Y+S+C +IL  L+     NG    +PYR+Y W +TYGDIYPLG+KQR ILINGQFPG
Sbjct  1     MGLYTSLCCVILVALLTVTCTNGE---DPYRFYNWNVTYGDIYPLGLKQRGILINGQFPG  57

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQI+ VTNDNLIINV+N L+EPFLLSWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ 
Sbjct  58    PQIESVTNDNLIINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQV  117

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL  HKAAGG+G I+I SR +IPVPF PPA DFT+LAGDW  +++  L+
Sbjct  118   KDQIGSYFYFPSLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLK  177

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILDSG+NLP PDGLLINGRG NG+TFTVD G+TYR RISNVG+ TSINFRIQGHK+ LV
Sbjct  178   AILDSGNNLPSPDGLLINGRGSNGFTFTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLV  237

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+H++Q+T+++LDIHLGQSYSVLVTADQ  +DYY+VVS+RFTS+VL+TT++LHYSNS
Sbjct  238   EVEGTHSLQNTYSSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNS  297

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPTTQI+WSL Q RSLRRNL+ASGPRPNPQGSYHYG+I   RTI L +SA
Sbjct  298   AGSVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSA  357

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P I+GKQRYAVN VSF+ PDTPLKLADYFKI GVF++GSI D+P  G AYL TSVM+A++
Sbjct  358   PIIDGKQRYAVNSVSFIQPDTPLKLADYFKISGVFSIGSIQDNPTGGGAYLQTSVMNADF  417

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R F E+VF+N EDTVQSWHIDG+SFFVVGMDGGQW  ASR RYNLRDT++RCTVQVYP S
Sbjct  418   RGFAELVFENPEDTVQSWHIDGHSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQVYPNS  477

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIYM LDNVGMWN+RSE+WARQYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR
Sbjct  478   WTAIYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRALGR  537

Query  1790  HTRPL  1804
              TRPL
Sbjct  538   RTRPL  542



>ref|XP_002869849.1| hypothetical protein ARALYDRAFT_914433 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46108.1| hypothetical protein ARALYDRAFT_914433 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   850 bits (2197),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 463/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVVGTTCPIPPGKNFTYVIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF+PP  DF +LAGDW K ++  L  +L++G NLP PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFSPPDGDFWLLAGDWYKTNHYVLRRLLEAGRNLPNPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KLVEVEGSHTVQ+ +T+LDIHLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHTMKLVEVEGSHTVQNIYTSLDIHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+V+SSRFT +VLTTT++LHYSNS   VSGP P GPT  I  SL+
Sbjct  257   SYSVLVTANQAPQDYYIVISSRFTRKVLTTTSILHYSNSRKGVSGPVPNGPTLDIASSLY  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R++RRNL+ASGPRPNPQGSYHYG+IKP RTI+LANSAP+INGKQR+AVNG SFV PDT
Sbjct  317   QARTIRRNLTASGPRPNPQGSYHYGLIKPGRTIILANSAPWINGKQRFAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  G+  YL +SVM AN+R F+E+VFQNWE +VQSWH+
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPPGGNGGYLQSSVMAANFREFIEVVFQNWESSVQSWHV  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGG+WT  SR++YNLRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGMDGGEWTPGSRSKYNLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_008229964.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=542

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/545 (74%), Positives = 471/545 (86%), Gaps = 3/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M  Y+SVC +IL  L+     +G    +PYR+Y W +TYGDIYPLG+KQR ILINGQFPG
Sbjct  1     MGLYTSVCCVILVALLTVTCTSGE---DPYRFYNWNVTYGDIYPLGLKQRGILINGQFPG  57

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQI+ VTNDNLIINV+N L+EPFLLSWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ 
Sbjct  58    PQIESVTNDNLIINVFNSLDEPFLLSWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQV  117

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL  HKAAGG+G I+I SR +IPVPF PPA DFT+LAGDW  +++  L+
Sbjct  118   KDQIGSYFYFPSLGFHKAAGGFGGIKIASRSVIPVPFPPPAGDFTILAGDWFSKNHTDLK  177

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILDSG+NLPL DGLLINGRG NG+TFTVD G+TYR RISNVG+ TSINFRIQGHK+ LV
Sbjct  178   AILDSGNNLPLSDGLLINGRGSNGFTFTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLV  237

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+H++Q+T+++LDIHLGQSYSVLVTADQ  +DYY+VVS+RFTS+VL+TT++LHYSN+
Sbjct  238   EVEGTHSLQNTYSSLDIHLGQSYSVLVTADQPAQDYYIVVSTRFTSQVLSTTSILHYSNA  297

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPTTQI+WSL Q RSLRRNL+ASGPRPNPQGSYHYG+I   RTI L +SA
Sbjct  298   AGSVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLTSSA  357

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P I+GKQRYAVN VSF+ PDTPLKLADYFKI GVF++GSI D+P  G AYL TSVM+A++
Sbjct  358   PIIDGKQRYAVNSVSFIQPDTPLKLADYFKISGVFSIGSIQDNPTGGGAYLQTSVMNADF  417

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R F E+VF+N EDTVQSWHIDG+SFFVVGMDGGQW  ASR RYNLRDT++RCTVQVYP S
Sbjct  418   RGFAELVFENPEDTVQSWHIDGHSFFVVGMDGGQWEPASRLRYNLRDTISRCTVQVYPNS  477

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIYM LDNVGMWN+RSE+WARQYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR
Sbjct  478   WTAIYMPLDNVGMWNVRSENWARQYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRALGR  537

Query  1790  HTRPL  1804
              TRPL
Sbjct  538   QTRPL  542



>ref|XP_004287955.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=542

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/545 (74%), Positives = 469/545 (86%), Gaps = 3/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M  Y+SVC ++L  L+     NG    +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MGLYTSVCCVLLVALLTVSFTNGE---DPYRFYNWNVTYGDIYPLGVKQQGILINGQFPG  57

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQIDCVTNDNLII+V+N L+EPFL+SWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ 
Sbjct  58    PQIDCVTNDNLIISVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQV  117

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSY+YFPSL  HKAAGGYG I+I SRP IPVPF PPA DFT+LAGDW K+++  L+
Sbjct  118   KDQIGSYYYFPSLAFHKAAGGYGGIKISSRPRIPVPFDPPAGDFTILAGDWFKQNHTDLK  177

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILD G+NLP PDGL+INGRG NG TFTVD G+TYRFRISNVGIATSINFRIQGHK+ LV
Sbjct  178   AILDGGNNLPFPDGLIINGRGSNGNTFTVDQGKTYRFRISNVGIATSINFRIQGHKMLLV  237

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG HT+Q+T+++LDIHLGQS SVLVTADQ P+DYY+VVS+RFTS+VL+ T++LHYSNS
Sbjct  238   EVEGIHTLQNTYSSLDIHLGQSLSVLVTADQPPQDYYIVVSTRFTSQVLSATSILHYSNS  297

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPTT+++WSL Q RS RRNL+ASGPRPNPQGSYHYG+I   RTI L NSA
Sbjct  298   GGSVSGPPPGGPTTEVDWSLEQARSFRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSA  357

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQRYA+N VSF+ PDTPLK+ADYFKI GVF++GSI D+P  G  YL TSVM A++
Sbjct  358   PIINGKQRYAINSVSFLQPDTPLKVADYFKISGVFSVGSISDNPTGGGGYLQTSVMHADF  417

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R+FVE VF+N E+T+QSWH+DGYSFFVVGMDGGQWT ASR RYNL DTV+RCTVQVYP S
Sbjct  418   RAFVEFVFENPENTLQSWHLDGYSFFVVGMDGGQWTPASRLRYNLMDTVSRCTVQVYPNS  477

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIY+ LDNVGMWN+RSE+WARQYLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR
Sbjct  478   WTAIYVPLDNVGMWNVRSENWARQYLGQQFYLRVYSPVNSWRDEYPIPKNALLCGRASGR  537

Query  1790  HTRPL  1804
              TRPL
Sbjct  538   RTRPL  542



>gb|KHG03845.1| L-ascorbate oxidase [Gossypium arboreum]
Length=542

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/524 (79%), Positives = 457/524 (87%), Gaps = 1/524 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             GV G +PYR++T K+T+GDIYPLGVKQ+ ILINGQFPGP ID VTNDNLII+VYNYLN P
Sbjct  19    GVNGESPYRFFTLKVTHGDIYPLGVKQKGILINGQFPGPTIDAVTNDNLIIHVYNYLNVP  78

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+QQRRNSWQDGV GT CPI P KNFTY+LQ KDQIG++FYFPSL  HKAAGGY
Sbjct  79    FLISWNGVQQRRNSWQDGVLGTNCPIRPGKNFTYVLQVKDQIGTFFYFPSLFFHKAAGGY  138

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G+IRI+SRP IPVPF  PA DFTVLAGDW KR++  L   L+SGH+LP PDGL+INGRGW
Sbjct  139   GSIRIWSRPKIPVPFPTPAGDFTVLAGDWYKRNHYVLRRYLESGHSLPFPDGLVINGRGW  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NGYTFTVDPGRTYRFR+SNVGI+TSINFRIQ HKLKL+EVEGSHT+Q+T+ + DIHLGQS
Sbjct  199   NGYTFTVDPGRTYRFRVSNVGISTSINFRIQSHKLKLIEVEGSHTLQNTYHSFDIHLGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YS LVTADQ P+DYYVV SSRFT RVLTTTA+LHYSNS   VSG  P  PT QI  SL Q
Sbjct  259   YSFLVTADQAPQDYYVVASSRFTPRVLTTTAILHYSNSRKGVSGLIPWAPTFQIAPSLMQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYGMI P+RTIMLANSAPYINGKQRYAVNGVS+V PDTP
Sbjct  319   ARSIRWNLTASGPRPNPQGSYHYGMITPSRTIMLANSAPYINGKQRYAVNGVSYVPPDTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             LKLADYFKI GVFNLGSIP  P  G +AYL TSVM A++R +VEIVFQNWE+TVQSWHID
Sbjct  379   LKLADYFKIPGVFNLGSIPTRPPSGNNAYLQTSVMAADFRKYVEIVFQNWENTVQSWHID  438

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSFFVVGMDGGQWT  SR  YNL D V+RCT QVYPRSWTAIYMALDNVGMWNIRSE+W
Sbjct  439   GYSFFVVGMDGGQWTPDSRRSYNLIDAVSRCTTQVYPRSWTAIYMALDNVGMWNIRSENW  498

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  NS+RDE PIPK+ALLCGRARGR TRPL
Sbjct  499   ARQYLGQQFYLRVYSPANSWRDEYPIPKHALLCGRARGRRTRPL  542



>ref|XP_009135529.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   847 bits (2188),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/525 (76%), Positives = 462/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAVTNDNIIISVFNYLRE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NS+QDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSYQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF  P  DF +LAGDW K ++  L  +L++G N+P PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPSPDGDFWLLAGDWYKTNHYVLRRLLEAGRNVPFPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG AT++NFRIQGH +KLVEVEGSHT+Q+ +T+LD+HLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGTATTLNFRIQGHTMKLVEVEGSHTIQNVYTSLDVHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+VVSSRFT RVLTTT++LHYSNS   VSGP P GPT  I  SLF
Sbjct  257   SYSVLVTANQAPQDYYIVVSSRFTRRVLTTTSILHYSNSRRGVSGPAPSGPTLNIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYG+IKPARTIMLANSAP+INGKQRYAVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGLIKPARTIMLANSAPWINGKQRYAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP +P  G+  YL TSVM AN+R F+EIVFQNWE++VQSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTNPPGGNGGYLTTSVMGANFREFIEIVFQNWENSVQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVG+DGG+WT+ SR++Y LRD V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGVDGGKWTQGSRSKYTLRDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+ SYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSTSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_008384084.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   846 bits (2186),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/525 (78%), Positives = 460/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G +PYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19    NGVNGEDPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SW+G+QQRRNSWQDGV+GTTCPIPP +NFTY +Q KDQIGS+FYFPSL+ HKAAGG
Sbjct  79    PFLISWDGIQQRRNSWQDGVFGTTCPIPPGRNFTYNIQVKDQIGSFFYFPSLQFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEY-ILDSGHNLPLPDGLLINGR  769
             +G IRI+SRP IPVPF  PA DFTVLAGDW K ++  L    LD G  LP PDGLLINGR
Sbjct  139   FGGIRIWSRPKIPVPFPTPAGDFTVLAGDWFKTNHYILRRGFLDRGRALPNPDGLLINGR  198

Query  770   GWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLG  949
             GWNGYTFTVD G+TYRFRISNVG+ TSINFRIQGHK KLVEVEGSHT+Q+ + +LDIHLG
Sbjct  199   GWNGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKXKLVEVEGSHTLQNXYDSLDIHLG  258

Query  950   QSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSL  1129
             QS SVLVTA+Q  +DYYVVVSSRFT +VLTTTAVLHYSNS   VSGP P GPTTQI WS+
Sbjct  259   QSLSVLVTANQPVQDYYVVVSSRFTRQVLTTTAVLHYSNSRNGVSGPIPWGPTTQIAWSV  318

Query  1130  FQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPD  1309
              Q RS+R NL+ASGPRPNPQGSYHYG+IKPARTIML NSAP+INGKQRYAVN VS+V PD
Sbjct  319   SQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLGNSAPWINGKQRYAVNSVSYVQPD  378

Query  1310  TPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             TPLKLADYF I GVF++GSI  +P  GS YL TSVM  ++R +VEIVFQNWEDTVQSWHI
Sbjct  379   TPLKLADYFNIQGVFSVGSIATNPTGGSGYLQTSVMHXDFREYVEIVFQNWEDTVQSWHI  438

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGYSFFV+GM+GGQWT ASR RYNLRDTVAR T QVYPR+WTAIY+ALDNVGMWN+RS++
Sbjct  439   DGYSFFVMGMEGGQWTPASRARYNLRDTVARSTTQVYPRAWTAIYIALDNVGMWNVRSQN  498

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVY+  +S+RDE PIP+NALLCGRARGRHTRPL
Sbjct  499   WARQYLGQQFYLRVYSPAHSWRDEYPIPRNALLCGRARGRHTRPL  543



>ref|XP_008371076.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
 ref|XP_008365611.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=543

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/525 (77%), Positives = 458/525 (87%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G +PYR++TWK+TYGDIYPLGVKQR ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19    NGVIGEDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SW+G+QQRRNSWQDG +GT CPIPP +NFTY +Q KDQIGS+FYFPSL+ HKAAGG
Sbjct  79    PFLISWDGIQQRRNSWQDGNFGTNCPIPPGRNFTYNIQVKDQIGSFFYFPSLKFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEY-ILDSGHNLPLPDGLLINGR  769
             +G IRI+SRP IPVPF  PA DFTVLAGDW K ++  L    LD G  LP PDG+LINGR
Sbjct  139   FGGIRIWSRPKIPVPFPNPAGDFTVLAGDWFKTNHYILRRGYLDRGRALPNPDGILINGR  198

Query  770   GWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLG  949
             GWNGYTFTVD G+TYRFRISNVG+  SINFRIQGHK+KLVEVEGSHT+Q+ + +LDIHLG
Sbjct  199   GWNGYTFTVDQGKTYRFRISNVGLTASINFRIQGHKMKLVEVEGSHTLQNMYDSLDIHLG  258

Query  950   QSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSL  1129
             QS SVLVTA+Q  +DYYVVVSSRFT RVLTTTAVLHYSNS   VSGP P GPTTQI WS+
Sbjct  259   QSLSVLVTANQPVQDYYVVVSSRFTRRVLTTTAVLHYSNSRKGVSGPIPWGPTTQIAWSV  318

Query  1130  FQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPD  1309
              Q RS+R NL+ASGPRPNPQGSYHYG+IKPARTIML NSAP+INGKQRYAVN VS+V PD
Sbjct  319   SQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLGNSAPWINGKQRYAVNSVSYVQPD  378

Query  1310  TPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             TPLKLAD+F I GVF++GSIP +P  GS YL TSVM AN+R +VEIVFQNWEDTVQSWHI
Sbjct  379   TPLKLADHFNIQGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWEDTVQSWHI  438

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DG+SFFV+GM+GGQWT ASR RYN RDTVAR T QVYPR+WTAIY+ALDNVGMWN+RS++
Sbjct  439   DGHSFFVMGMEGGQWTPASRARYNFRDTVARSTTQVYPRAWTAIYIALDNVGMWNVRSQN  498

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             W RQYLGQQFYLRVY+  +S+RDE PIP+NALLCGRARGRHTRPL
Sbjct  499   WERQYLGQQFYLRVYSPAHSWRDEYPIPRNALLCGRARGRHTRPL  543



>ref|XP_009359037.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=543

 Score =   843 bits (2177),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/525 (78%), Positives = 457/525 (87%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV G +PYR++TWK+TYGDIYPLGVKQR ILINGQFPGPQID VTNDNL+I+V+NYL E
Sbjct  19    NGVIGEDPYRFFTWKVTYGDIYPLGVKQRGILINGQFPGPQIDAVTNDNLVISVFNYLRE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SW+G+QQRRNSWQDGV GT CPIPP ++FTY +Q KDQIGS+FYFPSL+ HKAAGG
Sbjct  79    PFLISWDGIQQRRNSWQDGVLGTNCPIPPGRSFTYNIQVKDQIGSFFYFPSLQFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEY-ILDSGHNLPLPDGLLINGR  769
             +G IRI SRP IPVPF  PA DFTVLAGDW K ++  L    LD G  LP PDGLLINGR
Sbjct  139   FGGIRIRSRPKIPVPFPNPAGDFTVLAGDWFKTNHYLLRRGYLDRGRALPNPDGLLINGR  198

Query  770   GWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLG  949
             GWNGYTFTVD GRTYRFRISNVG+ TSINFRIQGHK+KLVEVEGSHT+Q+ + +LDIHLG
Sbjct  199   GWNGYTFTVDRGRTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNMYDSLDIHLG  258

Query  950   QSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSL  1129
             QS SVLVTA+Q  +DYYVVVSSRFT RVLTTTAVLHYSNS   VSGP P GPTTQI WS+
Sbjct  259   QSLSVLVTANQPVQDYYVVVSSRFTRRVLTTTAVLHYSNSRKGVSGPIPWGPTTQIAWSV  318

Query  1130  FQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPD  1309
              Q RS+R NL+ASGPRPNPQGSYHYG+IKPARTIML NSAP+INGKQRYAVN VS+V PD
Sbjct  319   SQARSIRWNLTASGPRPNPQGSYHYGLIKPARTIMLGNSAPWINGKQRYAVNSVSYVQPD  378

Query  1310  TPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             TPLKLADYF I GVF++GSIP +P  GS YL TSVM AN+R +VEIVFQNWEDTVQSWHI
Sbjct  379   TPLKLADYFNIQGVFSVGSIPTNPTGGSGYLQTSVMHANFREYVEIVFQNWEDTVQSWHI  438

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGYSFFV+GM+GGQWT ASR  YN RDTVAR T QVYPR+WTAIY+ALD+VGMWN+RS++
Sbjct  439   DGYSFFVMGMEGGQWTPASRACYNFRDTVARSTTQVYPRAWTAIYIALDSVGMWNVRSQN  498

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             W RQYLGQQFYLRVY+  +S+RDE PIP+NALLCGRARGRHTRPL
Sbjct  499   WGRQYLGQQFYLRVYSPAHSWRDEYPIPRNALLCGRARGRHTRPL  543



>ref|XP_010244491.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=543

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/518 (78%), Positives = 461/518 (89%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP ID V+NDNLII+VYN L+EPFL+SW
Sbjct  26    DPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPLIDSVSNDNLIISVYNSLDEPFLISW  85

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  86    NGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  145

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP+IPVPF PPA D+T+LAGDW K+++  L+ ILDSGH+LP PDGLLINGRG NGYTF
Sbjct  146   NSRPMIPVPFPPPAGDYTILAGDWFKQNHTDLKAILDSGHDLPFPDGLLINGRGLNGYTF  205

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFRISNVG+ TSINFRI GHK+ LVEVEGSHT+Q+T+++LDIHLGQSYSVLV
Sbjct  206   TVDQGKTYRFRISNVGLTTSINFRIAGHKMTLVEVEGSHTLQNTYSSLDIHLGQSYSVLV  265

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P+DYY+VVS+RFTS VLTTTA+LHYSNS  +VSGPPPGGPT +I+WSL Q RS+R
Sbjct  266   TADQPPQDYYIVVSTRFTSPVLTTTAILHYSNSAGQVSGPPPGGPTIEIDWSLNQARSIR  325

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI LAN+AP INGKQRYAVN VSF+  DTPLK+AD
Sbjct  326   WNLTASGPRPNPQGSYHYGLINTTRTIRLANNAPVINGKQRYAVNSVSFIPADTPLKIAD  385

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             Y+KI GVF LGSIPD+P  G  YL TSVM A++R+FVEIVF+NWEDT+QSWHIDGYSFFV
Sbjct  386   YYKIPGVFTLGSIPDNPTGGGGYLQTSVMAADFRTFVEIVFENWEDTIQSWHIDGYSFFV  445

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQW+ ASR  YNLRDTVARCT QVYP+SWTAIY+ALDNVGMWNIRSE+WARQYLG
Sbjct  446   VGMDGGQWSPASRDTYNLRDTVARCTTQVYPKSWTAIYVALDNVGMWNIRSENWARQYLG  505

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  506   QQFYLRVYSPANSWRDEYPIPKNALLCGRASGRRTRPL  543



>ref|XP_004293304.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/526 (77%), Positives = 460/526 (87%), Gaps = 2/526 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             +G  G +PY+  TWKITYGDIYPLGVKQ+ ILIN QFPGPQID VTN NL+I+V+NYL+E
Sbjct  19    HGANGEDPYKLLTWKITYGDIYPLGVKQQGILINNQFPGPQIDAVTNMNLVISVFNYLSE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSW+G+QQRRNSWQDG+ GT CPI P +NFTY +Q KDQIGS+FYFPS   HKAAGG
Sbjct  79    PFLLSWDGIQQRRNSWQDGMPGTNCPILPGRNFTYNIQVKDQIGSFFYFPSFLFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE-YILDSGHNLPLPDGLLINGR  769
             +G IRI+SRP IPVPF  PA D TVLAGDW K ++  L  Y L+ G NLPLPDGLLINGR
Sbjct  139   FGGIRIWSRPKIPVPFPNPAGDHTVLAGDWFKTNHYILRRYFLERGQNLPLPDGLLINGR  198

Query  770   GWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLG  949
             GWNGYTF V+PG+TYRFRISNVG+ TS+NFRIQGHK+KLVEVEGSHT+Q+T+  LDIHLG
Sbjct  199   GWNGYTFNVEPGKTYRFRISNVGLTTSLNFRIQGHKMKLVEVEGSHTLQNTYDALDIHLG  258

Query  950   QSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSL  1129
             QSYSVLVTADQ  KDYYVVVSSRFT+++LTTTA+LHY+NS   VSGP P GPT Q+ WSL
Sbjct  259   QSYSVLVTADQPAKDYYVVVSSRFTTKILTTTAILHYTNSRQGVSGPIPWGPTNQVAWSL  318

Query  1130  FQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPD  1309
              Q RS+R NL+ASGPRPNPQGSYHYGMIKPARTIMLANSAP+INGKQRYAVNGVS++ P+
Sbjct  319   NQARSIRWNLTASGPRPNPQGSYHYGMIKPARTIMLANSAPWINGKQRYAVNGVSYIPPN  378

Query  1310  TPLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWH  1486
             TPLKLAD+F I GVFNLGSI  +P  G+  YL TSVM AN+R FVEIVFQNWED+VQSWH
Sbjct  379   TPLKLADHFNIPGVFNLGSISTNPPGGNGGYLQTSVMHANFREFVEIVFQNWEDSVQSWH  438

Query  1487  IDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSE  1666
             IDGYSFFV+GMDGGQWT+ASR RYNLRDTVAR TVQVYP+SWTAI +ALDNVGMWN+RS+
Sbjct  439   IDGYSFFVLGMDGGQWTQASRARYNLRDTVARSTVQVYPKSWTAISVALDNVGMWNVRSQ  498

Query  1667  DWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             +WARQYLGQQFYLRVY+  +S+RDELPIP+NA+LCGRA+GRHTRPL
Sbjct  499   NWARQYLGQQFYLRVYSPAHSWRDELPIPRNAILCGRAKGRHTRPL  544



>gb|KFK28784.1| hypothetical protein AALP_AA7G047600 [Arabis alpina]
Length=541

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/525 (76%), Positives = 461/525 (88%), Gaps = 1/525 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NGV+G NPYR++TWKITYGDIYPLGVKQ+ ILINGQFPGP ID +TNDN+II+V+NYL E
Sbjct  17    NGVFGDNPYRFFTWKITYGDIYPLGVKQQGILINGQFPGPHIDAITNDNIIISVFNYLKE  76

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR+NSWQDGV GTTCPIPP KNFTY++Q KDQIGS++YFPSL  HKAAG 
Sbjct  77    PFLISWNGVQQRKNSWQDGVIGTTCPIPPGKNFTYIIQVKDQIGSFYYFPSLAFHKAAGA  136

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +GAIR++SRP IPVPF PP  DF +LAGDW K ++  L  +L++G NLP PDG+LINGRG
Sbjct  137   FGAIRVWSRPRIPVPFPPPEGDFWLLAGDWYKTNHYVLRRLLEAGRNLPAPDGVLINGRG  196

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             W G TFTV PG+TYRFRISNVG+ATS+NFRIQGH +KL+EVEGSHT+Q+ +T+LDIHLGQ
Sbjct  197   WGGNTFTVQPGKTYRFRISNVGVATSLNFRIQGHTMKLIEVEGSHTIQNVYTSLDIHLGQ  256

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTA+Q P+DYY+VVS+RFT +VLTTT++LHYSNS   +SGP P GPT  I  SLF
Sbjct  257   SYSVLVTANQAPQDYYIVVSTRFTRKVLTTTSILHYSNSRKGISGPAPSGPTLDIASSLF  316

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q R+++RNL+ASGPRPNPQGSYHYGMIKP RTI+LANSAP+INGKQR+AVNG SFV PDT
Sbjct  317   QARTIKRNLTASGPRPNPQGSYHYGMIKPGRTIILANSAPWINGKQRFAVNGASFVAPDT  376

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGS-AYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             PLKLADYFKI GVFNLGSIP SP  GS  YL +SVM AN+R F+EIVFQNWE ++QSWHI
Sbjct  377   PLKLADYFKIPGVFNLGSIPTSPSGGSGGYLQSSVMAANFREFIEIVFQNWESSIQSWHI  436

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
              GYSFFVVGMDGGQWT  SR +YNL D V+R TVQVYPR+WTAIY+ALDNVGMWNIRSE+
Sbjct  437   SGYSFFVVGMDGGQWTPGSRAKYNLHDAVSRSTVQVYPRAWTAIYIALDNVGMWNIRSEN  496

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRVYTS+NSYRDE P PKNAL+CGRARGRHTRP 
Sbjct  497   WARQYLGQQFYLRVYTSSNSYRDEYPPPKNALMCGRARGRHTRPF  541



>ref|XP_006447580.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 ref|XP_006469673.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Citrus sinensis]
 gb|ESR60820.1| hypothetical protein CICLE_v10014842mg [Citrus clementina]
 gb|KDO54689.1| hypothetical protein CISIN_1g009283mg [Citrus sinensis]
Length=538

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/542 (73%), Positives = 462/542 (85%), Gaps = 4/542 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M  YSS+C L+L  +++        G +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MASYSSICCLLLVFMLVSCTR----GESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPG  56

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             P I+ VTNDNLII+V+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ 
Sbjct  57    PSIEAVTNDNLIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQV  116

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL  HKAAGGYG I+I SRPLIPVPF PPA DFT+LAGDW K+++  L+
Sbjct  117   KDQIGSYFYFPSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLK  176

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILDSG +LP PDGL+INGRG N  TFTVD G+TYRFRISNVGI+TSINFRIQGHK+ LV
Sbjct  177   AILDSGSDLPFPDGLVINGRGSNANTFTVDQGKTYRFRISNVGISTSINFRIQGHKMLLV  236

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+HT+Q+T+ +LDIHLGQSYSVLV ADQ P+ YY+V+S+RFTS+VL+ T+VLHYSNS
Sbjct  237   EVEGTHTLQNTYDSLDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNS  296

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPTTQI+WSL Q RSLRRNL+ASGPRPNPQGSYHYG+I    TI L N+A
Sbjct  297   AGSVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTA  356

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQRYAVN VSF+  DTPLKLADYFKI GVF++GSIPD+P  G AYL TSVM A++
Sbjct  357   PTINGKQRYAVNSVSFIPADTPLKLADYFKIPGVFSVGSIPDNPTGGGAYLQTSVMAADF  416

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R F E+VF+N EDT+QSWHIDG++FF VGMDGG+WT ASR  YNLRDT++RCTVQVYP+S
Sbjct  417   RGFAEVVFENPEDTLQSWHIDGHNFFAVGMDGGEWTPASRLTYNLRDTISRCTVQVYPKS  476

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTA+Y+ LDNVGMWNIRSE+WARQYLGQQFYLRVY+S NS+RDE PIP NALLCGRA G 
Sbjct  477   WTAVYVPLDNVGMWNIRSENWARQYLGQQFYLRVYSSANSWRDEYPIPSNALLCGRAVGH  536

Query  1790  HT  1795
              T
Sbjct  537   RT  538



>ref|XP_010686816.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=543

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/524 (77%), Positives = 464/524 (89%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             NG+ G NPYR+Y WK+TYG IYPLG+KQ+ I+INGQFPGPQIDCVTNDNL+I+V+NYLNE
Sbjct  20    NGINGENPYRFYDWKVTYGYIYPLGIKQQVIMINGQFPGPQIDCVTNDNLVISVHNYLNE  79

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNGLQ RRNS+QDG+ GTTCPIPPR+N+TY+LQAKDQIGS+FYFPS+ +HKA+GG
Sbjct  80    PFLLSWNGLQNRRNSYQDGMPGTTCPIPPRRNYTYVLQAKDQIGSFFYFPSINLHKASGG  139

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             YGAIRIYSRP IPVPF PPA DFTVLAGDW K+S+RQL ++L+ G N+ +PDGLLINGRG
Sbjct  140   YGAIRIYSRPRIPVPFPPPAGDFTVLAGDWYKKSHRQLMHMLERGRNIRMPDGLLINGRG  199

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTV+ GRTYRFRISNVGI+TSINFRI GH+LKLVEVEG+HT+QS++T+LDIHLGQ
Sbjct  200   WNGYTFTVEQGRTYRFRISNVGISTSINFRIAGHRLKLVEVEGTHTMQSSYTSLDIHLGQ  259

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTADQ P DYYVVVSSRFT  VLTTTAVLHY NS+ +VSGP P GPTTQI WSL 
Sbjct  260   SYSVLVTADQPPDDYYVVVSSRFTKPVLTTTAVLHYRNSWKKVSGPLPRGPTTQIGWSLN  319

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q  S+R NL+ASGPRPNPQGSYHYGMIK  RTI+LANSA YING+QRYA+N VS+V  DT
Sbjct  320   QAHSIRMNLTASGPRPNPQGSYHYGMIKLQRTIVLANSAAYINGRQRYAINSVSYVQADT  379

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYF I GV+   S+P SP W  AY  T+V+  +YR+F+E+VFQN EDTVQS+HID
Sbjct  380   PLKLADYFNIPGVYYSNSMPSSPSWRPAYQQTAVLQTDYRTFIEMVFQNQEDTVQSYHID  439

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GY+FFVVGMDGGQWT  SR  YNLRD V R TVQVYP++WTA+YM+LDNVGMWNIRSE+W
Sbjct  440   GYAFFVVGMDGGQWTPRSRASYNLRDAVTRSTVQVYPKAWTAVYMSLDNVGMWNIRSENW  499

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
              RQYLGQQFY+RVYT+++S+RDE PIPKNALLCGRARGRHTRP+
Sbjct  500   IRQYLGQQFYMRVYTNSHSWRDEYPIPKNALLCGRARGRHTRPM  543



>ref|XP_003549771.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=549

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/523 (77%), Positives = 449/523 (86%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL EPF
Sbjct  27    VHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPF  86

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNGLQ RRNSWQDGVYGT CPIPP +N TY +Q KDQIGSYFYFPSL MHKAAG +G
Sbjct  87    LISWNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSLGMHKAAGAFG  146

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI+SRP IPVPF  PA D T+LAGDW K  +R+L  +L++GHNLP PDGLLINGRGWN
Sbjct  147   GIRIWSRPQIPVPFPSPAGDITILAGDWFKLDHRRLRRLLENGHNLPFPDGLLINGRGWN  206

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTVD G+TYRFRISNVG+ TSINFRIQGH LKLVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  207   GNTFTVDQGKTYRFRISNVGLTTSINFRIQGHSLKLVEVEGSHTLQNTYSSLDVHLGQSY  266

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  KDYY+VVS+RFT R+LTTT+VLHYS S T VSGP P GPT  I  S++Q 
Sbjct  267   SVLVTADQPVKDYYMVVSTRFTRRILTTTSVLHYSYSKTGVSGPVPPGPTLDIASSVYQA  326

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+IKP+RTIMLANSAPYINGKQRYAVNGVS+  PDTPL
Sbjct  327   RTIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYAVNGVSYNEPDTPL  386

Query  1319  KLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             KLADYF I GVF +GSIP  P  G +AYL TSVM AN+   VEIVFQNWED+VQSWHIDG
Sbjct  387   KLADYFNIPGVFYVGSIPTYPNGGNNAYLQTSVMGANFHELVEIVFQNWEDSVQSWHIDG  446

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVG   GQWT  SR +YNLRDTVARCT QVYPRSWTAIYMALDNVGMWNIRSE+W 
Sbjct  447   YSFFVVGYGSGQWTADSRVQYNLRDTVARCTTQVYPRSWTAIYMALDNVGMWNIRSENWG  506

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S+RDE P+PKNALLCGRA GR TRP 
Sbjct  507   RQYLGQQLYLRVYTPSKSWRDEYPVPKNALLCGRASGRRTRPF  549



>emb|CDP10787.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/522 (74%), Positives = 451/522 (86%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             + G +PY+++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI  VTN+NLI++V+N LNEPF
Sbjct  20    INGEDPYQFFTWNVTYGDIYPLGVKQQGILINGQFPGPQITSVTNENLIVSVFNSLNEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL   KAAGGYG
Sbjct  80    LLSWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFQKAAGGYG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             +IRIYSR +IPVPF PPA ++T+LAGDW K+++  L  ILD GH+LP PDG+LINGRG N
Sbjct  140   SIRIYSRSVIPVPFPPPAAEYTILAGDWFKQNHTDLRAILDGGHDLPFPDGILINGRGSN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVD G+TYRFRISNVG+ TS+NFRIQGHK+ LVEVEG+HT+Q+T+ + D+HLGQS 
Sbjct  200   GYTFTVDQGKTYRFRISNVGLVTSLNFRIQGHKMLLVEVEGTHTLQNTYDSFDLHLGQSC  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+V S+RFTS+VLT T++LHYSNS   V GPPPGGPTT+I+WSL Q 
Sbjct  260   SVLVTADQPARDYYIVFSTRFTSQVLTATSLLHYSNSAVSVVGPPPGGPTTEIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R+NL+ASGPRPNPQGSYHYGM+   RTI LANSAP INGK+RYAVN VSFV  DTPL
Sbjct  320   RSIRQNLTASGPRPNPQGSYHYGMVNTTRTIRLANSAPVINGKKRYAVNSVSFVPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+ I GVF+LGS+PD+P     YL TSVM A++R+F E+VF+N EDTVQSWHIDG+
Sbjct  380   KLADYYNIQGVFSLGSMPDNPTGSGGYLQTSVMAADFRAFFEVVFENSEDTVQSWHIDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
              FFVVGMDGGQW+ ASR+ YNLRD ++RCTVQVYPRSWTA+YM LDNVGMWN+RSE+WAR
Sbjct  440   IFFVVGMDGGQWSPASRSNYNLRDGISRCTVQVYPRSWTALYMPLDNVGMWNVRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS RDE PIPKNALLCGRA GR TRP 
Sbjct  500   QYLGQQFYLRVYSPANSLRDEYPIPKNALLCGRASGRKTRPF  541



>ref|XP_002269614.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI28811.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/522 (77%), Positives = 458/522 (88%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             + G +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I+ VTNDNLI++VYN L+EPF
Sbjct  20    ISGEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPPIESVTNDNLIVSVYNSLDEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL  HKAAGGYG
Sbjct  80    LLSWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              I+I SRPLIPVPF PPA D+T+LAGDW K+++  L+ ILD G +LP PDGLLINGRG N
Sbjct  140   GIKISSRPLIPVPFPPPAGDYTILAGDWYKKNHTDLKAILDGGSDLPFPDGLLINGRGSN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVD G+TYRFRISNVGIATS+NFRIQGHK+ LVEVEG+H +Q+T+++LDIHLGQSY
Sbjct  200   GYTFTVDQGKTYRFRISNVGIATSLNFRIQGHKMLLVEVEGTHALQNTYSSLDIHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVS+RFTS+VLTTT+ LHYSNS  RVSGPPPGGPT Q +WSL Q 
Sbjct  260   SVLVTADQPAQDYYIVVSTRFTSQVLTTTSTLHYSNSAGRVSGPPPGGPTIQTDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+RRNL+ASGPRPNPQGSYHYG+I    TI LANSAP INGKQRYAVN VSF+  DTPL
Sbjct  320   RSIRRNLTASGPRPNPQGSYHYGLINTTHTIRLANSAPVINGKQRYAVNSVSFIPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVFNLGSIPD+P  G  YL TSVM A++R F E+VF+N EDT+QSWHIDG+
Sbjct  380   KLADYFKISGVFNLGSIPDNPTGGGGYLQTSVMAADFRGFAEVVFENPEDTLQSWHIDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +FFVVGMDGGQWT +SR  YNLRDT++RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WAR
Sbjct  440   NFFVVGMDGGQWTPSSRLSYNLRDTISRCTVQVYPKSWTALYMPLDNVGMWNVRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  500   QYLGQQFYLRVYSPANSWRDEYPIPKNALLCGRASGRKTRPL  541



>ref|XP_010046372.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW88773.1| hypothetical protein EUGRSUZ_A01118 [Eucalyptus grandis]
Length=542

 Score =   826 bits (2134),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/516 (76%), Positives = 442/516 (86%), Gaps = 0/516 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PY +Y W +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L+EPFLL
Sbjct  26    GEDPYSFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNALDEPFLL  85

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQ+RNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G  
Sbjct  86    SWNGVQQKRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGFGGF  145

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SR +IPVPF PPA DFT+LAGDW  +++  L  ILD G +LP PDGLLINGRG NGY
Sbjct  146   KILSRSVIPVPFPPPANDFTILAGDWFTKNHSDLRAILDGGSDLPFPDGLLINGRGSNGY  205

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+T+RFRISNVGI T+INFRIQGHK+ LVEVEG+HT+Q+T+ +LDIHLGQS SV
Sbjct  206   TFTVDQGKTHRFRISNVGITTAINFRIQGHKMVLVEVEGTHTLQNTYDSLDIHLGQSCSV  265

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVT DQ  +DYY+VVS+RFTS VLTTT++LHYSNS   VSGPPPGGPT QI+WSL Q RS
Sbjct  266   LVTCDQPAQDYYIVVSTRFTSEVLTTTSILHYSNSAGSVSGPPPGGPTMQIDWSLEQARS  325

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +RRNL+ASGPRPNPQGSYHYGMI   +TI LANSA  INGKQRYAVN VSFV  DTPLKL
Sbjct  326   MRRNLTASGPRPNPQGSYHYGMINTTQTIRLANSASVINGKQRYAVNSVSFVPADTPLKL  385

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYF I GVF LGSIP+SP  G+AYL TSVM A++R + EIVF+N EDTVQSWHIDG++F
Sbjct  386   ADYFNIPGVFTLGSIPNSPTGGAAYLQTSVMAADFRGYAEIVFENSEDTVQSWHIDGHNF  445

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQWT ASR  YNLRDT++RCTVQVYP SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  446   FVVGMDGGQWTPASRLSYNLRDTISRCTVQVYPNSWTAVYMPLDNVGMWNVRSENWARQY  505

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             LGQQFY RVY+S  S+RDE PIP NALLCGRA G H
Sbjct  506   LGQQFYFRVYSSAKSWRDEYPIPSNALLCGRAAGHH  541



>gb|AGJ03718.1| multicopper oxidase [Citrus maxima]
Length=538

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/542 (73%), Positives = 460/542 (85%), Gaps = 4/542 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M  YSS+C L+L  +++        G +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MASYSSICCLLLVFMLVSCTR----GESPYRFFNWNVTYGDIYPLGVKQQGILINGQFPG  56

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             P I+ VTNDNLII+V+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPI P KNFTY+LQ 
Sbjct  57    PSIEAVTNDNLIISVFNALDEPFLISWNGVQQRRNSWQDGVYGTNCPISPGKNFTYVLQV  116

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL  HKAAGGYG I+I SRPLIPVPF PPA DFT+LAGDW K+++  L+
Sbjct  117   KDQIGSYFYFPSLAFHKAAGGYGGIKIASRPLIPVPFDPPAGDFTILAGDWYKKNHTDLK  176

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILDSG +LP PDGL+INGRG N  TFTVD G+TYRFRISNVGI+TSINFRIQGHK+ LV
Sbjct  177   AILDSGSDLPFPDGLVINGRGSNANTFTVDQGKTYRFRISNVGISTSINFRIQGHKMLLV  236

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+HT+Q+T+ +LDIHLGQSYSVLV ADQ P+ YY+V+S+RFTS+VL+ T+VLHYSNS
Sbjct  237   EVEGTHTLQNTYDSLDIHLGQSYSVLVRADQPPQGYYIVISTRFTSQVLSATSVLHYSNS  296

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPTTQI+WSL Q RSLRRNL+ASGPRPNPQGSYHYG+I    TI L N+ 
Sbjct  297   AGSVSGPPPGGPTTQIDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTHTIRLQNTG  356

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQRYAVN VSF+  DTPLKLADYFKI GVF++G+IPD+P  G AYL TSVM A++
Sbjct  357   PTINGKQRYAVNSVSFIPADTPLKLADYFKIPGVFSVGNIPDNPTGGGAYLQTSVMAADF  416

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R F E+VF+N EDT+QSWHIDG++FF VGMDGG+WT ASR  YNLRDT++RCTVQVYP+S
Sbjct  417   RGFAEVVFENPEDTLQSWHIDGHNFFAVGMDGGEWTPASRLTYNLRDTISRCTVQVYPKS  476

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTA+Y+ LDNVGMWNIRSE+WARQYLGQQFYLRVY+S NS+RDE PIP NALLCGRA G 
Sbjct  477   WTAVYVPLDNVGMWNIRSENWARQYLGQQFYLRVYSSANSWRDEYPIPSNALLCGRAVGH  536

Query  1790  HT  1795
              T
Sbjct  537   RT  538



>ref|XP_002524823.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF37543.1| multicopper oxidase, putative [Ricinus communis]
Length=538

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/517 (75%), Positives = 447/517 (86%), Gaps = 0/517 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             + G +PYR+Y+W I+YGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L+EPF
Sbjct  22    INGEDPYRFYSWNISYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGSYFYFPSL MHKAAGGYG
Sbjct  82    LISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGYG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               +I SR +IPVPF PPA DFTVLAGDW + ++  L+ ILD G +LP PDGLLINGRG N
Sbjct  142   GFKIASRSVIPVPFPPPAGDFTVLAGDWFRMNHTDLKAILDGGSDLPFPDGLLINGRGSN  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTF+VD G+TYRFRISNVG+ TSINFRIQGHK+ LVEVEG+HT+Q+T+ +LDIHLGQSY
Sbjct  202   GYTFSVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHTLQNTYDSLDIHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVS+RFTS+V TTT++LHYSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  262   SVLVTADQPAQDYYIVVSTRFTSQVFTTTSILHYSNSAGSVSGPPPGGPTIQIDWSLEQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+RRNLSASGPRPNPQGSYHYG++   RTI L NSA  INGKQRYAVN VSF   DTPL
Sbjct  322   RSIRRNLSASGPRPNPQGSYHYGLVNTTRTIRLQNSASMINGKQRYAVNSVSFTPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+F I GVF+LGSIPD+P  G AYL TSVM A++R + E+VF N EDT+QSWHIDG+
Sbjct  382   KLADHFNIPGVFSLGSIPDNPTGGGAYLQTSVMAADFRGYAEVVFDNPEDTLQSWHIDGH  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +FFVVGMDGGQW+ ASR  YNLRDT++RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WA 
Sbjct  442   NFFVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMWNVRSENWAH  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             QYLGQQFYLRVY+  NS+RDE PIP NALLCGRA GR
Sbjct  502   QYLGQQFYLRVYSPANSWRDEYPIPSNALLCGRAAGR  538



>gb|KDP22727.1| hypothetical protein JCGZ_01829 [Jatropha curcas]
Length=541

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/520 (75%), Positives = 446/520 (86%), Gaps = 0/520 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR+Y+W +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTN+NLIIN++N L+EPF
Sbjct  20    VSGEDPYRFYSWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINIFNSLDEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPP +NFTYMLQ KDQIGSYFYFPSL MHKAAGG G
Sbjct  80    LLSWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYMLQVKDQIGSYFYFPSLGMHKAAGGIG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               +I SR +IPVPF PPA DFTVLAGDW K+++  L+ ILD G +LP PDGLLINGR  N
Sbjct  140   GFKIASRSVIPVPFPPPAGDFTVLAGDWFKKNHTDLKAILDGGSDLPFPDGLLINGRASN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTVD G+TYRFRISNVG+ TSINFRIQGHK+ LVEVEG+HT+Q+T+ +LDIHLGQSY
Sbjct  200   GYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHTLQNTYDSLDIHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVS+RFTS+VLT T+ LHYSNS   VSGPPPGGPTTQ++WSL Q 
Sbjct  260   SVLVTADQPAQDYYIVVSTRFTSQVLTATSTLHYSNSAGSVSGPPPGGPTTQVDWSLEQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R+NL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQRYAVN VSF+  DTPL
Sbjct  320   RSIRKNLTASGPRPNPQGSYHYGLINTTRTIRLQNSAPIINGKQRYAVNSVSFIPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+F I GVF+LGSIPD+P  G AYL TSVM A++R + EI+F+N EDTVQSWH+DG+
Sbjct  380   KLADHFNIPGVFSLGSIPDNPTGGGAYLQTSVMAADFRGYAEIIFENTEDTVQSWHVDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
               FVVGMDGGQW+ ASR  YNLRDT++R TVQVYP+SWTA+YM LDNVGMWNIRSE+WA 
Sbjct  440   ILFVVGMDGGQWSPASRLSYNLRDTISRNTVQVYPKSWTAVYMPLDNVGMWNIRSENWAH  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             QYLGQQFYLRVY+  NS+RDE PIP N +LCGRA GR  R
Sbjct  500   QYLGQQFYLRVYSPANSWRDEYPIPTNTILCGRAAGRQIR  539



>ref|XP_007046383.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY02215.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=540

 Score =   824 bits (2129),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/517 (76%), Positives = 447/517 (86%), Gaps = 0/517 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G + YR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTN+NLIINV+N L++PFL+
Sbjct  24    GEDAYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNENLIINVFNSLDQPFLI  83

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP  NFTY LQ KDQIGSYFYFPSL +HKAAGGYG  
Sbjct  84    SWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGF  143

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             RI SR +IPVPF PPA D+T+LAGDW K+++  L+ ILDSG +LP PDGLLINGRG NGY
Sbjct  144   RILSRSVIPVPFPPPAADYTILAGDWYKKNHTDLKAILDSGSDLPFPDGLLINGRGANGY  203

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVG+ TSINFRIQGHKL LVEVEG+HT+Q+T+ +LDIHLGQSYSV
Sbjct  204   TFTVDQGKTYRFRISNVGLTTSINFRIQGHKLLLVEVEGTHTLQNTYDSLDIHLGQSYSV  263

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ  +DYY+V S+RFTS+VL TTAVLHYSNS   VSGP PGGPTTQI+WSL Q RS
Sbjct  264   LVTADQPAQDYYIVASTRFTSQVLATTAVLHYSNSAGTVSGPLPGGPTTQIDWSLEQARS  323

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +RRNL+ASGPRPNPQGSYHYG+I   RTI LA+SA  INGKQRYAVN VSF+  DTPLKL
Sbjct  324   IRRNLTASGPRPNPQGSYHYGLINTTRTIRLASSASIINGKQRYAVNSVSFIPADTPLKL  383

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYF I GVF+LGSIP  P  G AYL TSVM A++R + EIVF+N EDT+QSWHIDG++F
Sbjct  384   ADYFNISGVFSLGSIPVGPTGGGAYLQTSVMAADFRGYTEIVFENPEDTLQSWHIDGHNF  443

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQWT ASR  YNLRDT++RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  444   FVVGMDGGQWTPASRLTYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMWNVRSENWARQY  503

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHT  1795
             LGQQFYLRVY+   S+RDE PIP+NALLCGRA G+ T
Sbjct  504   LGQQFYLRVYSPAKSWRDEYPIPRNALLCGRAVGQRT  540



>ref|XP_003605947.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES88144.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=538

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/516 (75%), Positives = 443/516 (86%), Gaps = 0/516 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L+EPFL+
Sbjct  22    GEDPYRFYNWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIINVFNSLDEPFLI  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+ QRRNSWQDGVYGT CPI P +NFTY+LQ KDQIGSYFYFPSL  HKAAGGYG  
Sbjct  82    SWNGVLQRRNSWQDGVYGTNCPISPGQNFTYILQVKDQIGSYFYFPSLAFHKAAGGYGGF  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
              I SR +IPVPF PP+ D+T+LAGDW KR++  L  ILDSG +LP PDGL+INGRG N Y
Sbjct  142   TIASRSVIPVPFDPPSGDYTILAGDWYKRNHTDLRAILDSGSDLPFPDGLVINGRGSNAY  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TF VD G+TYRFRISNVGI TSINFRIQGHK+KLVEVEGSHT+Q+T+ +LDIHLGQ+YSV
Sbjct  202   TFAVDQGKTYRFRISNVGITTSINFRIQGHKIKLVEVEGSHTLQNTYDSLDIHLGQTYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P DYY+VV++RFTS+VL  +++LHYSNS   VSGP PGGPTT+I+WS+ Q RS
Sbjct  262   LVTADQPPHDYYIVVTTRFTSQVLNASSILHYSNSAGSVSGPLPGGPTTEIDWSVEQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYGMI   RTI L NSAP INGKQRYAVNGVSF+  DTPLKL
Sbjct  322   LRRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPIINGKQRYAVNGVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             AD+F I GVF+LGSIPD+P  G  YL TSVM A++R FVE+VF+N EDT+QSWHIDG+SF
Sbjct  382   ADHFNIQGVFSLGSIPDNPTGGGGYLQTSVMAADFRGFVEVVFENPEDTLQSWHIDGHSF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT+AR TVQVYP+SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  442   FVVGMDGGQWSAASRLNYNLRDTIARSTVQVYPKSWTALYMPLDNVGMWNVRSENWARQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             LG QFYLRVY+STNS RDE PIP NAL CG+A G H
Sbjct  502   LGHQFYLRVYSSTNSLRDEYPIPSNALQCGKAVGHH  537



>ref|XP_010686815.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=548

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/524 (76%), Positives = 461/524 (88%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N + G +PYR++T K+ YG IYP+GV+Q  I+INGQFPGPQIDCVTNDNL+I+V+NYLNE
Sbjct  25    NHINGESPYRFFTLKVHYGIIYPMGVRQNVIMINGQFPGPQIDCVTNDNLVISVHNYLNE  84

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNGLQ RRNS+QDG+ GTTCPIPPR+N+TY+LQAKDQIGS+FYFPS+ +HKA+GG
Sbjct  85    PFLLSWNGLQNRRNSYQDGMPGTTCPIPPRRNYTYVLQAKDQIGSFFYFPSINLHKASGG  144

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             YGAIRIYSRP IPVPF PPA DFTVLAGDW K+S+RQL ++L+ G N+ +PDGLLINGRG
Sbjct  145   YGAIRIYSRPRIPVPFPPPAGDFTVLAGDWYKKSHRQLMHMLERGRNIRMPDGLLINGRG  204

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNGYTFTV+ GRTYRFRISNVGI+TSINFRI GH+LKLVEVEG+HT+QS++T+LDIHLGQ
Sbjct  205   WNGYTFTVEQGRTYRFRISNVGISTSINFRIAGHRLKLVEVEGTHTMQSSYTSLDIHLGQ  264

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTADQ P DYYVVVSSRFT  VLTTTAVLHY NS+ +VSGP P GPTTQI WSL 
Sbjct  265   SYSVLVTADQPPDDYYVVVSSRFTKPVLTTTAVLHYRNSWKKVSGPLPRGPTTQIGWSLN  324

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q  S+R NL+ASGPRPNPQGSYHYGMIK  RTI+LANSA YING+QRYA+N VS+V  DT
Sbjct  325   QAHSIRMNLTASGPRPNPQGSYHYGMIKLQRTIVLANSAAYINGRQRYAINSVSYVQADT  384

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYF I GV+   S+P SP W  AY  T+V+  +YR+F+E+VFQN EDTVQS+HID
Sbjct  385   PLKLADYFNIPGVYYSNSMPSSPSWRPAYQQTAVLQTDYRTFIEMVFQNQEDTVQSYHID  444

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GY+FFVVGMDGGQWT  SR  YNLRD V R TVQVYP++WTA+YM+LDNVGMWNIRSE+W
Sbjct  445   GYAFFVVGMDGGQWTPRSRASYNLRDAVTRSTVQVYPKAWTAVYMSLDNVGMWNIRSENW  504

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
              RQYLGQQFY+RVYT+++S+RDE PIPKNALLCGRARGRHTRP+
Sbjct  505   IRQYLGQQFYMRVYTNSHSWRDEYPIPKNALLCGRARGRHTRPM  548



>ref|XP_003610452.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|AES92649.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=545

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/545 (75%), Positives = 461/545 (85%), Gaps = 0/545 (0%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M+ Y +V S +  V IL L    V   +PYR++TWKITYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MKSYYNVVSSLFLVTILLLFFTSVKCEDPYRFFTWKITYGDIYPLGVKQQGILINGQFPG  60

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQID VTN+NLII+VYNYL EPFL+SWNG+Q RRNSWQDGV GT CPIPP KNFTY LQ 
Sbjct  61    PQIDAVTNENLIISVYNYLTEPFLISWNGIQHRRNSWQDGVSGTNCPIPPGKNFTYTLQV  120

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIG+YFYFPSL MHKAAG +G IRI+SRP IPVPF PPA DFT+LAGDWSK  +R+L 
Sbjct  121   KDQIGTYFYFPSLGMHKAAGAFGGIRIWSRPRIPVPFPPPAGDFTLLAGDWSKLGHRRLR  180

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              +L++GHNLP PDGLLINGRGWNG TFTVD G+TYRFRISNVG+ATSINFRIQGH LKLV
Sbjct  181   RVLENGHNLPFPDGLLINGRGWNGNTFTVDQGKTYRFRISNVGLATSINFRIQGHSLKLV  240

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEGSHT+Q+T+++LDIHLGQSYSVLV A+Q  KDYY+VVS+RFT RVLTTT++LHYS S
Sbjct  241   EVEGSHTLQNTYSSLDIHLGQSYSVLVMANQPVKDYYIVVSTRFTRRVLTTTSILHYSYS  300

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGP P GPT  +  S+FQ R++R NL+ASGPRPNPQGSYHYG+IKP RTIMLANSA
Sbjct  301   RIGVSGPVPPGPTLDVVSSVFQARTIRWNLTASGPRPNPQGSYHYGLIKPTRTIMLANSA  360

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             PYINGKQRYAVN VS++ PDTPLKLADYF I GVF +G I  SP  G+AYL T+VM AN+
Sbjct  361   PYINGKQRYAVNSVSYIAPDTPLKLADYFNIPGVFYVGGISTSPTGGNAYLQTAVMGANF  420

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
               +VEIVFQNWE++VQSWHIDGYSFFVVG   GQWT  SR RYNLRDTVARCT QVYPRS
Sbjct  421   HEYVEIVFQNWENSVQSWHIDGYSFFVVGFGSGQWTPNSRGRYNLRDTVARCTTQVYPRS  480

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTAIYMALDNVGMWNIRSE+W RQYLGQQFYLRVYT + S RDE P+PKNALLCGRA GR
Sbjct  481   WTAIYMALDNVGMWNIRSENWERQYLGQQFYLRVYTPSKSLRDEYPVPKNALLCGRASGR  540

Query  1790  HTRPL  1804
              TRP 
Sbjct  541   VTRPF  545



>ref|XP_009353293.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=542

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/520 (76%), Positives = 456/520 (88%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+Y W +TYGDIYPLG+KQ+ ILINGQFPGPQI+ VTNDNLII+V+N L+EPFL+
Sbjct  23    GEDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLI  82

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ KDQIGSYFYFPSL +HKAAGG+G I
Sbjct  83    SWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGLHKAAGGFGGI  142

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP IPVPF PPA DFT+LAGDW  +++  L+ ILD G+NLP PDGLLINGRG NG+
Sbjct  143   KIDSRPRIPVPFPPPAGDFTILAGDWFSKNHTDLKAILDGGNNLPFPDGLLINGRGSNGF  202

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYR RISNVG  T INFRIQGHK+ LVEVEG+H++Q+T+++LDIHLGQSYSV
Sbjct  203   TFTVDQGKTYRLRISNVGRTTHINFRIQGHKMLLVEVEGTHSLQNTYSSLDIHLGQSYSV  262

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ PKDYY+VVSSRFTS+V++ T++LHYSNS   VSGPPPGGPTTQI+WSL Q RS
Sbjct  263   LVTADQPPKDYYIVVSSRFTSQVVSATSILHYSNSAGSVSGPPPGGPTTQIDWSLEQARS  322

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQRYAVN VSF+ PDTPLKL
Sbjct  323   LRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAVNSVSFIKPDTPLKL  382

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             AD+FKI GVF+LGSI D+P  G AYL TSVM+A++R F E+VF+N EDTVQSWHIDG++F
Sbjct  383   ADHFKISGVFSLGSIQDNPTGGGAYLQTSVMNADFRGFAELVFENPEDTVQSWHIDGHNF  442

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQWT ASR RYNLRDT++R TVQVYP SWTAIYM LDNVGMWNIRSE+WARQY
Sbjct  443   FVVGMDGGQWTPASRLRYNLRDTISRSTVQVYPNSWTAIYMPLDNVGMWNIRSENWARQY  502

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFY RVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  503   LGQQFYFRVYSPANSWRDEYPIPRNALLCGRALGRRTRPL  542



>ref|XP_010676489.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=549

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/513 (75%), Positives = 445/513 (87%), Gaps = 0/513 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW +TYGDIYPLGVKQ+ ILINGQFPGP I+ VTNDNLI++V+N L+EPFLLSW
Sbjct  26    SPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPPIEAVTNDNLIVSVFNSLDEPFLLSW  85

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSY+YFPSL  HKAAGGYG IRI
Sbjct  86    NGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYYYFPSLAFHKAAGGYGGIRI  145

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVP+  PA DFTVLAGDW K ++  L+ ILD G +LP PDGL+INGRG +G+TF
Sbjct  146   DSRPLIPVPYPTPAGDFTVLAGDWYKMNHTDLKAILDGGKDLPSPDGLIINGRGPSGFTF  205

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFRISNVGIATSINFRI GHK  LVE EG HT+Q+T+++LD+HLGQSYS+LV
Sbjct  206   TVDQGKTYRFRISNVGIATSINFRIDGHKFILVETEGDHTLQNTYSSLDVHLGQSYSILV  265

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             T DQ PKDYYVVVSSRFT+ VLTTT++LHYSNS   VSG PPGGPTTQI+WS+ Q RS+R
Sbjct  266   TMDQPPKDYYVVVSSRFTTDVLTTTSILHYSNSAASVSGLPPGGPTTQIDWSINQARSVR  325

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
             +NL+ASGPRPNPQGSYHYGMI   RTI LANSAP INGKQRYAVNGVSF+  DTPLKLAD
Sbjct  326   QNLTASGPRPNPQGSYHYGMINTTRTIRLANSAPVINGKQRYAVNGVSFIPADTPLKLAD  385

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF LGSIPD+P  G  YL TSVM A+YR+FVE+VF+N ED+VQSWHIDG+  F+
Sbjct  386   YFKISGVFTLGSIPDNPTSGGGYLQTSVMAADYRAFVEVVFENPEDSVQSWHIDGHVLFI  445

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG W+ ASR+ YNLRD ++RC+VQVYP+SWTA+YM LDNVGMWNIRSE+WARQYLG
Sbjct  446   VGMDGGDWSPASRSSYNLRDAISRCSVQVYPKSWTAVYMPLDNVGMWNIRSENWARQYLG  505

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             QQFYLRVY+  +S+RDE PIP NALLCG+A G 
Sbjct  506   QQFYLRVYSPADSWRDEYPIPSNALLCGQAVGH  538



>ref|XP_009347125.1| PREDICTED: L-ascorbate oxidase homolog, partial [Pyrus x bretschneideri]
Length=544

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/520 (76%), Positives = 454/520 (87%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+Y W +TYGDIYPLG+KQ+ ILINGQFPGP I+ VTNDNLII+V+N L+EPFL+
Sbjct  25    GEDPYRFYNWNVTYGDIYPLGIKQQGILINGQFPGPHIESVTNDNLIISVFNSLDEPFLI  84

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGV+GT CPIPP +NFTY+LQ KDQIGSYFYFPSL +HKAAGG+G I
Sbjct  85    SWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGLHKAAGGFGGI  144

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP IPVPF PPA DFT+LAGDW  +++  L+ ILD G+NLP PDGLLINGRG NG+
Sbjct  145   KIDSRPRIPVPFPPPAGDFTMLAGDWFSKNHTDLKAILDGGNNLPFPDGLLINGRGSNGF  204

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYR RISNVG+ T INFRIQGHK+ LVEVEG+H++Q+T+++LDIHLGQSYSV
Sbjct  205   TFTVDQGKTYRLRISNVGLTTHINFRIQGHKMLLVEVEGTHSLQNTYSSLDIHLGQSYSV  264

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ PKDYY VVSSRFTS+VL+ T++LHYSNS   VSGPPPGGPTTQI+WSL Q RS
Sbjct  265   LVTADQPPKDYYTVVSSRFTSQVLSATSILHYSNSAGSVSGPPPGGPTTQIDWSLEQARS  324

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQRYAVN VSF+ PDTPLKL
Sbjct  325   LRRNLTASGPRPNPQGSYHYGLINTTRTIRLTNSAPIINGKQRYAVNSVSFIQPDTPLKL  384

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI G+F+LGSI D+P  G AYL  SVM+A++R F E+VF+N EDTVQSWHIDG++F
Sbjct  385   ADYFKISGLFSLGSIQDNPTGGGAYLQISVMNADFRGFAELVFENLEDTVQSWHIDGHNF  444

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQWT ASR RYNLRDT++R TVQVYP SWTAIYM LDNVGMWNIRSE+WARQY
Sbjct  445   FVVGMDGGQWTPASRLRYNLRDTISRSTVQVYPNSWTAIYMPLDNVGMWNIRSENWARQY  504

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFY RVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  505   LGQQFYFRVYSPANSWRDEYPIPRNALLCGRALGRRTRPL  544



>ref|XP_008362259.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=542

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/545 (74%), Positives = 465/545 (85%), Gaps = 3/545 (1%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             M  Y S C ++L  L+     NG    +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPG
Sbjct  1     MGVYKSACCVVLVALLTVTCTNGE---DPYRFYNWNVTYGDIYPLGVKQQGILINGQFPG  57

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQID VTNDNLIINV+N L+EPFL+SWNG+QQRRNSWQDGV+GT CPIPP +NFTY LQ 
Sbjct  58    PQIDSVTNDNLIINVFNSLDEPFLISWNGVQQRRNSWQDGVFGTNCPIPPGQNFTYALQV  117

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL  HKAAGG+G I+I SRP IPVPF PPA DFT+LAGDW  +++  L+
Sbjct  118   KDQIGSYFYFPSLGFHKAAGGFGGIKIDSRPRIPVPFPPPAGDFTILAGDWFSKNHTDLK  177

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILD G+NLP PDGLLINGRG NG+TFTVD G+TYR RISNVG+ TSINFRIQGH + LV
Sbjct  178   AILDGGNNLPFPDGLLINGRGSNGFTFTVDQGKTYRLRISNVGLTTSINFRIQGHTMMLV  237

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+H++Q+T+++LDIHLGQSYSVLVTADQ P+DYY+VVSSRFTS+VL++T++LHYSNS
Sbjct  238   EVEGTHSLQNTYSSLDIHLGQSYSVLVTADQPPQDYYIVVSSRFTSQVLSSTSILHYSNS  297

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPTTQ++WSL Q RSLRRNL+ASGPRPNPQGSYHYG+I   RTI L +SA
Sbjct  298   AGSVSGPPPGGPTTQVDWSLEQARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLXSSA  357

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P I+GKQRYAVN VS++ PDTPLKLADYFKI GVF+LGSI D+P  G AYL TSVM+A++
Sbjct  358   PIIDGKQRYAVNSVSYIQPDTPLKLADYFKISGVFSLGSIQDNPTGGGAYLQTSVMNADF  417

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R F E+VF+N EDTVQSWHIDG++FFVVGMDGGQWT ASR RYNLRDT++R TVQVYP S
Sbjct  418   RGFAELVFENPEDTVQSWHIDGHNFFVVGMDGGQWTPASRLRYNLRDTISRSTVQVYPSS  477

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTA+YM LDNVGMWNIRSE+ ARQYLGQQFY RVY+  NS+RDE PIPKNALLCGRA GR
Sbjct  478   WTALYMPLDNVGMWNIRSENXARQYLGQQFYFRVYSPANSWRDEYPIPKNALLCGRALGR  537

Query  1790  HTRPL  1804
              TRPL
Sbjct  538   RTRPL  542



>ref|XP_007153964.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris]
 gb|ESW25958.1| hypothetical protein PHAVU_003G080100g [Phaseolus vulgaris]
Length=545

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/523 (77%), Positives = 454/523 (87%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL EPF
Sbjct  23    VHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNGLQ RRNSWQDGV GT CPIPP +N TY +Q KDQIGSYFYFPSL MHKAAG +G
Sbjct  83    LISWNGLQHRRNSWQDGVAGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSLGMHKAAGAFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI+SRPLIPVPF PPA DFT+LAGDW K  +R+L  +L++GHNLP PDGLLINGRGWN
Sbjct  143   GIRIWSRPLIPVPFPPPAGDFTILAGDWFKLDHRRLRRVLENGHNLPFPDGLLINGRGWN  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTVD G+TYRFRISNVG+ TSINFRIQGH LKLVEVEGSHT+Q+++++LDIHLGQSY
Sbjct  203   GNTFTVDQGKTYRFRISNVGLTTSINFRIQGHSLKLVEVEGSHTLQNSYSSLDIHLGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  KDYY+VVS+RFT R+LTTT++LHYS S   VSGP P GPT  I  S++Q 
Sbjct  263   SVLVTADQPVKDYYIVVSTRFTRRILTTTSILHYSYSRIGVSGPVPPGPTLDITSSVYQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I+P+RTIMLANSAPYINGKQRYAVNGVS+V PDTPL
Sbjct  323   RTIRWNLTASGPRPNPQGSYHYGLIQPSRTIMLANSAPYINGKQRYAVNGVSYVAPDTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             KLADYF I GVF +GSIP +P  G + YL TSVM AN+  FVEIVFQNWED+VQSWHIDG
Sbjct  383   KLADYFNIQGVFYVGSIPTNPSGGNNGYLQTSVMGANFHEFVEIVFQNWEDSVQSWHIDG  442

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVG   GQWT+ SR  YNLRDT+ARCTVQVYP+SWTAIYMALDNVGMWNIRSE+W 
Sbjct  443   YSFFVVGFGSGQWTQDSRVHYNLRDTIARCTVQVYPKSWTAIYMALDNVGMWNIRSENWE  502

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S+RDE P+PKNA+LCGRA GR TRP 
Sbjct  503   RQYLGQQFYLRVYTPSGSWRDEYPVPKNAVLCGRASGRRTRPF  545



>ref|XP_002320467.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
 gb|EEE98782.1| hypothetical protein POPTR_0014s15260g [Populus trichocarpa]
Length=532

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/514 (75%), Positives = 445/514 (87%), Gaps = 0/514 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G + YR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLII+V+N L+EPFL+
Sbjct  18    GEDAYRFHTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIISVFNSLDEPFLI  77

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT C IPP +NFTY+LQ KDQIGSYFYFPSL MHKAAGG+G  
Sbjct  78    SWNGVQQRRNSWQDGVYGTNCAIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGF  137

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SR +IPVPF+PP+ DFT LAGDW K+++  L+ ILD G +LP PDGLLINGRG NGY
Sbjct  138   KIASRSVIPVPFSPPSGDFTFLAGDWFKKNHSDLKAILDGGSDLPFPDGLLINGRGSNGY  197

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVDPG+TYRFRISNVG+ TSINFRIQGHK+ LVEVEG+H++Q+T+ +LDIHLGQSYSV
Sbjct  198   TFTVDPGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYDSLDIHLGQSYSV  257

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ   DY++VVS+RFTS+VLTTT++LHYSNS   VS  P GGPT QI+WSL Q RS
Sbjct  258   LVTADQAAHDYFIVVSTRFTSQVLTTTSILHYSNSAGSVSDTPLGGPTIQIDWSLEQARS  317

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RT+ L NSAP INGKQRYAVN VSF++ DTPLKL
Sbjct  318   LRRNLTASGPRPNPQGSYHYGLINTTRTVRLQNSAPIINGKQRYAVNSVSFISADTPLKL  377

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             AD++ I GVF+LGSIPDSP  G AYL TSVM A++R + EIVF+N ED VQSWHIDG++F
Sbjct  378   ADHYNIPGVFSLGSIPDSPTGGGAYLQTSVMAADFRGYAEIVFENPEDNVQSWHIDGHNF  437

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT++RCTVQVYP SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  438   FVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPESWTAVYMPLDNVGMWNVRSENWARQY  497

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARG  1786
             LGQQFYLRVY+  NS+RDE PIP NALLCGRA G
Sbjct  498   LGQQFYLRVYSPANSWRDEYPIPTNALLCGRAAG  531



>ref|XP_002301616.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
 gb|EEE80889.1| hypothetical protein POPTR_0002s21400g [Populus trichocarpa]
Length=545

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/520 (74%), Positives = 447/520 (86%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLGVKQ+ ILING+FPGPQI+ VTNDNLII+V+N L+EPFLL
Sbjct  26    GEDPYRFYTWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIISVFNSLDEPFLL  85

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGSYFYFPSL MHKAAGG+G  
Sbjct  86    SWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGF  145

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SR +IPVPF PPA DFT+LAGDW K+++  L+ ILD G +LP PDGLLINGRG NGY
Sbjct  146   KIASRSVIPVPFPPPAGDFTILAGDWFKKNHTDLKAILDGGSDLPFPDGLLINGRGSNGY  205

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYR RISNVG+ TSINFRIQGHK+ LVEVEG+H++Q+T+ +LDIHLGQSYSV
Sbjct  206   TFTVDQGKTYRLRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYDSLDIHLGQSYSV  265

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ  +DY++VVS+RFTS+VLTTT++LHYSNS   VS  PP GPT Q++WS+ Q RS
Sbjct  266   LVTADQAAQDYFIVVSTRFTSQVLTTTSILHYSNSAGSVSDSPPSGPTIQLDWSVEQARS  325

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I    T+ L NSAP INGKQRYAVN VSF+  DTPLKL
Sbjct  326   LRRNLTASGPRPNPQGSYHYGLINTTHTVRLQNSAPIINGKQRYAVNSVSFIPADTPLKL  385

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             AD+F I GVF+LGSI ++P  G AY  TSVM A++R + EIVF+N ED VQSWHIDG++F
Sbjct  386   ADHFNIPGVFSLGSISNNPTGGGAYRQTSVMAADFRGYAEIVFENPEDNVQSWHIDGHNF  445

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT++RCTVQVYP SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  446   FVVGMDGGQWSPASRLTYNLRDTISRCTVQVYPESWTAVYMPLDNVGMWNVRSENWARQY  505

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVY+  NS+RDE PIP NALLCGRA GR TRP+
Sbjct  506   LGQQFYLRVYSPANSWRDEYPIPTNALLCGRAAGRLTRPV  545



>ref|XP_011047251.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Populus euphratica]
 ref|XP_011047252.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Populus euphratica]
Length=547

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/520 (74%), Positives = 446/520 (86%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR++TW +TYGDIYPLGVKQ+ ILING FPGPQI+ VTNDNLII+V+N L+EPFL+
Sbjct  28    GEDPYRFHTWNVTYGDIYPLGVKQQGILINGLFPGPQIESVTNDNLIISVFNSLDEPFLI  87

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL MHKAAGG+G  
Sbjct  88    SWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLGMHKAAGGFGGF  147

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SR +IPVPF PP+ DFT LAGDW K+++  L+ ILD G +LP PDGLLINGRG NGY
Sbjct  148   KIASRSVIPVPFPPPSGDFTFLAGDWFKKNHNDLKAILDGGSDLPFPDGLLINGRGSNGY  207

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVG+ TSINFRIQGHK+ LVEVEG+H++Q+T+ +LDIHLGQSYSV
Sbjct  208   TFTVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGTHSLQNTYDSLDIHLGQSYSV  267

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ   DY++VVS+RFTS+VLTTT++LHYSNS   VS  P GGPT QI+WSL Q RS
Sbjct  268   LVTADQAAHDYFIVVSTRFTSQVLTTTSILHYSNSAGSVSDAPLGGPTIQIDWSLEQARS  327

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNLSASGPRPNPQGSYHYG+I   RT+ L NSAP INGKQR+AVN VSF++ DTPLKL
Sbjct  328   LRRNLSASGPRPNPQGSYHYGLINTTRTVRLQNSAPIINGKQRFAVNSVSFISADTPLKL  387

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             AD++ I GVF+L SIPDSP  G AYL TSVM A++R + EIVF+N ED VQSWHIDG++F
Sbjct  388   ADHYNIPGVFSLVSIPDSPTGGGAYLPTSVMAADFRGYAEIVFENPEDNVQSWHIDGHNF  447

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT++RCTVQVYP SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  448   FVVGMDGGQWSPASRLSYNLRDTISRCTVQVYPESWTAVYMPLDNVGMWNVRSENWARQY  507

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVY+  NS+RDE PIP NALLCGRA G  TR L
Sbjct  508   LGQQFYLRVYSPANSWRDEYPIPTNALLCGRAAGLRTRHL  547



>ref|XP_004507683.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=547

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/517 (78%), Positives = 450/517 (87%), Gaps = 0/517 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTN+NLII+VYNYL EPFL+SW
Sbjct  31    DPYRFFTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNENLIISVYNYLTEPFLISW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNSWQDGV GTTCPI P KNFTY LQ KDQIGS+FYFPSL MHKAAG +G IRI
Sbjct  91    NGIQHRRNSWQDGVSGTTCPILPGKNFTYTLQVKDQIGSFFYFPSLGMHKAAGAFGGIRI  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
             +SRPLIPVPF PPA DFT+LAGDW K  +R+L  +L++GHNLP PDGLLINGRGWNG TF
Sbjct  151   WSRPLIPVPFPPPAGDFTLLAGDWFKLGHRRLRRVLENGHNLPFPDGLLINGRGWNGNTF  210

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFRISNVG+ TSINFRIQGH LKLVEVEGSHT+Q+T+++LDIHLGQSYSVLV
Sbjct  211   TVDQGKTYRFRISNVGLTTSINFRIQGHTLKLVEVEGSHTLQNTYSSLDIHLGQSYSVLV  270

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TA+Q  KDYYVVVS+RFT RV TTT++LHYSNS   VSGP P GPT  +  S+FQ R++R
Sbjct  271   TANQPVKDYYVVVSTRFTRRVHTTTSILHYSNSRIGVSGPAPPGPTLDVTSSIFQARTIR  330

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+IKP+RTIMLANSAPYINGKQRYAVN VS++ PDTPLKLAD
Sbjct  331   WNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYAVNSVSYLEPDTPLKLAD  390

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YF I GVF +G I   P  G+AYL T+VM AN+  +VEIVFQNWE++VQSWHIDGYSFFV
Sbjct  391   YFNIPGVFYVGGISTLPTGGNAYLQTAVMGANFHEYVEIVFQNWENSVQSWHIDGYSFFV  450

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VG   GQWT  SR RYNLRDTVARCT QVYP+SWTAIYMALDNVGMWNIRSE+W RQYLG
Sbjct  451   VGFGSGQWTPNSRVRYNLRDTVARCTTQVYPKSWTAIYMALDNVGMWNIRSENWERQYLG  510

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRP  1801
             QQFYLRVYT + S RDE P+PKNALLCGRA GRHTRP
Sbjct  511   QQFYLRVYTPSKSLRDEYPVPKNALLCGRAGGRHTRP  547



>ref|XP_004166771.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/545 (72%), Positives = 459/545 (84%), Gaps = 2/545 (0%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MRE S +CSL    L+L      + G +PYR+  W ITYGDI+PLGVKQ+ ILINGQFPG
Sbjct  1     MRENSFLCSLTFLFLVLSFSC--INGEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPG  58

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQI+ VTN+NLIINV+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ 
Sbjct  59    PQIEAVTNENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQV  118

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL +HKAAGG+G  +I SR +IP+PF  PA +FTVLAGDW  +++  L 
Sbjct  119   KDQIGSYFYFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLR  178

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILD G +LP PDGLLINGRG NG TFTV+ G+TYRFRISNVG+ T+INFRIQGHK+ LV
Sbjct  179   AILDGGSDLPSPDGLLINGRGLNGNTFTVEQGKTYRFRISNVGLTTAINFRIQGHKMLLV  238

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+HT+Q+T+ ++DIHLGQSYSVLVTADQ P+DYY+VVS+RFTS++LTTT++LHYSNS
Sbjct  239   EVEGTHTLQNTYESIDIHLGQSYSVLVTADQPPQDYYIVVSTRFTSQILTTTSLLHYSNS  298

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPT QI+WSL Q RSLRRNL+A+GPRPNPQGSYHYG+I   RTI L ++A
Sbjct  299   AASVSGPPPGGPTFQIDWSLEQARSLRRNLTANGPRPNPQGSYHYGLINVTRTIRLHSTA  358

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQRYAVN VSF+  DTPLKLADYFKI GVF+LGSIPD P  G AYL TSVM+A++
Sbjct  359   PIINGKQRYAVNSVSFIPADTPLKLADYFKISGVFSLGSIPDYPTGGDAYLQTSVMNADF  418

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R + E+VF+N ED VQSWH+DG++FFVVGMDGGQW  ASR  YNLRDT++RCTVQVYP+S
Sbjct  419   RGYAEVVFENPEDVVQSWHVDGHNFFVVGMDGGQWIPASRLTYNLRDTISRCTVQVYPKS  478

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTA+YM LDNVGMWNIRSE+WARQYLGQQ YLRVY+  NS+RDE PIP NAL CGRA G 
Sbjct  479   WTAVYMPLDNVGMWNIRSENWARQYLGQQLYLRVYSPVNSWRDEYPIPSNALKCGRAIGL  538

Query  1790  HTRPL  1804
             +T PL
Sbjct  539   NTPPL  543



>gb|KHG04142.1| L-ascorbate oxidase [Gossypium arboreum]
Length=550

 Score =   816 bits (2107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/515 (76%), Positives = 451/515 (88%), Gaps = 0/515 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTN+NLIINV+N L++PFL+
Sbjct  29    GEDPYRFYTWNVTYGDIYPLGVKQQVILINGQFPGPQIETVTNENLIINVFNSLDQPFLI  88

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP  NFTY LQ KDQIGSYFYFPSL +HKAAGGYG  
Sbjct  89    SWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYTLQVKDQIGSYFYFPSLALHKAAGGYGGF  148

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             RI SR ++PVPF PPA D+T+LAGDW  +++  L+ ILDSGH+LP PDGL+INGRG NGY
Sbjct  149   RILSRSVVPVPFPPPAADYTILAGDWYNKNHNYLKAILDSGHDLPFPDGLIINGRGANGY  208

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVGI TSINFRIQGHKL LVEVEG+HT+Q+T+ +LDIHLGQS SV
Sbjct  209   TFTVDQGKTYRFRISNVGITTSINFRIQGHKLLLVEVEGTHTLQNTYDSLDIHLGQSLSV  268

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ  +DYY+V S+RFTS+VL TTA+LHYSNS   VSGPPPGGPTTQI+WSL Q RS
Sbjct  269   LVTADQPARDYYIVASTRFTSQVLATTAILHYSNSSAAVSGPPPGGPTTQIDWSLEQARS  328

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R NL+AS  RPNPQGSYHYG++K  RTI LA+SA  INGKQRYAVNGVSF+  DTPLKL
Sbjct  329   IRLNLTASAARPNPQGSYHYGLVKTTRTIRLASSAAVINGKQRYAVNGVSFIPADTPLKL  388

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVF+LGSIPD+P  G AYL TSVM A+YR +VEIVF+N EDTVQSWHIDGYSF
Sbjct  389   ADYFKISGVFSLGSIPDAPTGGGAYLKTSVMAADYRGYVEIVFENPEDTVQSWHIDGYSF  448

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQWT ASR  YNLRD +ARCTVQVYP+SW+A+Y+ALDNVGMWN+RSE+W RQY
Sbjct  449   FVVGMDGGQWTPASRLGYNLRDAIARCTVQVYPKSWSAVYIALDNVGMWNVRSENWVRQY  508

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             LGQQFYLR++++ NS+RDE PIP+NAL+CG+A GR
Sbjct  509   LGQQFYLRIFSAANSWRDEYPIPRNALVCGQALGR  543



>ref|XP_008789823.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Phoenix dactylifera]
Length=549

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/522 (76%), Positives = 455/522 (87%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  28    VRGDDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPF  87

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPPR+NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  88    LLSWNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFG  147

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               RI SRPLIPVPF PPA D+T+L GDW K ++  L+Y+LDSG NL  PDG+LINGRGWN
Sbjct  148   GFRILSRPLIPVPFPPPAGDYTLLIGDWYKANHTVLKYVLDSGRNLLFPDGVLINGRGWN  207

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+ G+TYRFRISNVG+ATS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  208   GNYFTVERGKTYRFRISNVGLATSLNIRFQGHTMKLVEVEGSHTLQNTYSSLDVHLGQSY  267

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+VVS+RFT  VLTTTA+LHYSNSF +  GP PGGPTTQINWSL Q 
Sbjct  268   SVLVTADQPPRDYYIVVSTRFTRTVLTTTAILHYSNSFGKPVGPLPGGPTTQINWSLNQA  327

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGKQRYAVN VSF+  DTPL
Sbjct  328   RSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPIINGKQRYAVNSVSFIPADTPL  387

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD++KI GVF+LGSIP +P +G  YL TSVM AN+R +VEI+F+N+EDTVQSWHIDGY
Sbjct  388   KLADFYKISGVFSLGSIPYNPAFGGGYLQTSVMAANFREYVEIIFENYEDTVQSWHIDGY  447

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQWT ASR  YNLRDTV RCT+QVYP+ WTA+YM LDNVGMWN+RSE+WAR
Sbjct  448   SFWVVGMDGGQWTAASRKSYNLRDTVNRCTLQVYPKGWTAVYMPLDNVGMWNVRSENWAR  507

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  508   QYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRAAGRRTRPL  549



>ref|XP_003529638.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN35730.1| L-ascorbate oxidase like [Glycine soja]
Length=547

 Score =   814 bits (2102),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/523 (78%), Positives = 453/523 (87%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL EPF
Sbjct  25    VHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPF  84

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNGLQ RRNSWQDGVYGT CPIPP +N TY +Q KDQIGSYFYFPSL MHKAAG +G
Sbjct  85    LISWNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGSYFYFPSLGMHKAAGAFG  144

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI+SRPLIPVPF PPA DFT+LAGDW K  +R+L  +L++GHNLP PDGLLINGRGWN
Sbjct  145   GIRIWSRPLIPVPFPPPAGDFTILAGDWFKLDHRRLRRLLENGHNLPFPDGLLINGRGWN  204

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTVD G+TYRFRISNVG+ TSINFRIQGH+LKLVEVEGSHT+Q+++++LDIHLGQSY
Sbjct  205   GNTFTVDQGKTYRFRISNVGLTTSINFRIQGHRLKLVEVEGSHTLQNSYSSLDIHLGQSY  264

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  KDYY+VVS+RFT R+LTTT+VLHYS S T VSGP P GPT  I  S++Q 
Sbjct  265   SVLVTADQPVKDYYIVVSTRFTRRILTTTSVLHYSYSKTGVSGPVPPGPTLDITSSVYQA  324

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+IKP+RTIMLANSAPYINGKQRYAVNGVS+  PDTPL
Sbjct  325   RTIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYAVNGVSYNAPDTPL  384

Query  1319  KLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             KLADYF I GVF +GSIP  P  G +AYL TSVM AN+  FVEIVFQNWED+VQSWHIDG
Sbjct  385   KLADYFNIPGVFYVGSIPTYPNGGNNAYLQTSVMGANFHEFVEIVFQNWEDSVQSWHIDG  444

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVG   GQWT  SR  YNLRDTVARCT QVYPRSWTAIYM+LDNVGMWNIRSE+W 
Sbjct  445   YSFFVVGFGSGQWTADSRVHYNLRDTVARCTTQVYPRSWTAIYMSLDNVGMWNIRSENWG  504

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S+RDE P+PKNALLCGRA GR TRP 
Sbjct  505   RQYLGQQLYLRVYTPSKSWRDEYPVPKNALLCGRASGRRTRPF  547



>ref|XP_010929557.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/522 (76%), Positives = 452/522 (87%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDN+IINV+N L EPF
Sbjct  20    VRGDDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNIIINVFNSLPEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPPR+NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  80    LLSWNGIQQRRNSWQDGVYGTNCPIPPRRNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               RI SRPLIPVPF PPA D T+L GDW K ++  L+YILDSG NLP PDG+LINGRGWN
Sbjct  140   GFRILSRPLIPVPFPPPAGDHTLLIGDWYKANHTVLKYILDSGRNLPFPDGVLINGRGWN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTVD G+TYRFRISNVG+ TS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  200   GNYFTVDRGKTYRFRISNVGLTTSLNIRFQGHTMKLVEVEGSHTLQNTYSSLDVHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+VVS+RFTS VLTTTA+LHYSNSF +   P P GPT QI+WSL Q 
Sbjct  260   SVLVTADQPPRDYYIVVSTRFTSTVLTTTAILHYSNSFGKPVDPLPWGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NLSASGPRPNPQGSYHYG++   RTI LANSAP INGKQRYAVN VSF+  DTPL
Sbjct  320   RSVRWNLSASGPRPNPQGSYHYGLVNTTRTIRLANSAPIINGKQRYAVNSVSFIPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD++KI GVF+LGSIP +P +G  YL TSVM AN+R +VEIVF+N+EDTVQSWHIDGY
Sbjct  380   KLADFYKISGVFSLGSIPYNPTFGGGYLQTSVMAANFREYVEIVFENYEDTVQSWHIDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQWT ASR  YNLRDTV RCTVQVYP+ WTAIYM LDNVGMWN+RSE+WAR
Sbjct  440   SFWVVGMDGGQWTAASRKSYNLRDTVNRCTVQVYPKGWTAIYMPLDNVGMWNVRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  500   QYLGQQFYLRVYSPANSWRDEYPIPRNALLCGRAAGRRTRPL  541



>ref|XP_008455444.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=543

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/516 (73%), Positives = 445/516 (86%), Gaps = 0/516 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             +YG +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTN+NLIINV+N L+EPF
Sbjct  22    IYGEDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIEAVTNENLIINVFNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL +HKAAGG+G
Sbjct  82    LISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               +I SR +IP+PF  PA +FTVLAGDW  +++  L  ILD G +LP PDGLLINGRG N
Sbjct  142   GFKIQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLRAILDGGSDLPSPDGLLINGRGLN  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTV+ G+TYRFRISNVG+ T+INFRIQGHK+ LVEVEG+HT+Q+T+ ++D+HLGQSY
Sbjct  202   GNTFTVEQGKTYRFRISNVGLTTAINFRIQGHKMLLVEVEGTHTLQNTYESIDVHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+VVS+RFTS++LTTT++LHYSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  262   SVLVTADQPPQDYYIVVSTRFTSQILTTTSILHYSNSAASVSGPPPGGPTIQIDWSLEQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RSLRRNL+A+GPRPNPQGSYHYG+I    TI L ++AP INGKQRYAVN VSF+  DTPL
Sbjct  322   RSLRRNLTANGPRPNPQGSYHYGLINVTHTIRLQSTAPIINGKQRYAVNSVSFIPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVF+LGSIPD P    AYL TSVM A++R + E+VF+N ED VQSWH+DG+
Sbjct  382   KLADYFKISGVFSLGSIPDYPTGSGAYLQTSVMAADFRGYAEVVFENPEDVVQSWHVDGH  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +FFVVGMDGGQWT A+R  YNLRDT++RCTVQVYP+SWTA+YM LDNVGMWNIRSE+WAR
Sbjct  442   NFFVVGMDGGQWTPANRLTYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMWNIRSENWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARG  1786
             QYLGQQ YLRVY+  NS+RDE PIP NAL CGRA G
Sbjct  502   QYLGQQLYLRVYSPVNSWRDEYPIPSNALKCGRAIG  537



>ref|XP_009596487.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=544

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/519 (73%), Positives = 448/519 (86%), Gaps = 0/519 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N + G +PYR+YTW +TYGDIYPLG+KQ+ ILINGQFPGP I+CVTNDNLIINV+N L+E
Sbjct  22    NLISGEDPYRFYTWNVTYGDIYPLGLKQQGILINGQFPGPPIECVTNDNLIINVFNNLDE  81

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG++QRRNSWQDGVYGT CPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG
Sbjct  82    PFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGG  141

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G+I I SR +IPVPF PPA +F++L+GDW K+++  L+ ILDSGH+LP PDGLLI+GRG
Sbjct  142   FGSINIASRSVIPVPFPPPAGEFSILSGDWFKQNHNDLKAILDSGHDLPFPDGLLISGRG  201

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              NGYTFTVD G+TYRFRISNVG+ TSINFRIQGHK+ +VEVEG+HTVQ+T+ +LDIHLGQ
Sbjct  202   SNGYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKMMVVEVEGTHTVQNTYDSLDIHLGQ  261

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVL+T DQ  KDYY+VVS+RFTS+VLT T+ L YSNS   VSGPPPGGPTT+++WSL 
Sbjct  262   SYSVLLTTDQPAKDYYIVVSTRFTSQVLTATSTLRYSNSAGSVSGPPPGGPTTEVDWSLN  321

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RSLRRNLSASGPRPNPQGSYHYG+I    TI LANSAP INGKQRYA+N VSFV  DT
Sbjct  322   QARSLRRNLSASGPRPNPQGSYHYGLINTTHTIRLANSAPIINGKQRYAINSVSFVPADT  381

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLAD+F I GVF LGSIPDSP  G AYL TSVM A++R++ E++F+N EDTVQS+HID
Sbjct  382   PLKLADHFNIPGVFTLGSIPDSPTGGGAYLQTSVMAADFRAYTEVIFENLEDTVQSYHID  441

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             G+ FFVVGM GG+WT ASR  YNLRDT++R TVQ+YP+SWTA+YM LDNVGMWNIRS++W
Sbjct  442   GHHFFVVGMGGGEWTPASRLTYNLRDTISRSTVQLYPKSWTALYMPLDNVGMWNIRSQNW  501

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             ARQYLGQQFYLRVY+  NS+RDE PIP +ALLCGRA  R
Sbjct  502   ARQYLGQQFYLRVYSPANSWRDEYPIPSDALLCGRASTR  540



>ref|XP_004144498.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=543

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/545 (71%), Positives = 459/545 (84%), Gaps = 2/545 (0%)
 Frame = +2

Query  170   MREYSSVCSlilavlilwlplNGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPG  349
             MR+ S +CSL    L+L    + + G +PYR+  W ITYGDI+PLGVKQ+ ILINGQFPG
Sbjct  1     MRKNSFLCSLTFLFLVLSF--SCINGEDPYRFLNWNITYGDIWPLGVKQQGILINGQFPG  58

Query  350   PQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQA  529
             PQI+ VTN+NLIINV+N L+EPFL+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ 
Sbjct  59    PQIEAVTNENLIINVFNSLDEPFLISWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQV  118

Query  530   KDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLE  709
             KDQIGSYFYFPSL +HKAAGG+G  +I SR +IP+PF  PA +FTVLAGDW  +++  L 
Sbjct  119   KDQIGSYFYFPSLALHKAAGGFGGFKIQSRSIIPIPFPTPAGEFTVLAGDWYSKNHTDLR  178

Query  710   YILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLV  889
              ILD G +LP PDGLLINGRG NG TFTV+ G+TYRFRISNVG+ T+INFRIQGHK+ LV
Sbjct  179   AILDGGSDLPSPDGLLINGRGLNGNTFTVEQGKTYRFRISNVGLTTAINFRIQGHKMLLV  238

Query  890   EVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS  1069
             EVEG+HT+Q+T+ ++DIHLGQSYSVLVTADQ P+DYY+VVS+RFTS++LTTT++LHYSNS
Sbjct  239   EVEGTHTLQNTYESIDIHLGQSYSVLVTADQPPQDYYIVVSTRFTSQILTTTSLLHYSNS  298

Query  1070  FTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
                VSGPPPGGPT QI+WSL Q RSLRRNL+A+GPRPNPQGSYHY +I   RTI L ++A
Sbjct  299   AASVSGPPPGGPTFQIDWSLEQARSLRRNLTANGPRPNPQGSYHYRLINVTRTIRLHSTA  358

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQRYAVN VSF+  DTPLKLADYFKI GVF+LGSIPD P  G AYL TSVM+A++
Sbjct  359   PIINGKQRYAVNSVSFIPADTPLKLADYFKISGVFSLGSIPDYPTGGDAYLQTSVMNADF  418

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R + E+VF+N ED VQSWH+DG++FFVVGMDGGQW  ASR  YNLRDT++RCTVQVYP+S
Sbjct  419   RGYAEVVFENPEDVVQSWHVDGHNFFVVGMDGGQWIPASRLTYNLRDTISRCTVQVYPKS  478

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             WTA+YM LDNVGMWNIRSE+WARQYLGQQ YLRVY+  NS+RDE PIP NAL CGRA G 
Sbjct  479   WTAVYMPLDNVGMWNIRSENWARQYLGQQLYLRVYSPVNSWRDEYPIPSNALKCGRAIGL  538

Query  1790  HTRPL  1804
             +T PL
Sbjct  539   NTPPL  543



>ref|XP_009794442.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=541

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/519 (73%), Positives = 445/519 (86%), Gaps = 0/519 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N + G +PYR+YTW ITYGD+YPLGVKQ+ ILINGQFPGP I+CVTNDNLIINV+N L+E
Sbjct  19    NLICGEDPYRFYTWNITYGDVYPLGVKQQGILINGQFPGPTIECVTNDNLIINVFNNLDE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG++QRRNSWQDGVYGT CPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG
Sbjct  79    PFLISWNGVEQRRNSWQDGVYGTNCPIPPGNNFTYVLQVKDQIGSFYYFPSLAFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G+I I S  +IPVPF PPA +F++L GDW K+++  L+ ILDSGH+LP PDGLLING G
Sbjct  139   FGSINIASSSVIPVPFPPPAGEFSILTGDWFKQNHNDLKAILDSGHDLPFPDGLLINGHG  198

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              NGYTFT+D G+TYRFRISNVG+ TSINFRIQGHK+ +VEVEG+HTVQ+T+ +LDIHLGQ
Sbjct  199   SNGYTFTIDQGKTYRFRISNVGLTTSINFRIQGHKMMVVEVEGTHTVQNTYDSLDIHLGQ  258

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             S+SVL+TADQ  KDYY+VVS+RFTS+VLT T+ LHY NS   VSG PP GPTT+I+WSL 
Sbjct  259   SFSVLLTADQPAKDYYIVVSTRFTSQVLTATSTLHYGNSAGSVSGLPPSGPTTEIDWSLN  318

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RSLRRNLSASGPRPNPQGSYHYG+I   RTI LANSAP INGKQRYA+N VSFV  DT
Sbjct  319   QARSLRRNLSASGPRPNPQGSYHYGLINTTRTIRLANSAPIINGKQRYAINSVSFVPADT  378

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLAD+F I GVF+LGSIPDSP  G AYL TSVM A +R+++E++F+N ED+VQS+HID
Sbjct  379   PLKLADHFNIPGVFSLGSIPDSPTGGGAYLQTSVMAAEFRAYIEVIFENLEDSVQSYHID  438

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             G+ FFVVGM GG+WT ASR  YNLRDT++R TVQVYP+SWTA+YM LDNVGMW+IRS++W
Sbjct  439   GHHFFVVGMGGGEWTPASRLTYNLRDTISRSTVQVYPKSWTALYMPLDNVGMWDIRSQNW  498

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
              RQYLGQQFYLRVY+  NS+RDE PIP NALLCGRA  R
Sbjct  499   VRQYLGQQFYLRVYSPANSWRDEYPIPSNALLCGRASTR  537



>ref|XP_010266098.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=547

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/518 (75%), Positives = 436/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPFLLSW
Sbjct  30    DPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPFLLSW  89

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  90    NGIQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  149

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA DFTVL GDW   S+  L+  LD G  L  PDG+LINGRG NG +F
Sbjct  150   LSRPRIPVPFPDPAGDFTVLIGDWYNASHTALKAKLDRGKRLHFPDGILINGRGPNGASF  209

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYRFRISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+ F++LD+H+GQSYSVLV
Sbjct  210   TVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGTHTLQTVFSSLDVHVGQSYSVLV  269

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+ VS+RFTS VLTTTA+LHYSNS  RVSG PP GPT QI+WSL Q  S+R
Sbjct  270   TADQPAQDYYIAVSTRFTSVVLTTTAILHYSNSVGRVSGSPPAGPTFQIDWSLNQALSIR  329

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI LANSA  INGKQRYAVNGVSFV  DTPLKLAD
Sbjct  330   TNLTASGPRPNPQGSYHYGLINITRTIRLANSAGLINGKQRYAVNGVSFVPADTPLKLAD  389

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF LGSI D+P  G  YL TSVM A++R+FVEIVF+N E  VQSWH+DGYSFFV
Sbjct  390   YFKIGGVFRLGSISDNPTGGQRYLDTSVMPADFRAFVEIVFENHESIVQSWHLDGYSFFV  449

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT  SR +YNLRD + RCT QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  450   VGMDGGKWTPTSRKQYNLRDAIVRCTTQVYPKSWTAIYVALDNVGMWNLRTEFWARQYLG  509

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA GRHTRPL
Sbjct  510   QQFYLRVYSPVESIRDEYPIPKNALLCGRASGRHTRPL  547



>ref|XP_002528421.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF33963.1| multicopper oxidase, putative [Ricinus communis]
Length=544

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/522 (74%), Positives = 443/522 (85%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINV+N L EPF
Sbjct  23    VNAEDPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  83    LISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRPLIPVPF  PA DFTVL GDW K ++ +L+ ILD GH LP PDG+LINGRG N
Sbjct  143   GIRILSRPLIPVPFPDPAGDFTVLIGDWYKTNHTKLKAILDYGHRLPFPDGILINGRGPN  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
               TFT +PG+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HTVQ+T+++LD+H+GQSY
Sbjct  203   ATTFTFEPGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGTHTVQTTYSSLDVHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VS+RFT++VLTTTA+LHYSNS  +VSGP PGGPTTQI+WSL Q 
Sbjct  263   SVLVTADQAAQDYYIAVSTRFTNKVLTTTAILHYSNSAKKVSGPIPGGPTTQIDWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +NGKQRYAVN VSF   DTPL
Sbjct  323   RSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAAQVNGKQRYAVNSVSFRPADTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSI DSP     YL TSVM A++R+FVEIVFQN E+ VQSWH+DGY
Sbjct  383   KLADYFKIGGVFRVGSISDSPTGKKMYLDTSVMGADFRAFVEIVFQNHENIVQSWHLDGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT ASR +YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+R+E WAR
Sbjct  443   SFWVVGMDGGVWTPASRDQYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNLRTEFWAR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+   S RDE PIPKNALLCGRA G+ TRPL
Sbjct  503   QYLGQQFYLRVYSPVMSIRDEYPIPKNALLCGRANGKTTRPL  544



>ref|XP_003596958.1| L-ascorbate oxidase-like protein [Medicago truncatula]
 gb|ABN08527.1| Multicopper oxidase, type 1 [Medicago truncatula]
 gb|AES67209.1| L-ascorbate oxidase-like protein [Medicago truncatula]
Length=539

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 450/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLI++V+N L++PFL+
Sbjct  25    GEDPYRFYTWNVTYGDIYPLGVKQQGILINGQFPGPQIESVTNDNLIVSVFNSLDQPFLI  84

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL +HKAAGGYG I
Sbjct  85    SWNGVQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLALHKAAGGYGGI  144

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP+IPVPF PP+ DFT+LAGDW  R++  L+ ILD+G +LPLPDGL+INGRG N Y
Sbjct  145   KINSRPMIPVPFPPPSNDFTILAGDWYNRNHTDLKAILDNGSDLPLPDGLIINGRGSNAY  204

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G TYRFRISNVG+ TSINFRIQGHK+KLVEVEG HT+Q+T+ +LDIHLGQSYSV
Sbjct  205   TFTVDQGNTYRFRISNVGLTTSINFRIQGHKMKLVEVEGIHTLQNTYDSLDIHLGQSYSV  264

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P+DYY+V S+RFTS++LT T++LHYSNS   VSGPPPGG T+QI+WSL Q RS
Sbjct  265   LVTADQPPQDYYIVASTRFTSQILTATSILHYSNSAKTVSGPPPGGLTSQIDWSLEQARS  324

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQRYAVN VSF+  DTPLKL
Sbjct  325   LRRNLTASGPRPNPQGSYHYGLINTTRTIRLENSAPVINGKQRYAVNSVSFIPADTPLKL  384

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVF+LGSIPD+P  G  YL TSVM A++R +VEIVF+N ED+VQSWHIDG+ F
Sbjct  385   ADYFKISGVFSLGSIPDNPTGGGGYLQTSVMAADFRGYVEIVFENPEDSVQSWHIDGHHF  444

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR+ YNL DT++RCTVQVYP+SW+A+YM LDNVGMWN+RSE+WARQY
Sbjct  445   FVVGMDGGQWSAASRSNYNLGDTISRCTVQVYPKSWSAVYMPLDNVGMWNVRSENWARQY  504

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             LGQQFYLRVY+  NS+RDE PIP NAL CGRA G 
Sbjct  505   LGQQFYLRVYSPANSWRDEYPIPSNALRCGRAVGH  539



>gb|KEH29685.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=537

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/516 (74%), Positives = 437/516 (85%), Gaps = 1/516 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+Y W +TYGDIYPLGVKQ+ ILING+FPGPQI+ VTNDNLIINV+N L+EPFL+
Sbjct  22    GEDPYRFYNWNVTYGDIYPLGVKQQGILINGKFPGPQIESVTNDNLIINVFNSLDEPFLI  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+ QRRNSWQDGVYGT CPI P KN TY+LQ KDQIGSYFYFPSL  HKAAGGYG  
Sbjct  82    SWNGVLQRRNSWQDGVYGTNCPISPGKN-TYILQVKDQIGSYFYFPSLAFHKAAGGYGGF  140

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
              I +R +IPVPF PP+ DFT+LAGDW KR++  L  ILDSG NLP PDGL+INGRG N Y
Sbjct  141   TIATRSVIPVPFDPPSGDFTILAGDWYKRNHTDLRAILDSGKNLPFPDGLVINGRGSNAY  200

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVGI TSINFRIQGHK+KLVEVEGSHTVQ+ + +LDIHLGQ+YSV
Sbjct  201   TFTVDQGKTYRFRISNVGITTSINFRIQGHKMKLVEVEGSHTVQNIYDSLDIHLGQTYSV  260

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P DYY+VV++RFTS+VL  +++LHY NS  RVSGP P GPTT+I+WS+ Q RS
Sbjct  261   LVTADQPPHDYYIVVTTRFTSQVLNASSILHYRNSARRVSGPLPAGPTTKIDWSVEQARS  320

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYGMI   RTI L NSAP I GKQRYAVN VSF+  DTPLKL
Sbjct  321   LRRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPIIKGKQRYAVNSVSFIPADTPLKL  380

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVF+LGSIPD+P  G   L TSVM A++R F+E+VF+N EDT+QSWHIDG+SF
Sbjct  381   ADYFKIQGVFSLGSIPDNPTGGGGNLQTSVMAADFRGFLEVVFENPEDTLQSWHIDGHSF  440

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT+AR TVQVYP+SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  441   FVVGMDGGQWSAASRLNYNLRDTIARSTVQVYPKSWTALYMPLDNVGMWNVRSENWARQY  500

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             LG QFYLRVY+  NS RDE PIP NAL CG+A G H
Sbjct  501   LGHQFYLRVYSPVNSLRDEYPIPNNALRCGKAVGHH  536



>ref|XP_010923874.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=542

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/522 (75%), Positives = 453/522 (87%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW ITYGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDNLIINVYN L EPF
Sbjct  21    VRGEDPYRFFTWNITYGDIWPLGVKQQGILINGQFPGPQIESVTNDNLIINVYNSLPEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+ QRRNSWQDGVYGT CPIPP  NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  81    LLSWNGVLQRRNSWQDGVYGTNCPIPPGGNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRPLIPVPF PPA D+T+L GDW K ++  L+YILDSG +LP PDG+LINGRGWN
Sbjct  141   GIRILSRPLIPVPFPPPAADYTLLIGDWYKANHTDLKYILDSGKDLPFPDGVLINGRGWN  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTVD G+TYRFRISNVG+ATS+N R QGH ++LVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  201   GNTFTVDQGKTYRFRISNVGLATSLNIRFQGHTMQLVEVEGSHTLQNTYSSLDVHLGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+V+S+RFTS VLTTT++LHYSNSF +   PPP GPTT+I+ S+ Q 
Sbjct  261   SVLVTADQPPRDYYIVISTRFTSTVLTTTSILHYSNSFGKPVDPPPAGPTTEIDLSINQA  320

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGKQRYAVN VSF+  DTPL
Sbjct  321   RSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPIINGKQRYAVNSVSFIPADTPL  380

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+KI GVF+LGSIPD+P +G  YL TSVM A++R++VEI+F+N+ED VQSWH+DGY
Sbjct  381   KLADYYKIPGVFSLGSIPDNPTFGGGYLQTSVMAADFRAYVEIIFENYEDIVQSWHLDGY  440

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGMDGGQWT ASR  YNLRD V RCTVQVYP+ W A+YM LDNVGMWNIRSE+WAR
Sbjct  441   TFWVVGMDGGQWTAASRESYNLRDAVNRCTVQVYPKGWAAVYMPLDNVGMWNIRSENWAR  500

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  501   QYLGQQFYMRVYSPANSWRDEYPIPRNALLCGRAAGRRTRPL  542



>ref|XP_006855939.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
 gb|ERN17406.1| hypothetical protein AMTR_s00037p00216460 [Amborella trichopoda]
Length=545

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/522 (75%), Positives = 452/522 (87%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW++T+GDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNL+INV+N L EPF
Sbjct  24    VNGDDPYRFFTWQVTWGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLVINVFNNLTEPF  83

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPP  NFTY LQAKDQIGSYFYFPSL  HKAAGG+G
Sbjct  84    LLSWNGIQQRRNSWQDGVYGTNCPIPPGGNFTYNLQAKDQIGSYFYFPSLAFHKAAGGFG  143

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRPLIPVPF PPA DFTVLAGDW K ++  L+  LD GH+LP PDG+LINGRG N
Sbjct  144   GIRVLSRPLIPVPFPPPAGDFTVLAGDWFKANHSDLKATLDGGHSLPFPDGILINGRGPN  203

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
                FTVD G+TYRFRISNVG+ TS NFRIQGHK+KLVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  204   ALVFTVDQGKTYRFRISNVGLTTSFNFRIQGHKMKLVEVEGSHTLQNTYSSLDVHLGQSY  263

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVS+RFT+ VLT+T++LHYSNS  +VSGPPPGGPT QI+WSL Q 
Sbjct  264   SVLVTADQPGQDYYIVVSTRFTNPVLTSTSILHYSNSQGQVSGPPPGGPTIQIDWSLNQA  323

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   RTI+L+NSA  INGKQR+AVN VSF+  DTPL
Sbjct  324   RSIRWNLTASGPRPNPQGSYHYGLINTTRTIILSNSANIINGKQRFAVNSVSFIPADTPL  383

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD++KI GVF+L SIPD P     YL TSVM A++R++VEIVF N ED VQSWH+DGY
Sbjct  384   KLADFYKIQGVFSLNSIPDRPSGSGGYLQTSVMAADFRAYVEIVFVNQEDVVQSWHLDGY  443

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT+ASR  YNLRDTVARCT QVYP+SWTAIY+ALDNVGMWN+RSE+W R
Sbjct  444   SFFVVGMDGGQWTQASRQNYNLRDTVARCTTQVYPKSWTAIYVALDNVGMWNLRSENWPR  503

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  504   QYLGQQFYLRVYSPVNSWRDEYPIPRNALLCGRASGRRTRPL  545



>ref|XP_009413373.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
 ref|XP_009413374.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=543

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/520 (74%), Positives = 439/520 (84%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGPQI+ VTNDNLI+NV+N L EPFL 
Sbjct  23    GDSPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPQIEAVTNDNLIVNVFNSLPEPFLF  82

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSYFYFPSL  HKAAGGYG I
Sbjct  83    SWNGIQQRRSSWQDGVYGTNCPIPPGGNFTYTMQVKDQIGSYFYFPSLAFHKAAGGYGGI  142

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRPLIPVPFAPPA D+TVL GDW K ++  L  ILD G +LP PDGLLING+G NG 
Sbjct  143   RVLSRPLIPVPFAPPAADYTVLVGDWYKANHTDLRNILDGGKDLPFPDGLLINGQGSNGS  202

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFR+SNVG+ATS+N RIQGH L LVEVEGSHT+Q+T+++LDIHLGQSYS 
Sbjct  203   AFTVDQGKTYRFRVSNVGVATSLNIRIQGHALLLVEVEGSHTLQNTYSSLDIHLGQSYSF  262

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P DYY+VVS+RFT+ VL+TTA+LHYSNS  +   PPPGGPTT I WSL Q RS
Sbjct  263   LVTADQPPMDYYIVVSTRFTTTVLSTTAILHYSNSDGKRVEPPPGGPTTDIEWSLNQARS  322

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R NL+ASGPRPNPQGSYHYG +   RTI +ANSAP INGKQRYAVN +SF+  DTPLKL
Sbjct  323   IRWNLTASGPRPNPQGSYHYGYVNVTRTIRIANSAPVINGKQRYAVNSLSFIPADTPLKL  382

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             AD++ I GVF LGSI D P  G A L TSVM A++R++VEIVF+N E +VQSWHIDGY+F
Sbjct  383   ADFYNISGVFELGSISDIPTSGPASLRTSVMAADFRAYVEIVFENSETSVQSWHIDGYNF  442

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             ++VGMDGGQWT ASR  YNLRD V+RCTVQVYP SW+AIYM LDNVGMWNIRSE+WARQY
Sbjct  443   WIVGMDGGQWTPASRDSYNLRDAVSRCTVQVYPNSWSAIYMPLDNVGMWNIRSENWARQY  502

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFY+RVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  503   LGQQFYIRVYSPANSWRDENPIPRNALLCGRASGRRTRPL  542



>ref|XP_008806480.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=542

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/522 (75%), Positives = 452/522 (87%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR+ TW +TYGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  21    VQGEDPYRFLTWNVTYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+ QRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  81    LLSWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSYFYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               RI SRP+IPVPF PPA D+T+L GDW K ++  L+YILDSG +L  PDG+LINGRGWN
Sbjct  141   GFRILSRPMIPVPFPPPAADYTLLLGDWYKANHTDLKYILDSGKDLAFPDGVLINGRGWN  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTVD G+TYRFRISNVG+ATS+N R QGH ++LVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  201   GNTFTVDQGKTYRFRISNVGLATSLNIRFQGHMMQLVEVEGSHTLQNTYSSLDVHLGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P DYY+VVS+RFTS  LTTT+VLHYSNSF +   PPPGGPTT+I+ S+ Q 
Sbjct  261   SVLVTADQPPSDYYIVVSTRFTSTALTTTSVLHYSNSFRKPVDPPPGGPTTEIDLSVNQA  320

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGKQRYAVN VSF+  DTPL
Sbjct  321   RSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPIINGKQRYAVNSVSFIPADTPL  380

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD++KI GVF+LGSIPD+P +G  YL TSVM A++R +VEIVF+N+EDT+QSWHIDGY
Sbjct  381   KLADFYKIPGVFSLGSIPDNPTFGGGYLQTSVMAADFRGYVEIVFENYEDTLQSWHIDGY  440

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQWT ASR  YNLRD V RCTVQVYP+ WTA+YMALDNVGMWN+RSE+WAR
Sbjct  441   SFWVVGMDGGQWTAASRESYNLRDAVNRCTVQVYPKGWTAVYMALDNVGMWNVRSENWAR  500

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVY+  NS+RDE PIP+NALLCG+A GR TRPL
Sbjct  501   QYLGQQFYIRVYSPANSWRDEYPIPRNALLCGQAAGRRTRPL  542



>ref|XP_004487420.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/515 (75%), Positives = 447/515 (87%), Gaps = 0/515 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLG+KQ+ ILINGQFPGPQI+ VTNDNLII+V+N LNEPFL+
Sbjct  22    GEDPYRFYTWNVTYGDIYPLGIKQQGILINGQFPGPQIESVTNDNLIISVFNSLNEPFLI  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIP  KNFTY+LQ KDQIGSYFYFPSL  HKAAGGYGA 
Sbjct  82    SWNGVQQRRNSWQDGVYGTNCPIPAGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGAF  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRPLIPVPF PPA DF++LAGDW  R++  L+ ILDSG +LP PDGL+ING G N Y
Sbjct  142   KINSRPLIPVPFPPPAADFSILAGDWYNRNHTDLKAILDSGSDLPFPDGLIINGHGSNAY  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVG+ TSINFRIQGHK++LVEVEG HT+Q+++ ++D+HLGQSYSV
Sbjct  202   TFTVDQGKTYRFRISNVGLKTSINFRIQGHKMQLVEVEGIHTLQNSYDSIDLHLGQSYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P+DYY+VVS+RFTS+VLT T++LHYSNS   VSGPPP G TTQI+WSL Q RS
Sbjct  262   LVTADQPPQDYYMVVSTRFTSQVLTATSILHYSNSARTVSGPPPAGLTTQIDWSLEQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQR+AVN VSF+  DTPLKL
Sbjct  322   LRRNLTASGPRPNPQGSYHYGLINTTRTIRLENSAPIINGKQRFAVNSVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVF+LGSIPDSP  G  YL TSVM A++R +VEIVF+N ED++QSWHIDG+ F
Sbjct  382   ADYFKIQGVFSLGSIPDSPSGGGGYLQTSVMAADFRGYVEIVFENPEDSLQSWHIDGHHF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR+ YNL DT++RCTVQVYP SWTA+YM LDNVG+WN+RSEDW RQY
Sbjct  442   FVVGMDGGQWSAASRSNYNLIDTISRCTVQVYPNSWTAVYMPLDNVGIWNVRSEDWGRQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             LGQQFYLRVY+S NS+RDE P+P NALLCGRA G 
Sbjct  502   LGQQFYLRVYSSANSWRDEYPLPSNALLCGRAVGH  536



>ref|XP_009794440.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
sylvestris]
Length=541

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/520 (75%), Positives = 452/520 (87%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW ITYGDIYPLGVKQ+ ILINGQFPGP I+CVTNDNLI++V+N L+EPFL+
Sbjct  22    GESPYRFYTWNITYGDIYPLGVKQQGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLM  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW+G+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGS+FYFPSL MHKAAGGYG +
Sbjct  82    SWDGIQQRRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSFFYFPSLAMHKAAGGYGGV  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRPLIPVPF PPA ++T+L GDW K+++  L+ ILD G +LP PDGLLINGRG N  
Sbjct  142   KIDSRPLIPVPFPPPAGEYTMLVGDWFKQNHTDLKAILDGGSDLPFPDGLLINGRGSNSL  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD GRTYRFRISNVG+ T+INFRIQGHK+ LVEVEG+HT+Q+T+ ++DIHLGQSYSV
Sbjct  202   TFTVDQGRTYRFRISNVGLTTAINFRIQGHKMVLVEVEGTHTLQNTYESIDIHLGQSYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVT DQ  +DYY+V S+RFTS+VLT T++LHYSNS   VSGPPPGGPT +I+WSL Q RS
Sbjct  262   LVTMDQPGQDYYIVASTRFTSQVLTATSILHYSNSAGSVSGPPPGGPTIEIDWSLNQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R+NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGKQRYAVN VSF+  DTPLKL
Sbjct  322   VRQNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPMINGKQRYAVNSVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVFNLGSI D+P  G  YL TSVM A++R+FVE+VF+N ED VQSWHIDG+ F
Sbjct  382   ADYFKIPGVFNLGSIQDNPTGGGGYLQTSVMAADFRAFVEVVFENPEDIVQSWHIDGHIF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRD ++RCT+QVYP+SWTA+YM LDNVGMWNIRSE+WARQY
Sbjct  442   FVVGMDGGQWSPASRLNYNLRDGISRCTIQVYPKSWTALYMPLDNVGMWNIRSENWARQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVY+  NS+RDE PIPKNAL+CGRA GR TRPL
Sbjct  502   LGQQFYLRVYSPANSWRDEYPIPKNALVCGRASGRSTRPL  541



>emb|CDP19581.1| unnamed protein product [Coffea canephora]
Length=541

 Score =   801 bits (2068),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/513 (74%), Positives = 437/513 (85%), Gaps = 0/513 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I+ VTNDNLIINV+N L+EPFL+SW
Sbjct  27    DPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPAIESVTNDNLIINVFNNLDEPFLISW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NGL+QRRNSWQDGV+GT CPIPP KN+TY LQ KDQIGSYFYFPSL  HKAAGGYG I+I
Sbjct  87    NGLEQRRNSWQDGVWGTNCPIPPGKNYTYALQVKDQIGSYFYFPSLAFHKAAGGYGGIKI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SR +IPVPFAPPA D+T+LAGDW  +S+  L+ ILDSGHNLP P+GLLINGRG NGY F
Sbjct  147   ASRSVIPVPFAPPAGDYTILAGDWFNQSHNDLKAILDSGHNLPFPNGLLINGRGTNGYVF  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYRFRISNVG+ATSINFRIQGHK+ LVEVEG+HT+Q+T+ +LDIHLGQSYSVLV
Sbjct  207   TVEHGKTYRFRISNVGLATSINFRIQGHKMVLVEVEGTHTLQNTYDSLDIHLGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+V S RFT +VLT T+VL YSNS   VSGPPPGGPT +++WSL Q RSLR
Sbjct  267   TADQPIQDYYLVASMRFTPQVLTATSVLRYSNSQKSVSGPPPGGPTIEVDWSLNQARSLR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
             RNL+ASGPRPNPQGSYHYG+I    TI LANSAP INGKQRYAVN VSF+  DTP+KLAD
Sbjct  327   RNLTASGPRPNPQGSYHYGLINTTHTIRLANSAPIINGKQRYAVNSVSFIPADTPVKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YF I GVF+L SIP +P  G  YL TSVM + YR + EIVF+N EDT+QSWHIDG+ FFV
Sbjct  387   YFNIPGVFSLSSIPQNPTGGGGYLQTSVMASEYRGYAEIVFENSEDTLQSWHIDGHHFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR  YNLRDT++R TVQVYP+SWTA+YM LDN GMWN+RS+DWARQ+LG
Sbjct  447   VGMDGGEWTPASRFVYNLRDTISRSTVQVYPKSWTAVYMPLDNAGMWNVRSQDWARQHLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             QQFYLR+++  NS+RDE PIP N LLCGRA G 
Sbjct  507   QQFYLRIFSPANSWRDENPIPSNTLLCGRAVGH  539



>ref|XP_009408654.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/524 (73%), Positives = 454/524 (87%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             +GV G +PYR++TW ITYGDI+P+GVKQ+ ILINGQFPGPQI+ VTNDN+I+NV+N L E
Sbjct  19    SGVLGDSPYRFFTWNITYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNVIVNVFNSLPE  78

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQR++SWQDGVYGT CPIPP +NFTY++Q KDQIGSYFYFPSL  HKAAGG
Sbjct  79    PFLISWNGIQQRKSSWQDGVYGTNCPIPPGRNFTYVMQFKDQIGSYFYFPSLAFHKAAGG  138

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IR+ SRPLIPVPF PPA DFT+L GDW K ++  L+Y+LDSG +LP PDG+LINGRG
Sbjct  139   FGGIRVLSRPLIPVPFPPPAGDFTLLIGDWFKANHSTLKYVLDSGRDLPFPDGVLINGRG  198

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNG TFTV  GRTYRFRISNVG+  S+N RIQGH +KLVEVEGSHT+Q+T+++LD+HLGQ
Sbjct  199   WNGNTFTVQQGRTYRFRISNVGLTASLNIRIQGHAMKLVEVEGSHTLQNTYSSLDLHLGQ  258

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             S SVLVTADQ   DYY+V S+RFTS+VL+TTA+L YSNS    +GPPPGGPT QI+WSL 
Sbjct  259   SCSVLVTADQPAMDYYIVASTRFTSKVLSTTAILRYSNSGGTTAGPPPGGPTIQIDWSLN  318

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NL+ASGPRPNPQGSYHYG++   RTI LANSAP+INGKQRYAVN VSF+  DT
Sbjct  319   QARSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPFINGKQRYAVNSVSFIPADT  378

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLK+AD++KI GVF+LGSI D+P +G  YL TSVM AN+R +VEIVF+N+E+T+QSWHID
Sbjct  379   PLKVADFYKIPGVFSLGSISDNPTFGGGYLQTSVMAANFRDYVEIVFENYENTMQSWHID  438

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSF++VGMDGGQW+ ASR  YNLRD VARCTVQVYP+SW+AIYM LDNVGMWN+RSE+W
Sbjct  439   GYSFWIVGMDGGQWSAASRKSYNLRDAVARCTVQVYPKSWSAIYMPLDNVGMWNVRSENW  498

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQ YLRVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  499   ARQYLGQQLYLRVYSPANSWRDENPIPRNALLCGRASGRRTRPL  542



>gb|KDP36848.1| hypothetical protein JCGZ_08139 [Jatropha curcas]
Length=542

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/518 (73%), Positives = 440/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  26    DPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  85

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  86    NGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  145

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPFA P  D+TVL GDW K ++ +L+  LD+G  LP PDG+LINGRG +GY  
Sbjct  146   LSRPRIPVPFADPDGDYTVLIGDWYKANHTELKAHLDNGKKLPFPDGILINGRG-SGYAL  204

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVL+
Sbjct  205   TVEQGKTYRLRISNVGLEHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLI  264

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVSSRFTS++LTTT VLHYSNS   VSG PPGGPT Q++WSL Q RS+R
Sbjct  265   TADQPGQDYYIVVSSRFTSQILTTTGVLHYSNSAGPVSGSPPGGPTIQVDWSLNQARSIR  324

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI  +RTI+ A+SA  +NGKQRYAVN VS++ PDTPLKLAD
Sbjct  325   TNLTASGPRPNPQGSYHYGMINTSRTIIFASSAGQVNGKQRYAVNSVSYIQPDTPLKLAD  384

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKI GVF   SI D P  G  YL TSV+  +YR+FVEIVFQN ED VQSWH+DGYSFFV
Sbjct  385   FFKIQGVFKENSISDRPYGGGIYLDTSVLTVDYRAFVEIVFQNDEDIVQSWHLDGYSFFV  444

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD +ARCT QVYP+SWTAIY+ LDNVGMWN+R+E WARQYLG
Sbjct  445   VGMDGGQWTTASRNQYNLRDAIARCTTQVYPKSWTAIYVPLDNVGMWNLRTEFWARQYLG  504

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT++ S RDE PIPKNALLCGRA GRHTRPL
Sbjct  505   QQLYLRVYTTSTSLRDEFPIPKNALLCGRASGRHTRPL  542



>ref|XP_010536445.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=541

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/518 (74%), Positives = 436/518 (84%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFL+SW
Sbjct  25    DPYRFFDWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLISW  84

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS+QDGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85    NGIQQRRNSFQDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L   LDSG+ LPL DG+LINGRG +G T 
Sbjct  145   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRVQLDSGNKLPLADGILINGRG-SGATL  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQSYSVLV
Sbjct  204   NVEQGKTYRLRISNVGLQNSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSYSVLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVSSRFTS VLTTT VL YSNS   VSGP PGGPT Q++WSL Q R++R
Sbjct  264   TADQPAQDYYIVVSSRFTSPVLTTTGVLRYSNSAGPVSGPIPGGPTIQVDWSLNQARAIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFTPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI D P  G  YL TSVM A+YR+FVEIVF+N ED VQSWH+DGYSFFV
Sbjct  384   YFKIDGVFRVGSISDHPTGGGIYLDTSVMQADYRAFVEIVFENPEDIVQSWHLDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD VARCTVQVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  444   VGMDGGQWTPASRNEYNLRDAVARCTVQVYPNSWTAIYVALDNVGMWNVRSEFWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  504   QQFYLRVYTTSTSLRDEYPIPKNALLCGRASGRRTRPL  541



>ref|XP_011046313.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=544

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/522 (73%), Positives = 442/522 (85%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINVYN L EPF
Sbjct  23    VNAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++Y+PSL  HKAAGG+G
Sbjct  83    LISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRPLIPVPF  PA DFTVL GDW K +++ L+ ILD GH LP PDG+L+NGRG N
Sbjct  143   GIRILSRPLIPVPFPEPADDFTVLIGDWYKANHKVLKAILDRGHKLPFPDGILVNGRGPN  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
                FT  PG+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T ++LD+H+GQSY
Sbjct  203   QTYFTFQPGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTHSSLDVHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VS+RFT+++LTTTA+LHYSNS  +VSGP PGGPTT+I+WSL Q 
Sbjct  263   SVLVTADQTAQDYYIAVSTRFTTKILTTTAILHYSNSAKKVSGPIPGGPTTEIDWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI   RTI L +SA  +NGKQRYAVN VSFV  DTPL
Sbjct  323   RSIRTNLTASGPRPNPQGSYHYGMINLTRTIKLESSAAQVNGKQRYAVNSVSFVPADTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADYFKIGGVF +GS+PD P     YL TSVM A++R+FVEIVFQN E+ VQSWHI+GY
Sbjct  383   KIADYFKIGGVFRVGSMPDYPTGKKMYLDTSVMGADFRAFVEIVFQNHENIVQSWHINGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT ASR +YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWNIR+E WAR
Sbjct  443   SFWVVGMDGGVWTPASRNQYNLRDAVSRCTTQVYPKSWTAIYIALDNVGMWNIRTEFWAR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVY+   S RDE PIPKNALLCGRA GR TRPL
Sbjct  503   QYLGQQFYMRVYSPVESPRDEYPIPKNALLCGRAIGRRTRPL  544



>ref|XP_003540295.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=536

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/515 (75%), Positives = 444/515 (86%), Gaps = 0/515 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLG+KQ+ ILINGQFPGPQI+ VTNDNLI++V+N L+EPFL+
Sbjct  22    GEDPYRFYTWNVTYGDIYPLGMKQQGILINGQFPGPQIESVTNDNLILHVFNSLDEPFLI  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGSYFYFPSL  HKAAGGYG  
Sbjct  82    SWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGF  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SR +IPVPF PPA DFT+LAGDW KR++  L  ILD G +LP PDGL+INGRG N Y
Sbjct  142   KIASRSVIPVPFPPPAGDFTILAGDWYKRNHTDLRAILDGGSDLPFPDGLIINGRGSNAY  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFRISNVG+ TSINFRIQGHK+ LVEVEG HT+Q+T+ +LDIHLGQSYSV
Sbjct  202   AFTVDQGKTYRFRISNVGLTTSINFRIQGHKMLLVEVEGIHTLQNTYDSLDIHLGQSYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P+DYY+VVS+RFTS+VLT T++LHYSNS T VS PPPGGPTTQI+WSL Q RS
Sbjct  262   LVTADQPPQDYYIVVSTRFTSQVLTATSILHYSNSPTSVSSPPPGGPTTQIDWSLDQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RT+ L NSA  INGKQRYAVN VSF+  DTPLKL
Sbjct  322   LRRNLTASGPRPNPQGSYHYGLINTTRTVRLQNSAGIINGKQRYAVNSVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVFNLGSIP++P     YL TSVM A++R + EIVF+N EDTVQSWH+DG+ F
Sbjct  382   ADYFKIPGVFNLGSIPENPTGSDCYLQTSVMAADFRGYAEIVFENPEDTVQSWHVDGHHF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             +VVGMDGGQW+ +SR+ YNLRDT++RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WARQY
Sbjct  442   YVVGMDGGQWSTSSRSNYNLRDTISRCTVQVYPKSWTAVYMPLDNVGMWNVRSENWARQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             LGQQFYL VY+  NS+RDE PIP NALLCGRA G 
Sbjct  502   LGQQFYLGVYSPANSWRDEYPIPSNALLCGRAIGH  536



>ref|XP_009597920.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=541

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/520 (74%), Positives = 452/520 (87%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW ITYGDIYPLGVKQ+ ILINGQFPGP I+CVTNDNLI++V+N L+EPFL+
Sbjct  22    GESPYRFYTWNITYGDIYPLGVKQQGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLM  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW+G+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGS+FYFPSL MHKAAGGYG I
Sbjct  82    SWDGIQQRRNSWQDGVYGTNCPIPPGQNFTYILQVKDQIGSFFYFPSLAMHKAAGGYGGI  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRPLIPVPF PPA ++T+L GDW K+++  L+ ILD G++LP PDGLLINGRG N  
Sbjct  142   KIDSRPLIPVPFPPPAGEYTMLVGDWFKQNHTDLKAILDGGNDLPFPDGLLINGRGSNSL  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD GRTYRFRISNVG+ T+INFRIQGHK+ LVEVEG+HT+Q+T+ ++DIHLGQSYSV
Sbjct  202   TFTVDQGRTYRFRISNVGLTTAINFRIQGHKMVLVEVEGTHTLQNTYESIDIHLGQSYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVT DQ  +DYY+V S+RFTS+VLT T++LHYSNS   VSG PPGGPT +I+WSL Q RS
Sbjct  262   LVTMDQPGQDYYIVASTRFTSQVLTATSILHYSNSAGSVSGTPPGGPTIEIDWSLNQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R+NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGK+RYAVN VSF+  DTPLKL
Sbjct  322   VRQNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPMINGKKRYAVNSVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVFNLGSI D+P  G  YL TSVM A++R+FVE+VF+N ED VQSWHIDG+ F
Sbjct  382   ADYFKIPGVFNLGSIQDNPTGGGGYLQTSVMAADFRAFVEVVFENPEDIVQSWHIDGHIF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRD ++RCT+QVYP+SWTA+YM LDNVGMWNIRSE+WARQY
Sbjct  442   FVVGMDGGQWSPASRLNYNLRDGISRCTIQVYPKSWTALYMPLDNVGMWNIRSENWARQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVY+  NS+RDE PIPKNAL+CGRA GR TRPL
Sbjct  502   LGQQFYLRVYSPANSWRDEYPIPKNALVCGRASGRRTRPL  541



>ref|XP_006486657.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|KDO68240.1| hypothetical protein CISIN_1g009054mg [Citrus sinensis]
Length=545

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/518 (73%), Positives = 442/518 (85%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  28    SPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLISW  87

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGSYFYFPS+   KAAGG+G IRI
Sbjct  88    NGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIRI  147

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF  PA DFTVL GDW K ++ +L+ +LD GH LP PDG+LING G NG +F
Sbjct  148   LSRPLIPVPFPEPAGDFTVLIGDWYKANHNKLKSVLDRGHRLPSPDGILINGHGSNGASF  207

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYRFRISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  208   TVEQGKTYRFRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLV  267

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             T DQ P+D+Y+ VS+RFT++VLT+T  LHYSNS   VSGP PGGPTTQI+WSL Q RS+R
Sbjct  268   TMDQPPQDFYIAVSTRFTNKVLTSTGTLHYSNSAHPVSGPVPGGPTTQIDWSLNQARSIR  327

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +NGKQRYAVN VSF+  DTPLKLAD
Sbjct  328   TNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNGKQRYAVNSVSFIPADTPLKLAD  387

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D P  G+ YL TSVM A++R F+EIVFQN E+ VQSWHIDGY+F+V
Sbjct  388   YFKIGGVFRVGSIQDQPTGGNIYLDTSVMGADFRGFIEIVFQNHENIVQSWHIDGYNFWV  447

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGM+GG WT ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  448   VGMNGGVWTPASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNVRSEFWARQYLG  507

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA+G+HTR L
Sbjct  508   QQFYLRVYSPVESIRDEYPIPKNALLCGRAKGKHTRSL  545



>ref|XP_004957823.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/522 (74%), Positives = 453/522 (87%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N LNEPF
Sbjct  29    VAGDDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPF  88

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+GLQQRRNS++DGV GTTCPIPP  NFTY++QAKDQIG+Y+YFPSL  HKAAGG+G
Sbjct  89    LLSWSGLQQRRNSFEDGVAGTTCPIPPGGNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFG  148

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRP IPVPF PPA D+TVL GDW K ++  L Y+LDSG  L  PDGLLINGR WN
Sbjct  149   GIRVLSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYMLDSGKALGFPDGLLINGRSWN  208

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTV+PGRTYRFRISNVG+ATS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  209   GYTFTVEPGRTYRFRISNVGLATSLNIRFQGHTMKLVEVEGSHTMQTTYSSLDVHLGQSY  268

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ   DY VVVS+RFT+++++TTAVLHY+NS  +  GP PGGPT QI+WSL Q 
Sbjct  269   SVLLTADQPGFDYAVVVSTRFTTKIISTTAVLHYTNSAGKAPGPLPGGPTIQIDWSLNQA  328

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++   RTI LANSA  INGKQRYAVN VS+V+PDTPL
Sbjct  329   RSIRWNLTASGPRPNPQGSYHYGLVPVTRTIRLANSAAIINGKQRYAVNSVSYVSPDTPL  388

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADY+KIGGVF++G+I DSP +GSAYL TSVM ANYR +VE+VF+N ED VQSWHIDGY
Sbjct  389   KVADYYKIGGVFSVGTIADSPSYGSAYLQTSVMGANYRDYVEVVFENNEDEVQSWHIDGY  448

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGMDGG+W+ ASR  YNLRD V+R TVQVYPRSWTAIYM LDNVGMWN+RSE+WAR
Sbjct  449   AFWVVGMDGGKWSPASRQGYNLRDGVSRYTVQVYPRSWTAIYMPLDNVGMWNVRSENWAR  508

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRV+T + S+RDE PIPKNALLCGRA GR TRPL
Sbjct  509   QYLGQQFYLRVWTPSTSFRDEYPIPKNALLCGRAAGRRTRPL  550



>ref|XP_008806482.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=543

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/522 (74%), Positives = 446/522 (85%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V GG+PYR++TW +TYGDI+PLGVKQ+ ILING+FPGPQI+ VTNDNLIINV+N L EPF
Sbjct  22    VQGGDPYRFFTWTVTYGDIWPLGVKQQGILINGEFPGPQIEAVTNDNLIINVFNKLPEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+ QR+NSWQDGVYGT CPIPP KNFTY +Q KDQIGSYFYFPSL  HKAAGG+G
Sbjct  82    LLSWNGVLQRKNSWQDGVYGTNCPIPPGKNFTYAMQVKDQIGSYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRPLIPVPF PPA D+T+L GDW K S+  L+YILDSG NLP PDG+LINGRGWN
Sbjct  142   GIRILSRPLIPVPFPPPASDYTLLIGDWYKTSHSGLKYILDSGKNLPFPDGVLINGRGWN  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+ G+TYRFRISNVG+ATS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  202   GNNFTVEQGKTYRFRISNVGLATSLNIRFQGHAMKLVEVEGSHTLQNTYSSLDVHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P  YY+VVS+RFT  VLTTTA+LHYSNSF +   PPP GPT +I WSL Q 
Sbjct  262   SVLVTADQPPSSYYIVVSTRFTRTVLTTTAILHYSNSFRKPVDPPPAGPTIEIYWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++   RT+ LANSAP INGKQRYAVN VSF+  DTPL
Sbjct  322   RSIRWNLTASGPRPNPQGSYHYGLVNITRTLRLANSAPIINGKQRYAVNSVSFIPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD++KI GVF+LGSIPD+P +   YL TSVM A++R F EIVF+N+EDTVQSWHIDGY
Sbjct  382   KLADFYKIPGVFSLGSIPDNPTFRDGYLQTSVMAADFRGFAEIVFENYEDTVQSWHIDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF++VGMDGG+WT ASR  YNLRD + RCTVQVYP+ W+A+YM LDNVGMWN+RSEDWAR
Sbjct  442   SFWIVGMDGGKWTAASRKLYNLRDAINRCTVQVYPKGWSAVYMPLDNVGMWNVRSEDWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS+RDE  IP+NAL CGRA GR TRPL
Sbjct  502   QYLGQQFYLRVYSPANSWRDEHTIPQNALRCGRAAGRRTRPL  543



>ref|XP_004243477.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=537

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/516 (72%), Positives = 438/516 (85%), Gaps = 0/516 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N ++G +PYR+Y W +TYGDIYPLGVKQ+ ILINGQFPGP I CVTNDNLIINV+N L+E
Sbjct  22    NFIHGEDPYRFYAWNVTYGDIYPLGVKQQGILINGQFPGPPIQCVTNDNLIINVFNNLDE  81

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG++QRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG
Sbjct  82    PFLISWNGVEQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFYYFPSLAFHKAAGG  141

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G+I I SR +IPVPF  PA +F++L GDW K+++  L+ ILD GH+LP PDGLLING G
Sbjct  142   FGSINIASRSVIPVPFPSPAGEFSILTGDWFKQNHSDLKAILDGGHDLPFPDGLLINGHG  201

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              NGYTFTVD G+TYRFRISNVG+ TS+NFRIQGHK+ +VEVEG+HTVQ+ + +LDIHLGQ
Sbjct  202   SNGYTFTVDQGKTYRFRISNVGLTTSVNFRIQGHKMTVVEVEGTHTVQNAYDSLDIHLGQ  261

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVL+TADQ  +DYY+VVS+RFTS+VLT T+ L YSNS   VSGPPPGGPT +I+WS  
Sbjct  262   SYSVLLTADQPAQDYYIVVSTRFTSQVLTATSTLRYSNSAGSVSGPPPGGPTIEIDWSFN  321

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RSLRRNL+ASGPRPNPQGSYHYG+I   RTI LANSAP INGKQRYA+N VSF+  DT
Sbjct  322   QARSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLANSAPIINGKQRYAINSVSFIPADT  381

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLAD+F I GVF LGSIPDSP    AYL TSVM A++R++ E+VF+N ED+VQS+HID
Sbjct  382   PLKLADHFNIPGVFTLGSIPDSPTGSGAYLQTSVMSADFRAYTEVVFENLEDSVQSYHID  441

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             G+ FFVVGM  G+WT ASR  YNLRDT++R TVQVYP+SWTA+YM LDNVGMWNIRS++W
Sbjct  442   GHHFFVVGMGRGEWTPASRLTYNLRDTISRSTVQVYPKSWTALYMPLDNVGMWNIRSQNW  501

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRA  1780
             ARQYLGQQFYLRVY+  NS+RDE P+P N L CGRA
Sbjct  502   ARQYLGQQFYLRVYSPVNSWRDESPVPSNVLHCGRA  537



>ref|NP_001058365.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAD45475.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAD45542.1| putative PS60 [Oryza sativa Japonica Group]
 dbj|BAF20279.1| Os06g0678800 [Oryza sativa Japonica Group]
 dbj|BAG92507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=542

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/521 (74%), Positives = 440/521 (84%), Gaps = 1/521 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW IT+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLL
Sbjct  22    GDDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLL  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  82    SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRP IPVPFAPPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG 
Sbjct  142   RVLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPPPDGLLINGQGWNGN  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFR+SNVGIATS+N RIQGH L LVEVEGSHTVQST+T++D+HLGQSYS 
Sbjct  202   RFTVDQGKTYRFRVSNVGIATSVNIRIQGHSLLLVEVEGSHTVQSTYTSIDVHLGQSYSF  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSG-PPPGGPTTQINWSLFQGR  1141
             LVTADQ P+DY ++VS+RFT+ VLTTTAVLHYSNS   +S   PP  PT QI+WSL Q R
Sbjct  262   LVTADQPPQDYSIIVSTRFTNPVLTTTAVLHYSNSNGALSTVAPPPAPTIQIDWSLNQAR  321

Query  1142  SLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLK  1321
             S+R NL+ASGPRPNPQGSYHYG++   RTI LANS   INGK RYAVN VSF+  DTPLK
Sbjct  322   SIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRASINGKLRYAVNSVSFIPADTPLK  381

Query  1322  LADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             +AD++ I GVF LGS+PD+P  G AYL T+VM AN R +VE++F+N E+ VQSWHIDGY+
Sbjct  382   VADFYNIQGVFALGSMPDNPTGGGAYLQTAVMAANMRDYVEVIFENSENFVQSWHIDGYA  441

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             F+VVGMDGGQWT ASR  YNLRD VAR T+QVYP+SWTAIYM LDNVGMWNIRSE WARQ
Sbjct  442   FWVVGMDGGQWTPASRQSYNLRDAVARYTLQVYPQSWTAIYMPLDNVGMWNIRSESWARQ  501

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             YLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  502   YLGQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  542



>gb|EAZ38022.1| hypothetical protein OsJ_22366 [Oryza sativa Japonica Group]
Length=532

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/521 (74%), Positives = 440/521 (84%), Gaps = 1/521 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW IT+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLL
Sbjct  12    GDDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLL  71

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  72    SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  131

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRP IPVPFAPPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG 
Sbjct  132   RVLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPPPDGLLINGQGWNGN  191

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFR+SNVGIATS+N RIQGH L LVEVEGSHTVQST+T++D+HLGQSYS 
Sbjct  192   RFTVDQGKTYRFRVSNVGIATSVNIRIQGHSLLLVEVEGSHTVQSTYTSIDVHLGQSYSF  251

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSG-PPPGGPTTQINWSLFQGR  1141
             LVTADQ P+DY ++VS+RFT+ VLTTTAVLHYSNS   +S   PP  PT QI+WSL Q R
Sbjct  252   LVTADQPPQDYSIIVSTRFTNPVLTTTAVLHYSNSNGALSTVAPPPAPTIQIDWSLNQAR  311

Query  1142  SLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLK  1321
             S+R NL+ASGPRPNPQGSYHYG++   RTI LANS   INGK RYAVN VSF+  DTPLK
Sbjct  312   SIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRASINGKLRYAVNSVSFIPADTPLK  371

Query  1322  LADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             +AD++ I GVF LGS+PD+P  G AYL T+VM AN R +VE++F+N E+ VQSWHIDGY+
Sbjct  372   VADFYNIQGVFALGSMPDNPTGGGAYLQTAVMAANMRDYVEVIFENSENFVQSWHIDGYA  431

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             F+VVGMDGGQWT ASR  YNLRD VAR T+QVYP+SWTAIYM LDNVGMWNIRSE WARQ
Sbjct  432   FWVVGMDGGQWTPASRQSYNLRDAVARYTLQVYPQSWTAIYMPLDNVGMWNIRSESWARQ  491

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             YLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  492   YLGQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  532



>ref|XP_006422489.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
 gb|ESR35729.1| hypothetical protein CICLE_v10028140mg [Citrus clementina]
Length=545

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 440/518 (85%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  28    SPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLISW  87

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGSYFYFPS+   KAAGG+G IRI
Sbjct  88    NGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSYFYFPSVGFQKAAGGFGGIRI  147

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF  PA DFTVL GDW K ++ +L+ +LD GH LP PDG+LING G NG +F
Sbjct  148   LSRPLIPVPFPEPAGDFTVLIGDWYKANHNKLKAVLDRGHRLPSPDGILINGHGSNGASF  207

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYRFRISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  208   TVEQGKTYRFRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLV  267

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             T DQ P+D+Y+ VS+RFT++VLT+   LHYSN    VSGP PGGPTTQI+WSL Q RS+R
Sbjct  268   TMDQPPQDFYIAVSTRFTNKVLTSAGTLHYSNPARPVSGPVPGGPTTQIDWSLNQARSIR  327

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +NGKQRYAVN VSF+  DTPLKLAD
Sbjct  328   TNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNGKQRYAVNSVSFIPADTPLKLAD  387

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D P  G+ YL TSVM A++R F+EIVFQN E+ VQSWHIDGY+F+V
Sbjct  388   YFKIGGVFRVGSIQDQPTGGNIYLDTSVMGADFRGFIEIVFQNHENIVQSWHIDGYNFWV  447

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGM+GG WT ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  448   VGMNGGVWTPASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNVRSEFWARQYLG  507

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA+G+HTR L
Sbjct  508   QQFYLRVYSPVESIRDEYPIPKNALLCGRAKGKHTRSL  545



>ref|XP_003563038.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=543

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/522 (74%), Positives = 449/522 (86%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI+PLGVKQ+ ILINGQFPGPQID VTNDNL++NVYN LNEPF
Sbjct  22    VGGEDPYRFFTWNVTYGDIFPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVYNNLNEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIG+YFYFPSL  HKAAGG+G
Sbjct  82    LLSWNGVQQRRNSFEDGVAGTTCPIPPGRNFTYILQVKDQIGTYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRP+IPVPF PPA DFT L GDW K ++  L YILDSG  L  PDGLLINGRGWN
Sbjct  142   GIRVLSRPMIPVPFPPPAADFTALIGDWYKTNHTDLRYILDSGKTLGFPDGLLINGRGWN  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTV PG+TYRFRI+NVG+ATS+N R QGH +KLVEVEGSHT+QS +++LD+HLGQSY
Sbjct  202   GYTFTVQPGKTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTLQSIYSSLDVHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ   DY +VVS+RFTS++++TTAVLHY+NS  +  GP PGGPTTQI+WSL Q 
Sbjct  262   SVLVTADQPGFDYPIVVSTRFTSKIISTTAVLHYTNSAGKAPGPLPGGPTTQIDWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG +   +TI LANSA  INGKQRYAVNGVSFVN DTPL
Sbjct  322   RSVRWNLTASGPRPNPQGSYHYGQVPTTKTIRLANSAAIINGKQRYAVNGVSFVNADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADY+KI GVF++G+I DSP  G AYL TSVM A+YR +VEIVF+N E+ VQSWHIDGY
Sbjct  382   KIADYYKIPGVFSVGTISDSPTSGGAYLKTSVMGADYRGYVEIVFENSENEVQSWHIDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGM+GGQW+ ASR  YNLRD V+R T+QVYP +WTAIYM LDNVGMWN+RSE+WAR
Sbjct  442   AFWVVGMNGGQWSSASRQIYNLRDAVSRYTLQVYPNAWTAIYMPLDNVGMWNVRSENWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRV+T + S+RDE PIPKNALLCGRA GR TRPL
Sbjct  502   QYLGQQFYLRVWTPSTSWRDEFPIPKNALLCGRAAGRRTRPL  543



>ref|XP_006656379.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=546

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/521 (73%), Positives = 440/521 (84%), Gaps = 1/521 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +T+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN++INVYN L  PFLL
Sbjct  26    GDDPYRFYTWNVTFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVYNSLPSPFLL  85

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  86    SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  145

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRP IPVPFAPPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG 
Sbjct  146   RVLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPFPDGLLINGQGWNGN  205

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFR+SNVGI+TS+N RIQGH L LVEVEGSHTVQS++T++D+HLGQSYS 
Sbjct  206   RFTVDQGKTYRFRVSNVGISTSVNIRIQGHSLLLVEVEGSHTVQSSYTSIDVHLGQSYSF  265

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSG-PPPGGPTTQINWSLFQGR  1141
             LVTADQ P+DY ++VS+RFT+ VLTTTAVLHYSNS   +S  PPP  PT QI+WSL Q R
Sbjct  266   LVTADQPPQDYSIIVSTRFTNPVLTTTAVLHYSNSNGVLSTVPPPPAPTIQIDWSLNQAR  325

Query  1142  SLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLK  1321
             S+R NL+ASGPRPNPQGSYHYG++   RTI LANS   INGK RYAVN VSF+  DTPLK
Sbjct  326   SIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRANINGKLRYAVNSVSFIPADTPLK  385

Query  1322  LADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             +AD++ I GVF LGS+PD+P  G AYL T+VM AN R ++E++F+N E+ VQSWHIDGY+
Sbjct  386   VADFYNIQGVFTLGSMPDNPTGGGAYLQTAVMAANMRDYIEVIFENSENFVQSWHIDGYA  445

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             F+VVGMDGGQWT ASR  YNLRD +AR T+QVYP+SWTAIYM LDNVGMWNIRSE W RQ
Sbjct  446   FWVVGMDGGQWTPASRQSYNLRDAIARYTLQVYPQSWTAIYMPLDNVGMWNIRSEIWGRQ  505

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             YLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  506   YLGQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  546



>ref|XP_002306213.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
 gb|EEE86724.1| hypothetical protein POPTR_0004s18730g [Populus trichocarpa]
Length=543

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/522 (73%), Positives = 442/522 (85%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++TW +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINVYN L EPF
Sbjct  23    VNAEDPYRFFTWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVYNSLPEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++Y+PSL  HKAAGG+G
Sbjct  83    LISWNGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYYPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRPLIPVPF  PA DFTVL GDW K ++  L+ ILD GH LPLPDG+L+NGRG N
Sbjct  143   GIRILSRPLIPVPFPEPADDFTVLIGDWYKANHTALKAILDRGHKLPLPDGILVNGRGPN  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
                FT  PG+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  203   QTYFTFQPGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VS+RFT+++LTTTA+LHYSNS  +VSGP PGGPTT+INWSL Q 
Sbjct  263   SVLVTADQTAQDYYIAVSTRFTTKILTTTAILHYSNSAKKVSGPIPGGPTTEINWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+RR + +SGPRPNPQGSYHYGMI   RTI L +SA  +NGKQRYAVN VSFV  DTPL
Sbjct  323   RSIRR-VPSSGPRPNPQGSYHYGMINLTRTIKLESSAAQVNGKQRYAVNSVSFVPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADYFKIGGVF +GS+PD P     YL TSVM A++R+FVEIVFQN E+ VQSWHI+GY
Sbjct  382   KIADYFKIGGVFRVGSMPDYPTGKKMYLDTSVMGADFRAFVEIVFQNHENIVQSWHINGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT ASR +YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWNIR+E WAR
Sbjct  442   SFWVVGMDGGVWTPASRNQYNLRDAVSRCTTQVYPKSWTAIYIALDNVGMWNIRTEFWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVY+   S RDE PIPKNALLCGRA GR TRPL
Sbjct  502   QYLGQQFYMRVYSPVESPRDEYPIPKNALLCGRAIGRRTRPL  543



>gb|EAZ02087.1| hypothetical protein OsI_24168 [Oryza sativa Indica Group]
Length=542

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/521 (74%), Positives = 440/521 (84%), Gaps = 1/521 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW IT+GDIYPLGVKQ+ ILINGQFPGPQID VTNDN+IINV+N L  PFLL
Sbjct  22    GDDPYRFYTWNITFGDIYPLGVKQQGILINGQFPGPQIDAVTNDNIIINVFNNLPSPFLL  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW G+QQRR+SWQDGVYGT CPIPP  NFTY++Q KDQIGSY+YFPSL  HKAAGGYG I
Sbjct  82    SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYIMQFKDQIGSYYYFPSLAFHKAAGGYGGI  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRP IPVPFAPPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG 
Sbjct  142   RVLSRPGIPVPFAPPAGDFTILAGDWFKLNHTDLQGILDSGNDLPPPDGLLINGQGWNGN  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFR+SNVGIATS+N RIQGH L LVEVEGSHTVQST+T++D+HLGQSYS 
Sbjct  202   RFTVDQGKTYRFRVSNVGIATSVNIRIQGHSLLLVEVEGSHTVQSTYTSIDVHLGQSYSF  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSG-PPPGGPTTQINWSLFQGR  1141
             LVTADQ P+DY ++VS+RFT+ VLTTTAVLHYSNS   +S   PP  PT QI+WSL Q R
Sbjct  262   LVTADQPPQDYSIIVSTRFTNPVLTTTAVLHYSNSNGALSTVAPPPAPTIQIDWSLNQAR  321

Query  1142  SLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLK  1321
             S+R NL+ASGPRPNPQGSYHYG++   RTI LANS   INGK RYAVN VSF+  DTPLK
Sbjct  322   SIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRASINGKLRYAVNSVSFIPADTPLK  381

Query  1322  LADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             +AD++ I GVF LGS+PD+P  G AYL T+VM AN R +VE++F+N E+ VQSWHIDGY+
Sbjct  382   VADFYNIQGVFALGSMPDNPTGGGAYLQTAVMAANMRDYVEVIFENSENFVQSWHIDGYA  441

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             F+VVGM+GGQWT ASR  YNLRD VAR T+QVYP+SWTAIYM LDNVGMWNIRSE WARQ
Sbjct  442   FWVVGMEGGQWTPASRQSYNLRDAVARYTLQVYPQSWTAIYMPLDNVGMWNIRSESWARQ  501

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             YLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  502   YLGQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  542



>gb|KEH36280.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=544

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/518 (72%), Positives = 437/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PY+++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  27    DPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLISW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIGS++YFPSL   KAAGG+G IRI
Sbjct  87    NGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP+PDG+LINGRG NG +F
Sbjct  147   LSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGVLINGRGPNGLSF  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  207   NVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYYVV S+RF+S++LTTTAVL YSNS   VSGPPPGGPT Q++WSL Q RS+R
Sbjct  267   TADQPSQDYYVVASTRFSSKILTTTAVLRYSNSAGAVSGPPPGGPTIQVDWSLNQARSIR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+LA+S   +NGKQRY +N VS+V PDTPLKLAD
Sbjct  327   TNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGINSVSYVVPDTPLKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI + P  G  YL TSVM A+YRSFVEIVFQN E+ VQS+H+DGYSFFV
Sbjct  387   YFKISGVFRVGSISERPTGGGLYLDTSVMQADYRSFVEIVFQNNENIVQSYHLDGYSFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT +SR  YNLRD VARCT QVYP SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  447   VGMDGGQWTTSSRNGYNLRDAVARCTTQVYPYSWTAIYVALDNVGMWNLRTEFWARQYLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNA LCGRA GRHTRPL
Sbjct  507   QQFYLRVYTASTSIRDEFPIPKNARLCGRASGRHTRPL  544



>ref|XP_010918208.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=541

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 433/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             NPYR++TW +++GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFL+SW
Sbjct  24    NPYRFFTWNVSFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLSEPFLISW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSW+DGV GT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G  RI
Sbjct  84    NGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLYFHKAAGGFGGFRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF+ PA D+TVL GDW K ++  L   LD G  LP PDG+LINGRG NG  F
Sbjct  144   LSRPLIPVPFSEPAGDYTVLIGDWYKANHTALRATLDGGKKLPFPDGILINGRGPNGAYF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYR RISNVG+  S+N RIQ H +KLVEVEG+HT+QS+++++D+H+GQS SVLV
Sbjct  204   TVDQGKTYRLRISNVGLQNSLNIRIQNHTMKLVEVEGTHTLQSSYSSIDVHVGQSLSVLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ PKDYY+ VS+RFT+ +LTTTAVLHYSNS  +V+G  PGGPTTQI+WSL Q RS R
Sbjct  264   TADQSPKDYYIAVSTRFTTIILTTTAVLHYSNSGQKVTGLIPGGPTTQIDWSLNQARSFR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VS+V PDTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGMINLTRTIRLASSAAQVNGKQRYAVNSVSYVEPDTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             Y+KIGGVF LGSI D+P  G  YL TSVM A+YR FVEIVFQN ED VQSWH+DGY+F+V
Sbjct  384   YYKIGGVFRLGSISDNPTGGKEYLDTSVMAADYRVFVEIVFQNNEDIVQSWHLDGYNFWV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQW+  SR  YNLRD V+RCT QVYP+SWTA+Y+ LDNVGMWN+R+E WARQYLG
Sbjct  444   VGMDGGQWSSDSRKGYNLRDAVSRCTTQVYPKSWTAVYLMLDNVGMWNVRTEYWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA GR TRPL
Sbjct  504   QQFYLRVYSPLESIRDEYPIPKNALLCGRASGRQTRPL  541



>ref|XP_002510630.1| multicopper oxidase, putative [Ricinus communis]
 gb|EEF52817.1| multicopper oxidase, putative [Ricinus communis]
Length=546

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/518 (72%), Positives = 436/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLG++Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  29    DPYRFFNWNVTYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  88

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  89    NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  148

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPFA P  D+T+L GDW K ++  L+  LD+G  LP PDG+LINGRG +GY  
Sbjct  149   LSRPRIPVPFADPDGDYTILIGDWYKSNHTDLKAHLDNGKKLPFPDGILINGRGPSGYYL  208

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISN+G+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVL 
Sbjct  209   TVEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLF  268

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVSSRFT++VLTTT VLHYSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  269   TADQPGQDYYIVVSSRFTTQVLTTTGVLHYSNSAGSVSGPPPGGPTIQIDWSLNQARSIR  328

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI  +RTI+LA+SA  +NGKQRYAVN VSF+  DTPLKLAD
Sbjct  329   TNLTASGPRPNPQGSYHYGMINTSRTIILASSAGQVNGKQRYAVNSVSFIPQDTPLKLAD  388

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKI GVF   SI D P  G  YL TSV+  +YR+FVEIVFQN ED VQSWH+DGYSFFV
Sbjct  389   FFKIPGVFKENSISDRPYGGGIYLDTSVLTVDYRAFVEIVFQNNEDIVQSWHLDGYSFFV  448

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD VARCT QVYP SWTAIY+ LDNVGMWN+R+E WARQYLG
Sbjct  449   VGMDGGQWTSASRDQYNLRDAVARCTAQVYPMSWTAIYVPLDNVGMWNLRTEFWARQYLG  508

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT++ S RDE PIPKNAL CG+A GR TRPL
Sbjct  509   QQLYLRVYTTSTSLRDEYPIPKNALTCGKASGRRTRPL  546



>gb|KHG21949.1| L-ascorbate oxidase [Gossypium arboreum]
Length=543

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 434/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV N L+EPFLLSW
Sbjct  26    SPYRFFDWNVTYGDIFPLGVRQQGILINGQFPGPDIYSVTNDNLIINVQNNLDEPFLLSW  85

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NGLQQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IR+
Sbjct  86    NGLQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRV  145

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA DFT+L GDW K  +RQL+ +LD GH LP PDG+LING G NG +F
Sbjct  146   LSRPRIPVPFTDPAGDFTLLIGDWFKNDHRQLKAMLDGGHKLPFPDGILINGHGPNGASF  205

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYRFRISNVG+  S+NFRIQGHK+KLVEVEG+HTVQ+ + +LD+H+GQSYSVLV
Sbjct  206   TVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGTHTVQTIYESLDVHVGQSYSVLV  265

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             T DQ  +D+Y+V S+RFT  +L+TTA LHYSNS   VSGP P GPT QI+WSL Q RS+R
Sbjct  266   TMDQAAQDFYIVASTRFTDNILSTTATLHYSNSNKAVSGPIPAGPTDQIDWSLNQARSIR  325

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGS+HYG+I   RTI L +SA  +NGKQRYAVN VSFV  DTPLKLAD
Sbjct  326   TNLTASGPRPNPQGSFHYGLINITRTIKLVSSAAQVNGKQRYAVNSVSFVPTDTPLKLAD  385

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSIPD+P   + YL TSVM A+YR+FVEIVF+N E+ VQ+WHIDGY+F+V
Sbjct  386   YFKIGGVFRVGSIPDNPTGQNMYLDTSVMGADYRAFVEIVFENHENIVQTWHIDGYAFWV  445

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGM+GG WT  SR  YNLRD V+R T QVYP+SWTAIYMALDNVGMWN+RSE WARQYLG
Sbjct  446   VGMNGGVWTPDSREEYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNVRSEFWARQYLG  505

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT  NS RDE  IPKNALLCGRA+GR TRPL
Sbjct  506   QQFYLRVYTPVNSLRDEYLIPKNALLCGRAQGRSTRPL  543



>gb|KEH30611.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/522 (72%), Positives = 435/522 (83%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  23    VASEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLPEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  83    LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             +I+I SRP IPVPF  PA D+T L GDW K  + +L  +LD GH LPLP  +LING   N
Sbjct  143   SIKILSRPRIPVPFPEPANDYTFLIGDWYKIDHTKLRKVLDFGHKLPLPQAVLINGHA-N  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G +FTVD G+TYR RISNVG+  ++NFRIQGH +KLVEVEG+HTVQ+++ ++D+H+GQSY
Sbjct  202   GTSFTVDQGKTYRLRISNVGLEHTLNFRIQGHIMKLVEVEGTHTVQTSYDSIDVHVGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ PKDYY+VVS+RFT+RVLT+TA LHYSNS   +SGP P GPTTQI+WS+ Q 
Sbjct  262   SVLITADQAPKDYYIVVSTRFTNRVLTSTAALHYSNSQQPLSGPIPAGPTTQIDWSIQQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI  +RTI L +SA  +NGKQRYAVN VSFV  DTPL
Sbjct  322   RSIRTNLTASGPRPNPQGSYHYGMINISRTIKLESSAAQVNGKQRYAVNSVSFVPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSIPD+P   S Y  TSVM A++R+FVEIVFQN E  VQSWHIDGY
Sbjct  382   KLADYFKIGGVFQVGSIPDTPSGRSMYTDTSVMGADFRAFVEIVFQNHESIVQSWHIDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT  SR +YNLRD V+R T QVYP+SWTAIYMALDNVGMWN+RSE WAR
Sbjct  442   SFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNVRSEFWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVY+   S RDE PIPKNALLCG+A GR TRPL
Sbjct  502   QYLGQQFYMRVYSDAGSIRDEYPIPKNALLCGKAVGRETRPL  543



>ref|XP_009397777.1| PREDICTED: L-ascorbate oxidase homolog [Musa acuminata subsp. 
malaccensis]
Length=541

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/524 (73%), Positives = 447/524 (85%), Gaps = 0/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             + V G +PYR++TW ITYGDI+P+GVKQ+ ILINGQFPGPQI+ VTNDN+IINV+N L E
Sbjct  18    SAVLGDDPYRFFTWNITYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNVIINVFNSLPE  77

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFL+SWNG+QQRRNSWQDGVYGT CPIPP +NFTY++Q KDQIGS+FYFPSL  HKAAGG
Sbjct  78    PFLISWNGIQQRRNSWQDGVYGTNCPIPPGRNFTYVMQFKDQIGSFFYFPSLAFHKAAGG  137

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IR+ SRPLIPVPF PPA DFT+L GDW K ++  L+Y+LDSG +L  PDG+LINGRG
Sbjct  138   FGGIRVLSRPLIPVPFPPPAGDFTLLIGDWYKANHSTLKYVLDSGRDLAFPDGVLINGRG  197

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
               G TFTVD GRTYRFRI NVG+ATS+N RIQGH +KLVEVEGSHT+Q+ +++LD+HL Q
Sbjct  198   SYGNTFTVDQGRTYRFRICNVGLATSLNIRIQGHTMKLVEVEGSHTLQNIYSSLDVHLAQ  257

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
              YSVLVTADQ   DY++VVS+RFTS VLTTTA+LHYSNS  R  G PPGGPT QI+WSL 
Sbjct  258   CYSVLVTADQPALDYFIVVSTRFTSSVLTTTAILHYSNSAGRTVGAPPGGPTIQIDWSLN  317

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGKQRYAVN VSF+  DT
Sbjct  318   QARSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPVINGKQRYAVNSVSFIPADT  377

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLK+AD++KI GV  LGSIPD+P +G  YL TSVM AN+R +VEIVF+N+E+T+QSWHID
Sbjct  378   PLKVADFYKIPGVVFLGSIPDNPTFGGGYLQTSVMAANFRDYVEIVFENYENTMQSWHID  437

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSF+ VGMDGGQW+ ASR  YNLRD VARCTVQV+P+SW+AIYM LDNVGMWNIRSE W
Sbjct  438   GYSFWTVGMDGGQWSAASRKNYNLRDAVARCTVQVFPKSWSAIYMPLDNVGMWNIRSEHW  497

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  498   ARQYLGQQFYLRVYSPANSWRDENPIPRNALLCGRASGRRTRPL  541



>ref|XP_009334388.1| PREDICTED: L-ascorbate oxidase homolog [Pyrus x bretschneideri]
Length=544

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/518 (72%), Positives = 435/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  27    DPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87    NGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LPLPDG+LINGRG  G++ 
Sbjct  147   LSRPRIPVPFPDPAGDYTVLIGDWYKANHTTLKAHLDRGKKLPLPDGILINGRGPGGFSL  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
               + G+TYR RISN+G+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  207   NFEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+V SSRFTS +LTTT  +HY+NS  +VSGPPPGGPT Q++WSL Q RS+R
Sbjct  267   TADQPGQDYYLVASSRFTSPILTTTGTVHYANSAGKVSGPPPGGPTIQVDWSLNQARSIR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +T +L NSA  +NGKQRY VN VSFV  DTPLKLAD
Sbjct  327   TNLTASGPRPNPQGSYHYGLINLTKTYVLQNSAGQVNGKQRYGVNSVSFVPADTPLKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D P  G  YL TSV+ A+YR+FVEIVFQN ED +QSWH+DGYSFFV
Sbjct  387   YFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRAFVEIVFQNNEDIIQSWHLDGYSFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR+ YNLRD V+RCT QVYP+SWTAIY+ LDNVGMWN+R+E WARQYLG
Sbjct  447   VGMDGGQWTTASRSAYNLRDAVSRCTTQVYPKSWTAIYIPLDNVGMWNLRTEFWARQYLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYTS+ S RDE PIP+NALLCGRA GR TRPL
Sbjct  507   QQLYLRVYTSSTSIRDEYPIPRNALLCGRASGRRTRPL  544



>gb|ACJ85585.1| unknown [Medicago truncatula]
Length=544

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/518 (72%), Positives = 436/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PY+++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  27    DPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLISW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIGS++YFPSL   KAAGG+G IRI
Sbjct  87    NGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP+PDG+LINGRG NG +F
Sbjct  147   LSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGVLINGRGPNGLSF  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  207   NVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYYVV S+RF+S++ TTTAVL YSNS   VSGPPPGGPT Q++WSL Q RS+R
Sbjct  267   TADQPSQDYYVVASTRFSSKIPTTTAVLRYSNSAGAVSGPPPGGPTIQVDWSLNQARSIR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+LA+S   +NGKQRY +N VS+V PDTPLKLAD
Sbjct  327   TNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGINSVSYVVPDTPLKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI + P  G  YL TSVM A+YRSFVEIVFQN E+ VQS+H+DGYSFFV
Sbjct  387   YFKISGVFRVGSISERPTGGGLYLDTSVMQADYRSFVEIVFQNNENIVQSYHLDGYSFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT +SR  YNLRD VARC +QVYP SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  447   VGMDGGQWTTSSRNGYNLRDAVARCAIQVYPYSWTAIYVALDNVGMWNLRTEFWARQYLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNA LCGRA GRHTRPL
Sbjct  507   QQFYLRVYTASTSIRDEFPIPKNARLCGRASGRHTRPL  544



>gb|KHG11003.1| L-ascorbate oxidase [Gossypium arboreum]
Length=545

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/522 (71%), Positives = 434/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP +  VTNDNLIINVYN L+EPF
Sbjct  24    VQSEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDLYSVTNDNLIINVYNNLDEPF  83

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQAKDQIG+++YFPSL  HKAAGG+G
Sbjct  84    LLSWNGMQQRRNSYEDGVYGTTCPIPPGKNFTYILQAKDQIGTFYYFPSLAFHKAAGGFG  143

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFTVL GDW K  +++L+  LD GH LP PDG+LING G N
Sbjct  144   GIRILSRPRIPVPFPDPASDFTVLIGDWFKTDHKKLQAKLDRGHKLPFPDGILINGHGPN  203

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+ G+TYRFRISNVG+  S+NFRIQGHK+KLVEVEG+HTVQ+ + +LD+H+GQSY
Sbjct  204   GAFFTVEQGKTYRFRISNVGLQNSLNFRIQGHKMKLVEVEGTHTVQTMYESLDVHVGQSY  263

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVT DQ  +D+Y+V S+RFT ++L+TTA LHYSNS   VSGP PGGPT QI+WSL Q 
Sbjct  264   SVLVTMDQSAQDFYIVASTRFTDKILSTTATLHYSNSNKAVSGPIPGGPTDQIDWSLNQA  323

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   RTI L +SA  + GKQRYAVN VSF+  DTPL
Sbjct  324   RSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSADQVKGKQRYAVNSVSFIPADTPL  383

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSI D P   + YL TSVM +++R+FVEIVF+N E  VQSWHIDGY
Sbjct  384   KLADYFKIGGVFRVGSISDKPTGQNMYLDTSVMGSDFRAFVEIVFENHESIVQSWHIDGY  443

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGMDGG WT  SR  YNLRD V+R T QVYPRSWTAIYMALDNVGMWN+R++ WAR
Sbjct  444   AFWVVGMDGGLWTPDSRKEYNLRDAVSRSTTQVYPRSWTAIYMALDNVGMWNVRTQFWAR  503

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS RDE PIPKNALLCGRA+G+ TRPL
Sbjct  504   QYLGQQFYLRVYSPVNSPRDEYPIPKNALLCGRAQGKSTRPL  545



>ref|XP_008236098.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=536

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/517 (72%), Positives = 436/517 (84%), Gaps = 0/517 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  20    DPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLISW  79

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI+I
Sbjct  80    NGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKI  139

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+++L GDW K  ++ L+ ILD GH LP PDG++INGRG NG  F
Sbjct  140   LSRPRIPVPFPDPAGDYSILIGDWYKTDHKILKGILDRGHRLPFPDGIIINGRGPNGTYF  199

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             T D G+TYR RISNVG+  S+NFRIQGHKLKLVEVEG+HT+Q+T+ +LDIH+GQSYSVLV
Sbjct  200   TFDQGKTYRLRISNVGLQNSLNFRIQGHKLKLVEVEGTHTIQTTYESLDIHVGQSYSVLV  259

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P+DYY+ VS+RFTS+VLT+TAV HYSNS  +VSGP P GPTTQ  WSL Q  S+R
Sbjct  260   TADQAPQDYYIAVSTRFTSQVLTSTAVFHYSNSARQVSGPIPAGPTTQTGWSLSQALSIR  319

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++  +RTI L +SA  ++GKQRYAVN VSF+  DTPLKLAD
Sbjct  320   TNLTASGPRPNPQGSYHYGLVNVSRTIKLESSAAQVSGKQRYAVNSVSFIPADTPLKLAD  379

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D+P     YL TSVM A++R+FVEIVFQN E+ VQSWH+DGYSF+V
Sbjct  380   YFKIGGVFKVGSISDNPTGQKMYLDTSVMGADFRAFVEIVFQNHENIVQSWHLDGYSFWV  439

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR +YNLRD V+R T QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  440   VGMDGGKWTPASRNKYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRSEFWARQYLG  499

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRP  1801
             QQFYLRVY+   S RDE PIP+NALLCGRA GR TRP
Sbjct  500   QQFYLRVYSPVESARDEYPIPRNALLCGRAAGRSTRP  536



>ref|XP_011099705.1| PREDICTED: L-ascorbate oxidase homolog [Sesamum indicum]
Length=538

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/518 (71%), Positives = 439/518 (85%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW +TYG IYPLGV Q+ ILINGQFPGP I  VTNDN+I+NV+N L+EPFL+ W
Sbjct  21    SPYRFYTWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNIIVNVFNSLDEPFLIHW  80

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             +G+Q RRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G I+I
Sbjct  81    SGVQNRRNSYEDGVYGTTCPIPPGQNFTYILQMKDQIGSFFYFPSLAFHKAAGGFGGIKI  140

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF PPA D+TVL GDW K ++  L+ ILD GH LP PDG+LINGRG N  +F
Sbjct  141   LSRPLIPVPFDPPADDYTVLIGDWYKSNHTALKAILDKGHKLPFPDGILINGRGPNVTSF  200

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV  G+ YR RI NVG+  S+NFRIQGHK+K+VEVEG+HT+Q ++++LDIHLGQ  SVLV
Sbjct  201   TVQQGKIYRLRICNVGLQNSLNFRIQGHKMKVVEVEGTHTLQVSYSSLDIHLGQCMSVLV  260

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQQP+DYY+VVSSRFTS VLTTT  L Y+NS    SGP PGGPTTQI+WSL Q RS+R
Sbjct  261   TADQQPQDYYIVVSSRFTSTVLTTTGFLRYANSNRPASGPLPGGPTTQIDWSLNQARSIR  320

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI  +RTI LA+SA  +N KQRYA+N VSFV  DTP+KLAD
Sbjct  321   TNLTASGPRPNPQGSYHYGMINTSRTIRLASSAGQVNRKQRYAINSVSFVPADTPIKLAD  380

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +F+I GV+++GSIPD+P     YL TSVM  +YR+F+EIVF+N+ED VQS+H++GYSF+V
Sbjct  381   FFQISGVYHVGSIPDAPNGRGVYLDTSVMQTDYRTFIEIVFENYEDIVQSYHLNGYSFWV  440

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD V+RCTVQVYP+SWTAIY+ALDNVGMW +RSE WARQYLG
Sbjct  441   VGMDGGQWTSASRNQYNLRDAVSRCTVQVYPKSWTAIYIALDNVGMWQLRSEFWARQYLG  500

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNALLCGRA+GRHTRPL
Sbjct  501   QQFYLRVYTTSTSLRDEYPIPKNALLCGRAKGRHTRPL  538



>ref|XP_002307765.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE94761.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=548

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/523 (72%), Positives = 438/523 (84%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26    VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86    LLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+T+L GDW   ++ +L+ ILDSG  LP P+G+LINGRG N
Sbjct  146   GIRILSRPRIPVPFDDPAGDYTILIGDWYMSNHTKLKAILDSGRKLPFPNGILINGRGRN  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY+ TV+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  206   GYSLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTS-RVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             SVL TADQ  +DYY+VV+SRFT+  VL TT +LHYSNS   VSGP PGGPTTQI+WSL Q
Sbjct  266   SVLFTADQPGQDYYIVVTSRFTAPVVLNTTGILHYSNSAGPVSGPFPGGPTTQIDWSLNQ  325

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYGMI   RTI++ANSA  +NGKQRY VN VSF+ PDTP
Sbjct  326   ARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRYGVNSVSFIAPDTP  385

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             +KLADYFKI GVF   SI D P  G  YL TSV+   YR+FVEIVFQN ED VQSWH+DG
Sbjct  386   MKLADYFKIQGVFKENSISDRPYGGGLYLDTSVLTLPYRAFVEIVFQNNEDIVQSWHLDG  445

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVGMDGGQWT ASR +YNLRD V+RCT+QVYP++WTAIY+ LDNVGMWN+R+E WA
Sbjct  446   YSFFVVGMDGGQWTTASRNQYNLRDGVSRCTIQVYPKAWTAIYIPLDNVGMWNLRTEFWA  505

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S RDE PIPKNALLCGRA GRHTRPL
Sbjct  506   RQYLGQQFYLRVYTDSTSLRDEYPIPKNALLCGRASGRHTRPL  548



>ref|XP_007041705.1| SKU5 similar 5 [Theobroma cacao]
 gb|EOX97536.1| SKU5 similar 5 [Theobroma cacao]
Length=547

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/518 (72%), Positives = 431/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP++  VTNDNLIINVYN L+EPFLLSW
Sbjct  30    DPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPELYSVTNDNLIINVYNNLDEPFLLSW  89

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G I+I
Sbjct  90    NGVQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIKI  149

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA DFTVL GDW K  +RQL+  LD GH LP PDG+LING G NG  F
Sbjct  150   LSRPRIPVPFPDPAGDFTVLIGDWYKTDHRQLKARLDGGHKLPFPDGILINGHGPNGAIF  209

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYRFRISNVG+  ++NFRIQGH +KLVEVEG+HTVQ+ + +LD+H+GQSYSVLV
Sbjct  210   TVEQGKTYRFRISNVGLQNTLNFRIQGHSMKLVEVEGTHTVQTIYESLDVHVGQSYSVLV  269

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             T DQ  KD+Y+V S+RFT ++LTTTA LHYSNS   VSGP PGGPT QI+WSL Q RS+R
Sbjct  270   TMDQTAKDFYIVASTRFTDKILTTTASLHYSNSNKAVSGPIPGGPTDQIDWSLNQARSIR  329

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI L +SA  +NGKQRYAVN VSFV  DTPLKLAD
Sbjct  330   TNLTASGPRPNPQGSYHYGLINITRTIKLVSSAAQVNGKQRYAVNSVSFVPADTPLKLAD  389

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI DSP     YL TSVM A++R+FVEIVF+N E  VQSWHI+GY+F+V
Sbjct  390   YFKIDGVFRVGSISDSPAGKKMYLDTSVMGADFRAFVEIVFENHESIVQSWHINGYAFWV  449

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG WT  SR +YNLRD V+R T QVYPRSWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  450   VGMDGGLWTPDSRKQYNLRDAVSRSTTQVYPRSWTAIYIALDNVGMWNVRTEFWARQYLG  509

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA G+ TRPL
Sbjct  510   QQFYLRVYSPVESVRDEYPIPKNALLCGRAAGKSTRPL  547



>ref|XP_002460757.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
 gb|EER97278.1| hypothetical protein SORBIDRAFT_02g034420 [Sorghum bicolor]
Length=548

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/520 (73%), Positives = 447/520 (86%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR++TW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N LNEPFLL
Sbjct  29    GDDPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLL  88

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW+GLQQRRNS++DGV GTTCPIPP  NFTY++QAKDQIG+Y+YFPSL  HKAAGG+G I
Sbjct  89    SWSGLQQRRNSFEDGVAGTTCPIPPGANFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGI  148

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRP IPVPF PPA D+TVL GDW K ++  L Y+LDSG  +  PDGLLINGR  NGY
Sbjct  149   RVLSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYVLDSGKAIGFPDGLLINGRSLNGY  208

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTV PGRTYRFRI+NVG+ATS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSYSV
Sbjct  209   TFTVQPGRTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTMQTTYSSLDVHLGQSYSV  268

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             L+TADQ   DY VVVS+RFT+++++TTAVLHY+NS  +  G  PGGPT QI+WSL Q RS
Sbjct  269   LLTADQPGFDYAVVVSTRFTAKIISTTAVLHYTNSAGKAPGSLPGGPTIQIDWSLNQARS  328

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R NL+ASGPRPNPQGSYHYG++   RTI LANSA  +NGKQRYAVN VS+V+PDTPLK+
Sbjct  329   IRWNLTASGPRPNPQGSYHYGLVPVTRTIRLANSAAAVNGKQRYAVNSVSYVSPDTPLKV  388

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADY+KIGGVF++G+I DSP +G AYL TSVM ANYR +VEIVF+N ED VQSWHIDGY+F
Sbjct  389   ADYYKIGGVFSVGTIADSPTYGGAYLQTSVMGANYRDYVEIVFENNEDEVQSWHIDGYAF  448

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             +VVGMDGG+W+ ASR  YNLRD V+R TVQVYPRSWTAIYM LDNVGMWN+RSE+WARQY
Sbjct  449   WVVGMDGGKWSSASRQGYNLRDGVSRYTVQVYPRSWTAIYMPLDNVGMWNVRSENWARQY  508

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRV+T + S RDE PIPKNALLCGRA GR TRPL
Sbjct  509   LGQQFYLRVWTPSTSLRDEYPIPKNALLCGRAAGRRTRPL  548



>emb|CDX73238.1| BnaC06g36860D [Brassica napus]
Length=541

 Score =   787 bits (2033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/523 (73%), Positives = 434/523 (83%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G +RI SRP IPVPFA PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG 
Sbjct  140   GGLRILSRPGIPVPFADPAGDYTVLIGDWYKANHTDLKAQLDSGRKLPLPDGILINGRG-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISN+G+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ  +DYYVVVSSRFTS VLTTT VL YS S   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+ +GSI   P  G  YL TSVM  +YR+F+EIVF+N ED VQSWH+DG
Sbjct  379   LKLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVMQTDYRTFIEIVFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQWT  SR  YNLRD VARCTVQVYP SWTAIY+ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQFYLRVYTTSTSLRDEYPIPKNALLCGRASGRSTRPL  541



>ref|XP_006390229.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
 gb|ESQ27515.1| hypothetical protein EUTSA_v10018373mg [Eutrema salsugineum]
Length=541

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/523 (73%), Positives = 433/523 (83%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVTAEDPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG 
Sbjct  140   GGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGILINGRG-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGIHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVL+TADQ P+DYYVVVSSRFTS VLTTT VL YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLITADQPPRDYYVVVSSRFTSAVLTTTGVLRYSNSAGGVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+ +GSI   P  G  YL TSV+  +YRSFVEIVF+N ED VQSWH+DG
Sbjct  379   LKLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVLQVDYRSFVEIVFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAIY+ALDNVGMWNIRSE WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNGYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNIRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTTSTSLRDEYPIPKNALLCGRASGRRTRPL  541



>ref|XP_002282214.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI37764.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/518 (71%), Positives = 435/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  25    DPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEPFLISW  84

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  85    NGVQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  144

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+T+L GDW   ++  L+ ILD G  LP PDG+LINGRG N  +F
Sbjct  145   LSRPRIPVPFPDPAGDYTILIGDWYTHNHNTLKAILDRGRRLPFPDGILINGRGANAASF  204

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRIQGHK+ LVEVEG+HT+Q+++++LD+H+GQSYSVLV
Sbjct  205   TVERGKTYRLRISNVGLQNSLNFRIQGHKMTLVEVEGTHTLQTSYSSLDVHVGQSYSVLV  264

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  KDYY+ VSSRFT +VLT++AVLHYSNS + VSGP PGGPTTQI++SL Q RS+R
Sbjct  265   TADQAAKDYYIAVSSRFTEKVLTSSAVLHYSNSVSPVSGPLPGGPTTQIDYSLNQARSIR  324

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI L N+A  +NGKQRYAVN VSF+  DTPLKLAD
Sbjct  325   TNLTASGPRPNPQGSYHYGLINITRTIKLGNTAGQVNGKQRYAVNSVSFIPADTPLKLAD  384

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSIPD P     YL TSVM A++R+FVEIVF+N E  +QSWH+DGYSF+V
Sbjct  385   YFKIGGVFRIGSIPDQPSGKKMYLDTSVMGADFRAFVEIVFENRESIIQSWHLDGYSFWV  444

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGM+GG WT ASR +YNLRD V+RCT QVYP+SWTA+Y+ALDNVGMWN+R+E WARQYLG
Sbjct  445   VGMNGGVWTPASRNQYNLRDAVSRCTTQVYPKSWTAVYIALDNVGMWNLRTEFWARQYLG  504

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA GR TR L
Sbjct  505   QQFYLRVYSPVGSIRDEYPIPKNALLCGRAAGRKTRSL  542



>ref|XP_011041276.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=548

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/523 (72%), Positives = 437/523 (84%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26    VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86    LLSWNGIQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+T+L GDW   ++ +L+ +LDSG  LP P G+LINGRG N
Sbjct  146   GIRILSRPRIPVPFDDPAGDYTILIGDWYMSNHTKLKALLDSGRRLPFPSGILINGRGRN  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY+ TV+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+TF++LD+H+GQSY
Sbjct  206   GYSLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTFSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTS-RVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             SVL TADQ  +DYY+VV+SRFT+  VL TT +LHYSNS   VSGP PGGPTTQI+WSL Q
Sbjct  266   SVLFTADQPGQDYYIVVTSRFTAPVVLNTTGILHYSNSAGPVSGPFPGGPTTQIDWSLNQ  325

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYGMI   RTI++ANSA  +NGKQRY VN VSFV PDTP
Sbjct  326   ARSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRYGVNSVSFVAPDTP  385

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             +KLADYFKI GVF   SI D P  G  YL TSV+   YR+FVEIVFQN E+ VQSWH+DG
Sbjct  386   MKLADYFKIQGVFKENSISDRPYGGGLYLDTSVLTLPYRAFVEIVFQNNENIVQSWHLDG  445

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVGMDGGQWT ASR +YNLRD V+RCT+QVYP++WTAIY+ LDNVGMWN+R+E WA
Sbjct  446   YSFFVVGMDGGQWTTASRNQYNLRDGVSRCTIQVYPKAWTAIYIPLDNVGMWNLRTEFWA  505

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S RDE PIPKNALLCGRA GRHTRPL
Sbjct  506   RQYLGQQFYLRVYTDSTSLRDEYPIPKNALLCGRASGRHTRPL  548



>gb|AFK35121.1| unknown [Medicago truncatula]
Length=544

 Score =   786 bits (2030),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/518 (72%), Positives = 435/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PY+++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  27    DPYKFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLISW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV GTTCPIPP +NFTY+LQ KDQIGS++YFPSL   KAAGG+G IRI
Sbjct  87    NGIQQRRNSFEDGVSGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFQKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP+PDG+LINGRG NG +F
Sbjct  147   LSRPRIPVPFPEPAGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGVLINGRGPNGLSF  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+  +TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  207   NVEQRKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYYVV S+RF+S++ TTTAVL YSNS   VSGPPPGGPT Q++WSL Q RS+R
Sbjct  267   TADQPSQDYYVVASTRFSSKIPTTTAVLRYSNSAGAVSGPPPGGPTIQVDWSLNQARSIR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+LA+S   +NGKQRY +N VS+V PDTPLKLAD
Sbjct  327   TNLTASGPRPNPQGSYHYGLINTTKTIILASSPGQVNGKQRYGINSVSYVVPDTPLKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI + P  G  YL TSVM A+YRSFVEIVFQN E+ VQS+H+DGYSFFV
Sbjct  387   YFKISGVFRVGSISERPTGGGLYLDTSVMQADYRSFVEIVFQNNENIVQSYHLDGYSFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT +SR  YNLRD VARC +QVYP SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  447   VGMDGGQWTTSSRNGYNLRDAVARCAIQVYPYSWTAIYVALDNVGMWNLRTEFWARQYLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNA LCGRA GRHTRPL
Sbjct  507   QQFYLRVYTASTSIRDEFPIPKNARLCGRASGRHTRPL  544



>ref|XP_009106271.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=541

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/522 (73%), Positives = 434/522 (83%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  21    VTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81    LLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              +RI SRP IPVPFA PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG +
Sbjct  141   GLRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGILINGRG-S  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISN+G+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQSY
Sbjct  200   GATLNVEQGKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYYVVVSSRFTS VLTTT VL YS S   VSGP PGGPT QI+WSL Q 
Sbjct  260   SVLVTADQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTPL
Sbjct  320   RAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GV+ +GSI   P  G  YL TSVM  +YR+F+EIVF+N ED VQSWH+DGY
Sbjct  380   KLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVMQTDYRTFIEIVFENSEDIVQSWHLDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQWT  SR  YNLRD VARCTVQVYP SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  440   SFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  500   QYLGQQFYLRVYTTSTSLRDEYPIPKNALLCGRASGRRTRPL  541



>ref|XP_007200295.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
 gb|EMJ01494.1| hypothetical protein PRUPE_ppa004000mg [Prunus persica]
Length=536

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/517 (72%), Positives = 434/517 (84%), Gaps = 0/517 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  20    DPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLISW  79

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI+I
Sbjct  80    NGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKI  139

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+++L GDW K  ++ L+ ILD GH LP PDG++INGRG NG  F
Sbjct  140   LSRPRIPVPFPDPAGDYSILIGDWYKTDHKILKGILDRGHRLPFPDGIIINGRGPNGTYF  199

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             T D G+TYR RISNVG+  S+NFRIQGHKLKLVEVEG+HT+Q+T+ +LDIH+GQSYSVLV
Sbjct  200   TFDQGKTYRLRISNVGLQNSLNFRIQGHKLKLVEVEGTHTIQTTYDSLDIHVGQSYSVLV  259

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P+DYY+ VS+RFTS+VLT+TAV HYSNS  +VSGP P GPTTQ  WSL Q  S+R
Sbjct  260   TADQAPQDYYIAVSTRFTSKVLTSTAVFHYSNSGRQVSGPIPAGPTTQTGWSLSQALSIR  319

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++  +RTI L +SA  ++GKQRYAVN VSF+  DTPLKLAD
Sbjct  320   TNLTASGPRPNPQGSYHYGLVNVSRTIKLESSAAQVSGKQRYAVNSVSFIPADTPLKLAD  379

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D+P     YL TSVM A++R+FVEIVFQN E+ VQSWH+DGYSF+V
Sbjct  380   YFKIGGVFKVGSISDNPTGQKMYLDTSVMGADFRAFVEIVFQNHENIVQSWHLDGYSFWV  439

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR  YNLRD V+R T QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  440   VGMDGGKWTPASRNEYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRTEFWARQYLG  499

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRP  1801
             QQFYLRVY+   S RDE PIP+NALLCGRA GR TRP
Sbjct  500   QQFYLRVYSPVESARDEYPIPRNALLCGRAAGRSTRP  536



>ref|XP_006435293.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 ref|XP_006473746.1| PREDICTED: L-ascorbate oxidase homolog [Citrus sinensis]
 gb|ESR48533.1| hypothetical protein CICLE_v10000783mg [Citrus clementina]
 gb|KDO85016.1| hypothetical protein CISIN_1g009149mg [Citrus sinensis]
Length=542

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/522 (71%), Positives = 437/522 (84%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+QR ILIN QFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22    VSAEDPYRFFNWNVTYGDIYPLGVRQRGILINWQFPGPDIHSVTNDNLIINVFNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82    LLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L   LD G  LPLPDG+LINGRG +
Sbjct  142   GIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDKGKKLPLPDGILINGRG-S  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  F V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  201   GAAFNVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVSSRFTS VLTTT +LHYSNS   VSGP PGGPT QI+WSL Q 
Sbjct  261   SVLVTADQPARDYYIVVSSRFTSTVLTTTGILHYSNSAGPVSGPIPGGPTVQIDWSLNQA  320

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   +TI L++SA  +NGKQRYA+N VSF+  DTPL
Sbjct  321   RSIRSNLTASGPRPNPQGSYHYGLINTTKTIRLSSSAGQVNGKQRYAINSVSFIPADTPL  380

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSI D+P  G  Y  T+VM A+YR+F+EIVFQN ED +QS+H++GY
Sbjct  381   KLADYFKIGGVFRIGSISDNPTGGGIYQDTAVMGADYRAFIEIVFQNDEDIIQSYHLNGY  440

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
              F+VVGMDGGQWT ASR +YNLRD VAR TVQVYP+SW+AIY+ALDNVGMWN+RSE WAR
Sbjct  441   QFWVVGMDGGQWTSASRNQYNLRDAVARVTVQVYPKSWSAIYIALDNVGMWNLRSESWAR  500

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT++ S RDE PIPKNA LCG+A GRHTRPL
Sbjct  501   QYLGQQFYLRVYTASTSLRDEYPIPKNARLCGKAAGRHTRPL  542



>gb|KHN03487.1| L-ascorbate oxidase like [Glycine soja]
Length=556

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/530 (74%), Positives = 436/530 (82%), Gaps = 8/530 (2%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V+  +PYRY TWK+TYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINVYNYL EPF
Sbjct  27    VHCEDPYRYLTWKVTYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLIINVYNYLREPF  86

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNGLQ RRNSWQDGVYGT CPIPP +N TY +Q KDQIGSYFYFP L MHKAAG +G
Sbjct  87    LISWNGLQHRRNSWQDGVYGTNCPIPPGRNLTYAIQVKDQIGSYFYFPFLGMHKAAGAFG  146

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI+SRP IPVPF  PA D T+LAGDW K  +R+L  +L++GHNLP PDGLLINGRGWN
Sbjct  147   GIRIWSRPQIPVPFPSPAGDITILAGDWFKLDHRRLRRLLENGHNLPFPDGLLINGRGWN  206

Query  779   GYTFTVD-------PGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLD  937
             G TFTVD       P   Y  +      AT ++  IQGH LKLVEVEGSHT+Q+T+++LD
Sbjct  207   GNTFTVDQGTPIDLPASMYCEQKLIHSSATYLSTIIQGHSLKLVEVEGSHTLQNTYSSLD  266

Query  938   IHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQI  1117
             +HLGQSYSVLVTADQ  KDYY+VVS+RFT R+LTTT+VLHYS S T VSGP P GPT  I
Sbjct  267   VHLGQSYSVLVTADQPVKDYYMVVSTRFTRRILTTTSVLHYSYSKTGVSGPVPPGPTLDI  326

Query  1118  NWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSF  1297
               S++Q R++R NL+ASGPRPNPQGSYHYG+IKP+RTIMLANSAPYINGKQRYAVNGVS+
Sbjct  327   ASSVYQARTIRWNLTASGPRPNPQGSYHYGLIKPSRTIMLANSAPYINGKQRYAVNGVSY  386

Query  1298  VNPDTPLKLADYFKIGGVFNLGSIPDSPRWG-SAYLATSVMDANYRSFVEIVFQNWEDTV  1474
               PDTPLKLADYF I GVF +GSIP  P  G +AYL TSVM AN+   VEIVFQNWED+V
Sbjct  387   NEPDTPLKLADYFNIPGVFYVGSIPTYPNGGNNAYLQTSVMGANFHELVEIVFQNWEDSV  446

Query  1475  QSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWN  1654
             QSWHIDGYSFFVVG   GQWT  SR +YNLRDTVARCT QVYPRSWTAIYMALDNVGMWN
Sbjct  447   QSWHIDGYSFFVVGYGSGQWTADSRVQYNLRDTVARCTTQVYPRSWTAIYMALDNVGMWN  506

Query  1655  IRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             IRSE+W RQYLGQQ YLRVYT + S+RDE P+PKNALLCGRA GR TRP 
Sbjct  507   IRSENWGRQYLGQQLYLRVYTPSKSWRDEYPVPKNALLCGRASGRRTRPF  556



>gb|AGT57427.1| ascorbate oxidase [Prunus persica]
Length=536

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/517 (72%), Positives = 433/517 (84%), Gaps = 0/517 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPFL+SW
Sbjct  20    DPYRFFDWNITYGDIYPLGVRQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLISW  79

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI+I
Sbjct  80    NGVQHRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAIKI  139

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+++L GDW K  ++ L+ ILD GH LP PDG++INGRG NG  F
Sbjct  140   LSRPRIPVPFPDPASDYSILIGDWYKTDHKILKGILDRGHRLPFPDGIIINGRGPNGTYF  199

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             T D G+TYR RISNVG+  S+NFRIQGHKLKLVEVEG+HT+Q+T+ +LDIH+GQSYSVLV
Sbjct  200   TFDQGKTYRLRISNVGLQNSLNFRIQGHKLKLVEVEGTHTIQTTYDSLDIHVGQSYSVLV  259

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P+DYY+ VS+RFTS+VLT+TAV HYSNS  +VSGP P GPTTQ  WSL Q  S+R
Sbjct  260   TADQAPQDYYIAVSTRFTSKVLTSTAVFHYSNSGRQVSGPIPAGPTTQTGWSLSQALSIR  319

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++  +RTI L +SA  ++GKQRYAVN VSF+  DTPLKLAD
Sbjct  320   TNLTASGPRPNPQGSYHYGLVNVSRTIKLESSAAQVSGKQRYAVNSVSFIPADTPLKLAD  379

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D+P     YL TSVM A++R+FVEIVFQN E+ VQSWH+DGYSF+V
Sbjct  380   YFKIGGVFKVGSISDNPTGQKMYLDTSVMGADFRAFVEIVFQNHENIVQSWHLDGYSFWV  439

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR  YNLRD V+R T QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  440   VGMDGGKWTPASRNEYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRTEFWARQYLG  499

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRP  1801
             QQFYLRVY+   S RDE P P+NALLCGRA GR TRP
Sbjct  500   QQFYLRVYSPAESARDEYPTPRNALLCGRAAGRSTRP  536



>emb|CDX87633.1| BnaA07g32400D [Brassica napus]
Length=541

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/522 (73%), Positives = 433/522 (83%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  21    VTAESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81    LLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              +RI SRP IPVPFA PA D TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG +
Sbjct  141   GLRILSRPGIPVPFADPAGDNTVLIGDWYKSNHTDLKAQLDSGRKLPLPDGILINGRG-S  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISN+G+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQSY
Sbjct  200   GATLNVEQGKTYRLRISNIGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYYVVVSSRFTS VLTTT VL YS S   VSGP PGGPT QI+WSL Q 
Sbjct  260   SVLVTADQPAQDYYVVVSSRFTSDVLTTTGVLRYSGSAGGVSGPIPGGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTPL
Sbjct  320   RAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GV+ +GSI   P  G  YL TSVM  +YR+F+EIVF+N ED VQSWH+DGY
Sbjct  380   KLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVMQTDYRTFIEIVFENSEDIVQSWHLDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQWT  SR  YNLRD VARCTVQVYP SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  440   SFWVVGMDGGQWTPDSRNEYNLRDAVARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  500   QYLGQQFYLRVYTTSTSLRDEYPIPKNALLCGRASGRRTRPL  541



>ref|XP_010028797.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW55613.1| hypothetical protein EUGRSUZ_I01478 [Eucalyptus grandis]
Length=545

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/523 (71%), Positives = 438/523 (84%), Gaps = 0/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EP
Sbjct  23    AVTAEDPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLPEP  82

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLL+WNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS+FY PSL  HKAAGG+
Sbjct  83    FLLTWNGVQQRRNSYEDGVQGTTCPIPPGKNFTYILQVKDQIGSFFYSPSLAFHKAAGGF  142

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRPLIPVPF  PA D+TVL GDW K ++ +L+ ILD GH LP PDG+LINGRG 
Sbjct  143   GGIRILSRPLIPVPFDNPADDYTVLIGDWYKANHTKLKAILDGGHRLPFPDGILINGRGS  202

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NG +F V+ G+TYR RISNVG+  ++NFRIQGHK+KLVEVEG+HTVQ+T+T+LD+H+GQS
Sbjct  203   NGASFKVEQGKTYRLRISNVGLQNTLNFRIQGHKMKLVEVEGTHTVQTTYTSLDVHVGQS  262

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYY+ VS+RFTS+VLT+TAVLHY+NS   VSGP PGGPT++I+WS+ Q
Sbjct  263   YSVLVTADQTPQDYYIAVSTRFTSKVLTSTAVLHYANSARPVSGPVPGGPTSEIDWSINQ  322

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I   RTI L +SA  INGKQRYAVN VS+V  DTP
Sbjct  323   ARSIRTNLTASGPRPNPQGSYHYGLINITRTIKLVSSAGLINGKQRYAVNSVSYVPADTP  382

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYF I GVF +GSI DSP     +L TSVM A+YR+F+E+VF+N E  VQSWH++G
Sbjct  383   LKLADYFNISGVFRVGSISDSPIARKMHLDTSVMGADYRAFIEVVFENRESIVQSWHLNG  442

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             Y+F+VVGMDGG WT   R  YNLRD ++RCT QVYP+SWTAIY+ALDNVGMWN+R+E WA
Sbjct  443   YAFWVVGMDGGLWTPERRNEYNLRDAISRCTTQVYPKSWTAIYIALDNVGMWNMRTEHWA  502

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRV+T + S RDE PIPKNALLCGRA+G+ TRPL
Sbjct  503   RQYLGQQFYLRVHTPSTSIRDEYPIPKNALLCGRAQGKITRPL  545



>ref|XP_003527501.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN41233.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/518 (72%), Positives = 432/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR+YTW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINVYN L+EPF
Sbjct  20    VRGEDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+ QRRNSWQDGVYGT CPI P  NFTY+LQ KDQIGSYFY+PSL  HKAAGGYG
Sbjct  80    LLSWNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               +I SRP IPVPF  PA DFT+LAGDW KR++  L  ILD G +LP PDG++INGRG N
Sbjct  140   GFKIASRPGIPVPFPTPAGDFTILAGDWYKRNHTDLRAILDGGSDLPFPDGIIINGRGSN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
              YTFTVD G+TYRFRISNVG+ TSINFRIQGHK+ +VEVEG+HT+Q+ + +LD+HLGQ+Y
Sbjct  200   AYTFTVDQGKTYRFRISNVGLTTSINFRIQGHKMTIVEVEGTHTLQNVYDSLDVHLGQTY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DY +VV++RFTS+VL  T++  YSNS   V+G  P GPT Q++WSL Q 
Sbjct  260   SVLVTADQPPQDYLIVVTTRFTSQVLNATSIFRYSNSGGGVTGLFPWGPTIQVDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RSLRRNL+ASGPRPNPQGSYHYG+I   RTI L NS P INGKQRYAVN VSF+  DTPL
Sbjct  320   RSLRRNLTASGPRPNPQGSYHYGLINTTRTIRLQNSGPVINGKQRYAVNSVSFIPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+KI GVF+LGSIPD P     YL TSVM+A++R F+E+VF+N EDTV+SWH+DG+
Sbjct  380   KLADYYKIQGVFSLGSIPDYPTGSGGYLQTSVMEADFRGFIEVVFENTEDTVESWHVDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQW+ ASR  YNLRDTV+R TVQVYP+SWTAIYM LDNVGMWN+RSE+W  
Sbjct  440   SFFVVGMDGGQWSSASRLNYNLRDTVSRSTVQVYPKSWTAIYMPLDNVGMWNVRSENWVH  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             QYLGQQFYLRVY+  NS+RDE PIP NA+ CG+A G +
Sbjct  500   QYLGQQFYLRVYSPANSWRDEYPIPSNAIRCGKAVGHY  537



>ref|XP_009402574.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/522 (72%), Positives = 441/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW + YGDIYPLGVKQ+ ILI+GQFPGPQI+ VTNDNLI+NV+N L EPF
Sbjct  20    VAGDDPYRFFTWSVIYGDIYPLGVKQQGILIDGQFPGPQIEAVTNDNLIVNVFNNLTEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQR+NSW+DGVYGT CPI P +N+TY++Q KDQIGSYFYFP+L  HKAAGG+G
Sbjct  80    LISWNGIQQRKNSWEDGVYGTNCPILPGQNYTYVMQVKDQIGSYFYFPTLDFHKAAGGFG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRPLIPVP+ PPA DFT+L GDW K ++  L+ I+DSG++LP PDGLLING+G N
Sbjct  140   GIRVLSRPLIPVPYPPPAGDFTLLTGDWFKTNHTDLKAIVDSGNDLPFPDGLLINGQGAN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY FTVD G+TYRFRISNVG+ TS+N R QGH +KLVE+EGSHTVQ+T+++LDIHLGQS 
Sbjct  200   GYAFTVDQGKTYRFRISNVGLLTSVNIRFQGHTMKLVEIEGSHTVQNTYSSLDIHLGQSC  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DY++VVS+RFT  +LTTTAVLHYSNS    + P PGGPT +++WSL Q 
Sbjct  260   SVLVTADQPAQDYFIVVSTRFTDPILTTTAVLHYSNSIEVPATPLPGGPTVEVDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS R NL+ASGPRPNPQGSYHYG +   RTI LANSAP INGKQRYAVN VSFV+ DTPL
Sbjct  320   RSFRLNLTASGPRPNPQGSYHYGQVNVTRTIRLANSAPIINGKQRYAVNSVSFVSADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+AD++ I GVF LGSIPD+P +   YL TSVM AN+R +VEI+F+N ED VQSWHIDG 
Sbjct  380   KIADFYNISGVFTLGSIPDNPTYAGGYLQTSVMAANFRDYVEIIFENDEDLVQSWHIDGN  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT ASR  YNL DTV+RCTVQVYPRSWTAIYM LDNVGMWN+RSE+W R
Sbjct  440   SFFVVGMDGGQWTSASRDSYNLHDTVSRCTVQVYPRSWTAIYMPLDNVGMWNVRSENWVR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             Q+LGQQFYLRVY+  NS+RDE PIPKNALLCG A GR TRPL
Sbjct  500   QHLGQQFYLRVYSPANSWRDEYPIPKNALLCGLASGRRTRPL  541



>gb|KDP47151.1| hypothetical protein JCGZ_00042 [Jatropha curcas]
Length=540

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/515 (73%), Positives = 430/515 (83%), Gaps = 0/515 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPGP I  VTN+NLIINV+N L EPFL+SW
Sbjct  23    DPYRFFDWNVTYGDIYPLGVKQQGILINGQFPGPDIYSVTNNNLIINVHNSLPEPFLISW  82

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  83    NGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  142

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF  PA DFTVL GDW K ++ +L+ ILD GH LP PDG+LINGRG N   F
Sbjct  143   LSRPLIPVPFPEPADDFTVLIGDWFKTNHTKLKAILDRGHRLPFPDGILINGRGPNATYF  202

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             T + G+TYR RISNVG+  S+NFRIQGH +KLVEVEG+HTVQ+T+++LD+H+GQSYSVLV
Sbjct  203   TFEQGKTYRLRISNVGLQNSLNFRIQGHTMKLVEVEGTHTVQTTYSSLDVHVGQSYSVLV  262

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P++YY+ VS+RFTS+VLTTTA+LHYSNS  +VSGP PGGPTTQINWSL Q RS+R
Sbjct  263   TADQPPQNYYIAVSTRFTSKVLTTTAILHYSNSNKQVSGPIPGGPTTQINWSLNQARSIR  322

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +N KQRYAVN VSFV  DTPLK+AD
Sbjct  323   TNLTASGPRPNPQGSYHYGLINISRTIKLESSAGQVNRKQRYAVNSVSFVPADTPLKIAD  382

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YF I GVF +GSIPD P     YL TSVM A +R FVEIVFQN E+ VQ+WHIDGY+F+V
Sbjct  383   YFNISGVFRVGSIPDYPTHKKMYLDTSVMGAGFRDFVEIVFQNHENIVQTWHIDGYNFWV  442

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGM+GG WT ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  443   VGMNGGVWTSASRNEYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNVRSEFWARQYLG  502

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHT  1795
             QQFYLRVY+   S RDE  IPKNALLCGRA+   T
Sbjct  503   QQFYLRVYSPVRSIRDEYNIPKNALLCGRAKAETT  537



>ref|XP_010266952.1| PREDICTED: L-ascorbate oxidase homolog [Nelumbo nucifera]
Length=546

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/522 (73%), Positives = 439/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPF
Sbjct  25    VRAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLPEPF  84

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+ QRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  85    LISWNGVLQRRNSWQDGVYGTNCPIPPGKNFTYVLQVKDQIGSFFYFPSLAFHKAAGGFG  144

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFTVL GDW K ++  L+  LD G  L  PDG+LINGRG N
Sbjct  145   GIRILSRPRIPVPFPDPAGDFTVLIGDWYKANHTTLKATLDRGKKLHFPDGILINGRGPN  204

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+ G+TYRFRISNVG+  S+NFRIQGH++KLVEVEG+HTVQ+TF++LD+H+GQSY
Sbjct  205   GAYFTVEQGKTYRFRISNVGLQNSLNFRIQGHRMKLVEVEGTHTVQTTFSSLDVHVGQSY  264

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVS+RFTS VLTTT VLHYSNS   VSGPPPGGPT Q++WSL Q 
Sbjct  265   SVLVTADQPAQDYYIVVSTRFTSVVLTTTGVLHYSNSAGGVSGPPPGGPTIQVDWSLNQA  324

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I   RTI L NSA  INGKQRYAVN VSF+  DTPL
Sbjct  325   RAIRTNLTASGPRPNPQGSYHYGLINTTRTIKLVNSAGLINGKQRYAVNSVSFIPADTPL  384

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+AD+FKIGGVF LGSI D+P  G  YL T+VM A++R+F+EIVF+N ED +QSWH+DGY
Sbjct  385   KIADFFKIGGVFRLGSISDNPTGGGMYLDTAVMPADFRAFIEIVFENHEDIIQSWHLDGY  444

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGG WT ASR +YNLRD +ARCT QVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  445   SFFVVGMDGGLWTPASRLQYNLRDAIARCTTQVYPKSWTAIYVALDNVGMWNLRSEFWAR  504

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+   S RDE PIP+NAL+CGRA GRHTRPL
Sbjct  505   QYLGQQFYLRVYSPVESIRDEYPIPRNALVCGRASGRHTRPL  546



>ref|XP_008387887.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=544

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/518 (71%), Positives = 431/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  27    DPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87    NGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG  G++ 
Sbjct  147   LSRPRIPVPFPDPAGDYTVLIGDWYKANHTTLKAHLDRGKKLPFPDGILINGRGPGGFSL  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
               + G+TYR RISN+G+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  207   NFEQGKTYRLRISNIGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+V SSRFTS +LTTT  +HY+NS  +VSGPPPGGPT Q++WSL Q RS+R
Sbjct  267   TADQPGQDYYLVASSRFTSPILTTTGTVHYANSAGKVSGPPPGGPTIQVDWSLNQARSIR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +T +L NSA  +NGKQRY VN VSFV  DTPLKLAD
Sbjct  327   TNLTASGPRPNPQGSYHYGLINLTKTYVLQNSAGQVNGKQRYGVNSVSFVPADTPLKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D P  G  YL TSV+ A+YR+FVEIVFQN ED +QSWH+DGYSFFV
Sbjct  387   YFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRAFVEIVFQNNEDIIQSWHLDGYSFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD V+RCT QVYP+SWTAIY+ LDNVGMWN+R+E WARQYLG
Sbjct  447   VGMDGGQWTTASRNAYNLRDAVSRCTTQVYPKSWTAIYIPLDNVGMWNLRTEFWARQYLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT + S RDE PIP+NA LCGRA GR TRPL
Sbjct  507   QQLYLRVYTPSTSIRDEYPIPRNARLCGRASGRRTRPL  544



>ref|XP_008377105.1| PREDICTED: LOW QUALITY PROTEIN: L-ascorbate oxidase homolog [Malus 
domestica]
Length=544

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/518 (71%), Positives = 431/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  27    DPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS+ DGVYGTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87    NGIQQRRNSFVDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLDFHKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  P  D+TVL GDW K ++  L+  LDSG  LP PDG+LINGRG  G++ 
Sbjct  147   LSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLKAHLDSGKKLPSPDGILINGRGPGGFSL  206

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
               + G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  207   NFEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  266

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYYVV SSRFTS +LTTT  +HY+NS   VSGPPPGGPT Q++WSL Q RS+R
Sbjct  267   TADQPGQDYYVVASSRFTSPILTTTGTVHYANSAGAVSGPPPGGPTIQVDWSLNQARSIR  326

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +T +L NSA  +NGKQRY VN VSFV  DTPLKLAD
Sbjct  327   TNLTASGPRPNPQGSYHYGLINXNKTYVLENSAGQVNGKQRYGVNSVSFVPADTPLKLAD  386

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D P  G  YL TSV+ A+YR+FVEIVFQN ED +QSWH+DGYSFFV
Sbjct  387   YFKIGGVFRVGSISDKPTGGGLYLDTSVLGADYRTFVEIVFQNNEDIIQSWHLDGYSFFV  446

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD V+RCT QVYP+SWTAI++ALDNVGMWN+R+E WARQYLG
Sbjct  447   VGMDGGQWTTASRDAYNLRDAVSRCTTQVYPKSWTAIHIALDNVGMWNLRTEFWARQYLG  506

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYTS+ S RDE PIP+NA LCGRA G+ TRPL
Sbjct  507   QQLYLRVYTSSTSLRDEFPIPRNARLCGRASGQRTRPL  544



>dbj|BAK04971.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/522 (72%), Positives = 446/522 (85%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW ++YGDIYPLGVKQ+ ILINGQFPGPQID VTNDNL++NV+N LNEPF
Sbjct  30    VAGEDPYRFFTWNVSYGDIYPLGVKQQGILINGQFPGPQIDAVTNDNLVVNVFNKLNEPF  89

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+G+QQRRNS++DGV GTTCPIP   NFTY+LQ KDQIG+YFYFPSL  HKAAGG+G
Sbjct  90    LLSWSGVQQRRNSFEDGVAGTTCPIPAGANFTYILQVKDQIGTYFYFPSLAFHKAAGGFG  149

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+ SRP IPVPF PPA D+T L GDW K ++  L Y+LDSG  L  PDGLLINGRGWN
Sbjct  150   AIRVLSRPRIPVPFPPPAADYTALIGDWYKANHTDLRYMLDSGKALGFPDGLLINGRGWN  209

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTV PG TYRFRI+NVG+ATS+N R QGH +KLVEVEGSHT+Q+++++LD+HLGQSY
Sbjct  210   GYTFTVRPGMTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTMQTSYSSLDVHLGQSY  269

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ   DY +VVS+RFT+++++TTAVLHY+NS  +  GP PGGPTTQI+WSL Q 
Sbjct  270   SVLLTADQPALDYAIVVSTRFTTKIISTTAVLHYANSAGKAPGPLPGGPTTQIDWSLNQA  329

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG +   RTI LANSA  INGKQRYAVNGVS VN DTPL
Sbjct  330   RSIRWNLTASGPRPNPQGSYHYGQVPTTRTIRLANSAATINGKQRYAVNGVSHVNADTPL  389

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADY+K+ GVF++G+I DSP +G AYL TSVM A+YR +VEIVF+N E+ VQSWHIDGY
Sbjct  390   KIADYYKMPGVFSVGTISDSPTYGGAYLRTSVMGADYRGYVEIVFENSENEVQSWHIDGY  449

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGM+GG+W+ ASR  YNLRD V+R TVQVYP +WTAIYM LDNVGMWN+RSE WAR
Sbjct  450   AFWVVGMNGGKWSPASRQIYNLRDGVSRYTVQVYPNAWTAIYMPLDNVGMWNVRSETWAR  509

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRV+T + S+RDE PIPKNALLCGRA GR TRPL
Sbjct  510   QYLGQQFYLRVWTPSTSWRDEFPIPKNALLCGRAAGRRTRPL  551



>ref|XP_008445302.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=538

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/519 (71%), Positives = 436/519 (84%), Gaps = 1/519 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYG IYPLG+ Q+ ILINGQFPGP I  VTNDN+IINV+N L+EPFLLSW
Sbjct  20    DPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPFLLSW  79

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  80    NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFGGIRI  139

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN-GYT  787
              SRP IPVPF  PA D+TVL GDW + ++  L   LD+G  LPLPDG+LINGRG N   +
Sbjct  140   LSRPRIPVPFPDPAGDYTVLIGDWYQANHTTLRAQLDNGSMLPLPDGILINGRGPNRTAS  199

Query  788   FTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVL  967
               V+ G+TYR RISNVG+ +S+NFRIQGH++K+VEVEG+HT+Q+ F++LD+H+GQSYSVL
Sbjct  200   INVEQGKTYRLRISNVGLQSSLNFRIQGHRMKVVEVEGTHTLQTEFSSLDVHVGQSYSVL  259

Query  968   VTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSL  1147
             VTADQ  +D+Y+VVSSRFT+ +LTTTA+L Y+NS   V GPPPGGPT QI+WSL Q R++
Sbjct  260   VTADQPAQDFYIVVSSRFTTPILTTTAILRYANSAGSVQGPPPGGPTIQIDWSLNQARAI  319

Query  1148  RRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLA  1327
             R NL+ASGPRPNPQGSYHYGMI   RTI+L+NSA  +NGKQRYAVN VSF+  DTPLK+A
Sbjct  320   RTNLTASGPRPNPQGSYHYGMINTTRTIVLSNSAGIVNGKQRYAVNSVSFIPADTPLKVA  379

Query  1328  DYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFF  1507
             D+FKIGGVF +GSI D P  G  Y  TSVM A+YR+FVEIVFQN ED +QSWH DGYSFF
Sbjct  380   DFFKIGGVFRVGSISDWPNGGGIYQDTSVMGADYRAFVEIVFQNNEDLIQSWHFDGYSFF  439

Query  1508  VVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYL  1687
             VVGMDGGQWT  SR +YNLRD +ARCTVQVYP+SW+AIY+ALDNVGMWNIRSE WARQYL
Sbjct  440   VVGMDGGQWTSNSRNQYNLRDAIARCTVQVYPKSWSAIYVALDNVGMWNIRSEFWARQYL  499

Query  1688  GQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             GQQFYLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  500   GQQFYLRVYTPSTSLRDEYPIPKNALLCGRATGRRTRPL  538



>ref|XP_007221787.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
 gb|EMJ22986.1| hypothetical protein PRUPE_ppa003860mg [Prunus persica]
Length=544

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/522 (71%), Positives = 436/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  23    VAAEDPYRFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  83    LISWNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LD+G  LP PDG+LINGRG  
Sbjct  143   GIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTSLKAHLDAGKKLPFPDGILINGRGPG  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G++F  + G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  203   GFSFNFEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+V SSRFT+ +LTTT  LHY+NS  RVSGPPPGGPT Q++WSL Q 
Sbjct  263   SVLVTADQPGQDYYIVASSRFTTPILTTTGTLHYTNSAGRVSGPPPGGPTIQVDWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   +T +L NSA  +NGKQRY VN VSFV  DTPL
Sbjct  323   RSIRTNLTASGPRPNPQGSYHYGLINTTKTYVLENSAGQVNGKQRYGVNSVSFVPADTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSI D P  G  YL TSV+ A+YR+FVE VFQN ED +QSWH+DGY
Sbjct  383   KLADYFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRTFVEFVFQNNEDIIQSWHLDGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVG+DGGQWT ASR  YNLRD V+RCTVQVYP+SWTAIY+ALDNVGMWN+R+E WAR
Sbjct  443   SFFVVGLDGGQWTPASRKEYNLRDAVSRCTVQVYPKSWTAIYVALDNVGMWNLRTEFWAR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  503   QYLGQQLYLRVYTPSTSIRDEYPIPKNALLCGRATGRRTRPL  544



>gb|KFK34458.1| hypothetical protein AALP_AA5G148000 [Arabis alpina]
Length=541

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/523 (73%), Positives = 431/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPFA PA D+TVL GDW K ++  L   LDSG  LPLPDG+LINGRG 
Sbjct  140   GGIRILSRPRIPVPFADPAGDYTVLIGDWYKSNHTDLRAQLDSGRKLPLPDGILINGRG-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISNVG+  S+NFRIQ HK+++VEVEG HT+ +TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRLRISNVGLQDSLNFRIQDHKMQVVEVEGIHTLPTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ  KDYY+VVSSRFTS VLTTT VL YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQPAKDYYMVVSSRFTSAVLTTTGVLRYSNSAGGVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NLSASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LK+ADYFKI GVF +GSI   P  G  YL TSV+  +YRSFVEIVF+N ED +QSWH+DG
Sbjct  379   LKIADYFKIDGVFRVGSIQPQPTGGGIYLDTSVLQVDYRSFVEIVFENTEDIMQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SW+AIY+ALDNVGMWNIRSE WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNGYNLRDAVARCTVQVYPSSWSAIYIALDNVGMWNIRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTASTSLRDEYPIPKNALLCGRASGRSTRPL  541



>ref|XP_006592035.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=544

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/520 (71%), Positives = 435/520 (84%), Gaps = 1/520 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  26    VAAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  86    LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AI+I SRP IPVPF  PA DF++L GDW + ++++L+ +LD GH LP P  +LINGR  +
Sbjct  146   AIKILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGHKLPFPQAVLINGRP-S  204

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFT   G+TYR RISNVG+  ++NFRIQGH +KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  205   GTTFTAIQGKTYRLRISNVGLQNTLNFRIQGHDMKLVEVEGTHTIQTTYSSLDVHVGQSY  264

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ PKDYY+VVS+RFT+++LT+TA+LHYSNS   VSGP PGGPTTQI+WS+ Q 
Sbjct  265   SVLITADQAPKDYYIVVSTRFTNKILTSTAILHYSNSLQSVSGPIPGGPTTQIDWSIKQA  324

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +NGKQRYAVN +SF   DTPL
Sbjct  325   RSIRTNLTASGPRPNPQGSYHYGLINISRTITLVSSAAQVNGKQRYAVNSISFRPVDTPL  384

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYF IG VF +GSIPDSP     YL TSVM A++R+FVEIVFQN E+ +QSWHIDGY
Sbjct  385   KLADYFNIGRVFQVGSIPDSPSGRPMYLDTSVMGADFRAFVEIVFQNHENIIQSWHIDGY  444

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT  SR +YNLRD V+R T QVYP+SWTAIYMALDNVGMWN+RSE WAR
Sbjct  445   SFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNVRSEFWAR  504

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             QYLGQQFYLRVY+   S RDE PIPKNA+LCG+  GR TR
Sbjct  505   QYLGQQFYLRVYSPVGSIRDEYPIPKNAILCGKVAGRTTR  544



>ref|XP_011034917.1| PREDICTED: L-ascorbate oxidase homolog [Populus euphratica]
Length=547

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/522 (71%), Positives = 429/522 (82%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26    VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86    LLSWNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW   ++  L+  LD G  LP PDG+LINGRG N
Sbjct  146   GIRILSRPRIPVPFDDPAGDYTVLIGDWYLSNHTDLKAALDGGRKLPFPDGILINGRGRN  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY  TV+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  206   GYYLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL TADQ  +DYY+VV+SRFTS VL TT VLHYSNS   VSGP PGGPT +++WS+ Q 
Sbjct  266   SVLFTADQPGQDYYIVVTSRFTSTVLNTTGVLHYSNSAGAVSGPFPGGPTIEVDWSINQA  325

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI   RTI++ANSA  +NGKQRY VN VSFV PDTP+
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGKQRYGVNSVSFVAPDTPM  385

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVF    I D P  G  YL T+V+   YR++VEIVFQN ED +QSWH+DGY
Sbjct  386   KLADYFKIQGVFKENGITDRPYGGGLYLDTAVLTVPYRAYVEIVFQNDEDILQSWHLDGY  445

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT ASR +YNLRD VARCT QVYP++WTAIY+ LDNVGMWN+R+E WAR
Sbjct  446   SFFVVGMDGGQWTTASRDQYNLRDAVARCTAQVYPKAWTAIYIPLDNVGMWNLRTEFWAR  505

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  506   QYLGQQFYLRVYTDSTSLRDEFPIPKNALLCGRASGRRTRPL  547



>ref|XP_008452926.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
 gb|ADN34135.1| multicopper oxidase [Cucumis melo subsp. melo]
Length=541

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 440/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP I CVTNDNLIINV+N L+EPFL+SW
Sbjct  25    NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDIHCVTNDNLIINVFNSLDEPFLISW  84

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85    NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  N  +F
Sbjct  145   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGILINGRA-NDTSF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             +V+ G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  204   SVEQGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RFTSRVL TT +L YSNS   V GPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQPAQDYYIVVSTRFTSRVLATTGILRYSNSAGPVKGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+LANSA  +N KQRYAVN VSFV  DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTKTIILANSAGQVNRKQRYAVNSVSFVPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKIGGVF +GSI D P  G  YL TSVM A+YR+FVEIVFQN E+ VQSWHIDGYSFFV
Sbjct  384   FFKIGGVFRVGSISDRPTGGGIYLDTSVMGADYRAFVEIVFQNNENIVQSWHIDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT++SR +YNLRD +ARCT QVYP SWTAIY+ALDNVG+WN+RSE WARQYLG
Sbjct  444   VGMDGGQWTQSSRNQYNLRDAIARCTTQVYPYSWTAIYVALDNVGLWNVRSEFWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT + S RDE PIPKNALLCGRA GRHTRPL
Sbjct  504   QQFYLRVYTPSTSLRDEFPIPKNALLCGRASGRHTRPL  541



>ref|XP_004506310.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/516 (71%), Positives = 433/516 (84%), Gaps = 0/516 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR+YTW +TYGDIYP G++Q+ ILINGQFPGPQI+ VTNDN+IINV+N L+EPF
Sbjct  20    VSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+ QRRNSWQDGVYGT CPIPP +NFTY LQ K+QIGSYFYFPSL +HKAAGGYG
Sbjct  80    LISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFPSLALHKAAGGYG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              + + SRP+IPVPF PP+ DFT+LAGDW ++S+ +L  ILD+G+NLP PDG++ING G N
Sbjct  140   GLSVASRPMIPVPFDPPSGDFTILAGDWYQKSHTELRAILDNGNNLPFPDGIIINGHGSN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
               TFTVD G+TY+FRISNVG+ TSINFRIQGHK+KLVEVEG+HT+Q+ + ++DIHLGQSY
Sbjct  200   PITFTVDQGKTYQFRISNVGLTTSINFRIQGHKMKLVEVEGTHTLQNIYDSIDIHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+VVS+RFTS+VLT  ++LHY NS   VSGP P GPT    W + Q 
Sbjct  260   SVLVTADQPPQDYYIVVSTRFTSKVLTVVSILHYRNSEGTVSGPFPLGPTIDTEWPIEQV  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQG+Y YGMI   RTI L NSAP INGKQRYA+N VSF+  DTPL
Sbjct  320   RSIRGNLTASGPRPNPQGTYKYGMINTTRTITLQNSAPIINGKQRYAINSVSFIPSDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KL DYFKI G+F+LGSI D+P  G  YL TSVM A+YR++VEIVF N EDT+QSWHIDG+
Sbjct  380   KLGDYFKIQGLFSLGSISDNPTGGDGYLQTSVMAADYRAYVEIVFHNPEDTLQSWHIDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
              FFVVGMD GQW+ ASR  YNL D ++RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WAR
Sbjct  440   FFFVVGMDIGQWSPASRLSYNLIDAISRCTVQVYPKSWTALYMPLDNVGMWNVRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARG  1786
             QYLGQQFYLRVY+S NS+RDE PIP NAL CG+  G
Sbjct  500   QYLGQQFYLRVYSSANSWRDEYPIPLNALHCGKVVG  535



>gb|EMT15848.1| L-ascorbate oxidase-like protein [Aegilops tauschii]
Length=545

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/522 (72%), Positives = 444/522 (85%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW ++YGDIYPLG KQ+ ILINGQFPGPQI+ VTNDNL++NV+N LNEPF
Sbjct  24    VAGEDPYRFFTWNVSYGDIYPLGGKQQGILINGQFPGPQIEAVTNDNLVVNVFNKLNEPF  83

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+GLQQRRNS++DGV GTTCPIPP  NFTY+LQAKDQIG+YFYFPSL  HKAAGG+G
Sbjct  84    LLSWSGLQQRRNSFEDGVAGTTCPIPPGANFTYILQAKDQIGTYFYFPSLAFHKAAGGFG  143

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRP IPVPF PPA D+TVL GDW K ++  L Y+LDSG  L  PDGLLINGRGWN
Sbjct  144   GIRVLSRPRIPVPFPPPAADYTVLIGDWYKTNHTDLRYMLDSGKALGFPDGLLINGRGWN  203

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTFTV PG TYRFRI+NVG+ATS+N R QGH +KLVEVEGSHT+Q+ +++LD+HLGQSY
Sbjct  204   GYTFTVQPGMTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTMQTAYSSLDVHLGQSY  263

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ   DY +VVS+RFT+++++TTAVLHY+NS  +  GP PGGPTTQI+WSL Q 
Sbjct  264   SVLLTADQPGFDYSIVVSTRFTTKIISTTAVLHYANSAGKAPGPLPGGPTTQIDWSLNQA  323

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG +   +TI LANSA  INGKQRYAVN VS VN DTPL
Sbjct  324   RSIRWNLTASGPRPNPQGSYHYGQVPTTKTIRLANSAATINGKQRYAVNSVSHVNADTPL  383

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADY+KI GVF++G+I DSP +G AYL TSVM A+YR +VEIVF+N E+ VQSWHIDGY
Sbjct  384   KIADYYKIPGVFSVGTISDSPTYGGAYLRTSVMGADYRGYVEIVFENSENEVQSWHIDGY  443

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGM+GG+W+ ASR  YNLRD V+R TVQVYP +WTAIYM LDNVGMWN+RSE WAR
Sbjct  444   AFWVVGMNGGKWSPASRQIYNLRDGVSRYTVQVYPNAWTAIYMPLDNVGMWNVRSETWAR  503

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRV+T + S+RDE PIPKNALLCGRA GR TRP 
Sbjct  504   QYLGQQFYLRVWTPSTSWRDEFPIPKNALLCGRAAGRRTRPF  545



>ref|XP_003537754.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/520 (71%), Positives = 433/520 (83%), Gaps = 1/520 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  29    VAAEDPYRFFDWTITYGDIYPLGVKQQVILINGQFPGPEIYSVTNDNLIINVHNNLTEPF  88

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  89    LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  148

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AI+I SRP IPVPF  PA DF++L GDW + ++++L+ +LD GH LP P  +LINGR  +
Sbjct  149   AIKILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGHRLPFPQAVLINGRP-S  207

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTV+ G+TYR RISNVG+  ++NFRIQGH +KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  208   GTTFTVEQGKTYRLRISNVGLQNTLNFRIQGHDMKLVEVEGTHTIQTTYSSLDVHVGQSY  267

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+T DQ PKDYY+VVS+RFT+++ T+TA+LHYSNS   VSGP P GPTTQI+WS+ Q 
Sbjct  268   SVLITVDQAPKDYYIVVSTRFTNKIFTSTAILHYSNSQQSVSGPIPSGPTTQIDWSIKQA  327

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I  +RTI L +S   +N KQRYAVN VSF   DTPL
Sbjct  328   RSIRTNLTASGPRPNPQGSYHYGLINISRTITLVSSTAQVNKKQRYAVNSVSFTPADTPL  387

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYF IGG+F +GSIPDSP     YL TSVM A++R+FVE+VFQN E+ +QSWHIDGY
Sbjct  388   KLADYFNIGGIFQVGSIPDSPSGRPMYLDTSVMGADFRAFVEVVFQNHENIIQSWHIDGY  447

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT  SR +YNLRD V+R T QVYP+SWTAIYMALDNVGMWN+RSE WAR
Sbjct  448   SFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNMRSEFWAR  507

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             QYLGQQFYLRVY    S RDE PIPKNALLCG+A GR TR
Sbjct  508   QYLGQQFYLRVYLPVGSIRDEYPIPKNALLCGKAAGRTTR  547



>ref|XP_006302110.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
 gb|EOA35008.1| hypothetical protein CARUB_v10020107mg [Capsella rubella]
Length=541

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/523 (72%), Positives = 429/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINVYN L+EP
Sbjct  20    AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGVQQRRNSFVDGVYGTTCPIPPGKNYTYMLQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L   LD+G  LPLPDG+LINGR  
Sbjct  140   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLRAQLDNGKKLPLPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRLRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ PKDYYVVVSSRFTS VLTTT VL YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQPPKDYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEI+F+N ED VQSWH+DG
Sbjct  379   LKLADYFKIDGVYRTGSIQYQPTGGGIYLDTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+ ASR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWSPASRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S RDE P+P+NALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRPL  541



>gb|KHN05478.1| L-ascorbate oxidase like [Glycine soja]
Length=544

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/520 (71%), Positives = 434/520 (83%), Gaps = 1/520 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  26    VAAEDPYRFFDWTITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNNLTEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  86    LLSWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AI+I SRP IPVPF  PA DF++L GDW + ++++L+ +LD GH LP P  +LINGR  +
Sbjct  146   AIKILSRPRIPVPFPDPAGDFSLLIGDWYQINHKKLQSVLDFGHKLPFPQAVLINGRP-S  204

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFT   G+TYR RISNVG+  ++NFRIQGH +KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  205   GTTFTAIQGKTYRLRISNVGLQNTLNFRIQGHDMKLVEVEGTHTIQTTYSSLDVHVGQSY  264

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ PKDYY+VVS+RFT+++LT+TA+LHYSNS   VSGP  GGPTTQI+WS+ Q 
Sbjct  265   SVLITADQAPKDYYIVVSTRFTNKILTSTAILHYSNSLQSVSGPILGGPTTQIDWSIKQA  324

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +NGKQRYAVN VSF   DTPL
Sbjct  325   RSIRTNLTASGPRPNPQGSYHYGLINISRTITLVSSAAQVNGKQRYAVNSVSFRPADTPL  384

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYF IG VF +GSIPDSP     YL TSVM A++R+FVEIVFQN E+ +QSWHIDGY
Sbjct  385   KLADYFNIGRVFQVGSIPDSPSGRPMYLDTSVMGADFRAFVEIVFQNHENIIQSWHIDGY  444

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT  SR +YNLRD V+R T QVYP+SWTAIYMALDNVGMWN+RSE WAR
Sbjct  445   SFWVVGMDGGVWTPNSRNQYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNVRSEFWAR  504

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             QYLGQQFYLRVY+   S RDE PIPKNA+LCG+  GR TR
Sbjct  505   QYLGQQFYLRVYSPVGSIRDEYPIPKNAILCGKVAGRTTR  544



>ref|XP_007131584.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
 gb|ESW03578.1| hypothetical protein PHAVU_011G025400g [Phaseolus vulgaris]
Length=545

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/516 (72%), Positives = 432/516 (84%), Gaps = 1/516 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV N L EPFLLSW
Sbjct  31    DPYRFFDWTVTYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVRNNLTEPFLLSW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS+QDGVYGTTCPIPP +NFTY LQ KDQIGS+FYFPSL  HKAAGG+GAI+I
Sbjct  91    NGVQQRRNSYQDGVYGTTCPIPPGQNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFGAIKI  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA DF++L GDW + +++ L+ +LD GH LPLP  +LINGR  NG TF
Sbjct  151   LSRPRIPVPFPDPAGDFSLLIGDWYQINHKTLQTVLDLGHRLPLPQAVLINGRP-NGTTF  209

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRI+GH +KLVEVEG+HT+Q+T+++LD+H+GQSYSVL+
Sbjct  210   TVEQGKTYRLRISNVGLENSLNFRIEGHSMKLVEVEGTHTIQTTYSSLDVHVGQSYSVLI  269

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ PKDYY+ VS+RFT +++T+TA LHYSNS   VSG  PGGPT QI+WSL Q RS+R
Sbjct  270   TADQAPKDYYIAVSTRFTDKIITSTANLHYSNSQQSVSGLIPGGPTDQIDWSLQQARSIR  329

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +N KQRYAVN VSF+  DTPLKLAD
Sbjct  330   TNLTASGPRPNPQGSYHYGLINVSRTITLVSSAAQVNRKQRYAVNSVSFIPADTPLKLAD  389

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSIPDSP     YL TSVM A++R+FVEIVFQN E+ VQSWHIDGYSF+V
Sbjct  390   YFKIGGVFQVGSIPDSPSRKPMYLDTSVMGADFRAFVEIVFQNHENIVQSWHIDGYSFWV  449

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG WT  SR  YNLRD V+R T QVYP+SWTAIYMALDNVGMWN+RSE WARQYLG
Sbjct  450   VGMDGGVWTPQSRNEYNLRDAVSRSTTQVYPKSWTAIYMALDNVGMWNVRSEFWARQYLG  509

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             QQFY+RVY+   S RDE PIPKNALLCG+A GR +R
Sbjct  510   QQFYMRVYSPVGSIRDEYPIPKNALLCGKAAGRTSR  545



>ref|XP_008382461.1| PREDICTED: L-ascorbate oxidase homolog [Malus domestica]
Length=535

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/521 (71%), Positives = 434/521 (83%), Gaps = 1/521 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W +TYGDIYPLG +Q+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  16    VSAEDPYRYFDWNVTYGDIYPLGARQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPF  75

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  76    LISWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFG  135

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AI+I SRP IPVPF  PA D+++L GDW K  ++ L+ ILD GH LP PD +LINGRG +
Sbjct  136   AIKIJSRPRIPVPFPEPAGDYSILIGDWYKTDHKVLKAILDRGHRLPFPDSVLINGRGPS  195

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFT + G+TYR RISNVG+  S+NFRIQGH LKLVEVEG+HT+Q+T+ +LDIH+GQSY
Sbjct  196   GTTFTFEQGKTYRLRISNVGLQNSLNFRIQGHXLKLVEVEGTHTLQTTYESLDIHVGQSY  255

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+ VS+RFTS+VLT+TA+ HYSNS  +VSGP PGGP TQ  WSL Q 
Sbjct  256   SVLVTADQAPQDYYIAVSTRFTSKVLTSTAIFHYSNSARQVSGPIPGGP-TQTGWSLSQA  314

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++  +RTIML +SA  ++GKQRYAVN VSF+  DTPL
Sbjct  315   RSIRTNLTASGPRPNPQGSYHYGLVNVSRTIMLQSSAAQVSGKQRYAVNSVSFIPADTPL  374

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVF +GSI D P   + YL TSVM A++R+FVEIVF+N E+ VQS+H+DGY
Sbjct  375   KLADYFKIDGVFKVGSISDYPTHQNMYLDTSVMGADFRAFVEIVFENKENIVQSFHLDGY  434

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG+WT  SR  YNLRD V+R T QVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  435   SFWVVGMDGGKWTPTSRNEYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNVRSEFWAR  494

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRP  1801
             QYLGQQFYLRVY+   S RDE PIP+NALLCGRA GR TRP
Sbjct  495   QYLGQQFYLRVYSPVESTRDEFPIPRNALLCGRAAGRTTRP  535



>ref|XP_008791980.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 431/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             NPYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL+SW
Sbjct  24    NPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNSLTEPFLISW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSW+DGV GT CPIPP KNFTY+LQ KDQIGSYFYFPSL  HKAAGG+G  RI
Sbjct  84    NGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQVKDQIGSYFYFPSLYFHKAAGGFGGFRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF+ PA D+TVL GDW K ++  L   LD G  LP PDG+LING G NG  F
Sbjct  144   LSRPLIPVPFSEPAGDYTVLIGDWYKANHSALRARLDGGTKLPFPDGILINGHGPNGAYF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYR RISNVG+  S+N RIQGH +KLVEVEG+HT+Q+T++++D+HLGQS SVLV
Sbjct  204   TVDQGKTYRLRISNVGLQNSLNIRIQGHTMKLVEVEGTHTLQNTYSSIDVHLGQSLSVLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ PKDYY+ VS+RFT+ VLTTTAVLHYS+S  +VSGP PGGPTTQI+WSL Q RS R
Sbjct  264   TADQAPKDYYIAVSTRFTTTVLTTTAVLHYSSSGQKVSGPIPGGPTTQIDWSLNQARSFR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   RTI L++SA  +NGKQRYAVN VS+V PDTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGMINVTRTIQLSSSAAQVNGKQRYAVNSVSYVEPDTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKIGGVF LGSI D P  G  YL TSVM ANYR FVEIVF+N ED VQSWH+DGY+F+V
Sbjct  384   HFKIGGVFRLGSISDHPTGGKEYLDTSVMAANYRVFVEIVFENSEDIVQSWHLDGYNFWV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQW   SR  YNLRD V+RCT QVYP+SWTA+Y+ LDNVGMWN+RSE WAR+YLG
Sbjct  444   VGMDGGQWRPDSRKGYNLRDAVSRCTAQVYPKSWTAVYLMLDNVGMWNVRSEYWARRYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCGRA G HTRPL
Sbjct  504   QQFYLRVYSPIESIRDEYPIPKNALLCGRASGHHTRPL  541



>ref|XP_002300669.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
 gb|EEE79942.1| multi-copper oxidase type 1 family protein [Populus trichocarpa]
Length=547

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/522 (70%), Positives = 429/522 (82%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  26    VKAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86    LLSWNGIQQRRNSFEDGVIGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+T+L GDW   ++  L+ +LD G  LP PDG+LINGRG N
Sbjct  146   GIRILSRPRIPVPFDDPAGDYTILIGDWYLSNHTDLKAVLDGGRKLPFPDGILINGRGRN  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY  TV+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  206   GYYLTVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL TADQ  +DYY+VV+SRFTS VL TT +LHYSNS   VSGP PGGPT +++WSL Q 
Sbjct  266   SVLFTADQPGQDYYIVVTSRFTSTVLNTTGILHYSNSAGAVSGPFPGGPTIEVDWSLNQA  325

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI   RTI++ANSA  +NG QRY VN VSF+ PDTP+
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGMINTTRTIIVANSAGQVNGNQRYGVNSVSFIAPDTPM  385

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADYFKI GVF    I D P  G  YL T+V+   YR++VEIVFQN ED +QSWH+DGY
Sbjct  386   KIADYFKIQGVFKENGITDRPYGGGLYLDTAVLTVPYRAYVEIVFQNDEDILQSWHLDGY  445

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT ASR +YNLRD VARCT QVYP++WTAIY+ LDNVGMWN+R+E WAR
Sbjct  446   SFFVVGMDGGQWTTASRDQYNLRDAVARCTTQVYPKAWTAIYIPLDNVGMWNLRTEFWAR  505

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  506   QYLGQQFYLRVYTDSTSLRDEFPIPKNALLCGRASGRRTRPL  547



>ref|XP_004142986.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 gb|KGN62282.1| Multicopper oxidase [Cucumis sativus]
Length=539

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/523 (71%), Positives = 438/523 (84%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYG IYPLG+ Q+ ILINGQFPGP I  VTNDN+IINV+N L+EPF
Sbjct  17    VRAEDPYRFFDWNVTYGTIYPLGLPQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEPF  76

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  77    LLSWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQMKDQIGSFYYFPSLGFHKAAGGFG  136

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW + ++  L   LD+G  LPLPDG+LINGRG N
Sbjct  137   GIRILSRPRIPVPFPDPAGDYTVLIGDWYQANHTTLRAQLDNGSMLPLPDGILINGRGPN  196

Query  779   -GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
                +  V+ G+TYR RISNVG+ +S+NFRIQGH++K+VEVEG+HT+Q+ F++LDIH+GQS
Sbjct  197   RTASINVEQGKTYRLRISNVGLQSSLNFRIQGHRMKVVEVEGTHTLQTEFSSLDIHVGQS  256

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ  +D+Y+VVSSRFT+ +L+TTA+L Y+NS   V GPPPGGPT QI+WSL Q
Sbjct  257   YSVLVTADQPAQDFYIVVSSRFTTPILSTTAILRYANSAGSVQGPPPGGPTIQIDWSLNQ  316

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI++ANSA  ++GKQRYAVN VSF+  DTP
Sbjct  317   ARAIRTNLTASGPRPNPQGSYHYGMITTTRTIVVANSAGIVDGKQRYAVNSVSFIPADTP  376

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LK+AD+FKIGGVF +GSI D P  G  Y  TSVM A+YR+FVEIVFQN ED +QSWH+DG
Sbjct  377   LKVADFFKIGGVFRVGSISDWPNGGGIYQDTSVMGADYRAFVEIVFQNNEDLIQSWHLDG  436

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVGMDGGQWT  SR +YNLRD +ARCTVQVYP+SW+AIY+ALDNVGMWNIR+E WA
Sbjct  437   YSFFVVGMDGGQWTSNSRNQYNLRDAIARCTVQVYPKSWSAIYVALDNVGMWNIRTEFWA  496

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  497   RQYLGQQFYLRVYTPSTSLRDEYPIPKNALLCGRATGRRTRPL  539



>ref|XP_004506275.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=536

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/516 (71%), Positives = 432/516 (84%), Gaps = 0/516 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR+YTW +TYGDIYP G++Q+ ILINGQFPGPQI+ VTNDN+IINV+N L+EPF
Sbjct  20    VSGEDPYRFYTWNVTYGDIYPFGIQQQGILINGQFPGPQIESVTNDNVIINVFNSLDEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+ QRRNSWQDGVYGT CPIPP +NFTY LQ K+QIGSYFYFPSL +HKAAGGYG
Sbjct  80    LISWNGVLQRRNSWQDGVYGTNCPIPPGQNFTYALQVKNQIGSYFYFPSLALHKAAGGYG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              + + SRP+IPVPF PP+ DFT+LAGDW ++S+ +L  ILD+G+NLP PDG++ING G N
Sbjct  140   GLSVASRPMIPVPFDPPSGDFTILAGDWYQKSHTELRAILDNGNNLPFPDGIIINGHGSN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
               TFTVD G+TYRFRISNVG+ TSINFRIQGHK+KLVEVEG+HT+Q+ + ++DIHLGQSY
Sbjct  200   PITFTVDQGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGTHTLQNIYDSIDIHLGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ P+DYY+VVS+RFTS+VLT  ++LHY NS   VSGP P GPT    W + Q 
Sbjct  260   SVLVTADQPPQDYYIVVSTRFTSKVLTVVSILHYRNSEGTVSGPFPLGPTIDTEWPIEQV  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPN QG+Y YGMI   RTI L NSAP INGKQRYA+N VSF+  DTPL
Sbjct  320   RSIRGNLTASGPRPNLQGTYKYGMINTTRTITLQNSAPIINGKQRYAINSVSFIPSDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI G+F+LGSI D+P  G  YL TSVM A+YR +VEIVFQN EDT+QSWHIDG+
Sbjct  380   KLADYFKIQGLFSLGSISDNPTGGDGYLQTSVMAADYRDYVEIVFQNPEDTLQSWHIDGH  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
              FFVVGMD GQW+ ASR  YNL D V+RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WAR
Sbjct  440   FFFVVGMDVGQWSPASRLSYNLIDAVSRCTVQVYPKSWTALYMPLDNVGMWNVRSENWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARG  1786
             QYLGQQFYLRVY+S NS+RDE  IP NAL CG+  G
Sbjct  500   QYLGQQFYLRVYSSANSWRDEYRIPPNALHCGKVVG  535



>ref|XP_007017955.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
 gb|EOY15180.1| SKU5 similar 5 isoform 1 [Theobroma cacao]
Length=541

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/518 (74%), Positives = 437/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24    DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84    NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L   LD G  LP PDG+LINGRG  G +F
Sbjct  144   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLRAHLDLGKKLPFPDGILINGRGPGGASF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T++++DIH+GQS SVL 
Sbjct  204   NVEQGKTYRLRISNVGLQNSLNFRIQNHKLKLVEVEGTHTLQTTYSSIDIHVGQSSSVLF  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RFT+ VLTTTA L YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQPAQDYYIVVSTRFTNPVLTTTATLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI LANSA  +NGKQRYAVN VSFV  DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTRTIRLANSAGQVNGKQRYAVNSVSFVPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF +GSI D+P  G  YL TSVM+A+YR+F+EIVFQN ED VQSWH+DGYSFFV
Sbjct  384   YFKIGGVFRVGSISDNPYGGGIYLDTSVMNADYRAFIEIVFQNDEDIVQSWHLDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD ++RCT QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  444   VGMDGGQWTAASRNQYNLRDAISRCTTQVYPKSWTAIYVALDNVGMWNLRSEFWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT ++S RDE PIPKNALLCGRA GR TRPL
Sbjct  504   QQFYLRVYTDSSSLRDEYPIPKNALLCGRASGRSTRPL  541



>ref|XP_002438855.1| hypothetical protein SORBIDRAFT_10g027270 [Sorghum bicolor]
 gb|EER90222.1| hypothetical protein SORBIDRAFT_10g027270 [Sorghum bicolor]
Length=546

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/518 (73%), Positives = 438/518 (85%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW +T+GDIYPLGVKQ  ILINGQFPGPQID VTNDN+I+NV+N L  PFLLSW
Sbjct  29    DPYRFYTWNVTFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLSW  88

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
              G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIG+Y+YFPSL  HKAAGGYG IR+
Sbjct  89    QGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGTYYYFPSLLFHKAAGGYGGIRV  148

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA DFT+LAGDW K ++  L+ ILDSG++LPLPDGLLING+GWNG  F
Sbjct  149   LSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPLPDGLLINGQGWNGNRF  208

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFR+SNVGIATS+N RIQGH + LVEVEGSHT+QST+T++DIHLGQSYS LV
Sbjct  209   TVDQGKTYRFRVSNVGIATSVNIRIQGHSMLLVEVEGSHTMQSTYTSIDIHLGQSYSFLV  268

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P DY +++S+RFT+ VLTTTA+LHYSNS    + PPP  PT +I++SL Q RS+R
Sbjct  269   TADQPPADYSIIISTRFTTPVLTTTAILHYSNSNGAATVPPPAAPTVEIDFSLNQARSIR  328

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++   RTI+LANS   INGK RYAVN +SF+  DTPLK+AD
Sbjct  329   WNLTASGPRPNPQGSYHYGLVNTTRTIILANSRATINGKLRYAVNSISFIPADTPLKVAD  388

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             ++KI GVF LGS+PD+P  G AYL TSVM AN R +VEIVFQN E+ VQSWHIDGY+F+V
Sbjct  389   FYKIPGVFTLGSMPDNPTGGGAYLQTSVMAANMRDYVEIVFQNTENFVQSWHIDGYAFWV  448

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD +AR T+QVYP+SWTAIYM LDNVGMWN+RSE WARQYLG
Sbjct  449   VGMDGGQWTPASRQGYNLRDAIARYTLQVYPQSWTAIYMPLDNVGMWNVRSESWARQYLG  508

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  509   QQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  546



>ref|XP_010061137.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW68030.1| hypothetical protein EUGRSUZ_F01712 [Eucalyptus grandis]
Length=543

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 442/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV N LNEPFLLSW
Sbjct  27    DPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVINSLNEPFLLSW  86

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  87    NGIQQRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  146

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF PPA D+T+L GDW K ++  L  ILD+G  LP PDG+LINGRG +G +F
Sbjct  147   LSRPLIPVPFPPPAGDYTILIGDWYKANHTDLRAILDNGKVLPFPDGILINGRG-SGASF  205

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRIQGHK+ L EVEG+HTVQ+T+ +LD+H+GQS SVLV
Sbjct  206   TVEQGKTYRLRISNVGLMNSLNFRIQGHKMVLAEVEGTHTVQNTYESLDVHVGQSLSVLV  265

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  KDYY+VVSSRFT++VLTTT VLHYSNS   VSGP PGGPTTQI+WSL Q RS+R
Sbjct  266   TADQPGKDYYIVVSSRFTTQVLTTTGVLHYSNSAGPVSGPVPGGPTTQIDWSLNQARSIR  325

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   RTI LANSA  +NGKQRYAVN VSF+  DTPLKLAD
Sbjct  326   TNLTASGPRPNPQGSYHYGMINTTRTIRLANSAGPVNGKQRYAVNSVSFIPADTPLKLAD  385

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI D+P     YL TSVM  +YR+++EIVF+N EDT+QSWH++GY+FFV
Sbjct  386   YFKIDGVFRVGSISDNPTGSGIYLDTSVMRVDYRAYIEIVFENSEDTIQSWHLNGYAFFV  445

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD V+RCT+QVYP+SW+AIY+ LDNVGMWN+RSE WARQYLG
Sbjct  446   VGMDGGQWTPASRNQYNLRDGVSRCTIQVYPKSWSAIYIPLDNVGMWNLRSESWARQYLG  505

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFY++VYT++ S RDE PIPKNA+LCGRA GRHTRPL
Sbjct  506   QQFYMQVYTTSTSLRDEYPIPKNAILCGRASGRHTRPL  543



>ref|XP_010471765.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   776 bits (2005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/523 (72%), Positives = 430/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR+Y W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINVYN L+EP
Sbjct  21    AVTAEDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEP  80

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP +N+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81    FLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGF  140

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L+  LD+G  LPLPDG+LINGR  
Sbjct  141   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGILINGRS-  199

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  200   SGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQS  259

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT VL YSNS   VSGP PGGPT QI+WSL Q
Sbjct  260   YSVLVTADQPPRDYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGPTIQIDWSLNQ  319

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  320   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  379

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEIVF+N ED VQSWH+DG
Sbjct  380   LKLADYFKIDGVYRTGSIQYQPTGGGIYLDTSVMQVDYRTFVEIVFENSEDIVQSWHLDG  439

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  440   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  499

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S RDE P+P+NALLCGRA GR TRPL
Sbjct  500   RQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRPL  542



>gb|KHF99506.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/518 (73%), Positives = 436/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +T+GDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFL+SW
Sbjct  24    DPYRFFDWNVTFGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVHNSLNEPFLISW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             +G+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G IRI
Sbjct  84    SGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGGIRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG  G +F
Sbjct  144   LSRPRIPVPFPDPAGDYTVLVGDWYKSNHTNLKARLDRGKKLPFPDGILINGRGPGGASF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ H+L LVEVEG+HT+Q+T++++D+HLGQS SVL 
Sbjct  204   NVEQGKTYRLRISNVGLQNSLNFRIQNHRLTLVEVEGTHTLQTTYSSIDLHLGQSCSVLF  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
              ADQ  KDYY+ VS+RFTSRVLT+TA+L YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   KADQPAKDYYIAVSTRFTSRVLTSTAILRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI LANSA  +NGKQRYAVN VSFV  DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTRTIRLANSAGQVNGKQRYAVNSVSFVPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGG+F +GSI D+P  G  YL TSVM A+YR+F+EIVFQN E+ VQSWH+DGYSFFV
Sbjct  384   YFKIGGIFRVGSISDNPYGGKIYLDTSVMQADYRAFIEIVFQNNENIVQSWHLDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  444   VGMDGGQWTTASRRGYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNLRSEFWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNALLCGRA GRHTRPL
Sbjct  504   QQFYLRVYTTSTSLRDEYPIPKNALLCGRASGRHTRPL  541



>ref|XP_002889063.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65322.1| hypothetical protein ARALYDRAFT_895494 [Arabidopsis lyrata subsp. 
lyrata]
Length=541

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/523 (72%), Positives = 428/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVVAEDPYRFFEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L   LDSG  LPLPDG+LINGR  
Sbjct  140   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLRAQLDSGKKLPLPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K++EVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRLRISNVGLQDSLNFRIQDHKMKVIEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT +L YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQTPRDYYVVVSSRFTSNVLTTTGILRYSNSAGAVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LK+ADYFKI GVF  GSI   P  G  YL TSVM  +YR+FVEIVF+N ED VQSWH+DG
Sbjct  379   LKIADYFKIDGVFRSGSIQYQPTGGGIYLDTSVMQVDYRTFVEIVFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNVYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTPSTSLRDEYPIPKNALLCGRASGRRTRPL  541



>ref|NP_001147597.1| LOC100281206 precursor [Zea mays]
 gb|ACG28039.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACL54459.1| unknown [Zea mays]
 gb|AFW68979.1| L-ascorbate oxidase [Zea mays]
Length=548

 Score =   776 bits (2004),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/518 (73%), Positives = 436/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW +T+GDIYPLGVKQ  ILINGQFPGPQID VTNDN+I+NV+N L  PFLLSW
Sbjct  31    DPYRFYTWNVTFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLSW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
              G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYGAIR+
Sbjct  91    QGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLLFHKAAGGYGAIRV  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG  F
Sbjct  151   LSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGLLINGQGWNGNRF  210

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFR+SNVGIATS+N RIQGH + LVEVEGSHT+QST+T++D+HLGQSYS LV
Sbjct  211   TVDQGKTYRFRVSNVGIATSVNIRIQGHSMLLVEVEGSHTMQSTYTSIDVHLGQSYSFLV  270

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P DY +VVS+RFT+ VLTT A+LHYS+S    S PPP  PT +I++SL Q RS+R
Sbjct  271   TADQPPADYSIVVSTRFTTPVLTTAAILHYSSSNGAASVPPPPAPTVEIDFSLNQARSIR  330

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++   RTI LANS   INGK RYAVNG+SFV  DTPLK+AD
Sbjct  331   WNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRATINGKLRYAVNGISFVPADTPLKVAD  390

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             ++ I GVF LGS+PD+P  G AYL TSVM AN R +VE+VF+N E+ VQSWHIDGY+F+V
Sbjct  391   FYSIPGVFTLGSMPDNPTGGGAYLQTSVMAANMRDYVEVVFENAENLVQSWHIDGYAFWV  450

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD +AR T+QVYP+SWTAIYM LDNVGMWN+RSE WARQYLG
Sbjct  451   VGMDGGQWTPASRQGYNLRDAIARYTLQVYPQSWTAIYMPLDNVGMWNVRSESWARQYLG  510

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  511   QQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  548



>ref|XP_010923873.1| PREDICTED: L-ascorbate oxidase homolog [Elaeis guineensis]
Length=543

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/522 (72%), Positives = 434/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW I YGDI+PLGVKQ+ ILINGQFPGPQI+ VTNDN+IINV+N L EPF
Sbjct  22    VRGEDPYRFFTWNIAYGDIWPLGVKQQGILINGQFPGPQIEAVTNDNIIINVFNNLPEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+ QR+N WQDGVYGT CPIPP +NFTY LQ KDQIGSYFYFPSL  HKAAGG+G
Sbjct  82    LLSWNGVLQRKNCWQDGVYGTNCPIPPGQNFTYALQVKDQIGSYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
               RI SRPLIPVPF PPA D+T+L GDW K ++  L+ +LD G NLP PDG+LINGRGWN
Sbjct  142   GFRILSRPLIPVPFPPPAADYTLLIGDWYKTNHYGLKGVLDGGKNLPFPDGVLINGRGWN  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+ G+TYRFRISNVG+ATS+N R QGH ++LVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  202   GNNFTVEQGKTYRFRISNVGLATSLNIRFQGHTMQLVEVEGSHTLQNTYSSLDVHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLV ADQ P DYY+VVS+RFT  VLTTT++LHY+NSF +   PPP GPTT I WSL Q 
Sbjct  262   SVLVKADQLPGDYYIVVSTRFTRTVLTTTSILHYNNSFKKPVDPPPAGPTTDIAWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG +   RTI LANSAP INGKQRYA+N VSF+  DTPL
Sbjct  322   RSIRWNLTASGPRPNPQGSYHYGSVNITRTIRLANSAPIINGKQRYAINSVSFIPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+F I GVF+LGSIPD+P +   YL TSVM A++R F EIVF+N+EDTVQSWHIDGY
Sbjct  382   KLADFFNISGVFSLGSIPDNPTFKDGYLQTSVMAADFRGFAEIVFENYEDTVQSWHIDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF++VGMD G WTE SR  YNL D V RCT+QVYP+ WTAIYM LDNVGMWN+RSEDWAR
Sbjct  442   SFWIVGMDEGTWTEDSRKSYNLVDAVNRCTLQVYPKGWTAIYMPLDNVGMWNVRSEDWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS RDE  IPKNAL CGRA GR TRPL
Sbjct  502   QYLGQQFYLRVYSPANSLRDEYAIPKNALRCGRAAGRRTRPL  543



>ref|XP_008798222.1| PREDICTED: L-ascorbate oxidase homolog [Phoenix dactylifera]
Length=541

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 437/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  V+NDNLIINV+N L EPFL+SW
Sbjct  24    SPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVSNDNLIINVHNSLTEPFLISW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNSW+DGV GT CPIPP KNFTY+LQAKDQIGS+FYFPSL  HKAAGG+G  RI
Sbjct  84    NGVQQRRNSWEDGVSGTNCPIPPGKNFTYILQAKDQIGSFFYFPSLYFHKAAGGFGGFRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPF  PA D+TVL GDW K +++ L   LD G  LP PDG+LINGRG NG +F
Sbjct  144   LSRPLIPVPFPEPAGDYTVLIGDWYKANHKVLRARLDRGKKLPFPDGILINGRGPNGASF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+ YR RISNVG+  S+N RIQGHK+KLVEVEG+HT+Q+T++++DIH+GQS SVL+
Sbjct  204   TVDQGKIYRLRISNVGLQHSLNIRIQGHKMKLVEVEGTHTLQNTYSSIDIHVGQSVSVLI  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ PKDYYV VS+RFT+  LTTTAVLHYSNS  +VSGP PGGPTTQI+WSL QGRS R
Sbjct  264   TADQPPKDYYVAVSTRFTTTTLTTTAVLHYSNSREKVSGPIPGGPTTQIDWSLNQGRSFR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   RTI LANSA  +NGKQRYAVN VS+V PDTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGMINVTRTIRLANSAAQVNGKQRYAVNSVSYVEPDTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKIGGVF LGSI D+P     YL TSVM A++R+FVEIVF+N E  VQSWH+DGY+F+V
Sbjct  384   HFKIGGVFRLGSISDNPTGTKVYLDTSVMAADFRTFVEIVFENKESIVQSWHLDGYNFWV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+W+ ASR  YNLRD V+RCT QVYPRSWTA+Y+ LDNVGMWN+R+E W+R+YLG
Sbjct  444   VGMDGGKWSPASRKGYNLRDAVSRCTAQVYPRSWTAVYVMLDNVGMWNVRTEFWSRRYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+   S RDE PIPKNALLCG+A GR+TRPL
Sbjct  504   QQFYLRVYSPLESIRDEYPIPKNALLCGKATGRYTRPL  541



>ref|XP_004157080.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 438/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP + CVTNDNLIINV+N L+EPFL+SW
Sbjct  25    NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISW  84

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85    NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  N  +F
Sbjct  145   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGILINGRA-NDTSF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVL+
Sbjct  204   GVEQGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLI  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RFTSRVL TT +L YSNS   V GPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQPAQDYYIVVSTRFTSRVLATTGILRYSNSAGPVKGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+LANSA  +N KQRYAVN VSFV  DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTKTIILANSAGQVNRKQRYAVNSVSFVPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKIGGVF +GSI D P  G  YL TSVM  +YR+FVEI+FQN E+ VQSWHIDGYSFFV
Sbjct  384   FFKIGGVFRVGSISDRPTGGGIYLDTSVMGVDYRAFVEIIFQNNENIVQSWHIDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT++SR +YNLRD +ARCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  444   VGMDGGQWTQSSRNQYNLRDAIARCTTQVYPYSWTAIYVALDNVGMWNVRSEFWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT + S RDE PIPKNALLCG+A GRHTRPL
Sbjct  504   QQFYLRVYTPSTSLRDEFPIPKNALLCGKASGRHTRPL  541



>gb|ACL53812.1| unknown [Zea mays]
 tpg|DAA62866.1| TPA: L-ascorbate oxidase [Zea mays]
Length=550

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/520 (73%), Positives = 444/520 (85%), Gaps = 2/520 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N LNEPFLLSW
Sbjct  31    DPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLSW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             +GLQQRRNS++DGV GTTCPIPP  NFTY++QAKDQIG+Y+YFPSL  HKAAGG+G IR+
Sbjct  91    SGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIRV  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA D+TVL GDW K ++  L Y+LDSG  L  PDGLLINGRG NGYTF
Sbjct  151   LSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYVLDSGVALGFPDGLLINGRGLNGYTF  210

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V PGRTYRFRI+NVG+ATS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSYSVL+
Sbjct  211   NVQPGRTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTMQTTYSSLDVHLGQSYSVLL  270

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ   DY VVVS+RFTSR+++TTAVL Y+NS  R  GP PGGPT QI+WSL Q RS+R
Sbjct  271   TADQPGYDYAVVVSTRFTSRIISTTAVLRYANSAGRAPGPLPGGPTIQIDWSLNQARSVR  330

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++   RTI LANSA  I GK+RYAVNG S+V PDTPLK+AD
Sbjct  331   WNLTASGPRPNPQGSYHYGLVPVTRTIRLANSAATIGGKRRYAVNGASYVGPDTPLKVAD  390

Query  1331  YFKIGGVFNLGSIPDSP--RWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             Y+KIGGVF++G+I DSP    G+AYL TSVM A+YR +VE+VF+N ED VQSWHIDGY+F
Sbjct  391   YYKIGGVFSVGTIADSPPAYGGAAYLRTSVMGASYRDYVEVVFENGEDEVQSWHIDGYAF  450

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             +VVGMDGG+W+ ASR  YNLRD V+R TVQVYPRSWTAIYM LDNVGMWN+RSE+WARQY
Sbjct  451   WVVGMDGGKWSSASRQGYNLRDGVSRYTVQVYPRSWTAIYMPLDNVGMWNVRSENWARQY  510

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRV+T + S RDE PIPKNALLCGRA GR TRPL
Sbjct  511   LGQQFYLRVWTPSTSLRDEYPIPKNALLCGRAAGRRTRPL  550



>ref|XP_010323833.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=543

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/520 (75%), Positives = 446/520 (86%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+Y W ITYGDIYPLGVKQ+ ILINGQFPGP ID VTNDNLIINV+N L+EPFLL
Sbjct  24    GESPYRWYNWNITYGDIYPLGVKQQGILINGQFPGPPIDSVTNDNLIINVFNSLDEPFLL  83

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGS+FYFPSL MHKAAGGYG I
Sbjct  84    SWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAMHKAAGGYGGI  143

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
              I SRPLIPVPF PPA D+T+L GDW K ++  L+ ILD G++LP PDGLL+NGRG NG 
Sbjct  144   IIRSRPLIPVPFPPPAGDYTILVGDWFKLNHTDLKAILDGGNDLPFPDGLLVNGRGSNGL  203

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD GRTYRFRISNVG+ T+INFRIQGHK+ LVE EG+HT+Q+T+ +LDIHLGQSYSV
Sbjct  204   TFTVDQGRTYRFRISNVGLTTAINFRIQGHKMVLVEAEGTHTLQNTYESLDIHLGQSYSV  263

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVT DQ  +DYY+V S+RFTS VLT T++LHYSNS   VSGPPPGGPT +I+WSL Q RS
Sbjct  264   LVTMDQPGQDYYIVASTRFTSPVLTATSILHYSNSAGGVSGPPPGGPTIEIDWSLNQARS  323

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R+NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGK+RYAVN VSF+  DTPLKL
Sbjct  324   IRQNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPMINGKKRYAVNSVSFIPADTPLKL  383

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVFNLGSI D P  G  YL TSVM A++R++VE+VF+N EDTVQSWHIDG+ F
Sbjct  384   ADYFKIPGVFNLGSIQDYPTGGGGYLQTSVMAADFRAYVEVVFENPEDTVQSWHIDGHIF  443

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRD ++RCT+QVYPRSWTA+YM LDNVGMWNIRSE+WARQY
Sbjct  444   FVVGMDGGQWSAASRLNYNLRDGISRCTIQVYPRSWTALYMPLDNVGMWNIRSENWARQY  503

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVY+  NS+RDE PIP  ALLCGRA GR TRPL
Sbjct  504   LGQQFYLRVYSPVNSWRDEYPIPIGALLCGRASGRKTRPL  543



>ref|XP_010416527.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=541

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/523 (72%), Positives = 430/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR+Y W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINVYN L+EP
Sbjct  20    AVTAEDPYRFYEWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP +N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYVLQMKDQIGSFYYFPSLAFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L+  LD+G  LPLPDG+LINGR  
Sbjct  140   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT VL YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQPPRDYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEIVF+N ED VQSWH+DG
Sbjct  379   LKLADYFKIDGVYRTGSIQYQPTGGGIYLDTSVMQVDYRTFVEIVFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S RDE P+P+NALLCGRA GR TRPL
Sbjct  499   RQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRPL  541



>ref|XP_007160607.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
 gb|ESW32601.1| hypothetical protein PHAVU_001G001500g [Phaseolus vulgaris]
Length=539

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/518 (72%), Positives = 440/518 (85%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L++PFLLSW
Sbjct  22    DPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLSW  81

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG+G +RI
Sbjct  82    NGVQQRRNSFEDGVWGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGLRI  141

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+ ILD G  LP PDG+LINGRG NG +F
Sbjct  142   LSRPRIPVPFDDPAGDYTVLIGDWYKFNHTDLQAILDRGSKLPFPDGILINGRGSNGASF  201

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HTVQ+T+++LD+H+GQSYSVLV
Sbjct  202   NVEQGKTYRLRISNVGLENSLNFRIQNHKLKLVEVEGTHTVQTTYSSLDVHVGQSYSVLV  261

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVSSRFTS VLT+TA+L Y+NS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  262   TADQPGQDYYIVVSSRFTSTVLTSTAILRYANSAGPVSGPPPGGPTIQIDWSLNQARSIR  321

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI+L++SA  INGKQRY +N VS+V PDTPLKLAD
Sbjct  322   TNLTASGPRPNPQGSYHYGLINTTRTIILSSSAGIINGKQRYGINSVSYVAPDTPLKLAD  381

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +G+I D P  G  YL TSVM  +YR+FVEIVFQN ED +QS+H+DGYSFFV
Sbjct  382   YFKIPGVFRVGTISDRPTGGGIYLDTSVMQTDYRTFVEIVFQNDEDVIQSYHLDGYSFFV  441

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT AS+ +YNLRD V+RCT QVYP+SWTAIY+ LDNVGMWN+RSE WARQYLG
Sbjct  442   VGMDGGQWTAASKNQYNLRDAVSRCTTQVYPKSWTAIYIPLDNVGMWNLRSEFWARQYLG  501

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFY+RVYT++ S RDE P+PKNALLCGRA GRHTRPL
Sbjct  502   QQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRPL  539



>ref|XP_009418785.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=543

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/522 (74%), Positives = 449/522 (86%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI+P+GVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  22    VLGDDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPP  NFTY++Q KDQIGSYFYFPSL  HKAAGG+G
Sbjct  82    LLSWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGSYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRPLIPVPF PPA D+T+L G W K ++  L YILDSG +LP PDG+LINGRG  
Sbjct  142   GIRVLSRPLIPVPFPPPAADYTLLIGAWYKANHTDLRYILDSGRDLPFPDGILINGRGQY  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTV+ G+TYRFR+SNVG+ATS+N RIQGH + LVEVEGSHT+Q+T+++ D+HLGQS 
Sbjct  202   GNTFTVEQGKTYRFRVSNVGLATSLNVRIQGHAMLLVEVEGSHTLQNTYSSFDLHLGQSC  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             S LVTADQ P DYY+VVSSRFTS VL+TTAVLHYSNS  +  GPPPGGPT QI+WSL Q 
Sbjct  262   SFLVTADQPPMDYYIVVSSRFTSTVLSTTAVLHYSNSGGQPVGPPPGGPTIQIDWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG++   RTI LA+SAP INGKQRYAVN VSF+  DTPL
Sbjct  322   RSIRWNLTASGPRPNPQGSYHYGLVNTTRTIRLASSAPVINGKQRYAVNSVSFIPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+AD++ I GVF+LGS+PD+P +G+ YL TSVM AN+R +VEI+F+N EDT+QSWHIDGY
Sbjct  382   KVADFYNIPGVFSLGSMPDNPTYGAGYLQTSVMAANFRDYVEIIFENSEDTLQSWHIDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQWT ASR  YNLRD VARCTVQVYP+SW+AIYM LDNVGMWNIRSE+WAR
Sbjct  442   SFWVVGMDGGQWTSASREGYNLRDAVARCTVQVYPKSWSAIYMPLDNVGMWNIRSENWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR TRPL
Sbjct  502   QYLGQQFYLRVYSPANSWRDENPIPRNALLCGRASGRRTRPL  543



>ref|XP_009785141.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=540

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 440/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24    DPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGSY+YFPSL  HKAAGG+G I+I
Sbjct  84    NGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIKI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K+++  L+ ILD G  LP PDG+LINGRG NG +F
Sbjct  144   LSRPRIPVPFPDPADDYTVLIGDWYKKNHTALKAILDGGKKLPFPDGILINGRGPNGVSF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRI+GHK+KLVEVEG+HT+Q+T+++LD+H+GQ+YSVL+
Sbjct  204   TVEQGKTYRLRISNVGLQNSLNFRIEGHKMKLVEVEGTHTLQTTYSSLDVHVGQTYSVLI  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ+ KD+Y+VVSSRFTS VLTTT VLHYSNS T VSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQEAKDHYIVVSSRFTSPVLTTTGVLHYSNSNTPVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NLSASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSFV  DTPLKL D
Sbjct  324   TNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFVPLDTPLKLLD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFK+GG F +GSI D+P  G  +L TSV+ A+YR F+EIVF+N ED VQSWH++GYSF+V
Sbjct  384   YFKVGG-FRVGSISDAPSGGGIFLDTSVLGADYRQFIEIVFENNEDIVQSWHLNGYSFWV  442

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT+ASR  YNLRD VARCT QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  443   VGMDGGQWTQASRNGYNLRDAVARCTTQVYPKSWTAIYIALDNVGMWNLRTEFWARQYLG  502

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ Y+RVYT++ S RDE PIP+NA LCG+  GRHTRPL
Sbjct  503   QQLYMRVYTTSTSLRDEYPIPRNARLCGKVAGRHTRPL  540



>ref|XP_010103300.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB95367.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=548

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/517 (71%), Positives = 433/517 (84%), Gaps = 0/517 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ WKITYGDIYPLGV+QR ILINGQFPGP I  VTNDN+IINV N L EPF
Sbjct  24    VSAEDPYRFFDWKITYGDIYPLGVRQRGILINGQFPGPDIFSVTNDNIIINVQNNLPEPF  83

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+G+Q R+NS++DGVYGTTCPIPP KNFTY LQ KDQIG++FYFPSL  HKAAGG+G
Sbjct  84    LLSWSGVQNRKNSFEDGVYGTTCPIPPGKNFTYKLQMKDQIGTFFYFPSLAFHKAAGGFG  143

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              I+I SRP IPVPF  PA D+T+L GDW K  +++L+ ILD GH LP PDG+LINGRG +
Sbjct  144   GIKILSRPRIPVPFPDPAGDYTILIGDWYKLDHQKLKAILDGGHKLPNPDGILINGRGPS  203

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G +FT +PG+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T++++D+H+GQSY
Sbjct  204   GTSFTFEPGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTIQTTYSSIDVHVGQSY  263

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTAD  P+DYY  VSSRFT +VL +TA++HYSNS  +VSGP PGGPTT+I+WSL Q 
Sbjct  264   SVLVTADLAPQDYYFAVSSRFTDKVLPSTAIIHYSNSARQVSGPIPGGPTTEIDWSLNQA  323

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I  +RTI+L +SA  +N KQRY +N VSFV  DTPL
Sbjct  324   RSIRTNLTASGPRPNPQGSYHYGQINISRTIILESSAALVNRKQRYGINSVSFVPADTPL  383

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSI D P     YL TSVM A+YRSFVEIVFQN E+ VQS+H++GY
Sbjct  384   KLADYFKIGGVFRVGSIADKPPRKKMYLDTSVMGADYRSFVEIVFQNRENIVQSYHLNGY  443

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +F+VVGMDGGQWT ASR +YNL D V+RCT QVYPRSWTAIY+ALDNVGMWNIRSE WAR
Sbjct  444   NFWVVGMDGGQWTPASRKQYNLEDAVSRCTTQVYPRSWTAIYVALDNVGMWNIRSEFWAR  503

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             QYLGQQFYLRVYT  NS RDE  IP+NALLCGRA G+
Sbjct  504   QYLGQQFYLRVYTPVNSTRDEYLIPQNALLCGRAVGQ  540



>ref|NP_177743.1| SKU5-like 5 protein [Arabidopsis thaliana]
 gb|AAF17645.1|AC009978_21 T23E18.10 [Arabidopsis thaliana]
 dbj|BAH19558.1| AT1G76160 [Arabidopsis thaliana]
 gb|AEE35804.1| SKU5-like 5 protein [Arabidopsis thaliana]
Length=541

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/523 (72%), Positives = 427/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W ITYGDIYPLGV+Q+ ILING FPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L   LD+G  LPLPDG+LINGR  
Sbjct  140   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQLDNGKKLPLPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYRFRISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRFRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT +  YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQTPRDYYVVVSSRFTSNVLTTTGIFRYSNSAGGVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NLSASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LK+ADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEI+F+N ED VQSWH+DG
Sbjct  379   LKIADYFKIDGVYRSGSIQYQPTGGGIYLDTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTPSTSLRDEYPIPKNALLCGRASGRSTRPL  541



>ref|XP_006366591.1| PREDICTED: L-ascorbate oxidase homolog, partial [Solanum tuberosum]
Length=568

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/520 (75%), Positives = 446/520 (86%), Gaps = 0/520 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+Y W ITYGDIYPLGVKQ+ ILINGQFPGPQID VTNDNLIINV+N L+EPFLL
Sbjct  49    GESPYRWYNWNITYGDIYPLGVKQQGILINGQFPGPQIDSVTNDNLIINVFNSLDEPFLL  108

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+QQRRNSWQDGVYGT CPIPP +NFTY+LQ KDQIGS+FYFPSL MHKAAGGYG I
Sbjct  109   SWNGIQQRRNSWQDGVYGTNCPIPPGQNFTYVLQVKDQIGSFFYFPSLAMHKAAGGYGGI  168

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
              I SRPLIP+PF PP  D+T+L GDW K+++  L+ ILD G++LP PDGLL+NGRG NG 
Sbjct  169   IIRSRPLIPIPFPPPTGDYTILVGDWFKQNHTDLKAILDGGNDLPFPDGLLVNGRGSNGL  228

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD GRTYRFRISNVG+ T+INFRIQGHK+ LVE EG+HT+Q+T+ +LDIHLGQSYSV
Sbjct  229   TFTVDQGRTYRFRISNVGLTTAINFRIQGHKMVLVEAEGTHTLQNTYESLDIHLGQSYSV  288

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVT DQ  +DYY+V S+RFTS VLT T++LHYSNS   VSGPPPGGPT +I+WSL Q RS
Sbjct  289   LVTMDQPGQDYYIVASTRFTSPVLTATSILHYSNSAGGVSGPPPGGPTIEIDWSLNQARS  348

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R+NL+ASGPRPNPQGSYHYG++   RTI LANSAP INGK+RYAVN VSF+  DTPLKL
Sbjct  349   VRQNLTASGPRPNPQGSYHYGLVNTTRTIRLANSAPMINGKKRYAVNSVSFIPADTPLKL  408

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADYFKI GVFNLGSI D P  G  YL TSV+ A++R++VEIVF+N EDTVQSWHIDG+ F
Sbjct  409   ADYFKIPGVFNLGSIQDYPTGGGGYLQTSVLAADFRAYVEIVFENPEDTVQSWHIDGHIF  468

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMD GQW+ ASR  YN+RD ++RCT+QVYPRSWTA+YM LDNVGMWNIRSE+WARQY
Sbjct  469   FVVGMDDGQWSAASRLNYNIRDGISRCTIQVYPRSWTALYMPLDNVGMWNIRSENWARQY  528

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRVY+  NS+RDE PIP  ALLCGRA GR TRPL
Sbjct  529   LGQQFYLRVYSPVNSWRDEYPIPIGALLCGRASGRKTRPL  568



>ref|XP_004500896.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=548

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/518 (72%), Positives = 440/518 (85%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFL+SW
Sbjct  31    DPYRFFNWNVTYGDIYPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLISW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  91    NGIQQRRNSFEDGVFGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLSFHKAAGGFGGIRI  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  P  D+TVL GDW K ++  L+  LD G  LP+PDG+LINGRG N  +F
Sbjct  151   LSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLKAHLDKGKKLPIPDGILINGRGPNEISF  210

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  211   NVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  270

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RF+S++LTTT VL YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  271   TADQPSQDYYIVVSTRFSSKILTTTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  330

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+L++S   +NGKQRYA+N VS+V PDTPLKLAD
Sbjct  331   TNLTASGPRPNPQGSYHYGLINTTKTIILSSSPGQVNGKQRYAINSVSYVAPDTPLKLAD  390

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF +GSI D P  G  YL TSV+ A+YRSFVEIVFQN E+ +QS+H+DGYSFFV
Sbjct  391   YFKISGVFRVGSISDRPTGGGIYLDTSVLQADYRSFVEIVFQNNENIIQSYHLDGYSFFV  450

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD VARCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  451   VGMDGGQWTTASRNQYNLRDAVARCTTQVYPYSWTAIYVALDNVGMWNLRSEFWARQYLG  510

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYT++ S RDE PIPKNALLCG+A GRHTRP+
Sbjct  511   QQFYLRVYTTSTSIRDEFPIPKNALLCGKASGRHTRPI  548



>ref|XP_002285913.1| PREDICTED: L-ascorbate oxidase homolog [Vitis vinifera]
 emb|CBI18890.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/522 (72%), Positives = 439/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPF
Sbjct  20    VAAEDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+G+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  80    LLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D TVL GDW K ++  L+ ILD G  L  PDG+LINGRG N
Sbjct  140   GIRILSRPRIPVPFPDPAGDITVLIGDWYKANHTTLKAILDRGKKLHFPDGILINGRGPN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G +FTV+ G+TYRFRISNVG+  S+NFRIQ HK+ LVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  200   GVSFTVEQGKTYRFRISNVGLQNSLNFRIQDHKMVLVEVEGTHTLQTTYSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +D+Y+VVS+RFTS+VLTTT +L YSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  260   SVLVTADQPAQDFYIVVSTRFTSQVLTTTGILRYSNSAGPVSGPPPGGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI  +RTI LA+SA  +NGKQRYAVN VS+V  DTPL
Sbjct  320   RSIRTNLTASGPRPNPQGSYHYGMITTSRTIRLASSAGQVNGKQRYAVNSVSYVPGDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+AD+FKIGGVF +GSI D+P  G  YL TSVM A++R+FVEIVF+N ED +QSWHIDGY
Sbjct  380   KVADFFKIGGVFRVGSISDNPTGGGVYLDTSVMGADFRAFVEIVFENPEDIIQSWHIDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGG WT  SR +YNLRD VAR T QVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  440   SFFVVGMDGGLWTANSRNQYNLRDAVARSTTQVYPKSWTAIYVALDNVGMWNVRSEFWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+   S RDE PIPKNALLCG+A GR TRPL
Sbjct  500   QYLGQQFYLRVYSPVESIRDEFPIPKNALLCGKASGRRTRPL  541



>gb|AAL09733.1| At1g76160/T23E18_10 [Arabidopsis thaliana]
Length=541

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/523 (72%), Positives = 426/523 (81%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W ITYGDIYPLGV+Q+ ILING FPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L   LD+G  LPLPDG+LINGR  
Sbjct  140   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQLDNGKKLPLPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYRFRISNVG+  S+NFR Q HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRFRISNVGLQDSLNFRFQDHKMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT +  YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQTPRDYYVVVSSRFTSNVLTTTGIFRYSNSAGGVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NLSASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LK+ADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEI+F+N ED VQSWH+DG
Sbjct  379   LKIADYFKIDGVYRSGSIQYQPTGGGIYLDTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTPSTSLRDEYPIPKNALLCGRASGRSTRPL  541



>gb|KHF99853.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/518 (73%), Positives = 435/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDI+PLGV+Q  ILINGQFPGP I  VTNDNLIINV+N LNEPFLLSW
Sbjct  24    DPYRFFNWNVTYGDIFPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLNEPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  84    NGVQNRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLGFHKAAGGFGGIRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L   LDSG  LP PDG+LINGRG  G +F
Sbjct  144   LSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLRAQLDSGRKLPFPDGILINGRGPGGASF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T++++D+HLGQS SVL 
Sbjct  204   NVEQGKTYRLRISNVGLQNSLNFRIQNHKLKLVEVEGTHTLQTTYSSIDLHLGQSMSVLF  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVSSRFT+ VLT+TA L YSNS   VSGPPPGGPT Q++WSL Q RS+R
Sbjct  264   TADQPAQDYYIVVSSRFTNPVLTSTATLRYSNSAGPVSGPPPGGPTIQVDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI LANSA  +NGKQRYAVN VSFV  DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTRTIRLANSAGQVNGKQRYAVNSVSFVPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKI GV+ +GSI D+P  G  YL TSVM+++YRSF+EIVFQN ED VQSWH+DGYSFFV
Sbjct  384   FFKIDGVYRIGSISDNPTGGGMYLDTSVMNSDYRSFIEIVFQNDEDIVQSWHLDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  444   VGMDGGQWTAASRNGYNLRDAVSRCTTQVYPKSWTAIYVALDNVGMWNLRSEYWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRV+T++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  504   QQFYLRVFTTSTSLRDEYPIPKNALLCGRASGRRTRPL  541



>ref|XP_010539810.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=542

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/523 (70%), Positives = 433/523 (83%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP +  VTNDNLIINV+N L+EP
Sbjct  20    AVTAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDVRSVTNDNLIINVFNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SW+G+QQRRNS+ DGVYGTTCPIPP KN+TY LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLISWSGIQQRRNSFVDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LD+G  LPLPDG+LINGRG 
Sbjct  140   GGIRILSRPKIPVPFPDPAGDYTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGILINGRG-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+T+R RISNVG+ TS+NF+IQGH +K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATINVEQGKTFRLRISNVGLQTSLNFQIQGHTMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVL+TADQ  +DYY+VVSS+FTS  LTTT VL Y+NS   VSGP PGGPT QINWSL Q
Sbjct  259   YSVLITADQPARDYYIVVSSQFTSENLTTTGVLRYNNSAGPVSGPIPGGPTDQINWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQG+YHYG I   RTI LA+SA  +NGK RYAVN +SF+  DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGTYHYGKINTTRTIRLASSAGQVNGKLRYAVNSISFIPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADY+KI GVF +GSI D P  G  Y   SVM A+YR+FVEIVF+N ED VQSWH++G
Sbjct  379   LKLADYYKIDGVFRVGSISDHPTGGEIYQDASVMQADYRAFVEIVFENPEDIVQSWHLNG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVGMDGG+WT  SR  YNL D V+RCTVQVY +SWTAIY+ALDNVGMWN+RSEDW 
Sbjct  439   YSFFVVGMDGGEWTPESRNEYNLHDAVSRCTVQVYRKSWTAIYVALDNVGMWNVRSEDWE  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRV+T++ S RDE PIPKN+LLCGRA GRHTRPL
Sbjct  499   RQYLGQQFYLRVHTNSTSPRDEYPIPKNSLLCGRASGRHTRPL  541



>gb|AAM97070.1| pectinesterase, putative [Arabidopsis thaliana]
 gb|AAN15546.1| pectinesterase, putative [Arabidopsis thaliana]
Length=541

 Score =   771 bits (1990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/523 (72%), Positives = 426/523 (81%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W ITYGDIYPLGV+Q+ ILING FPGP I  VTNDNLIINVYN L+EP
Sbjct  20    AVTAEDPYRFFEWNITYGDIYPLGVRQQGILINGAFPGPDIHSVTNDNLIINVYNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSFVDGVYGTTCPIPPGKNYTYILQMKDQIGSFYYFPSLGFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L   LD+G  LPLPDG+LINGR  
Sbjct  140   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKANHTDLRAQLDNGKKLPLPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+TYRFRISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  199   SGATLNVEQGKTYRFRISNVGLQDSLNFRIQDHKMKVVEVEGTHTLQTTFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT +  YSNS   VSGP PGGPT QI+WSL Q
Sbjct  259   YSVLVTADQTPRDYYVVVSSRFTSNVLTTTGIFRYSNSAGGVSGPIPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NLSASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  319   ARAIRTNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LK+ADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEI+F+N ED VQSWH+DG
Sbjct  379   LKIADYFKIDGVYRSGSIQYQPTGGGIYLDTSVMQVDYRTFVEIIFENSEDIVQSWHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+R E WA
Sbjct  439   YSFWVVGMDGGQWSPDSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRPEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  499   RQYLGQQLYLRVYTPSTSLRDEYPIPKNALLCGRASGRSTRPL  541



>ref|XP_010428667.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/523 (71%), Positives = 429/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINV+N L+EP
Sbjct  21    AVTAEDPYRFYEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNSLDEP  80

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP +N+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81    FLLSWNGVQQRRNSFVDGVYGTTCPIPPGQNYTYMLQMKDQIGSFYYFPSLAFHKAAGGF  140

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D TVL GDW K ++  L+  LD+G  LPLPDG+LINGR  
Sbjct  141   GGIRILSRPRIPVPFPDPAGDTTVLIGDWYKSNHTDLKAQLDNGKKLPLPDGILINGRS-  199

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G T  V+ G+ YR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  200   SGATLNVEQGKVYRLRISNVGLQDSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQS  259

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ P+DYYVVVSSRFTS VLTTT VL YSNS   VSGP PGGPT QI+WSL Q
Sbjct  260   YSVLVTADQPPRDYYVVVSSRFTSNVLTTTGVLRYSNSAGAVSGPIPGGPTIQIDWSLNQ  319

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  ++GKQRYAVN VSF   DTP
Sbjct  320   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVDGKQRYAVNSVSFKPADTP  379

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+  GSI   P  G  YL TSVM  +YR+FVEIVF+N ED +QS+H+DG
Sbjct  380   LKLADYFKIDGVYRTGSIQYQPTGGGIYLDTSVMQVDYRTFVEIVFENTEDIIQSYHLDG  439

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW+  SR  YNLRD VARCTVQVYP SWTAI +ALDNVGMWN+RSE WA
Sbjct  440   YSFWVVGMDGGQWSPNSRNEYNLRDAVARCTVQVYPSSWTAILIALDNVGMWNLRSEFWA  499

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFYLRVYT + S RDE P+P+NALLCGRA GR TRPL
Sbjct  500   RQYLGQQFYLRVYTPSTSLRDEYPVPRNALLCGRASGRRTRPL  542



>ref|XP_003523207.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/518 (73%), Positives = 435/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  30    DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  89

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  90    NGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  149

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG NG + 
Sbjct  150   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPFPDGILINGRGPNGVSL  209

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  210   NVEQGKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  269

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+V SSRF+ +VLTTT VL YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  270   TADQPAQDYYIVFSSRFSYKVLTTTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  329

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   +TI+LA+SA  +NGKQRYA+N VS+V PDTPLKLAD
Sbjct  330   TNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAINSVSYVAPDTPLKLAD  389

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF  GSI D P  G  YL TSV+ A+YR+FVEIVFQN E  VQS+H+DGYSFFV
Sbjct  390   YFKISGVFRPGSISDRPTGGGIYLDTSVLQADYRTFVEIVFQNNEKIVQSYHLDGYSFFV  449

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD VARCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  450   VGMDGGQWTPASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNVGMWNLRSEFWARQYLG  509

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT++ S RDE P+PKNA+LCGRA GRHTRPL
Sbjct  510   QQLYLRVYTASTSIRDEFPVPKNAILCGRASGRHTRPL  547



>gb|KHN33820.1| L-ascorbate oxidase like [Glycine soja]
Length=540

 Score =   770 bits (1988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/518 (73%), Positives = 435/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  23    DPYRFFNWNVTYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  82

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  83    NGIQQRRNSFEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  142

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG NG + 
Sbjct  143   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPFPDGILINGRGPNGVSL  202

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVLV
Sbjct  203   NVEQGKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLV  262

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+V SSRF+ +VLTTT VL YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  263   TADQPAQDYYIVFSSRFSYKVLTTTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  322

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   +TI+LA+SA  +NGKQRYA+N VS+V PDTPLKLAD
Sbjct  323   TNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAINSVSYVAPDTPLKLAD  382

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF  GSI D P  G  YL TSV+ A+YR+FVEIVFQN E  VQS+H+DGYSFFV
Sbjct  383   YFKISGVFRPGSISDRPTGGGIYLDTSVLQADYRTFVEIVFQNNEKIVQSYHLDGYSFFV  442

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD VARCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  443   VGMDGGQWTPASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNVGMWNLRSEFWARQYLG  502

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT++ S RDE P+PKNA+LCGRA GRHTRPL
Sbjct  503   QQLYLRVYTASTSIRDEFPVPKNAILCGRASGRHTRPL  540



>ref|XP_010530339.1| PREDICTED: L-ascorbate oxidase homolog [Tarenaya hassleriana]
Length=540

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/523 (70%), Positives = 434/523 (83%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V G +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  19    AVTGESPYRFFEWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEP  78

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+Q RRNS+ DGVYGTTCPIPP +N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  79    FLISWNGVQNRRNSYVDGVYGTTCPIPPGRNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  138

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRPLIPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  
Sbjct  139   GGIRILSRPLIPVPFDQPAGDYTVLIGDWYKSNHTDLKARLDRGKKLPNPDGILINGRS-  197

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             +G TF V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+TF++LD+H+GQS
Sbjct  198   SGATFNVEQGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTLQTTFSSLDVHVGQS  257

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ  +DYYVVVSSRFT ++ TTT +L YS S T  SGP PGGPT Q++WSL Q
Sbjct  258   YSVLVTADQPARDYYVVVSSRFTDKINTTTGILRYSGSSTPASGPIPGGPTIQVDWSLNQ  317

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYG++  ARTI   +SA  INGKQRYA+N VSFV  DTP
Sbjct  318   ARAIRTNLTASGPRPNPQGSYHYGLVSLARTIRFGSSAGQINGKQRYALNSVSFVPADTP  377

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLAD+F+I GV+ + SI D P  G  YL TSV+ A+YR+FVEIVF+N ED VQS+H+DG
Sbjct  378   LKLADFFQISGVYKVNSISDRPTGGGMYLDTSVLQADYRTFVEIVFENNEDIVQSYHLDG  437

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             Y+F+VVGMDGGQWT ASR  YNLRD ++R TVQVYP+SWTAIY+ALDNVGMWN+RSE WA
Sbjct  438   YAFWVVGMDGGQWTVASRNGYNLRDAISRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  497

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRV+T++ S RDE PIPKNALLCGRA+GRHTRPL
Sbjct  498   RQYLGQQLYLRVFTTSTSLRDEFPIPKNALLCGRAKGRHTRPL  540



>ref|XP_004291312.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=545

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/522 (70%), Positives = 432/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+QR ILINGQFPGP I+ VTNDNLIINV+N L+EPF
Sbjct  24    VTAEDPYRFFQWNVTYGDIYPLGVRQRGILINGQFPGPDINSVTNDNLIINVFNSLDEPF  83

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQR NS+QDGVYGTTCPIPP +N TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  84    LLSWNGIQQRHNSFQDGVYGTTCPIPPGRNLTYILQVKDQIGSFYYFPSLAFHKAAGGFG  143

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  P+ D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG N
Sbjct  144   GIRILSRPRIPVPFPDPSGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGILINGRGPN  203

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
              ++ T + G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  204   QFSLTFEQGKTYRLRISNVGLQHSLNFRIQDHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  263

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ   DYY+VVSSRF++ +LTTT +LHYS +  +VSGP PGGPT QI+WSL Q 
Sbjct  264   SVLVTADQPGHDYYIVVSSRFSTPILTTTGILHYSGAGGQVSGPIPGGPTIQIDWSLNQA  323

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   +T +LA++A  +NGKQRY +N VSFV  DTPL
Sbjct  324   RSIRTNLTASGPRPNPQGSYHYGLINLTKTYILASAAGQVNGKQRYGINSVSFVPADTPL  383

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVF +GS+ D P  G+ YL TSV+ A+YR+FVEIVFQN ED VQS+H+DGY
Sbjct  384   KLADYFKISGVFRVGSVSDRPTGGNLYLDTSVLGADYRTFVEIVFQNDEDIVQSYHLDGY  443

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
              FFVVGMDGG+WT ASR  YNLRD VAR T QVYP SWTAIY++LDNVGMWN+R+E WAR
Sbjct  444   QFFVVGMDGGKWTTASRNGYNLRDAVARSTTQVYPFSWTAIYLSLDNVGMWNLRTEFWAR  503

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRVYTS+ S RDE PIP+NA LCGRA GRHTRPL
Sbjct  504   QYLGQQLYLRVYTSSTSIRDEYPIPRNARLCGRASGRHTRPL  545



>ref|XP_006657750.1| PREDICTED: L-ascorbate oxidase homolog [Oryza brachyantha]
Length=551

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/524 (72%), Positives = 441/524 (84%), Gaps = 2/524 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI PLGVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  28    VAGDDPYRFFTWTVTYGDIAPLGVKQQGILINGQFPGPQIEAVTNDNLIINVFNNLTEPF  87

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV GTTCPIPP  NFTY+LQ KDQIG+YFYFPSL  HKAAGG+G
Sbjct  88    LLSWNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFG  147

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRP+IPVPF PPA D+T+LAGDW K ++  L+Y+LDSG  L  PDGLLINGR W+
Sbjct  148   GIRVLSRPMIPVPFPPPAADYTLLAGDWYKANHTDLKYMLDSGKALGFPDGLLINGRSWD  207

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTF V  GRTYRFRISNVG++TS+N R QGH +KLVEVEGSHT+Q+ +++LD+HLGQSY
Sbjct  208   GYTFDVQQGRTYRFRISNVGLSTSLNVRFQGHTMKLVEVEGSHTMQTAYSSLDVHLGQSY  267

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ   DY VVVS+RFTSR+++TTAVL YS S  +   P PGGPT QI+WSL Q 
Sbjct  268   SVLLTADQPAYDYAVVVSTRFTSRIISTTAVLRYSGSAGKAPVPLPGGPTIQIDWSLNQA  327

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGM+   RTI LA+SA  INGKQRYAVNGVS VNPDTPL
Sbjct  328   RSIRWNLTASGPRPNPQGSYHYGMVTATRTIRLASSAATINGKQRYAVNGVSHVNPDTPL  387

Query  1319  KLADYFKIGGVFNLGSIPDSPR--WGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             K+ADY+KI GVF++G+I DSP    G AYL T+VM A+YR +VE+VF+N E  VQSWHID
Sbjct  388   KIADYYKIAGVFSVGTISDSPSGGGGGAYLQTAVMGASYRDYVEVVFENPESEVQSWHID  447

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GY+F+VVGMDGG+W+ ASR  YNLRD V+R TVQVYP SWTAIYM LDNVGMWN+RSE W
Sbjct  448   GYAFWVVGMDGGEWSAASRQSYNLRDAVSRYTVQVYPNSWTAIYMPLDNVGMWNVRSESW  507

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRV+T + S+RDE PIPKNALLCGRA GR TRPL
Sbjct  508   ARQYLGQQFYLRVWTPSTSWRDEYPIPKNALLCGRAAGRRTRPL  551



>ref|XP_003527461.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 436/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W ITYGDIYPLGV+Q  ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  30    DPYRFFNWNITYGDIYPLGVRQTGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  89

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPIP  KNFTY+LQ KDQIG+++YFPSL  HKAAGG+G IRI
Sbjct  90    NGIQQRRNSFEDGVFGTTCPIPAGKNFTYILQVKDQIGTFYYFPSLAFHKAAGGFGGIRI  149

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG NG +F
Sbjct  150   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKARLDRGKKLPFPDGILINGRGPNGVSF  209

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+ +++LD+H+GQSYSVLV
Sbjct  210   NVEQGKTYRLRISNVGLQHSLNFRIQNHKMKLVEVEGTHTLQTMYSSLDVHVGQSYSVLV  269

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RF+ +VLTTT VL YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  270   TADQPAQDYYIVVSTRFSYKVLTTTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  329

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   +TI+LA+SA  +NGKQRYA+N VS+V PDTPLKLAD
Sbjct  330   TNLTASGPRPNPQGSYHYGMINTTKTIILASSAGQVNGKQRYAINSVSYVVPDTPLKLAD  389

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF  GSI D P  G  YL TSV+ A+YR+FVEIVFQN E+ VQS+H+DGYSFFV
Sbjct  390   YFKISGVFRPGSISDRPTGGGIYLDTSVLQADYRNFVEIVFQNNENIVQSYHLDGYSFFV  449

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD VARCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  450   VGMDGGQWTTASRNQYNLRDAVARCTTQVYPFSWTAIYIALDNVGMWNLRSEFWARQYLG  509

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT++ S RDE P+PKNA+LCGRA GRHTRPL
Sbjct  510   QQLYLRVYTTSTSIRDEFPVPKNAILCGRASGRHTRPL  547



>ref|XP_008221175.1| PREDICTED: L-ascorbate oxidase homolog [Prunus mume]
Length=544

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/522 (70%), Positives = 431/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PY+++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  23    VAAEDPYKFFEWNVTYGDIYPLGVRQKGILINGQFPGPDIHSVTNDNLIINVFNSLDEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  83    LISWNGIQQRRNSFEDGVYGTTCPIPPGRNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L   LD+G  LP PDG+LINGRG  
Sbjct  143   GIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTSLRAHLDAGKKLPFPDGILINGRGPG  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G++   + G+TYR RISNVG+  S+NFRIQ H LKLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  203   GFSLNFEQGKTYRLRISNVGLQHSLNFRIQNHNLKLVEVEGTHTLQTTYSSLDVHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+V SSRFT+ +LTTT  LHY+NS  RVSGPPPGGPT Q++WSL Q 
Sbjct  263   SVLVTADQPGQDYYIVASSRFTTPILTTTGTLHYTNSAGRVSGPPPGGPTIQVDWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   +T +L NSA  +NGKQRY VN VSFV  DTPL
Sbjct  323   RSIRTNLTASGPRPNPQGSYHYGLINTTKTYVLENSAGQVNGKQRYGVNSVSFVPADTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSI D P  G  YL TSV+ A+YR+FVE VFQN ED +QSWH+DGY
Sbjct  383   KLADYFKIGGVFRVGSISDRPTGGGLYLDTSVLGADYRTFVEFVFQNNEDIIQSWHLDGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVG+DGGQWT  SR  YNLRD V+RCT+QVYP+SWTAIY+ALDNVGMWN+R+E WAR
Sbjct  443   SFFVVGLDGGQWTPNSRKEYNLRDAVSRCTIQVYPKSWTAIYVALDNVGMWNLRTEFWAR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRVYT + S RDE PIPKNA LCGRA GR TRPL
Sbjct  503   QYLGQQLYLRVYTPSTSIRDEYPIPKNARLCGRAAGRRTRPL  544



>emb|CDP07321.1| unnamed protein product [Coffea canephora]
Length=543

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/518 (69%), Positives = 429/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PY ++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTN+NL+INV+N L EPFLLSW
Sbjct  26    DPYLFFNWNVTYGTIYPLGVPQQGILINGQFPGPDIHSVTNNNLVINVFNSLTEPFLLSW  85

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             +G+Q RRNS+ DGVYGTTCPIPP KN+TY+LQ KDQIGS++YFPSL  HKAAGG+G  RI
Sbjct  86    SGIQNRRNSYVDGVYGTTCPIPPGKNYTYILQVKDQIGSFYYFPSLAFHKAAGGFGGFRI  145

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SR +IPVPFA PA DFTVL GDW  +++  L+ ILD GH LP PDG+LINGRG NG + 
Sbjct  146   LSRSVIPVPFAEPAGDFTVLIGDWYSKNHTVLKRILDGGHKLPFPDGILINGRGPNGTSL  205

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             T + G+TYR RISNVG+  S+NFRIQGHKLKLVEVEG+HT+Q+T++++D+H+GQS SVLV
Sbjct  206   TFEQGKTYRLRISNVGLQHSLNFRIQGHKLKLVEVEGTHTLQNTYSSIDVHVGQSMSVLV  265

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P+DY++VV++RFT+ ++TTT  L Y+NS +R SGP PGGPT Q++WSL Q RS+R
Sbjct  266   TADQPPQDYFIVVNTRFTTPIITTTGFLRYANSNSRASGPIPGGPTIQVDWSLNQARSIR  325

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSFV  DTPLKLAD
Sbjct  326   TNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGRVNGKQRYAVNSVSFVPADTPLKLAD  385

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +F I GV+ + SI  +P  G  YL TSV+ A+YR+F+EIVF+N ED +QSWH+DGY+FFV
Sbjct  386   FFNIPGVYRVNSISSAPTGGGIYLDTSVLQADYRAFIEIVFENNEDIIQSWHLDGYAFFV  445

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD V R T QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  446   VGMDGGQWTAASRNGYNLRDAVFRSTTQVYPKSWTAIYVALDNVGMWNLRTEFWARQYLG  505

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVYTS+ S RDE PIPKNALLCGRA G HTRPL
Sbjct  506   QQFYLRVYTSSTSLRDEFPIPKNALLCGRASGHHTRPL  543



>ref|XP_004966212.1| PREDICTED: L-ascorbate oxidase homolog [Setaria italica]
Length=550

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/518 (72%), Positives = 434/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW IT+GDIYPLGVKQ  ILINGQFPGPQID VTNDN+I+NV+N L  PFLLSW
Sbjct  33    DPYRFYTWNITFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIIVNVFNNLPVPFLLSW  92

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
              G+QQRR+SWQDGV GT CPIPP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  93    QGIQQRRSSWQDGVSGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLLFHKAAGGYGGIRV  152

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG  F
Sbjct  153   LSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGLLINGQGWNGNRF  212

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFR+SNVGIATS+N RIQGH + LVEVEGSH++QSTFT++DIHLGQSYS LV
Sbjct  213   TVDQGKTYRFRVSNVGIATSVNIRIQGHSMLLVEVEGSHSMQSTFTSIDIHLGQSYSFLV  272

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ P DY ++VS+RFT+ VLTT A+LHYSN+    + PPP  PTT+I++SL Q RS+R
Sbjct  273   TADQPPADYSIIVSTRFTTPVLTTNAILHYSNANGAATVPPPPAPTTEIDFSLNQARSIR  332

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++   RTI LANS   INGK RYAVN VSF+  DTPLK+AD
Sbjct  333   WNLTASGPRPNPQGSYHYGLVNTTRTIRLANSRATINGKLRYAVNSVSFIPADTPLKVAD  392

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             ++ I GVF LGS+PD+P  G AYL TSVM AN R +VE++F+N E+ VQSWHIDGY+F+V
Sbjct  393   FYNISGVFTLGSMPDNPTGGGAYLQTSVMAANMREYVEVIFENAENFVQSWHIDGYAFWV  452

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR  YNLRD +AR T+QVYP+SWTAIYM LDNVGMWN+RSE WARQYLG
Sbjct  453   VGMDGGQWTPASRQGYNLRDAIARYTLQVYPQSWTAIYMPLDNVGMWNVRSESWARQYLG  512

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  513   QQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  550



>ref|XP_006596528.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=547

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/522 (71%), Positives = 436/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L++PF
Sbjct  26    VVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS++DGV GTTCPIPP  NFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  86    LLSWNGVQQRRNSFEDGVLGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L  +LDSG  LP P+G+LINGRG N
Sbjct  146   GIRILSRPRIPVPFDDPAGDYTVLIGDWYKLNHTDLMSLLDSGRKLPFPNGILINGRGSN  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  F V+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  206   GAYFNVEQGKTYRLRISNVGLENSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVS+RFTS VLT+T VL YSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  266   SVLVTADQPAQDYYIVVSTRFTSTVLTSTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQA  325

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG+I   RTI+L++S   +NGKQRYA+N VS+V PDTPL
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGLINTTRTIILSSSPGIVNGKQRYAINSVSYVAPDTPL  385

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GVF +GS  D P  G  YL TSV+  +YR+FVE VFQN ED +QS+H+DGY
Sbjct  386   KLADYFKIPGVFRVGSFSDRPTGGGIYLDTSVLQTDYRTFVEFVFQNDEDIIQSYHLDGY  445

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  446   SFFVVGMDGGQWTPASRNTYNLRDAVSRCTTQVYPKSWTAIYIALDNVGMWNLRSEFWAR  505

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVYT++ S RDE P+PKNALLCGRA GRHTRPL
Sbjct  506   QYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRPL  547



>emb|CAN83942.1| hypothetical protein VITISV_013559 [Vitis vinifera]
Length=541

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/522 (72%), Positives = 438/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++TW +T+GDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L EPF
Sbjct  20    VAAEDPYRFFTWNVTFGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVYNSLTEPF  79

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+G+QQRRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  80    LLSWSGVQQRRNSYEDGVYGTTCPIPPGRNFTYILQVKDQIGSFFYFPSLDFHKAAGGFG  139

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D TVL GDW K ++  L+ ILD G  L  PDG+LINGRG N
Sbjct  140   GIRILSRPRIPVPFPDPAGDITVLIGDWYKANHTTLKAILDRGKKLHFPDGILINGRGPN  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G +FTV+ G+TYRFRISNVG+  S+NFRIQ HK+ LVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  200   GVSFTVEQGKTYRFRISNVGLQNSLNFRIQDHKMVLVEVEGTHTLQTTYSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +D+Y VVS+RFTS+VLTTT +L YSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  260   SVLVTADQPAQDFYXVVSTRFTSQVLTTTGILRYSNSAGPVSGPPPGGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI  +RTI LA+SA  +NGKQRYAVN VS+V  DTPL
Sbjct  320   RSIRTNLTASGPRPNPQGSYHYGMIXTSRTIRLASSAGQVNGKQRYAVNSVSYVPGDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+AD+FKIGGVF +GSI ++P  G  YL TSVM A++R+FVEIVF+N ED +QSWHIDGY
Sbjct  380   KVADFFKIGGVFRVGSISBNPTGGGXYLDTSVMGADFRAFVEIVFENPEDIIQSWHIDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGG WT  SR +YNLRD VAR T QVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  440   SFFVVGMDGGLWTANSRNQYNLRDAVARSTTQVYPKSWTAIYVALDNVGMWNVRSEFWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVY+   S RDE PIPKNALLCG+A GR TRPL
Sbjct  500   QYLGQQFYLRVYSPVESIRDEFPIPKNALLCGKASGRRTRPL  541



>ref|NP_001152000.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG45329.1| L-ascorbate oxidase precursor [Zea mays]
Length=550

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/520 (73%), Positives = 442/520 (85%), Gaps = 2/520 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++TW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N LNEPFLLSW
Sbjct  31    DPYRFFTWTVTYGDIYPLGVKQQGILINNQFPGPQIEAVTNDNLIINVFNKLNEPFLLSW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             +GLQQRRNS++DGV GTTCPIPP  NFTY++QAKDQIG+Y+YFPSL  HKAAGG+G IR+
Sbjct  91    SGLQQRRNSFEDGVAGTTCPIPPGSNFTYIMQAKDQIGTYYYFPSLAFHKAAGGFGGIRV  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA D+TVL GDW K ++  L Y+LDSG  L  PDGLLING G NGYTF
Sbjct  151   LSRPQIPVPFPPPAADYTVLIGDWYKANHTDLRYVLDSGVALGFPDGLLINGWGLNGYTF  210

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V PGRTYRFRI+NVG+ATS+N R QGH +KLVEVEGSHT+Q+T+++LD+HLGQSYSVL+
Sbjct  211   NVQPGRTYRFRITNVGLATSLNIRFQGHTMKLVEVEGSHTMQTTYSSLDVHLGQSYSVLL  270

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ   DY VVVS+RFTSR+++TTAVL Y+NS  R  GP PGGPT QI+WSL Q RS+R
Sbjct  271   TADQPGYDYAVVVSTRFTSRIISTTAVLRYANSAGRAPGPLPGGPTIQIDWSLNQARSVR  330

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG++    TI LANSA  I GK+RYAVNG S+V PDTPLK+AD
Sbjct  331   WNLTASGPRPNPQGSYHYGLVPVTWTIRLANSAATIGGKRRYAVNGASYVGPDTPLKVAD  390

Query  1331  YFKIGGVFNLGSIPDSP--RWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             Y+KIGGVF++G+I DSP    G+AYL TSVM A+YR +VE+VF+N ED VQSWHIDGY+F
Sbjct  391   YYKIGGVFSVGTIADSPPAYGGAAYLRTSVMGASYRDYVEVVFENGEDEVQSWHIDGYAF  450

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             +VVGMDGG+W+ ASR  YNLRD V+R TVQVYPRSWTAIYM LDNVGMWN+RSE+WARQY
Sbjct  451   WVVGMDGGKWSSASRQGYNLRDGVSRYTVQVYPRSWTAIYMPLDNVGMWNVRSENWARQY  510

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             LGQQFYLRV+T + S RDE PIPKNALLCGRA GR TRPL
Sbjct  511   LGQQFYLRVWTPSTSLRDEYPIPKNALLCGRAAGRRTRPL  550



>ref|XP_009623446.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=540

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/518 (72%), Positives = 440/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24    DPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGSY+YFPSL  HKAAGG+G I+I
Sbjct  84    NGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIKI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+T+L GDW K+++  L+ ILD G  LP PDG+LINGRG NG +F
Sbjct  144   LSRPRIPVPFPDPADDYTLLIGDWYKKNHTALKAILDGGKKLPFPDGILINGRGPNGVSF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRI+GH++KLVEVEG+HT+Q+T+++LD+H+GQ+YSVL+
Sbjct  204   TVEQGKTYRLRISNVGLQNSLNFRIEGHRMKLVEVEGTHTLQTTYSSLDVHVGQTYSVLI  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ+ KD+Y+VVSSRFTS+VLTTT VLHYSNS T VSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQEAKDHYIVVSSRFTSQVLTTTGVLHYSNSNTPVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NLSASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSFV  DTPLKL D
Sbjct  324   TNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFVPLDTPLKLLD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFK+GG F +GSI D+P  G  +L TSV+ A+YR F+EIVF+N ED VQSWH++GYSF+V
Sbjct  384   YFKVGG-FRVGSISDAPSGGGIFLDTSVLGADYRQFIEIVFENTEDIVQSWHLNGYSFWV  442

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT+ASR  YNLRD VAR T QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  443   VGMDGGQWTQASRNGYNLRDAVARYTTQVYPKSWTAIYIALDNVGMWNLRTEFWARQYLG  502

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ Y+RVYT++ S RDE PIP+NA LCG+  GRHTRPL
Sbjct  503   QQLYMRVYTTSTSLRDEYPIPRNARLCGKVAGRHTRPL  540



>ref|XP_007132533.1| hypothetical protein PHAVU_011G102500g [Phaseolus vulgaris]
 gb|ESW04527.1| hypothetical protein PHAVU_011G102500g [Phaseolus vulgaris]
Length=538

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/516 (72%), Positives = 436/516 (84%), Gaps = 0/516 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINV+N L+EPFLL
Sbjct  23    GEDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVFNSLDEPFLL  82

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+ QRRNSWQDGVYGT CPI P  NFTY+LQ KDQIGSYFY+PSL  HKAAGGYG  
Sbjct  83    SWNGVLQRRNSWQDGVYGTNCPISPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGF  142

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP IPVPF PPA DFT+LAGDW KR++  L  ILD G++LP PDGL+INGRG N Y
Sbjct  143   KIASRPGIPVPFPPPAGDFTILAGDWYKRNHTDLRAILDGGNDLPFPDGLIINGRGSNAY  202

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVG+ TSINFRIQGHK+ +VEVEG+HT+Q+ + +LD+HLGQ+YSV
Sbjct  203   TFTVDQGKTYRFRISNVGLTTSINFRIQGHKMTIVEVEGTHTLQNIYDSLDVHLGQTYSV  262

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P+DY +VV++RFTS+VL  T++  YSNS   V+G  P GPT Q++WSL Q RS
Sbjct  263   LVTADQPPQDYLIVVTTRFTSQVLNATSIFRYSNSGGSVTGLFPWGPTIQVDWSLNQARS  322

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYGMI   RTI L NSAP INGKQRYAVN VSF+  DTPLKL
Sbjct  323   LRRNLTASGPRPNPQGSYHYGMINTTRTIRLQNSAPVINGKQRYAVNSVSFIPADTPLKL  382

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADY+KI GVF+LGSIPD+P  G  YL TSVM+A++R+F+E+VF+N EDTV+SWHIDG+SF
Sbjct  383   ADYYKIQGVFSLGSIPDNPTGGGGYLQTSVMEADFRAFLEVVFENTEDTVESWHIDGHSF  442

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGG W++ASR  YNLRDT++R TVQVYP+SWTA+Y+ LDNVGMWN+RSE+W  QY
Sbjct  443   FVVGMDGGLWSQASRLSYNLRDTISRSTVQVYPKSWTALYVPLDNVGMWNVRSENWVHQY  502

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             LGQQFYLRVY+  NS+RDE PIP NA  CG+A G +
Sbjct  503   LGQQFYLRVYSPANSWRDEYPIPSNAPRCGKAVGHY  538



>ref|XP_004505676.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=533

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/517 (70%), Positives = 428/517 (83%), Gaps = 1/517 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V+  +PYR++ W ITYGDIYPLGVKQ+ ILINGQFPGP+I  VTNDNLIINV+N L EPF
Sbjct  18    VFAEDPYRFFDWNITYGDIYPLGVKQQGILINGQFPGPEIYSVTNDNLIINVHNSLPEPF  77

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGVYGTTCPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAGG+G
Sbjct  78    LISWNGIQQRRNSYEDGVYGTTCPIPPGKNFTYTLQVKDQIGSFFYFPSLAFHKAAGGFG  137

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             +I+I SRP IPVPF  P  D+T+L GDW +  + +L  +LD GH LP P  +LINGR  N
Sbjct  138   SIKILSRPRIPVPFPDPTDDYTLLIGDWYQIDHTRLRKVLDFGHRLPFPQAVLINGRA-N  196

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTV+ G+TYR RISNVG+  ++NFRIQ H +KLVEVEG+HT+Q++++++D+H+GQSY
Sbjct  197   GTTFTVEQGKTYRLRISNVGLQNTLNFRIQNHIMKLVEVEGTHTIQTSYSSIDVHVGQSY  256

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ PKDYY+VVS+RFT+ +LT+TA LHYSNS   + GP P GPTTQI+WSL Q 
Sbjct  257   SVLITADQAPKDYYIVVSTRFTNTILTSTANLHYSNSQQPLLGPIPAGPTTQIDWSLEQA  316

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I  +RTI L +SA  +NGKQRYAVN VSF+  DTPL
Sbjct  317   RSIRTNLTASGPRPNPQGSYHYGTINISRTIKLESSAALVNGKQRYAVNSVSFIPADTPL  376

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF +GSIPD+P     YL TSVM A++R+FVEIVFQN E+ +QSWHIDGY
Sbjct  377   KLADYFKIGGVFQVGSIPDTPSHKPMYLDTSVMGADFRAFVEIVFQNHENIIQSWHIDGY  436

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGG WT  SR +YNL D V+R T QVYP+SWTAIYMALDNVGMWN+RSE W R
Sbjct  437   SFWVVGMDGGVWTPNSRGQYNLNDAVSRSTTQVYPKSWTAIYMALDNVGMWNVRSEFWTR  496

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             QYLGQQFYLRVY+   S RDE PIPKNALLCG+A GR
Sbjct  497   QYLGQQFYLRVYSPVESVRDEYPIPKNALLCGKAFGR  533



>emb|CAA65634.1| PS60 [Nicotiana tabacum]
Length=540

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/518 (71%), Positives = 439/518 (85%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYG IYPLGV Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  24    DPYRFFEWNVTYGTIYPLGVPQQGILINGQFPGPDIYSVTNDNLIINVFNSLDEPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS++DGVYGTTCPIPP +NFTY+LQ KDQIGSY+YFPSL  HKAAGG+G I+I
Sbjct  84    NGIQNRRNSFEDGVYGTTCPIPPGRNFTYILQMKDQIGSYYYFPSLAFHKAAGGFGGIKI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+T+L GDW K+++  L+ ILD G  LP PDG+LINGRG NG +F
Sbjct  144   LSRPRIPVPFPDPADDYTLLIGDWYKKNHTALKAILDGGKKLPFPDGILINGRGPNGVSF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RISNVG+  S+NFRI+GH++KLVEVEG+HT+Q+T+++LD+H+GQ+YSVL+
Sbjct  204   TVEQGKTYRLRISNVGLQNSLNFRIEGHRMKLVEVEGTHTLQTTYSSLDVHVGQTYSVLI  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ+ KD+Y+VVSSRFTS+VLTTT VLHYSNS T VSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQEAKDHYIVVSSRFTSQVLTTTGVLHYSNSNTPVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NLSASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSFV  DTPLKL D
Sbjct  324   TNLSASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFVPLDTPLKLLD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFK+GG F +GSI D+P  G  +L TSV+ A+YR F+EIVF+N ED VQSWH++GYSF+V
Sbjct  384   YFKVGG-FRVGSISDAPSGGGIFLDTSVLGADYRQFIEIVFENTEDIVQSWHLNGYSFWV  442

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG WT+ASR  YNLRD VAR T QVYP+SWTAIY+ALDNVGMWN+R+E WARQYLG
Sbjct  443   VGMDGGHWTQASRNGYNLRDAVARYTTQVYPKSWTAIYIALDNVGMWNLRTEFWARQYLG  502

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ Y+RVYT++ S RDE PIP+NA LCG+  GRHTRPL
Sbjct  503   QQLYMRVYTTSTSLRDEYPIPRNARLCGKVAGRHTRPL  540



>ref|XP_003550444.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
 gb|KHN48525.1| L-ascorbate oxidase like [Glycine soja]
Length=541

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/523 (72%), Positives = 434/523 (83%), Gaps = 0/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L++P
Sbjct  19    AVVAEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQP  78

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS++DGV GTTCPIP   NFTY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  79    FLLSWNGVQQRRNSFEDGVLGTTCPIPAGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGF  138

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG 
Sbjct  139   GGIRILSRPRIPVPFDDPAGDYTVLIGDWYKLNHTDLKSQLDSGRKLPLPDGILINGRGS  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NG    V+ G+TYR RISNVG+  S+N RIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQS
Sbjct  199   NGAYLNVEQGKTYRLRISNVGLENSLNLRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ  +DYY+VVSSRFTS VLTTT +L YSNS   VSGPPPGGPT QI+WSL Q
Sbjct  259   YSVLVTADQPAQDYYIVVSSRFTSTVLTTTGILRYSNSAGPVSGPPPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I   RTI+L+ S   +NGKQRYA+N VS+V PDTP
Sbjct  319   ARSIRTNLTASGPRPNPQGSYHYGLINTTRTIILSGSPGIVNGKQRYAINSVSYVAPDTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GVF +GSI D P  G  YL TSV+  +YR+FVE VFQN ED +QS+H+DG
Sbjct  379   LKLADYFKIPGVFRVGSISDRPTGGGIYLDTSVLQTDYRTFVEFVFQNDEDIIQSYHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVGMDGGQWT ASR  YNLRD V+R T QVYP+SWTAIY+ALDNVGMWN+RSE WA
Sbjct  439   YSFFVVGMDGGQWTPASRNTYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQFY+RVYT++ S RDE P+PKNALLCGRA GRHTRPL
Sbjct  499   RQYLGQQFYMRVYTTSTSIRDEYPVPKNALLCGRASGRHTRPL  541



>ref|XP_003539859.1| PREDICTED: L-ascorbate oxidase homolog [Glycine max]
Length=537

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/516 (72%), Positives = 433/516 (84%), Gaps = 0/516 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINVYN L+EPFLL
Sbjct  22    GEDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLL  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+ QRRNSWQDGVYGT CPI P  NFTY+LQ KDQIGSYFY+PSL  HKAAGGYG  
Sbjct  82    SWNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGF  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP IPVPF PPA DFT+LAGDW KR++  L  ILD G +LP PDG++INGRG N Y
Sbjct  142   KIESRPGIPVPFPPPAGDFTILAGDWYKRNHTDLRAILDGGSDLPFPDGIIINGRGSNAY  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVG+ +SINFRIQGHK+ +VEVEG+HT+Q+ + +LD+HLGQ+YSV
Sbjct  202   TFTVDQGKTYRFRISNVGLTSSINFRIQGHKMTIVEVEGTHTLQNIYDSLDVHLGQTYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P+DY +VV++RFTS+VL  T++  YSNS   V+G  P GPT Q++WSL Q RS
Sbjct  262   LVTADQPPQDYLIVVTTRFTSQVLNATSMFRYSNSGGGVTGLLPWGPTIQVDWSLNQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQRYAVN VSF+  DTPLKL
Sbjct  322   LRRNLTASGPRPNPQGSYHYGLINTTRTIRLQNSAPVINGKQRYAVNSVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADY+KI GVF+LGSIPD P     YL TSVM+A++R FVE+VF+N EDTV+SWH+DG+SF
Sbjct  382   ADYYKIQGVFSLGSIPDYPTGSGGYLQTSVMEADFRGFVEVVFENTEDTVESWHVDGHSF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT++R TVQVYP+SWTAIYM LDNVGMWN+RSE+W  QY
Sbjct  442   FVVGMDGGQWSSASRLNYNLRDTISRSTVQVYPKSWTAIYMPLDNVGMWNVRSENWVHQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             LGQQFYLRVY+  NS+RDE PIP NA+ CG+A G +
Sbjct  502   LGQQFYLRVYSPANSWRDEYPIPSNAIRCGKAVGHY  537



>ref|XP_011008684.1| PREDICTED: L-ascorbate oxidase homolog, partial [Populus euphratica]
Length=468

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/464 (81%), Positives = 413/464 (89%), Gaps = 3/464 (1%)
 Frame = +2

Query  422   LSW---NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             LSW   NG+QQRRNSWQDGVYGT CPIPP KNFTY LQ KDQIGS+FYFPSL  HKAAG 
Sbjct  5     LSWHNRNGIQQRRNSWQDGVYGTNCPIPPGKNFTYALQVKDQIGSFFYFPSLGFHKAAGA  64

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI+SRP IPVPF PPA DFTVLAGDW KR++ QL  ILD GHNLP PDGLLINGRG
Sbjct  65    FGGIRIWSRPRIPVPFPPPAGDFTVLAGDWYKRNHYQLRRILDGGHNLPFPDGLLINGRG  124

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
             WNG TFTVDPG+TYRFRISNVG+ TSINFRIQGHK+KLVEVEGSHT+Q+T+++LDIHLGQ
Sbjct  125   WNGCTFTVDPGKTYRFRISNVGLTTSINFRIQGHKMKLVEVEGSHTLQNTYSDLDIHLGQ  184

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVLVTADQ  KDYY+VVSSRFT  VLTTTA+LHYSNS+ RVSGP PGGPTTQI+WSL 
Sbjct  185   SYSVLVTADQPAKDYYIVVSSRFTKPVLTTTAILHYSNSWQRVSGPIPGGPTTQIDWSLN  244

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS R NL+ASGPRPNPQGSYHYG+IK +RTI LANS P IN KQRYAVNGVS++  DT
Sbjct  245   QARSFRWNLTASGPRPNPQGSYHYGLIKTSRTITLANSGPIINRKQRYAVNGVSYIPADT  304

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLK+ADYF I GVF+LGS+P SP WG+AYL T+VM AN+R F+EIVFQNWEDTVQSWHID
Sbjct  305   PLKIADYFNIPGVFSLGSMPSSPSWGNAYLQTAVMPANFREFIEIVFQNWEDTVQSWHID  364

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             G+SFFVVGMDGGQWT ASR RYNLRDTVARCT QVYP+SWTAIYMALDNVGMWNIRSE+W
Sbjct  365   GHSFFVVGMDGGQWTPASRARYNLRDTVARCTTQVYPKSWTAIYMALDNVGMWNIRSENW  424

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQFYLRVY+  +S+RDELPIPKNALLCGRARGRHTRPL
Sbjct  425   ARQYLGQQFYLRVYSPAHSWRDELPIPKNALLCGRARGRHTRPL  468



>gb|ACN50176.1| pectinesterase [Annona cherimola]
Length=540

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/521 (73%), Positives = 442/521 (85%), Gaps = 0/521 (0%)
 Frame = +2

Query  242   YGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFL  421
             +G +PYR++TW +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L EPFL
Sbjct  20    FGEDPYRFFTWNVTYGDIYPLGVRQQGILINGQFPGPDIFSVTNDNLIINVHNSLPEPFL  79

Query  422   LSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGA  601
             +SWNG+QQRRNSWQDGVYGT CPIPP KNFTY+LQ KDQIGS+FYFPSL  HKAAGG+G 
Sbjct  80    ISWNGVQQRRNSWQDGVYGTNCPIPPGKNFTYILQVKDQIGSFFYFPSLAFHKAAGGFGG  139

Query  602   IRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNG  781
             I+I SRP IPVPF  PA D+T L GDW K+++  L+ ILD G  LP PDG+LINGRG NG
Sbjct  140   IKILSRPRIPVPFPDPAADYTALIGDWYKKNHTDLKAILDGGRKLPFPDGILINGRGPNG  199

Query  782   YTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYS  961
              +FTV+ G+TYRFRISNVG+  S+NFRIQGHKLKLVEVEG+HTVQ+ +++LD+H+GQSYS
Sbjct  200   ASFTVEQGKTYRFRISNVGLQNSLNFRIQGHKLKLVEVEGTHTVQTEYSSLDVHVGQSYS  259

Query  962   VLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGR  1141
             VLV ADQ  +DYY+VVS+RFT+ VLTTTAVLHY+NS   VSGPPPGGPT QI+WSL Q R
Sbjct  260   VLVLADQPGQDYYIVVSTRFTTTVLTTTAVLHYANSAGPVSGPPPGGPTIQIDWSLNQAR  319

Query  1142  SLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLK  1321
             S+R NL+ASGPRPNPQGSYHYG+I   RTI+LA+SA  ++ KQRY VNGVSFV  DTPLK
Sbjct  320   SIRTNLTASGPRPNPQGSYHYGLINTTRTIILASSAGQVDRKQRYGVNGVSFVPADTPLK  379

Query  1322  LADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             LAD+FKIGGVF LGSI D P     Y  TSVM A++R+FVEIVFQN ED VQSWH+DGY+
Sbjct  380   LADFFKIGGVFRLGSISDKPTTRHLYQDTSVMAADFRAFVEIVFQNNEDIVQSWHLDGYN  439

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             FFVVGMDGGQWT AS+  YNLRD ++RCTVQVYP+SWTAI++ALDN+GMWN+RSE WARQ
Sbjct  440   FFVVGMDGGQWTRASKDGYNLRDAISRCTVQVYPKSWTAIWVALDNIGMWNVRSEFWARQ  499

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             YLGQQFYLRVY+   S RDE PIPKNALLCGRA GRHTRPL
Sbjct  500   YLGQQFYLRVYSPVESIRDEYPIPKNALLCGRAAGRHTRPL  540



>gb|KHN21220.1| L-ascorbate oxidase like [Glycine soja]
Length=537

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/516 (72%), Positives = 433/516 (84%), Gaps = 0/516 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW +TYGDIYPLGVKQ+ ILIN QFPGPQI+ VTNDNLIINVYN L+EPFLL
Sbjct  22    GEDPYRFYTWNVTYGDIYPLGVKQQGILINWQFPGPQIEAVTNDNLIINVYNSLDEPFLL  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SWNG+ QRRNSWQDGVYGT CPI P  NFTY+LQ KDQIGSYFY+PSL  HKAAGGYG  
Sbjct  82    SWNGVLQRRNSWQDGVYGTNCPILPGHNFTYVLQVKDQIGSYFYYPSLAFHKAAGGYGGF  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP IPVPF PPA DFT+LAGDW KR++  L  ILD G +LP PDG++INGRG N Y
Sbjct  142   KIESRPGIPVPFPPPAGDFTILAGDWYKRNHTDLRAILDGGSDLPFPDGIIINGRGSNAY  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
             TFTVD G+TYRFRISNVG+ +SINFRIQGHK+ +VEVEG+HT+Q+ + +LD+HLGQ+YSV
Sbjct  202   TFTVDQGKTYRFRISNVGLTSSINFRIQGHKMTIVEVEGTHTLQNIYDSLDVHLGQTYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             LVTADQ P+DY +VV++RFTS+VL  T++  YSNS   V+G  P GPT Q++WSL Q RS
Sbjct  262   LVTADQPPQDYLIVVTTRFTSQVLNATSIFRYSNSGGGVTGLFPWGPTIQVDWSLNQARS  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             LRRNL+ASGPRPNPQGSYHYG+I   RTI L NSAP INGKQRYAVN VSF+  DTPLKL
Sbjct  322   LRRNLTASGPRPNPQGSYHYGLINTTRTIRLQNSAPVINGKQRYAVNSVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSF  1504
             ADY+KI GVF+LGSIPD P     YL TSVM+A++R F+E+VF+N EDTV+SWH+DG+SF
Sbjct  382   ADYYKIQGVFSLGSIPDYPTGSGGYLQTSVMEADFRGFIEVVFENTEDTVESWHVDGHSF  441

Query  1505  FVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQY  1684
             FVVGMDGGQW+ ASR  YNLRDT++R TVQVYP+SWTAIYM LDNVGMWN+RSE+W  QY
Sbjct  442   FVVGMDGGQWSSASRLNYNLRDTISRSTVQVYPKSWTAIYMPLDNVGMWNVRSENWVHQY  501

Query  1685  LGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRH  1792
             LGQQFYLRVY+  NS+RDE PIP NA+ CG+A G +
Sbjct  502   LGQQFYLRVYSPANSWRDEYPIPSNAIRCGKAVGHY  537



>emb|CDY68834.1| BnaCnng60730D, partial [Brassica napus]
Length=549

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/523 (71%), Positives = 431/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILI+G+FPGP I  VTNDNL+IN++N L+EP
Sbjct  28    AVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEP  87

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  88    FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGF  147

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG 
Sbjct  148   GGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAKLDSGRKLPLPDGILINGRG-  206

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
              G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQS
Sbjct  207   TGATLNVEQGKTYRLRISNVGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQS  266

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ   DYYVVVSSRFTS VLTTT VL YS S   VSGP PGGPT QI+WSL Q
Sbjct  267   YSVLVTADQPAHDYYVVVSSRFTSTVLTTTGVLRYSGSSGGVSGPIPGGPTIQIDWSLNQ  326

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTP
Sbjct  327   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFKPADTP  386

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+ +GS+   P  G  YL TSV+ A+YR+FVEIVF+N E+ VQ+WH+DG
Sbjct  387   LKLADYFKIDGVYRVGSVQSQPTGGGIYLDTSVLQADYRTFVEIVFENPENIVQTWHLDG  446

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGG+W+  SR  YNLRD +ARCTVQVYP SWTAIY+ALDNVGMWN+RSE WA
Sbjct  447   YSFWVVGMDGGKWSPDSRNEYNLRDALARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  506

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  507   RQYLGQQLYLRVYTTSTSLRDEFPIPKNALLCGRASGRSTRPL  549



>ref|XP_009794441.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
sylvestris]
Length=497

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/496 (74%), Positives = 430/496 (87%), Gaps = 0/496 (0%)
 Frame = +2

Query  317   RAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTCPIP  496
             + ILINGQFPGP I+CVTNDNLI++V+N L+EPFL+SW+G+QQRRNSWQDGVYGT CPIP
Sbjct  2     QGILINGQFPGPPIECVTNDNLIVSVFNNLDEPFLMSWDGIQQRRNSWQDGVYGTNCPIP  61

Query  497   PRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTVLAG  676
             P +NFTY+LQ KDQIGS+FYFPSL MHKAAGGYG ++I SRPLIPVPF PPA ++T+L G
Sbjct  62    PGQNFTYILQVKDQIGSFFYFPSLAMHKAAGGYGGVKIDSRPLIPVPFPPPAGEYTMLVG  121

Query  677   DWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIATSIN  856
             DW K+++  L+ ILD G +LP PDGLLINGRG N  TFTVD GRTYRFRISNVG+ T+IN
Sbjct  122   DWFKQNHTDLKAILDGGSDLPFPDGLLINGRGSNSLTFTVDQGRTYRFRISNVGLTTAIN  181

Query  857   FRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVL  1036
             FRIQGHK+ LVEVEG+HT+Q+T+ ++DIHLGQSYSVLVT DQ  +DYY+V S+RFTS+VL
Sbjct  182   FRIQGHKMVLVEVEGTHTLQNTYESIDIHLGQSYSVLVTMDQPGQDYYIVASTRFTSQVL  241

Query  1037  TTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIK  1216
             T T++LHYSNS   VSGPPPGGPT +I+WSL Q RS+R+NL+ASGPRPNPQGSYHYG++ 
Sbjct  242   TATSILHYSNSAGSVSGPPPGGPTIEIDWSLNQARSVRQNLTASGPRPNPQGSYHYGLVN  301

Query  1217  PARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSA  1396
               RTI LANSAP INGKQRYAVN VSF+  DTPLKLADYFKI GVFNLGSI D+P  G  
Sbjct  302   TTRTIRLANSAPMINGKQRYAVNSVSFIPADTPLKLADYFKIPGVFNLGSIQDNPTGGGG  361

Query  1397  YLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTV  1576
             YL TSVM A++R+FVE+VF+N ED VQSWHIDG+ FFVVGMDGGQW+ ASR  YNLRD +
Sbjct  362   YLQTSVMAADFRAFVEVVFENPEDIVQSWHIDGHIFFVVGMDGGQWSPASRLNYNLRDGI  421

Query  1577  ARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPK  1756
             +RCT+QVYP+SWTA+YM LDNVGMWNIRSE+WARQYLGQQFYLRVY+  NS+RDE PIPK
Sbjct  422   SRCTIQVYPKSWTALYMPLDNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDEYPIPK  481

Query  1757  NALLCGRARGRHTRPL  1804
             NAL+CGRA GR TRPL
Sbjct  482   NALVCGRASGRSTRPL  497



>gb|KHG21048.1| L-ascorbate oxidase [Gossypium arboreum]
Length=541

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/518 (73%), Positives = 433/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+Y+W +TYGDIYPLGV+Q  +LINGQFPGP I  VTNDNLIINVYN LNE FLLSW
Sbjct  24    DPYRFYSWNVTYGDIYPLGVRQTGLLINGQFPGPDIHSVTNDNLIINVYNNLNESFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTYMLQ KDQIGS++Y+PSL  HKAAGG+G IRI
Sbjct  84    NGVQQRRNSYEDGVYGTTCPIPPGKNFTYMLQVKDQIGSFYYYPSLGFHKAAGGFGGIRI  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGRG  G +F
Sbjct  144   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTVLQAHLDGGKKLPFPDGVLINGRGPGGASF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ H+L LVEVEG+HT+Q+T++++D+HLGQS SVL 
Sbjct  204   NVEQGKTYRLRISNVGLQNSLNFRIQNHRLTLVEVEGTHTLQTTYSSIDLHLGQSCSVLF  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+V S+RFT+ VLTTTA L YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQPAQDYYIVASTRFTNPVLTTTATLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   RTI LANSA  +NGKQRYAVN VSFV PDTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTRTIRLANSAGQVNGKQRYAVNSVSFVLPDTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGGVF  GSI D+P  G  YL TSV++A+YR+FVEIVF+N E+ +QSWH++GYSFFV
Sbjct  384   YFKIGGVFRPGSISDNPYGGGIYLDTSVLNADYRAFVEIVFENTENIIQSWHLNGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR  YNLRD VARCT QVYP+SWTAIY+ALDNVG+WN+RSE WARQYLG
Sbjct  444   VGMDGGRWTAASRNGYNLRDAVARCTTQVYPKSWTAIYVALDNVGIWNLRSEYWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT + S RDE PIPKNALLCGRA GR TRPL
Sbjct  504   QQLYLRVYTDSTSLRDEYPIPKNALLCGRAAGRSTRPL  541



>gb|KEH40258.1| multi-copper oxidase-like protein [Medicago truncatula]
Length=543

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/522 (71%), Positives = 436/522 (84%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             +   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22    IVAEDPYRFFNWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82    LISWNGVQQRRNSYEDGVFGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LD+G  LP PDG+LINGRG  
Sbjct  142   GIRILSRPRIPVPFDDPAGDYTVLIGDWYKSNHTDLKAQLDNGKKLPFPDGILINGRGSG  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G +  V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  202   GSSLNVEQGKTYRLRISNVGLENSLNFRIQNHKMKLVEVEGTHTLQTTYSSLDVHVGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+VVSSRFT+ VLT+T +L YSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  262   SVLVTADQPSQDYYIVVSSRFTNPVLTSTGILRYSNSAGPVSGPPPGGPTIQIDWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI   RTI+L++SA  +NGKQRYA+N VS+V PDTPL
Sbjct  322   RSIRTNLTASGPRPNPQGSYHYGMINLTRTIVLSSSAGQVNGKQRYAINSVSYVAPDTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+FKI GV+  GSI D P  G  YL TSVM  +YR+FVEIVFQN ED +QS+H+DGY
Sbjct  382   KLADFFKIAGVYRPGSISDRPSGGGIYLDTSVMQTDYRTFVEIVFQNDEDILQSYHLDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQWT   R +YNLRD V+R T QVYP+SWTAIY+ LDNVGMWN+RSE WAR
Sbjct  442   SFFVVGMDGGQWTSDKRNQYNLRDAVSRSTTQVYPKSWTAIYVPLDNVGMWNLRSEFWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVYT++ S RDE PIPKNALLCGRA GRHTRPL
Sbjct  502   QYLGQQFYMRVYTTSTSLRDEYPIPKNALLCGRATGRHTRPL  543



>emb|CDY55201.1| BnaCnng28410D, partial [Brassica napus]
Length=549

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/523 (71%), Positives = 430/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILI+G+FPGP I  VTNDNL+IN++N L+EP
Sbjct  28    AVTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEP  87

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+
Sbjct  88    FLLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGF  147

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG 
Sbjct  148   GGIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAKLDSGRKLPLPDGILINGRG-  206

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
              G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++ D+H+GQS
Sbjct  207   TGATLNVEQGKTYRLRISNVGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSFDVHVGQS  266

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVLVTADQ   DYYVVVSSRFTS VLTTT VL YS S   VSGP PGGPT QI+WSL Q
Sbjct  267   YSVLVTADQPAHDYYVVVSSRFTSTVLTTTGVLRYSGSSGGVSGPIPGGPTIQIDWSLNQ  326

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTP
Sbjct  327   ARAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFKPADTP  386

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GV+ +GS+   P  G  YL TSV+ A+YR+FVEIVF+N E+ VQ+WH+DG
Sbjct  387   LKLADYFKIDGVYRVGSVQSQPTGGGIYLDTSVLQADYRTFVEIVFENPENIVQTWHLDG  446

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGG+W+  SR  YNLRD +ARCTVQVYP SWTAIY+ALDNVGMWN+RSE WA
Sbjct  447   YSFWVVGMDGGKWSPDSRNEYNLRDALARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  506

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  507   RQYLGQQLYLRVYTTSTSLRDEFPIPKNALLCGRASGRSTRPL  549



>ref|NP_564479.1| SKU5 similar 6 [Arabidopsis thaliana]
 gb|AEE31910.1| SKU5 similar 6 [Arabidopsis thaliana]
Length=542

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/523 (69%), Positives = 429/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  21    AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEP  80

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81    FLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  140

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  
Sbjct  141   GGIRILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLPSPDGILINGRS-  199

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NG T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQS
Sbjct  200   NGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQS  259

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVL+TADQ P+DYYVVVSSRFT +++TTT VL YS S T  SGP PGGPT Q++WSL Q
Sbjct  260   YSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGGPTIQVDWSLNQ  319

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY VN VSFV  DTP
Sbjct  320   ARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTP  379

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLAD+FKI GV+ + SI D P +G  YL TSV+  +YR+F+EIVF+N ED VQS+H++G
Sbjct  380   LKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  439

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WA
Sbjct  440   YSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  499

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRV+TS+ S RDE PIPKN+ LCGRARGRHTRPL
Sbjct  500   RQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCGRARGRHTRPL  542



>gb|EEC82126.1| hypothetical protein OsI_26158 [Oryza sativa Indica Group]
Length=546

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/525 (71%), Positives = 442/525 (84%), Gaps = 3/525 (1%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI PLGVKQ+ ILINGQFPGP I+ VTNDNLIINV+N LN+PF
Sbjct  22    VAGDDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGV GTTCPIPP  NFTY+LQ KDQIG+YFYFPSL  HKAAGG+G
Sbjct  82    LISWNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+ SRP+IPVPF PPA D+ +L GDW K ++  L+Y+LDSG  L  PDGLLINGR W+
Sbjct  142   AIRVLSRPMIPVPFPPPAADYPLLIGDWYKANHTDLKYMLDSGKALGFPDGLLINGRSWD  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTF V  GRTYRFRISNVG++TS+N R QGH + LVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  202   GYTFNVQQGRTYRFRISNVGLSTSLNIRFQGHTMTLVEVEGSHTMQTTYSSLDVHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ   DY VVVS+RFTS++++TTAVL YS S  +     PGGPT QI+WSL Q 
Sbjct  262   SVLLTADQPAYDYAVVVSTRFTSKIISTTAVLRYSGSGGKSPAALPGGPTIQIDWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGM+   RTI LA+S+  +NGKQRYAVNGVS VNPDTPL
Sbjct  322   RSIRWNLTASGPRPNPQGSYHYGMVTTTRTIRLASSSATVNGKQRYAVNGVSHVNPDTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPR---WGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             K+ADY+KI GVF++G+I DSP     G AYL T+VM A+YR +VEIVF+N E+ VQSWHI
Sbjct  382   KVADYYKIAGVFSVGTISDSPSGGGGGGAYLQTAVMGASYRDYVEIVFENPENEVQSWHI  441

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGY+F+VVGMDGG+W+ ASR  YNLRD V+R TVQVYP SWTAIYM LDNVGMWN+RSE+
Sbjct  442   DGYAFWVVGMDGGKWSSASRQGYNLRDAVSRYTVQVYPNSWTAIYMPLDNVGMWNVRSEN  501

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRV+TS+ S+RDE PIPKNALLCGRA GR TRPL
Sbjct  502   WARQYLGQQFYLRVWTSSTSWRDEYPIPKNALLCGRAAGRRTRPL  546



>gb|AAF99833.1|AC008046_5 Putative pectinesterase [Arabidopsis thaliana]
Length=541

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/523 (69%), Positives = 429/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  20    AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  80    FLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  
Sbjct  140   GGIRILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLPSPDGILINGRS-  198

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NG T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQS
Sbjct  199   NGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQS  258

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVL+TADQ P+DYYVVVSSRFT +++TTT VL YS S T  SGP PGGPT Q++WSL Q
Sbjct  259   YSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGGPTIQVDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY VN VSFV  DTP
Sbjct  319   ARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLAD+FKI GV+ + SI D P +G  YL TSV+  +YR+F+EIVF+N ED VQS+H++G
Sbjct  379   LKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WA
Sbjct  439   YSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRV+TS+ S RDE PIPKN+ LCGRARGRHTRPL
Sbjct  499   RQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCGRARGRHTRPL  541



>ref|XP_004290036.1| PREDICTED: L-ascorbate oxidase homolog [Fragaria vesca subsp. 
vesca]
Length=540

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/519 (70%), Positives = 433/519 (83%), Gaps = 1/519 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR++ W +TYGDIYPLG+KQR ILINGQFPGP+I  VTNDNLIINV+N L EPFL+
Sbjct  22    GEDPYRFFEWNVTYGDIYPLGIKQRGILINGQFPGPEIYSVTNDNLIINVHNSLPEPFLI  81

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             +WNG+QQRRNS+QDGVYGTTCPIPP KNFTY LQ KDQIGS++YFPSL  HKAAGG+GAI
Sbjct  82    TWNGVQQRRNSYQDGVYGTTCPIPPGKNFTYTLQVKDQIGSFYYFPSLAFHKAAGGFGAI  141

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             +I SRP IPVPF  PA D+++L GDW    +++L+ ILD+GH LP P GLLINGRG N  
Sbjct  142   KILSRPRIPVPFPEPAADYSLLIGDWYNLDHKRLQAILDNGHRLPNPQGLLINGRGGNDT  201

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTV+ G+TYR RISNVG+  ++NFRIQGH++KLVEVEG+HTVQ+T+ +LD+H+GQSYSV
Sbjct  202   WFTVEQGKTYRLRISNVGMQNTLNFRIQGHQMKLVEVEGTHTVQTTYDSLDVHVGQSYSV  261

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRS  1144
             L+TADQ P+DYY+V S+RFTS+VLT+TAVLHYSNS  +VSGP PGGPT Q  WSL Q R+
Sbjct  262   LITADQAPQDYYIVTSTRFTSKVLTSTAVLHYSNSRRQVSGPIPGGPTIQTGWSLSQART  321

Query  1145  LRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKL  1324
             +R NL+ASGPRPNPQGSYHYG++  +RTI L++SA  +NGKQRY VNGVSF+  DTPLKL
Sbjct  322   IRTNLTASGPRPNPQGSYHYGLVNVSRTIRLSSSAAQVNGKQRYGVNGVSFIPADTPLKL  381

Query  1325  ADYFKIGGVFNLGSIPDSPR-WGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             ADYFKI GVF +GSI D+P    S YL T+VM A++R+FVEIVF+N E+ VQSWH+DGY 
Sbjct  382   ADYFKIDGVFKVGSIQDNPTGQKSLYLDTAVMGADFRTFVEIVFENPENIVQSWHLDGYY  441

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             F+VVGMDGG+WT  SR  YNL D V+R T QVYP+SWTA+Y+ALDNVGMWN+RS+ W RQ
Sbjct  442   FWVVGMDGGKWTPDSRKEYNLVDAVSRHTTQVYPKSWTAVYVALDNVGMWNVRSQFWTRQ  501

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             YLGQQFYLRVY+   S RDE PIPKNALLCGRA GR  R
Sbjct  502   YLGQQFYLRVYSPVGSVRDEYPIPKNALLCGRAAGRTRR  540



>gb|AAL24296.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM91125.1| unknown protein [Arabidopsis thaliana]
Length=542

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/523 (69%), Positives = 429/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EP
Sbjct  21    AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEP  80

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  81    FLISWNGVQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  140

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  
Sbjct  141   GGIRILSRPGIPVPFADPAGDYTVLIGDWYKFNHTDLKSRLDRGRKLPSPDGILINGRS-  199

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NG T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQS
Sbjct  200   NGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQS  259

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVL+TADQ P+DYYVVVSSRFT +++TTT VL YS S T  SGP PGGPT Q++WSL Q
Sbjct  260   YSVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSTPASGPIPGGPTIQVDWSLNQ  319

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY VN VSFV  DTP
Sbjct  320   ARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTP  379

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLAD+FKI GV+ + SI D P +G  YL TSV+  +YR+F+EIVF+N ED VQS+H++G
Sbjct  380   LKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  439

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WA
Sbjct  440   YSFWVVGMDGGQWETGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  499

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRV+TS+ S RDE PIPKN+ LCGRARGRHTRPL
Sbjct  500   RQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCGRARGRHTRPL  542



>ref|XP_003563398.1| PREDICTED: L-ascorbate oxidase homolog [Brachypodium distachyon]
Length=549

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/521 (70%), Positives = 432/521 (83%), Gaps = 1/521 (0%)
 Frame = +2

Query  245   GGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLL  424
             G +PYR+YTW IT+GDIYPLGVKQ  ILINGQFPGPQID VTNDN++INV+N L  PFLL
Sbjct  29    GEDPYRFYTWNITFGDIYPLGVKQEGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLL  88

Query  425   SWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAI  604
             SW G+QQRR+SWQDGVYGT CPIPP  NFTY +Q KDQIGSY+YFPSL +HKAAGGYG I
Sbjct  89    SWQGIQQRRSSWQDGVYGTNCPIPPGGNFTYNMQFKDQIGSYYYFPSLELHKAAGGYGGI  148

Query  605   RIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGY  784
             R+ SRP IPVPF PPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG 
Sbjct  149   RVLSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGLLINGQGWNGN  208

Query  785   TFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSV  964
              FTVD G+TYRFR+SNVGI+TS+N RIQGH L LVEVEGSHT+QS +++LD+HLGQSYS 
Sbjct  209   KFTVDQGKTYRFRVSNVGISTSVNIRIQGHSLLLVEVEGSHTMQSNYSSLDVHLGQSYSF  268

Query  965   LVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS-FTRVSGPPPGGPTTQINWSLFQGR  1141
             LV ADQ P+DY +VVS+RF + VLT TAVL YSNS   R + PPP  PT +++WS+ Q +
Sbjct  269   LVKADQAPQDYTIVVSTRFANPVLTNTAVLQYSNSNGARAALPPPPEPTVEVDWSMNQAK  328

Query  1142  SLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLK  1321
             S+R NL+ASGPRPNPQGSYHYG++   RT+ LANS   INGK RYAVN VSF+  DTPLK
Sbjct  329   SIRWNLTASGPRPNPQGSYHYGLVNTTRTMRLANSRANINGKLRYAVNSVSFIPADTPLK  388

Query  1322  LADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYS  1501
             +AD++ I GVF  GS+PD+P  G+AYL T+VM +N R +VE+VF+N E++VQSWHIDGY+
Sbjct  389   VADFYNIQGVFTPGSMPDNPTGGAAYLQTAVMASNMRDYVEVVFENAENSVQSWHIDGYA  448

Query  1502  FFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQ  1681
             F+VVGM+GG WT ASR  YNLRD +AR T+QVYP SWTAIYM LDNVGMWN+RSE W RQ
Sbjct  449   FWVVGMEGGPWTPASRQAYNLRDAIARYTLQVYPGSWTAIYMPLDNVGMWNVRSESWGRQ  508

Query  1682  YLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             YLGQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  509   YLGQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  549



>gb|EEE67250.1| hypothetical protein OsJ_24405 [Oryza sativa Japonica Group]
Length=546

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/525 (71%), Positives = 442/525 (84%), Gaps = 3/525 (1%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI PLGVKQ+ ILINGQFPGP I+ VTNDNLIINV+N LN+PF
Sbjct  22    VAGDDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGV GTTCPIPP  NFTY+LQ KDQIG+YFYFPSL  HKAAGG+G
Sbjct  82    LISWNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+ SRP+IPVPF PPA D+ +L GDW K ++  L+Y+LDSG  L  PDGLLINGR W+
Sbjct  142   AIRVLSRPMIPVPFPPPAADYPLLIGDWYKANHTDLKYMLDSGKALGFPDGLLINGRSWD  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GYTF V  GRTYRFRISNVG++TS+N R QGH + LVEVEGSHT+Q+T+++LD+HLGQSY
Sbjct  202   GYTFNVQQGRTYRFRISNVGLSTSLNIRFQGHTMTLVEVEGSHTMQTTYSSLDVHLGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ   DY VVVS+RFTS++++TTAVL YS S  +     PGGPT QI+WSL Q 
Sbjct  262   SVLLTADQPAYDYAVVVSTRFTSKIISTTAVLRYSGSGGKSPAALPGGPTIQIDWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGM+   RTI LA+S+  +NGKQRY+VNGVS VNPDTPL
Sbjct  322   RSIRWNLTASGPRPNPQGSYHYGMVTTTRTIRLASSSATVNGKQRYSVNGVSHVNPDTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPR---WGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHI  1489
             K+ADY+KI GVF++G+I DSP     G AYL T+VM A+YR +VEIVF+N E+ VQSWHI
Sbjct  382   KVADYYKIAGVFSVGTISDSPSGGGGGGAYLQTAVMGASYRDYVEIVFENPENEVQSWHI  441

Query  1490  DGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSED  1669
             DGY+F+VVGMDGG+W+ ASR  YNLRD V+R TVQVYP SWTAIYM LDNVGMWN+RSE+
Sbjct  442   DGYAFWVVGMDGGKWSSASRQGYNLRDAVSRYTVQVYPNSWTAIYMPLDNVGMWNVRSEN  501

Query  1670  WARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             WARQYLGQQFYLRV+TS+ S+RDE PIPKNALLCGRA GR TRPL
Sbjct  502   WARQYLGQQFYLRVWTSSTSWRDEYPIPKNALLCGRAAGRRTRPL  546



>ref|XP_004145593.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=541

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/510 (72%), Positives = 431/510 (85%), Gaps = 1/510 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             NPYR++TW ++Y +IYPLGV+Q+ ILINGQFPGP + CVTNDNLIINV+N L+EPFL+SW
Sbjct  25    NPYRFFTWNVSYANIYPLGVRQQGILINGQFPGPDVHCVTNDNLIINVFNSLDEPFLISW  84

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G IRI
Sbjct  85    NGIQQRRNSYEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFGGIRI  144

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  N  +F
Sbjct  145   LSRPRIPVPFPDPAGDYTVLIGDWYKSNHTTLKAHLDRGKKLPFPDGILINGRA-NDTSF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T+++LD+H+GQSYSVL+
Sbjct  204   GVEQGKTYRLRISNVGLQHSLNFRIQGHKMKLVEVEGTHTLQTTYSSLDVHVGQSYSVLI  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RFTSRVL TT +L YSNS   V GPPPGGPT QI+WSL Q RS+R
Sbjct  264   TADQPAQDYYIVVSTRFTSRVLATTGILRYSNSAGPVKGPPPGGPTIQIDWSLNQARSIR  323

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I   +TI+LANSA  +N KQRYAVN VSFV  DTPLKLAD
Sbjct  324   TNLTASGPRPNPQGSYHYGLINTTKTIILANSAGQVNRKQRYAVNSVSFVPADTPLKLAD  383

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             +FKIGGVF +GSI D P  G  YL TSVM  +YR+FVEI+FQN E+ VQSWHIDGYSFFV
Sbjct  384   FFKIGGVFRVGSISDRPTGGGIYLDTSVMGVDYRAFVEIIFQNNENIVQSWHIDGYSFFV  443

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT++SR +YNLRD +ARCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  444   VGMDGGQWTQSSRNQYNLRDAIARCTTQVYPYSWTAIYVALDNVGMWNVRSEFWARQYLG  503

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRA  1780
             QQFYLRVYT + S RDE PIPKNALLCG+A
Sbjct  504   QQFYLRVYTPSTSLRDEFPIPKNALLCGKA  533



>ref|XP_004238406.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=540

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/524 (71%), Positives = 435/524 (83%), Gaps = 1/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N V   +PYRY+ W +TYG IYPLGV Q+ ILINGQFPGP I+ VTNDNL+IN++N L+E
Sbjct  18    NSVVAEDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDE  77

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNG+Q RRNS+ DGVYGTTCPIPP +N T+ LQ KDQIGS++YFPSL  HKAAGG
Sbjct  78    PFLLSWNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGG  137

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI SRP IPVPF  PA D+T+L GDW K+++  L+ ILD G  LP PDG+LINGRG
Sbjct  138   FGGIRILSRPRIPVPFPDPANDYTILIGDWYKKNHTDLKAILDGGRKLPFPDGILINGRG  197

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              NG TFTVD G+TYR RISNVG+  S+NFR++GHK+ LVEVEG+HT+Q+T+++LD+H GQ
Sbjct  198   PNGVTFTVDQGKTYRLRISNVGLQNSLNFRVEGHKMTLVEVEGTHTLQTTYSSLDVHAGQ  257

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVL+TA+Q+ KD+Y+VVSSRFT+ VLTTTAVLHYS+S T VSGPPPGGPT QI+WSL 
Sbjct  258   SYSVLITANQEAKDHYIVVSSRFTTPVLTTTAVLHYSSSNTPVSGPPPGGPTIQIDWSLN  317

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NLSASGPRPNPQGSYHYGMI   +TI LA+SA  +NGKQRYAVN VSFV  DT
Sbjct  318   QARSIRTNLSASGPRPNPQGSYHYGMINTTKTIRLASSAGQVNGKQRYAVNSVSFVPLDT  377

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKL DYFKIGG F +GSIPDSP  G  Y  TSV+  NYR F+EI+F+N ED VQSWH+D
Sbjct  378   PLKLLDYFKIGG-FRVGSIPDSPTGGGIYQDTSVLGVNYRQFIEIIFENNEDIVQSWHLD  436

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSF+VVGMDGGQWT+ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+R+E W
Sbjct  437   GYSFWVVGMDGGQWTQASRNGYNLRDAVSRCTTQVYPKSWTAIYIALDNVGMWNLRTEFW  496

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQ Y+RVYT + S RDE PIP+ A LCG+   RHTRPL
Sbjct  497   ARQYLGQQLYMRVYTDSTSLRDEYPIPRGARLCGKVANRHTRPL  540



>ref|XP_009418784.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/545 (71%), Positives = 449/545 (82%), Gaps = 23/545 (4%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI+P+GVKQ+ ILINGQFPGPQI+ VTNDNLIINV+N L EPF
Sbjct  22    VLGDDPYRFFTWNVTYGDIWPMGVKQQGILINGQFPGPQIEAVTNDNLIINVFNSLPEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNSWQDGVYGT CPIPP  NFTY++Q KDQIGSYFYFPSL  HKAAGG+G
Sbjct  82    LLSWNGVQQRRNSWQDGVYGTNCPIPPGGNFTYVMQVKDQIGSYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IR+ SRPLIPVPF PPA D+T+L G W K ++  L YILDSG +LP PDG+LINGRG  
Sbjct  142   GIRVLSRPLIPVPFPPPAADYTLLIGAWYKANHTDLRYILDSGRDLPFPDGILINGRGQY  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G TFTV+ G+TYRFR+SNVG+ATS+N RIQGH + LVEVEGSHT+Q+T+++ D+HLGQS 
Sbjct  202   GNTFTVEQGKTYRFRVSNVGLATSLNVRIQGHAMLLVEVEGSHTLQNTYSSFDLHLGQSC  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             S LVTADQ P DYY+VVSSRFTS VL+TTAVLHYSNS  +  GPPPGGPT QI+WSL Q 
Sbjct  262   SFLVTADQPPMDYYIVVSSRFTSTVLSTTAVLHYSNSGGQPVGPPPGGPTIQIDWSLNQA  321

Query  1139  RSLRR-----------------------NLSASGPRPNPQGSYHYGMIKPARTIMLANSA  1249
             RS+R                        NL+ASGPRPNPQGSYHYG++   RTI LA+SA
Sbjct  322   RSIRYPLPHSAETVRHFTDRSLSMNHRWNLTASGPRPNPQGSYHYGLVNTTRTIRLASSA  381

Query  1250  PYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANY  1429
             P INGKQRYAVN VSF+  DTPLK+AD++ I GVF+LGS+PD+P +G+ YL TSVM AN+
Sbjct  382   PVINGKQRYAVNSVSFIPADTPLKVADFYNIPGVFSLGSMPDNPTYGAGYLQTSVMAANF  441

Query  1430  RSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRS  1609
             R +VEI+F+N EDT+QSWHIDGYSF+VVGMDGGQWT ASR  YNLRD VARCTVQVYP+S
Sbjct  442   RDYVEIIFENSEDTLQSWHIDGYSFWVVGMDGGQWTSASREGYNLRDAVARCTVQVYPKS  501

Query  1610  WTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGR  1789
             W+AIYM LDNVGMWNIRSE+WARQYLGQQFYLRVY+  NS+RDE PIP+NALLCGRA GR
Sbjct  502   WSAIYMPLDNVGMWNIRSENWARQYLGQQFYLRVYSPANSWRDENPIPRNALLCGRASGR  561

Query  1790  HTRPL  1804
              TRPL
Sbjct  562   RTRPL  566



>ref|XP_008447902.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis melo]
Length=546

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/521 (68%), Positives = 432/521 (83%), Gaps = 1/521 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N  +  +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+ INV+N L E
Sbjct  24    NIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPE  83

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNG+QQR+NS+QDGVYGTTCPIPP +NFTY +Q KDQIGSYFYFPSL  HKAAGG
Sbjct  84    PFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGG  143

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G+IR+ SRPLIPVPF  PA D+T+L GDW   ++  L+ ILD GH LP P+G++INGRG
Sbjct  144   FGSIRVLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHRLPFPNGIVINGRG  203

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              +  TFTV+ G+TYRFRI+NVG+  S+NFR+Q H+LKLVEVEG+HT+Q+T+++LD+H+GQ
Sbjct  204   PSATTFTVEKGKTYRFRITNVGLQHSLNFRVQDHELKLVEVEGTHTMQNTYSSLDVHVGQ  263

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVL+TADQ  +D+Y+ VS+RF  +VLT+TA+LHYS+S T V GP PGGP T++ WS+ 
Sbjct  264   SYSVLITADQPSRDFYIAVSTRFAPKVLTSTAILHYSDSTTSVGGPIPGGP-TEVEWSIN  322

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  +N KQRYAVN VSF+  DT
Sbjct  323   QARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAALVNRKQRYAVNSVSFIPADT  382

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYF I GVF +GSIPD P   + +L TSVM A+YR+F+EIVFQN E+ VQSWHID
Sbjct  383   PLKLADYFSIDGVFRIGSIPDFPSGKTMFLDTSVMGADYRAFIEIVFQNHENIVQSWHID  442

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSF+VVGMDGG WT ASR +YNLRD V+RCT QVYP+SWTAIYM+LDNVGMWNIRSE W
Sbjct  443   GYSFWVVGMDGGVWTPASREQYNLRDAVSRCTTQVYPKSWTAIYMSLDNVGMWNIRSEFW  502

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHT  1795
             ARQYLGQQFYLRVYT   S+RDE  +P NALLCG+A G+ T
Sbjct  503   ARQYLGQQFYLRVYTPVKSFRDEYNVPDNALLCGKADGKST  543



>ref|XP_009630901.1| PREDICTED: L-ascorbate oxidase homolog isoform X2 [Nicotiana 
tomentosiformis]
Length=546

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/520 (69%), Positives = 429/520 (83%), Gaps = 0/520 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIIN++N L EPF
Sbjct  26    VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIISVTNDNLIINIHNDLPEPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  86    LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFT+L GDW K  ++ L+ +LD G  L  P+G+ ING G +
Sbjct  146   GIRILSRPRIPVPFLEPAGDFTILIGDWYKTDHKALQTVLDRGKMLKFPNGIQINGLGRD  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+ G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T ++LD+H+GQSY
Sbjct  206   GAKFTVESGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGTHTIQTTLSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VSSRF +++L +TA+LHYSNS   VSG PP GPTT I+WSL Q 
Sbjct  266   SVLVTADQPAQDYYIAVSSRFATQILNSTAILHYSNSRKSVSGLPPPGPTTDISWSLNQA  325

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I  +RTI LANSA  ++ KQRYAVNGVSF+  DTPL
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGQINVSRTIRLANSAGLVDRKQRYAVNGVSFIPADTPL  385

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+ I GVF +GSIPD P     +L T+VM A+YRSFVEIVF+N E+ +QSWH+DGY
Sbjct  386   KLADYYNIKGVFEVGSIPDQPTGRQIHLDTAVMGADYRSFVEIVFENRENIMQSWHLDGY  445

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMD G+W+ AS+ +YNL D V+RCT QVYPRSWTAIY+ LDNVGMWN+R++ WAR
Sbjct  446   SFFVVGMDEGRWSPASKRQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRTQFWAR  505

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             QYLGQQFYLRVYT   S+RDE PIPKNAL CGRA+GR  R
Sbjct  506   QYLGQQFYLRVYTPVQSFRDEYPIPKNALHCGRAKGRTIR  545



>gb|KFK34651.1| hypothetical protein AALP_AA5G173600 [Arabis alpina]
Length=543

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/522 (69%), Positives = 430/522 (82%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINV+N L+EPF
Sbjct  23    VTGESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNVIINVHNSLDEPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFP+L  HKAAGG+G
Sbjct  83    LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQMKDQIGSFYYFPTLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  +
Sbjct  143   GIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDKGKKLPSPDGILINGRS-S  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+ F+ LD+H+GQ+Y
Sbjct  202   GATINVEQGKTYRLRISNVGLQNSLNFRIQGHKMKLVEVEGTHTLQTIFSELDVHVGQTY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P+DYYV VSSRFT ++ TTT VL YS S T  SGP P GP+ Q++WSL Q 
Sbjct  262   SVLITADQSPRDYYVAVSSRFTDKINTTTGVLRYSGSSTPASGPVPWGPSIQVDWSLRQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG++  ARTI+  +SA  INGKQRY VN VSFV  DTPL
Sbjct  322   RAIRTNLTASGPRPNPQGSYHYGLVPLARTIVFGSSAGQINGKQRYGVNSVSFVPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GV+ + SI D P  G  YL TSV+  +YR+F+EIVF+N ED VQS+H++GY
Sbjct  382   KLADYFKISGVYKVNSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENQEDIVQSYHLNGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQW+ +SR  YNLRD V+RCTVQVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  442   SFWVVGMDGGQWSSSSRNGYNLRDGVSRCTVQVYPKSWTAIYIALDNVGMWNLRSEFWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ Y+RVYT++ S RDE PIPKN+ LCGRA+GRHTRPL
Sbjct  502   QYLGQQLYVRVYTTSTSLRDEYPIPKNSHLCGRAKGRHTRPL  543



>ref|XP_007136137.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
 gb|ESW08131.1| hypothetical protein PHAVU_009G021000g [Phaseolus vulgaris]
Length=548

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/518 (71%), Positives = 434/518 (84%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR++ W +TYGDI+PLGV+QR ILINGQFPGP I  VTNDNLIINV+N L+EPFLLSW
Sbjct  31    DPYRFFNWNVTYGDIFPLGVRQRGILINGQFPGPDIHSVTNDNLIINVFNSLDEPFLLSW  90

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+QQRRNS++DGV+GTTCPI P KNFTY+LQ KDQIGS++YFPSL  HKA GG+G IRI
Sbjct  91    NGIQQRRNSFEDGVFGTTCPIAPGKNFTYILQVKDQIGSFYYFPSLAFHKAGGGFGGIRI  150

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  P  D+TVL GDW K ++  L   LD+G  LP PDG+LINGRG NG +F
Sbjct  151   LSRPRIPVPFPDPDGDYTVLIGDWYKSNHTTLRAHLDNGKKLPFPDGILINGRGPNGASF  210

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V+ G+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HTVQ+T+++LD+H+GQSYSVLV
Sbjct  211   NVEQGKTYRLRISNVGLEHSLNFRIQNHKMKLVEVEGTHTVQTTYSSLDVHVGQSYSVLV  270

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RF+ +VLTT+ VL YSNS   VSGPPPGGPT QI+WSL Q RS+R
Sbjct  271   TADQPARDYYIVVSTRFSYKVLTTSGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIR  330

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I  +RTI+LA+SA  ++GKQRYA+N VS+V PDTPLKLAD
Sbjct  331   TNLTASGPRPNPQGSYHYGLINTSRTIVLASSAGQVHGKQRYAMNSVSYVAPDTPLKLAD  390

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKI GVF  GSI D P  G  YL TSV+  +YR+FVEIVFQN E+ VQS+H+DGYSFFV
Sbjct  391   YFKISGVFRPGSISDRPSGGGIYLDTSVLQTDYRTFVEIVFQNNENIVQSYHLDGYSFFV  450

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG WT ASR +YNL D V+RCT QVYP SWTAIY+ALDNVGMWN+RSE WARQYLG
Sbjct  451   VGMDGGLWTAASRNQYNLHDAVSRCTTQVYPMSWTAIYVALDNVGMWNLRSEFWARQYLG  510

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ Y+RVYT++ S RDE P+PKNA+LCGRA GRHTRPL
Sbjct  511   QQLYMRVYTTSTSIRDEFPVPKNAILCGRASGRHTRPL  548



>ref|XP_009128157.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/523 (71%), Positives = 430/523 (82%), Gaps = 2/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILI+G+FPGP I  VTNDNL+IN++N L+EPF
Sbjct  21    VTAEDPYRFFNWNVTYGDIYPLGVRQQGILIDGKFPGPDIHSVTNDNLVINIFNNLDEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+QQRRNS+ DGVYGTTCPIPP KN+TYMLQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81    LLSWNGVQQRRNSYVDGVYGTTCPIPPGKNYTYMLQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L+  LDSG  LPLPDG+LINGRG  
Sbjct  141   GIRILSRPRIPVPFPDPAGDYTVLIGDWYKSNHTDLKAKLDSGRKLPLPDGILINGRG-T  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQ HK+K+VEVEG+HT+Q+TF++LD+H+GQSY
Sbjct  200   GATLNVEQGKTYRLRISNVGLQHSLNFRIQNHKMKVVEVEGTHTLQTTFSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ   DYYVVVSSRFTS VLTTT VL YS S   VSGP PGGPT QI+WSL Q 
Sbjct  260   SVLVTADQPAHDYYVVVSSRFTSTVLTTTGVLRYSGSSGGVSGPIPGGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYGMI   RTI LA+SA  +NGKQRYAVN VSF   DTPL
Sbjct  320   RAIRTNLTASGPRPNPQGSYHYGMINTTRTIRLASSAGQVNGKQRYAVNSVSFNPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVE-IVFQNWEDTVQSWHIDG  1495
             KLADYFKI GV+ +GSI   P  G  YL TSVM  +YR+F+E IVF+N E+ VQ+WH+DG
Sbjct  380   KLADYFKIDGVYRVGSIQSQPTGGGIYLDTSVMQTDYRTFIEIIVFENPENIVQTWHLDG  439

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGG+W+  SR  YNLRD +ARCTVQVYP SWTAIY+ALDNVGMWN+RSE WA
Sbjct  440   YSFWVVGMDGGKWSPDSRNEYNLRDALARCTVQVYPSSWTAIYIALDNVGMWNLRSEFWA  499

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  500   RQYLGQQLYLRVYTTSTSLRDEFPIPKNALLCGRASGRSTRPL  542



>ref|XP_004144874.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
 ref|XP_004152953.1| PREDICTED: L-ascorbate oxidase homolog [Cucumis sativus]
Length=546

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/521 (68%), Positives = 431/521 (83%), Gaps = 1/521 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N  +  +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+ INV+N L E
Sbjct  24    NIAFADSPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIYAVTNDNIYINVHNSLPE  83

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNG+QQR+NS+QDGVYGTTCPIPP +NFTY +Q KDQIGSYFYFPSL  HKAAGG
Sbjct  84    PFLLSWNGVQQRKNSYQDGVYGTTCPIPPGQNFTYRIQVKDQIGSYFYFPSLAFHKAAGG  143

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G+IR+ SRPLIPVPF  PA D+T+L GDW   ++  L+ ILD GH LP P+G++INGRG
Sbjct  144   FGSIRVLSRPLIPVPFPEPAADYTLLIGDWYTANHTTLKTILDRGHKLPFPNGIVINGRG  203

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              N  TFTV+ G+TYR RI+NVG+  S+NFR+Q H++KLVEVEG+HT+Q+T+++LD+H+GQ
Sbjct  204   PNATTFTVEKGKTYRLRITNVGLQHSLNFRVQDHEMKLVEVEGTHTMQNTYSSLDVHVGQ  263

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVL+TADQ  +D+Y+VVS+RF  +VL +TA+LHYS+S T V GP PGGP T++ WS+ 
Sbjct  264   SYSVLITADQPSRDFYIVVSTRFAPKVLISTAILHYSDSTTSVGGPIPGGP-TEVEWSIN  322

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NL+ASGPRPNPQGSYHYG+I  +RTI L +SA  ++ KQRYAVN VSF+  DT
Sbjct  323   QARSIRTNLTASGPRPNPQGSYHYGLINISRTIKLESSAALVSRKQRYAVNSVSFIPADT  382

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKLADYF I GVF++GS+PD P     YL TSVM A+YR+F+EIVFQN E+ VQSWHID
Sbjct  383   PLKLADYFGIDGVFSVGSVPDVPSRKPMYLDTSVMGADYRAFIEIVFQNHENIVQSWHID  442

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSF+VVGMDGG WT ASR +YNLRD V+RCT QVYP+SWTAIYM+LDNVGMWNIRSE W
Sbjct  443   GYSFWVVGMDGGVWTPASREQYNLRDAVSRCTTQVYPKSWTAIYMSLDNVGMWNIRSEFW  502

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHT  1795
             ARQYLGQQFYLRVYT   S+RDE  +P NALLCG+A G+ T
Sbjct  503   ARQYLGQQFYLRVYTPVKSFRDEYNVPDNALLCGKAEGKST  543



>ref|XP_004231076.1| PREDICTED: L-ascorbate oxidase homolog [Solanum lycopersicum]
Length=536

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/514 (70%), Positives = 422/514 (82%), Gaps = 0/514 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W+ITYGDI+PLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N+L  PF
Sbjct  23    VVAEDPYRYFDWRITYGDIHPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNHLPHPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LL+WNGLQQR+NS+QDGVYGTTCPIPP KNFTY +Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  83    LLTWNGLQQRKNSFQDGVYGTTCPIPPGKNFTYTMQVKDQIGSFFYFPSLQFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFT+L GDW K  ++ L+ ILD G  LP PDG+ ING G +
Sbjct  143   GIRILSRPKIPVPFPEPAGDFTILIGDWYKTDHKVLKTILDHGKKLPFPDGIQINGLGRD  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+PG+TYR RI NVG+  S+NFRIQGHK+KLVEVEG+HT+Q+T ++LDIH+GQSY
Sbjct  203   GAKFTVEPGKTYRLRICNVGLQNSLNFRIQGHKMKLVEVEGTHTIQTTLSSLDIHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ+ +DYY+ VSSRFT+++L +TA+LHY NS   VSGPPP GPT  I+WSL Q 
Sbjct  263   SVLVTADQRAQDYYIAVSSRFTTQILNSTAILHYRNSKKTVSGPPPPGPTADISWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I   RTI LAN A  ++ KQRYAVNGVSF+  DTPL
Sbjct  323   RSIRTNLTASGPRPNPQGSYHYGQINVTRTIRLANHAGLVDKKQRYAVNGVSFIPADTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+ I GVF +GSI D P   + +L T+VM A+YR+FVEIVF+N E+ VQSWH+DGY
Sbjct  383   KLADYYNIDGVFKVGSIQDKPTGRNIHLDTAVMGADYRAFVEIVFENRENIVQSWHLDGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMD G W+ AS+ +YNL D V+RCT QVYPRSWTAIY+ LDNVGMWN+RS+ WAR
Sbjct  443   SFFVVGMDVGIWSPASKNQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRSQFWAR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRA  1780
             QYLG QFYLRVYT   SYRDE PIPKNAL CGRA
Sbjct  503   QYLGHQFYLRVYTPVKSYRDEYPIPKNALHCGRA  536



>ref|XP_010667351.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/522 (70%), Positives = 434/522 (83%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR+++W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PF
Sbjct  18    VVAEDPYRFFSWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNNLDVPF  77

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+Q RRNS++DGVYGTTCPIPP +NFTYMLQ KDQIGS++Y+PSL  HKAAG +G
Sbjct  78    LLSWNGVQNRRNSFEDGVYGTTCPIPPGRNFTYMLQVKDQIGSFYYYPSLAFHKAAGAFG  137

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  P+ D+TVL GDW K ++  L+  LD+GH LP PDG+LINGRG +
Sbjct  138   GIRILSRPRIPVPFPDPSGDYTVLIGDWYKANHTDLQATLDNGHKLPPPDGILINGRG-S  196

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q++F++LD+H+GQ+Y
Sbjct  197   GATINVEQGKTYRLRISNVGLENSLNFRIQGHKMKLVEVEGTHTLQTSFSSLDVHVGQTY  256

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P++YYVV SSRFT+ VLTTT +L Y+NS   V G  PGGPT QI+WSL Q 
Sbjct  257   SVLITADQPPRNYYVVASSRFTNPVLTTTGILSYANSGGSVQGQIPGGPTIQIDWSLNQA  316

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NLSASGPRPNPQGSYHYGM+   RTI L NSA  +NGKQRYAVN VSF+  DTPL
Sbjct  317   RAVRTNLSASGPRPNPQGSYHYGMVNTTRTIRLQNSAGQVNGKQRYAVNSVSFIPADTPL  376

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF++GSIP SP     YLATSVM A+YRSF+EIVF+N E+ VQSWH++GY
Sbjct  377   KLADYFKIGGVFSVGSIPSSPSGSGIYLATSVMGADYRSFIEIVFENTENIVQSWHLNGY  436

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGG W+ ASR +YNLRD V RCT QVYP++WTA+Y+ LDNVGMWN+RSE WAR
Sbjct  437   SFFVVGMDGGTWSPASRNQYNLRDAVFRCTTQVYPKAWTAVYLPLDNVGMWNLRSEFWAR  496

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT++ S RDE PIP+NA  CGRA GR TRPL
Sbjct  497   QYLGQQFYLRVYTTSTSLRDEYPIPRNARTCGRAAGRRTRPL  538



>dbj|BAJ91397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/519 (71%), Positives = 432/519 (83%), Gaps = 1/519 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW +T+GD+YPLGV+Q+ ILINGQFPGPQID VTNDN++INV+N L  PFLLSW
Sbjct  24    DPYRFYTWNVTFGDVYPLGVRQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
              G+QQRR+SWQDGVYGT CP PP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  84    QGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIRV  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG  F
Sbjct  144   LSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGLLINGQGWNGNRF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFR+SNVGI+TS+N RIQGH L LVEVEGSHT+Q+T+++LD+HLGQSYS LV
Sbjct  204   TVDQGKTYRFRVSNVGISTSVNIRIQGHSLLLVEVEGSHTMQNTYSSLDVHLGQSYSFLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS-FTRVSGPPPGGPTTQINWSLFQGRSL  1147
             TADQ P+DY +VVS+RFT+ VL+ TA+LHYSNS     + PPP GPT +I+WSL Q RS+
Sbjct  264   TADQPPQDYTIVVSTRFTNPVLSNTAMLHYSNSNGVPAALPPPPGPTIEIDWSLNQARSI  323

Query  1148  RRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLA  1327
             R NL+ASGPRPNPQGSYHYG++   RT+ LANS   INGK RYAVN VSFV  DTPLK+A
Sbjct  324   RWNLTASGPRPNPQGSYHYGLVNTTRTMRLANSRVTINGKLRYAVNSVSFVPADTPLKVA  383

Query  1328  DYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFF  1507
             D++ I GVF  GS+PDSP  G AYL TSVM +N R +VE+VF+N E  VQSWHIDGY+F+
Sbjct  384   DFYNIQGVFTPGSMPDSPSGGPAYLQTSVMASNMRDYVEVVFENAEGYVQSWHIDGYAFW  443

Query  1508  VVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYL  1687
             VVGMDGGQWT ASR  YNLRD +AR T+QVYP +WTAIYM LDNVGMWN+RSE W RQYL
Sbjct  444   VVGMDGGQWTPASRQNYNLRDAIARYTLQVYPGAWTAIYMPLDNVGMWNVRSESWGRQYL  503

Query  1688  GQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             GQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  504   GQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  542



>ref|XP_010063104.1| PREDICTED: L-ascorbate oxidase homolog [Eucalyptus grandis]
 gb|KCW70294.1| hypothetical protein EUGRSUZ_F03538 [Eucalyptus grandis]
Length=540

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/518 (71%), Positives = 431/518 (83%), Gaps = 0/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             NPYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PFL+SW
Sbjct  23    NPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPFLISW  82

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             +G+QQRRNS++DGVYGTTCPIPP +NFTY+ Q KDQIGS+FYFPSL+ HKAAGG+G IRI
Sbjct  83    SGIQQRRNSYEDGVYGTTCPIPPGRNFTYIFQVKDQIGSFFYFPSLKFHKAAGGFGGIRI  142

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRPLIPVPFA PA D+TVL GDW K ++  L   LD G  L  PDG+LINGRG NG +F
Sbjct  143   LSRPLIPVPFAEPAGDYTVLIGDWYKANHTTLIATLDRGKKLKYPDGILINGRGPNGISF  202

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
              V  G+TYR RISNVG+  S+NFRIQGHK+ LVEVEG+H +Q+ F++LD+H+GQSYSVLV
Sbjct  203   DVQQGKTYRLRISNVGLMNSLNFRIQGHKMLLVEVEGTHVMQTHFSSLDVHVGQSYSVLV  262

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ  +DYY+VVS+RF+S++LTTT +L YSNS   VSGPPPGGPT QI+WSL Q R++R
Sbjct  263   TADQPAQDYYIVVSTRFSSQILTTTGILRYSNSAGPVSGPPPGGPTIQIDWSLNQARAIR  322

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NL+ASGPRPNPQGSYHYG+I P RTI L++SA  +NGKQRYAVN VSF+  DTPLKLAD
Sbjct  323   TNLTASGPRPNPQGSYHYGLITPTRTIRLSSSAGQVNGKQRYAVNSVSFIPADTPLKLAD  382

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YF IGGVF + SI D P  G  YL T+V+  +YR+FVEIVF+N E+ VQSWH+DGYSFFV
Sbjct  383   YFNIGGVFRVNSISDRPTGGGIYLDTAVLGVDYRAFVEIVFENNENIVQSWHLDGYSFFV  442

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGGQWT ASR +YNLRD V R T QVYP SWTAIY+ALDNVGMWN+R+E WAR YLG
Sbjct  443   VGMDGGQWTTASRNQYNLRDAVFRSTTQVYPYSWTAIYVALDNVGMWNLRTEFWARHYLG  502

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ YLRVYT++ S RDE PIPKNALLCGRA+GRHTRP 
Sbjct  503   QQLYLRVYTTSTSLRDEFPIPKNALLCGRAQGRHTRPF  540



>ref|XP_010667350.1| PREDICTED: L-ascorbate oxidase homolog [Beta vulgaris subsp. 
vulgaris]
Length=539

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/522 (69%), Positives = 425/522 (81%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W ITYGDIYPLGV+Q+ ILINGQFPGP I  VTNDN+IINV+N LN PF
Sbjct  18    VVAEDPYRYFNWNITYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNIIINVFNNLNVPF  77

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSW+G+Q RRNS+QDGVYGTTCPIPP +NFTY LQ KDQIGS++YFPSL  HKAAG +G
Sbjct  78    LLSWSGVQNRRNSYQDGVYGTTCPIPPGRNFTYKLQFKDQIGSFYYFPSLAFHKAAGAFG  137

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+TVL GDW K ++  L+ ILD GH LP PDG+LINGRG +
Sbjct  138   GIRILSRPRIPVPFPDPAGDYTVLIGDWYKANHTDLQAILDDGHKLPPPDGILINGRG-S  196

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V  G+TYR RISNVG+  S+NFRIQGHK+KLVEVEG+HT+Q+TF++LD+H+GQ+Y
Sbjct  197   GATINVVQGKTYRLRISNVGLENSLNFRIQGHKMKLVEVEGTHTLQTTFSSLDVHVGQTY  256

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P++YYVV SSRFTS VLTTT +L Y+NS   V G  PGGPT QI+WSL Q 
Sbjct  257   SVLITADQPPRNYYVVASSRFTSPVLTTTGILSYANSGGSVQGKIPGGPTIQIDWSLNQA  316

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NLSASGPRPNPQG+YHYG I   R I L NSA  +NGKQRYAVN VSF+  DTPL
Sbjct  317   RAVRTNLSASGPRPNPQGAYHYGKINITRIIRLQNSAGQVNGKQRYAVNSVSFIPADTPL  376

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKIGGVF++GSIP +P     YLATSVM A++R+F+EIVF+N ED VQSWH+DGY
Sbjct  377   KLADYFKIGGVFSVGSIPSNPSSSGIYLATSVMGADFRNFIEIVFENTEDIVQSWHLDGY  436

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             +FFVVGMDGG W+ A+R +YNLRD   RCT QVYP++WTA+Y+ LDNVGMWN+RSE WAR
Sbjct  437   NFFVVGMDGGTWSPANRNQYNLRDAAFRCTTQVYPKAWTAVYVPLDNVGMWNLRSESWAR  496

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT + S + E  IP NAL CGRA GR TRP+
Sbjct  497   QYLGQQFYLRVYTPSRSLKYEFHIPINALTCGRAAGRRTRPV  538



>ref|XP_006364519.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=541

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/516 (69%), Positives = 426/516 (83%), Gaps = 0/516 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W+ITYGDIYPLG++Q+ ILINGQFPGP I  VTNDNLIINV+N L++PF
Sbjct  26    VVAEDPYRYFDWRITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVHNDLHDPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LL+WNGLQQR+NS++DGVYGTTCPIPP +NFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  86    LLTWNGLQQRKNSFEDGVYGTTCPIPPGQNFTYIMQVKDQIGSFFYFPSLQFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFT+L GDW K  ++ L+ ILD G  L  PDG+ ING G +
Sbjct  146   GIRILSRPRIPVPFPEPAGDFTILIGDWYKTDHKVLQTILDRGKRLTFPDGIQINGLGRD  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+PG+TYR RISNVG+  S+NFRIQGHK+ LVEVEG+HT+Q+T ++LD+H+GQSY
Sbjct  206   GAKFTVEPGKTYRLRISNVGLQNSLNFRIQGHKMTLVEVEGTHTIQTTLSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VSSRFT+++L +TA+LHYSNS   VSG PP GPTT I+WSL Q 
Sbjct  266   SVLVTADQPAQDYYIAVSSRFTTQILNSTAILHYSNSRKTVSGLPPPGPTTDISWSLNQA  325

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I   RTI LAN A  ++ KQRYAVNGVSF+  DTPL
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGQINVTRTIRLANHAGLVDKKQRYAVNGVSFIPADTPL  385

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+ I GVF +GSI D P     +L T+VM A+YR+FVEIVF+N E+ VQSWH+DGY
Sbjct  386   KLADYYNIDGVFKVGSIQDKPAGRKIHLDTAVMGADYRAFVEIVFENRENIVQSWHLDGY  445

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMD G+W+ AS+ +YNL D V+RCT QVYPRSWTAIY+ LDNVGMWN+RS+ WAR
Sbjct  446   SFFVVGMDVGRWSPASKNQYNLIDAVSRCTTQVYPRSWTAIYVPLDNVGMWNLRSQFWAR  505

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARG  1786
             QYLGQQFYLRVYT   S+RDE PIPKNAL CGRA+G
Sbjct  506   QYLGQQFYLRVYTPVKSFRDEYPIPKNALHCGRAKG  541



>ref|XP_004499321.1| PREDICTED: L-ascorbate oxidase homolog [Cicer arietinum]
Length=544

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/522 (70%), Positives = 435/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W ITYGDIYPLG++Q+ ILINGQFPGP I  VTNDNLIINV+N L+ PF
Sbjct  23    VLAEDPYRFFDWNITYGDIYPLGIRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDVPF  82

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGV GTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  83    LISWNGVQQRRNSYEDGVSGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  142

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA D+T+L GDW K ++  L+  LD+G  LP  DG+LINGRG  
Sbjct  143   GIRILSRPRIPVPFDDPAGDYTLLIGDWYKSNHTDLKAQLDNGKKLPFADGILINGRGSG  202

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G +  V+ G+TYR RISNVG+  S+NFRIQ HK KLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  203   GASLNVEQGKTYRLRISNVGLENSLNFRIQNHKFKLVEVEGTHTLQTTYSSLDVHVGQSY  262

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ  +DYY+VVSSRFT+ VLTTT +L YSNS   VSGPPPGGPT QI+WSL Q 
Sbjct  263   SVLLTADQPAQDYYIVVSSRFTNPVLTTTGILRYSNSAGPVSGPPPGGPTIQIDWSLNQA  322

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI   RTI+L++S   +NGKQRYA+N VS++ PDTPL
Sbjct  323   RSIRTNLTASGPRPNPQGSYHYGMINTTRTIILSSSPAQVNGKQRYAINSVSYIAPDTPL  382

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+FKI GV+  GSIPD P  G  YL TSV+  +YR+FVEIVFQN ED +QS+H+DGY
Sbjct  383   KLADFFKISGVYRPGSIPDRPTGGGIYLDTSVLQTDYRTFVEIVFQNDEDILQSYHLDGY  442

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGGQW+ ASR +YNLRD V+R T QVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  443   SFFVVGMDGGQWSPASRNQYNLRDAVSRSTTQVYPKSWTAIYIALDNVGMWNLRSEFWAR  502

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFY+RVYT++ S RDE PIPKNALLCGRA GRHTRPL
Sbjct  503   QYLGQQFYMRVYTTSTSLRDEYPIPKNALLCGRASGRHTRPL  544



>ref|XP_002888337.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64596.1| hypothetical protein ARALYDRAFT_475543 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/523 (68%), Positives = 428/523 (82%), Gaps = 1/523 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
              V   +PYR++ W +TYGDIYPLGV+Q+ ILING+FPGP I  VTNDNLIINV+N L+EP
Sbjct  22    AVTAESPYRFFDWNVTYGDIYPLGVRQQGILINGKFPGPDIHSVTNDNLIINVHNSLDEP  81

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FL+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+
Sbjct  82    FLISWNGIQNRRNSYVDGMYGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGF  141

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  
Sbjct  142   GGIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKSRLDRGRKLPPPDGILINGRS-  200

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
             NG T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQS
Sbjct  201   NGATLNVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQS  260

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             YSVL+TADQ P+ YYVVVSSRFT +++T+T VL YS S T  SGP PGGPT Q++WSL Q
Sbjct  261   YSVLITADQSPRAYYVVVSSRFTDKIITSTGVLRYSGSSTPASGPIPGGPTIQVDWSLNQ  320

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY VN VSFV  DTP
Sbjct  321   ARAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTP  380

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLAD+FKI GV+ + SI D P +G  YL TSV+  +YR+F+EIVF+N ED VQS+H++G
Sbjct  381   LKLADFFKISGVYKINSISDKPTYGGLYLDTSVLQVDYRTFIEIVFENQEDIVQSYHLNG  440

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WA
Sbjct  441   YSFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWA  500

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRV+TS+ S RDE PIPKN+ LCGRARGRHTRPL
Sbjct  501   RQYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCGRARGRHTRPL  543



>emb|CDY35790.1| BnaA08g04510D [Brassica napus]
Length=542

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/522 (68%), Positives = 427/522 (82%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22    VTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82    LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  N
Sbjct  142   GIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDGILINGRS-N  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQSY
Sbjct  201   GATLNVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSLDVHVGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P+DYYVV SSRFT +++TTT +L YS S T  SGP PGGPT QI+WSL Q 
Sbjct  261   SVLITADQSPRDYYVVASSRFTDKIITTTGILRYSGSSTSASGPIPGGPTIQIDWSLNQA  320

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY +N VSFV  DTPL
Sbjct  321   RAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVSFVPADTPL  380

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+FKI GV+ + SI D P  G  YL TSV+  +YR+F+EIVF+N E+ VQS+H++GY
Sbjct  381   KLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKENIVQSYHLNGY  440

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  441   SFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWAR  500

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRV+T++ S RDE PIPKN+ LCGRA+GRHTRPL
Sbjct  501   QYLGQQLYLRVFTTSTSLRDEYPIPKNSRLCGRAKGRHTRPL  542



>ref|XP_006342102.1| PREDICTED: L-ascorbate oxidase homolog [Solanum tuberosum]
Length=540

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/524 (70%), Positives = 435/524 (83%), Gaps = 1/524 (0%)
 Frame = +2

Query  233   NGVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNE  412
             N +   +PYRY+ W +TYG IYPLGV Q+ ILINGQFPGP I+ VTNDNL+IN++N L+E
Sbjct  18    NSIVAEDPYRYFDWNVTYGTIYPLGVPQQGILINGQFPGPDINSVTNDNLVINIHNSLDE  77

Query  413   PFLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGG  592
             PFLLSWNG+Q RRNS+ DGVYGTTCPIPP +N T+ LQ KDQIGS++YFPSL  HKAAGG
Sbjct  78    PFLLSWNGVQNRRNSFVDGVYGTTCPIPPGRNNTFNLQVKDQIGSFYYFPSLAFHKAAGG  137

Query  593   YGAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRG  772
             +G IRI SRP IPVPF  PA D+T+L GDW K+++  L+ ILD G  LP PDG+LINGRG
Sbjct  138   FGGIRILSRPRIPVPFPDPANDYTILIGDWYKKNHTDLKTILDGGRKLPFPDGILINGRG  197

Query  773   WNGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQ  952
              NG TFTVD G+TYR RISNVG+  S+NFR++GHK+ LVEVEG+HT+Q+T+++LD+H+GQ
Sbjct  198   PNGVTFTVDQGKTYRLRISNVGLQNSLNFRVEGHKMTLVEVEGTHTLQTTYSSLDVHVGQ  257

Query  953   SYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLF  1132
             SYSVL+TA+Q+ KD+Y+VVSSRFT+ VLTTTAVLHYS+S T VSGPPPGGPT QI+WSL 
Sbjct  258   SYSVLITANQEAKDHYIVVSSRFTTPVLTTTAVLHYSSSNTPVSGPPPGGPTIQIDWSLN  317

Query  1133  QGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDT  1312
             Q RS+R NLSASGPRPNPQGSYHYGMI   +TI LA+SA  +NGKQRYAVN VSFV  DT
Sbjct  318   QARSIRTNLSASGPRPNPQGSYHYGMINTTKTIRLASSAGQVNGKQRYAVNSVSFVPLDT  377

Query  1313  PLKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHID  1492
             PLKL DYFKIGG F +GSI DSP  G  Y  TSV+  +YR FVEI+F+N ED VQSWH+D
Sbjct  378   PLKLLDYFKIGG-FRVGSIQDSPTGGGIYQDTSVLGVDYRQFVEIIFENNEDIVQSWHLD  436

Query  1493  GYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDW  1672
             GYSF+VVGMDGGQWT+ASR  YNLRD V+RCT QVYP+SWTAIY+ALDNVGMWN+R+E W
Sbjct  437   GYSFWVVGMDGGQWTQASRDGYNLRDAVSRCTAQVYPKSWTAIYIALDNVGMWNLRTEFW  496

Query  1673  ARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             ARQYLGQQ Y+RVYT + S RDE PIP+ A LCG+   RHTRPL
Sbjct  497   ARQYLGQQLYVRVYTDSTSLRDEYPIPRGARLCGKVADRHTRPL  540



>emb|CDY67479.1| BnaCnng55180D [Brassica napus]
Length=541

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/522 (68%), Positives = 427/522 (82%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  21    VTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81    LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  N
Sbjct  141   GIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDGILINGRS-N  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQSY
Sbjct  200   GATLNVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P+DYYVV SSRFT +++TTT +L YS S T  SGP PGGPT QI+WSL Q 
Sbjct  260   SVLITADQSPRDYYVVASSRFTDKIITTTGILRYSGSSTSASGPIPGGPTIQIDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY +N VSFV  DTPL
Sbjct  320   RAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVSFVPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+FKI GV+ + SI D P  G  YL TSV+  +YR+F+EIVF+N E+ VQS+H++GY
Sbjct  380   KLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKENIVQSYHLNGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  440   SFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRV+T++ S RDE PIPKN+ LCGRA+GRHTRPL
Sbjct  500   QYLGQQLYLRVFTTSTSLRDEYPIPKNSRLCGRAKGRHTRPL  541



>dbj|BAK00459.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/519 (71%), Positives = 431/519 (83%), Gaps = 1/519 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+YTW +T+GD+YPLGVKQ+ ILINGQFPGPQID VTNDN++INV+N L  PFLLSW
Sbjct  24    DPYRFYTWNVTFGDVYPLGVKQQGILINGQFPGPQIDAVTNDNIVINVFNNLPAPFLLSW  83

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
              G+QQRR+SWQDGVYGT CP PP  NFTY +Q KDQIGSY+YFPSL  HKAAGGYG IR+
Sbjct  84    QGIQQRRSSWQDGVYGTNCPTPPGGNFTYNMQFKDQIGSYYYFPSLAFHKAAGGYGGIRV  143

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF PPA DFT+LAGDW K ++  L+ ILDSG++LP PDGLLING+GWNG  F
Sbjct  144   LSRPRIPVPFDPPAGDFTILAGDWFKLNHTDLKGILDSGNDLPFPDGLLINGQGWNGNRF  203

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TVD G+TYRFR+SNVGI+TS+N RIQGH L LVEVEGSHT+Q+T+++LD+HLGQSYS LV
Sbjct  204   TVDQGKTYRFRVSNVGISTSVNIRIQGHSLLLVEVEGSHTMQNTYSSLDVHLGQSYSFLV  263

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNS-FTRVSGPPPGGPTTQINWSLFQGRSL  1147
             TADQ P+DY +VVS+RFT+ VL+ TA+LHYSNS     + PPP GPT +I+WSL Q RS+
Sbjct  264   TADQPPQDYTIVVSTRFTNPVLSNTAMLHYSNSNGVPAALPPPPGPTIEIDWSLNQARSI  323

Query  1148  RRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLA  1327
             R NL+ASGPRPNPQGSYHYG++   RT+ LANS   INGK RYAVN VSFV  DTPLK+A
Sbjct  324   RWNLTASGPRPNPQGSYHYGLVNTTRTMRLANSRVTINGKLRYAVNSVSFVPADTPLKVA  383

Query  1328  DYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFF  1507
             D++ I GVF  GS+PDSP  G AYL TSVM +N R +VE+VF+N E  VQSWHI GY+F+
Sbjct  384   DFYNIQGVFTPGSMPDSPSGGPAYLQTSVMASNMRDYVEVVFENAEGYVQSWHIGGYAFW  443

Query  1508  VVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYL  1687
             VVGMDGGQWT ASR  YNLRD +AR T+QVYP +WTAIYM LDNVGMWN+RSE W RQYL
Sbjct  444   VVGMDGGQWTPASRQNYNLRDAIARYTLQVYPGAWTAIYMPLDNVGMWNVRSESWGRQYL  503

Query  1688  GQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             GQQFYLRVY+  NS+RDE PIPKNALLCGRA GR TRPL
Sbjct  504   GQQFYLRVYSPANSWRDENPIPKNALLCGRASGRRTRPL  542



>ref|XP_009107631.1| PREDICTED: L-ascorbate oxidase homolog [Brassica rapa]
Length=542

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/522 (68%), Positives = 427/522 (82%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22    VTAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+Q RRNS+ DG+YGTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82    LISWNGVQNRRNSYVDGMYGTTCPIPPRTNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  N
Sbjct  142   GIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKARLDRGRKLPSPDGILINGRS-N  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQSY
Sbjct  201   GATLNVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTMQTMFSSLDVHVGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P+DYYVV SSRFT +++TTT +L YS S T  SGP PGGPT QI+WSL Q 
Sbjct  261   SVLITADQSPRDYYVVASSRFTGKIITTTGILRYSGSSTSASGPIPGGPTIQIDWSLNQA  320

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY +N VSFV  DTPL
Sbjct  321   RAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGINSVSFVPADTPL  380

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+FKI GV+ + SI D P  G  YL TSV+  +YR+F+EIVF+N E+ VQS+H++GY
Sbjct  381   KLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKENIVQSYHLNGY  440

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  441   SFWVVGMDGGQWNTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWAR  500

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRV+T++ S RDE PIPKN+ LCGRA+GRHTRPL
Sbjct  501   QYLGQQLYLRVFTTSTSLRDEYPIPKNSRLCGRAKGRHTRPL  542



>ref|XP_010101299.1| L-ascorbate oxidase-like protein [Morus notabilis]
 gb|EXB88234.1| L-ascorbate oxidase-like protein [Morus notabilis]
Length=541

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/523 (71%), Positives = 434/523 (83%), Gaps = 1/523 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYG IYPLGV+Q+ ILINGQFPGP I  VTNDNLIINVYN L+EPF
Sbjct  19    VRAEDPYRFFDWNVTYGFIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVYNSLDEPF  78

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LLSWNG+Q RRNS++DGVYGTTCPIPP KNFTY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  79    LLSWNGIQNRRNSFEDGVYGTTCPIPPGKNFTYILQVKDQIGSFYYFPSLAFHKAAGGFG  138

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  P+ D+T+L GDW K ++  L+  LD G  LP PDG+L+NGRG N
Sbjct  139   GIRILSRPRIPVPFPDPSGDYTILIGDWYKTNHTDLKDHLDGGKKLPFPDGILVNGRGPN  198

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             GY+ TV+ G+TYR RISNVG+  S+NFRIQ HKLKLVEVEG+HT+Q+T+++LD+H+GQSY
Sbjct  199   GYSLTVEQGKTYRLRISNVGLQHSLNFRIQNHKLKLVEVEGTHTLQTTYSSLDVHVGQSY  258

Query  959   SVLVTADQQPKDYYVVVSSRFTS-RVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
             SVL TADQ  +DYY+VVS+RFT+  VLTTT VLHYSNS   VSGPPPGGPT QI+WSL Q
Sbjct  259   SVLFTADQPGQDYYIVVSTRFTAPEVLTTTGVLHYSNSAGPVSGPPPGGPTIQIDWSLNQ  318

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+ASGPRPNPQGSYHYG+I   +T +L++SA  IN KQRY  N VSFV  DTP
Sbjct  319   ARSIRTNLTASGPRPNPQGSYHYGLINLTKTYILSSSAGQINDKQRYGFNSVSFVPADTP  378

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADY+ IGGVF +GSI D P  G+ YL T+V+ A+YR+FVE VFQN ED VQS H+DG
Sbjct  379   LKLADYYNIGGVFRVGSISDRPYGGALYLDTAVLGADYRAFVEFVFQNDEDIVQSLHLDG  438

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFVVGMDGGQWTE+SR +YNLRD V+RCT QVYP SWTAIY+ALDNVGMWN+RSE WA
Sbjct  439   YSFFVVGMDGGQWTESSRNQYNLRDAVSRCTTQVYPNSWTAIYVALDNVGMWNLRSEFWA  498

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             RQYLGQQ YLRVYT++ S RDE PIPKNA LCG+A GRHTRPL
Sbjct  499   RQYLGQQLYLRVYTTSTSLRDEYPIPKNARLCGKASGRHTRPL  541



>gb|EYU36818.1| hypothetical protein MIMGU_mgv1a004264mg [Erythranthe guttata]
Length=536

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/522 (68%), Positives = 425/522 (81%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W ITYG IYPLG+ Q+ ILINGQFPGP+I  VTNDN+I+NV+N L++PF
Sbjct  15    VAAEDPYRFFNWNITYGTIYPLGIAQQGILINGQFPGPEIYSVTNDNIIVNVFNSLDQPF  74

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+ WNG+Q RRNS++DGVYGTTCPIP   NFTY+LQ KDQIGS+FYFPSL  HKAAG +G
Sbjct  75    LIHWNGIQNRRNSYEDGVYGTTCPIPAGGNFTYILQMKDQIGSFFYFPSLGFHKAAGAFG  134

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AI+I SRPLIPVPF  P  DF+VL GDW   ++  L+ ILD G+ LP PDG+LINGRG N
Sbjct  135   AIKILSRPLIPVPFDNPTDDFSVLIGDWYTSNHTDLKAILDKGNKLPFPDGILINGRGPN  194

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
               +FT+  G+TYRFRI NVG+  S+NFRIQGHK+K+VEVEG+HTVQ ++++LDIH+GQ  
Sbjct  195   VTSFTIQQGKTYRFRICNVGLQNSLNFRIQGHKMKVVEVEGTHTVQVSYSSLDIHVGQCM  254

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQQP+DYY+VVSSRFT+ VL+TT  L Y+ S     GP PGGPT +++WSL Q 
Sbjct  255   SVLLTADQQPQDYYIVVSSRFTTPVLSTTGFLRYAGSNRPALGPLPGGPTIEVDWSLNQA  314

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYGMI   RT  L++SA  +  KQRYA+N VSF+  DTPL
Sbjct  315   RSIRTNLTASGPRPNPQGSYHYGMINTTRTYRLSSSAGQVANKQRYALNSVSFIPADTPL  374

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             K+ADYFKI GVF +GSI DSP  G  YL TSV+ A+YR+FVEIVF+N ED VQS+H+ GY
Sbjct  375   KVADYFKIDGVFRVGSISDSPTGGGIYLDTSVLGADYRAFVEIVFENTEDIVQSYHLSGY  434

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGG+WT  SR +YNLRD V+RCTVQVYP SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  435   SFFVVGMDGGKWTSDSRAQYNLRDAVSRCTVQVYPMSWTAIYVALDNVGMWNLRSEFWAR  494

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRVYT++ S RDE PIPKNALLCGRA GR TRPL
Sbjct  495   QYLGQQTYLRVYTTSTSLRDEYPIPKNALLCGRASGRRTRPL  536



>gb|ABK25092.1| unknown [Picea sitchensis]
 gb|ACN40425.1| unknown [Picea sitchensis]
Length=539

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/522 (69%), Positives = 426/522 (82%), Gaps = 2/522 (0%)
 Frame = +2

Query  236   GVYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEP  415
             GV   + Y+Y+TW +TYG IYP+GV Q+ ILINGQFPGPQ++ VTNDN+IINV+NYLNEP
Sbjct  20    GVRTEDAYKYFTWTVTYGTIYPMGVPQQGILINGQFPGPQLNVVTNDNVIINVFNYLNEP  79

Query  416   FLLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGY  595
             FLLSWNG+QQRRNSWQDGV GT+CPIPPR+NFTY  QAKDQIG+YFYFPS  +HKAAGG+
Sbjct  80    FLLSWNGIQQRRNSWQDGVLGTSCPIPPRRNFTYKFQAKDQIGTYFYFPSTLLHKAAGGF  139

Query  596   GAIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGW  775
             G + I SR +I +P+  PA ++T L GDW K ++  L   LDSG  L +P+G+ INGRG 
Sbjct  140   GGLAIASRSVISIPYPTPAGEYTALIGDWYKTNHAVLRRWLDSGRALGMPNGVHINGRGK  199

Query  776   NGYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQS  955
                TF VDPGRTYR RISNVG++TS+NFRIQGHK+KLVEVEGSHTVQ+ + +LD+H+GQS
Sbjct  200   GLSTFKVDPGRTYRLRISNVGLSTSLNFRIQGHKMKLVEVEGSHTVQNVYDSLDLHVGQS  259

Query  956   YSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQ  1135
              SVL+TADQ PKDYY+V S+RFT+ VL   A+L YSNS    SGP P GPTTQI+WSL Q
Sbjct  260   CSVLITADQAPKDYYIVASTRFTNPVLYGVALLRYSNSRQPASGPLPPGPTTQIDWSLSQ  319

Query  1136  GRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTP  1315
              RS+R NL+A+  RPNPQGSYHYG+IKPARTI LANSAP INGKQRYAVNGVSF+ PDTP
Sbjct  320   ARSIRWNLTANAARPNPQGSYHYGLIKPARTITLANSAPIINGKQRYAVNGVSFMPPDTP  379

Query  1316  LKLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDG  1495
             LKLADYFKI GVFNLG+I D PR G  YL T+VM   +RSF+EIVFQN E+T+QSWHIDG
Sbjct  380   LKLADYFKIQGVFNLGTISDYPRGGGGYLQTAVMSGQFRSFIEIVFQNDENTIQSWHIDG  439

Query  1496  YSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWA  1675
             YSFFV GMDGGQW+ ASR  YNL D V+R T QVYP SWTA+ + LDN GMWN+RSE WA
Sbjct  440   YSFFVAGMDGGQWSPASRKGYNLFDAVSRSTTQVYPNSWTAVLLMLDNAGMWNVRSEIWA  499

Query  1676  RQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRP  1801
             RQYLGQQFY++V  +  + +DE  +P+NAL+CGRARGRHTRP
Sbjct  500   RQYLGQQFYMKV--AGFAGQDEYIVPRNALMCGRARGRHTRP  539



>ref|XP_006307199.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
 gb|EOA40097.1| hypothetical protein CARUB_v10008790mg [Capsella rubella]
Length=541

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/522 (68%), Positives = 427/522 (82%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR++ W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNL+INV+N L+EPF
Sbjct  21    VIAESPYRFFDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLVINVHNSLDEPF  80

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+Q RRNS+ DG+ GTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  81    LISWNGVQNRRNSFVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  140

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR  +
Sbjct  141   GIRILSRPGIPVPFADPAGDYTVLIGDWYKSNHTDLKSRLDRGRKLPSPDGILINGRS-S  199

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LD+H+GQSY
Sbjct  200   GATINVEQGKTYRLRISNVGLQDSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDVHVGQSY  259

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P+DYYVVVSSRFT++++TTT VL YS S T  SG  PGGPT Q++WSL Q 
Sbjct  260   SVLITADQSPRDYYVVVSSRFTNKIITTTGVLRYSGSSTPASGQLPGGPTIQVDWSLNQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY VN VSFV  DTPL
Sbjct  320   RAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVPADTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GV+ + SI D P  G  YL TSV+  +YR+F+EIVF+N ED VQS+H++GY
Sbjct  380   KLADYFKISGVYKVNSISDKPTGGGLYLDTSVLQVDYRTFIEIVFENKEDIVQSYHLNGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  440   SFWVVGMDGGQWRTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWAR  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRV+T++ S RDE PIP+N+ LCGRARGRHTRPL
Sbjct  500   QYLGQQLYLRVFTTSTSLRDEYPIPRNSRLCGRARGRHTRPL  541



>gb|KHN44868.1| L-ascorbate oxidase like [Glycine soja]
Length=490

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/494 (74%), Positives = 422/494 (85%), Gaps = 4/494 (1%)
 Frame = +2

Query  308   VKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSWNGLQQRRNSWQDGVYGTTC  487
             +KQ+ ILINGQFPGPQI+ VTNDNLI++V+N L+EPFL+SWNG+QQRRNSWQDGVYGT C
Sbjct  1     MKQQGILINGQFPGPQIESVTNDNLILHVFNSLDEPFLISWNGVQQRRNSWQDGVYGTNC  60

Query  488   PIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRIYSRPLIPVPFAPPARDFTV  667
             PIPP KNFTY+LQ KDQIGSYFYFPSL  HKAAGGYG  +I SR +IPVPF PPA DFT+
Sbjct  61    PIPPGKNFTYVLQVKDQIGSYFYFPSLAFHKAAGGYGGFKIASRSVIPVPFPPPAGDFTI  120

Query  668   LAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTFTVDPGRTYRFRISNVGIAT  847
             LAGDW KR++  L  ILD G +LP PDGL+INGRG N Y FTVD G+TYRFRISNVG+ T
Sbjct  121   LAGDWYKRNHTDLRAILDGGSDLPFPDGLIINGRGSNAYAFTVDQGKTYRFRISNVGLTT  180

Query  848   SINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTS  1027
             SINFRIQGHK+ LVEVEG HT+Q+T+ +LDIHLGQSYSVLVTADQ P+DYY+VVS+RFTS
Sbjct  181   SINFRIQGHKMLLVEVEGIHTLQNTYDSLDIHLGQSYSVLVTADQPPQDYYIVVSTRFTS  240

Query  1028  RVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYG  1207
             +VLT T++LHYSNS T VS PPPGGPTTQI+WSL Q RSLRRNL+ASGPRPNPQGSYHYG
Sbjct  241   QVLTATSILHYSNSPTSVSSPPPGGPTTQIDWSLDQARSLRRNLTASGPRPNPQGSYHYG  300

Query  1208  MIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPRW  1387
             +I   RT+ L NSA  INGKQRYAVN VSF+  DTPLKLADYFKI GVFNLGSIP++P  
Sbjct  301   LINTTRTVRLQNSAGIINGKQRYAVNSVSFIPADTPLKLADYFKIPGVFNLGSIPENPTG  360

Query  1388  GSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLR  1567
                YL    + A++R + EIVF+N EDTVQSWH+DG+ F+VVGMDGGQW+ +SR+ YNLR
Sbjct  361   SDCYL----LAADFRGYAEIVFENPEDTVQSWHVDGHHFYVVGMDGGQWSTSSRSNYNLR  416

Query  1568  DTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELP  1747
             DT++RCTVQVYP+SWTA+YM LDNVGMWN+RSE+WARQYLGQQFY+ VY+  NS+RDE P
Sbjct  417   DTISRCTVQVYPKSWTAVYMPLDNVGMWNVRSENWARQYLGQQFYIGVYSPANSWRDEYP  476

Query  1748  IPKNALLCGRARGR  1789
             IP NALLCGRA G 
Sbjct  477   IPSNALLCGRAIGH  490



>dbj|BAC83966.1| putative PS60 [Oryza sativa Japonica Group]
Length=563

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/542 (69%), Positives = 443/542 (82%), Gaps = 20/542 (4%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V G +PYR++TW +TYGDI PLGVKQ+ ILINGQFPGP I+ VTNDNLIINV+N LN+PF
Sbjct  22    VAGDDPYRFFTWTVTYGDITPLGVKQQGILINGQFPGPTIEAVTNDNLIINVFNKLNDPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+QQRRNS++DGV GTTCPIPP  NFTY+LQ KDQIG+YFYFPSL  HKAAGG+G
Sbjct  82    LISWNGIQQRRNSFEDGVAGTTCPIPPGGNFTYILQVKDQIGTYFYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIR+ SRP+IPVPF PPA D+ +L GDW K ++  L+Y+LDSG  L  PDGLLINGR W+
Sbjct  142   AIRVLSRPMIPVPFPPPAADYPLLIGDWYKANHTDLKYMLDSGKALGFPDGLLINGRSWD  201

Query  779   GYTFTV-----------------DPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSH  907
             GYTF V                 + GRTYRFRISNVG++TS+N R QGH + LVEVEGSH
Sbjct  202   GYTFNVQQGKIPCFSKIFVLKTKNAGRTYRFRISNVGLSTSLNIRFQGHTMTLVEVEGSH  261

Query  908   TVQSTFTNLDIHLGQSYSVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSG  1087
             T+Q+T+++LD+HLGQSYSVL+TADQ   DY VVVS+RFTS++++TTAVL YS S  +   
Sbjct  262   TMQTTYSSLDVHLGQSYSVLLTADQPAYDYAVVVSTRFTSKIISTTAVLRYSGSGGKSPA  321

Query  1088  PPPGGPTTQINWSLFQGRSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGK  1267
               PGGPT QI+WSL Q RS+R NL+ASGPRPNPQGSYHYGM+   RTI LA+S+  +NGK
Sbjct  322   ALPGGPTIQIDWSLNQARSIRWNLTASGPRPNPQGSYHYGMVTTTRTIRLASSSATVNGK  381

Query  1268  QRYAVNGVSFVNPDTPLKLADYFKIGGVFNLGSIPDSPR---WGSAYLATSVMDANYRSF  1438
             QRY+VNGVS VNPDTPLK+ADY+KI GVF++G+I DSP     G AYL T+VM A+YR +
Sbjct  382   QRYSVNGVSHVNPDTPLKVADYYKIAGVFSVGTISDSPSGGGGGGAYLQTAVMGASYRDY  441

Query  1439  VEIVFQNWEDTVQSWHIDGYSFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTA  1618
             VEIVF+N E+ VQSWHIDGY+F+VVGMDGG+W+ ASR  YNLRD V+R TVQVYP SWTA
Sbjct  442   VEIVFENPENEVQSWHIDGYAFWVVGMDGGKWSSASRQGYNLRDAVSRYTVQVYPNSWTA  501

Query  1619  IYMALDNVGMWNIRSEDWARQYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTR  1798
             IYM LDNVGMWN+RSE+WARQYLGQQFYLRV+TS+ S+RDE PIPKNALLCGRA GR TR
Sbjct  502   IYMPLDNVGMWNVRSENWARQYLGQQFYLRVWTSSTSWRDEYPIPKNALLCGRAAGRRTR  561

Query  1799  PL  1804
             PL
Sbjct  562   PL  563



>ref|XP_010500092.1| PREDICTED: L-ascorbate oxidase homolog [Camelina sativa]
Length=542

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/522 (69%), Positives = 427/522 (82%), Gaps = 1/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYR+Y W +TYGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L+EPF
Sbjct  22    VTAESPYRFYDWNVTYGDIYPLGVRQQGILINGQFPGPDIHSVTNDNLIINVHNSLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SWNG+Q RRNS+ DG+ GTTCPIPPR N+TY+LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82    LISWNGVQNRRNSYVDGMSGTTCPIPPRSNYTYILQVKDQIGSFYYFPSLAFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPFA PA D+TVL GDW K ++  L+  LD G  LP PDG+LINGR + 
Sbjct  142   GIRILSRPGIPVPFADPAGDYTVLIGDWYKTNHTDLKSRLDRGRKLPSPDGILINGRSY-  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  V+ G+TYR RISNVG+  S+NFRIQ H++KLVEVEG+HT+Q+ F++LDIH+GQSY
Sbjct  201   GATINVEQGKTYRLRISNVGLQNSLNFRIQNHRMKLVEVEGTHTLQTMFSSLDIHVGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ P+DYYVVVSSRFT +++TTT VL YS S    SGP PGGPT Q++WSL Q 
Sbjct  261   SVLITADQSPRDYYVVVSSRFTDKIITTTGVLRYSGSSASASGPIPGGPTIQVDWSLNQA  320

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R++R NL+ASGPRPNPQGSYHYG+I   RTI+  +SA  INGKQRY VN VSFV+ DTPL
Sbjct  321   RAIRTNLTASGPRPNPQGSYHYGLIPLIRTIVFGSSAGQINGKQRYGVNSVSFVSSDTPL  380

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLAD+FKI GV+ + SI D P  G  YL TSV+  +YR+F+EI+F+N ED VQS+H++GY
Sbjct  381   KLADFFKISGVYKINSISDKPTGGGLYLDTSVLQVDYRTFIEIIFENKEDIVQSYHLNGY  440

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SF+VVGMDGGQW   SR  YNLRD V+R TVQVYP+SWTAIY+ALDNVGMWN+RSE WAR
Sbjct  441   SFWVVGMDGGQWKTGSRNGYNLRDAVSRSTVQVYPKSWTAIYIALDNVGMWNLRSEFWAR  500

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQ YLRV+TS+ S RDE PIPKN+ LCGRARGRHTRPL
Sbjct  501   QYLGQQLYLRVFTSSTSLRDEYPIPKNSRLCGRARGRHTRPL  542



>ref|XP_009630902.1| PREDICTED: L-ascorbate oxidase homolog isoform X3 [Nicotiana 
tomentosiformis]
Length=543

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/522 (69%), Positives = 433/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             +   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L +PF
Sbjct  22    IVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  82    LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFT+L GDW K  ++ L+ +LD G  L  P+G+ ING G +
Sbjct  142   GIRILSRPRIPVPFLEPAGDFTILIGDWYKTDHKALQTVLDRGKMLKFPNGIQINGLGPD  201

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+PG+TYR RISNVG+  ++N RIQGHK+KL+EVEG+HT+Q+T ++LD+H+GQSY
Sbjct  202   GAKFTVEPGKTYRLRISNVGLQNTLNLRIQGHKMKLIEVEGTHTIQTTLSSLDVHVGQSY  261

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VSSRFT+++L +TA+LHYSNS   VSGPPP GPTT I+WSL Q 
Sbjct  262   SVLVTADQPAQDYYIAVSSRFTTQILNSTAILHYSNSQKTVSGPPPPGPTTDISWSLNQA  321

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I  +RTI LANSA  ++ KQRYAVNGVSF+  DTPL
Sbjct  322   RSIRTNLTASGPRPNPQGSYHYGQINVSRTIRLANSAGLVDKKQRYAVNGVSFIPADTPL  381

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+KI GVF +GSIPD P     +L T+VM A+YRSFVEIVF+N E+ +QSWH+DGY
Sbjct  382   KLADYYKIKGVFEVGSIPDQPTGRHIHLNTAVMGADYRSFVEIVFENRENIMQSWHLDGY  441

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMD G+W+ AS+ +YNL D V+RCT QVYPRSWTAIY+ LDNVGMWN+R++ WAR
Sbjct  442   SFFVVGMDEGRWSHASKNQYNLIDAVSRCTTQVYPRSWTAIYIPLDNVGMWNLRTQFWAR  501

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT   S+RDE PIPKNAL CGRARGR  R L
Sbjct  502   QYLGQQFYLRVYTPVQSFRDEYPIPKNALHCGRARGRAIRAL  543



>ref|XP_009612547.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana tomentosiformis]
Length=539

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/518 (68%), Positives = 424/518 (82%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+Y + +TYG I PLGVKQ+ ILINGQFPGP I  VTNDN+IINV+NYL+EPFL+SW
Sbjct  23    SPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLISW  82

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS++DGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPS   HKAAGG+G  RI
Sbjct  83    NGIQNRRNSFEDGVWGTTCPIPPGKNFTYILQVKDQIGSFYYFPSTAFHKAAGGFGGFRI  142

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA DFTVL GDW K ++  L+ ILD  H LP  DG+LING+G NG +F
Sbjct  143   LSRPGIPVPFPEPAGDFTVLIGDWYKSNHTYLKSILDRNHKLPFVDGILINGQGRNGASF  202

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RI NVG+  S+NFRIQ HK+KLVEVEG+HT+Q  +++LD+H+GQ YSVL 
Sbjct  203   TVEQGKTYRLRICNVGLEHSLNFRIQDHKMKLVEVEGTHTMQEIYSSLDVHVGQCYSVLF  262

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ PKDYY+V S+RF+S ++ TTAVLHYSNS  +VSG PPGGPT +I WSL+Q RS+R
Sbjct  263   TADQPPKDYYIVASNRFSSILIDTTAVLHYSNSNQQVSGFPPGGPTIEIGWSLYQARSIR  322

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NLSASGPRPNPQGSYHYGMI   RTI LANSA  +NGKQRYAVN VSFV  DTPLKL D
Sbjct  323   TNLSASGPRPNPQGSYHYGMINTTRTIRLANSAGQVNGKQRYAVNSVSFVPTDTPLKLVD  382

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGG F +G+IPD+P  G  +L TSV+  +YR+F+EIVF+N E  +QSWH++GY+F+V
Sbjct  383   YFKIGG-FTVGNIPDTPPGGRIHLDTSVLQTDYRTFIEIVFENKEGIMQSWHLNGYAFWV  441

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR +YNLRD V+R T+QVYP+SWTAI +ALDNVG+WN+RSE WARQYLG
Sbjct  442   VGMDGGKWTPASRNQYNLRDAVSRSTIQVYPKSWTAILIALDNVGLWNLRSEFWARQYLG  501

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ Y+ VYT + S RD  PIP NALLCG+  GRH RPL
Sbjct  502   QQLYMNVYTESTSLRDVYPIPINALLCGKVAGRHKRPL  539



>ref|XP_009630899.1| PREDICTED: L-ascorbate oxidase homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=547

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/522 (69%), Positives = 433/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L +PF
Sbjct  26    VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPF  85

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  86    LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  145

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFT+L GDW K  ++ L+ +LD G  L  P+G+ ING G +
Sbjct  146   GIRILSRPRIPVPFLEPAGDFTILIGDWYKTDHKALQTVLDRGKMLKFPNGIQINGLGPD  205

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+PG+TYR RISNVG+  ++N RIQGHK+KL+EVEG+HT+Q+T ++LD+H+GQSY
Sbjct  206   GAKFTVEPGKTYRLRISNVGLQNTLNLRIQGHKMKLIEVEGTHTIQTTLSSLDVHVGQSY  265

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VSSRFT+++L +TA+LHYSNS   VSGPPP GPTT I+WSL Q 
Sbjct  266   SVLVTADQPAQDYYIAVSSRFTTQILNSTAILHYSNSQKTVSGPPPPGPTTDISWSLNQA  325

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I  +RTI LANSA  ++ KQRYAVNGVSF+  DTPL
Sbjct  326   RSIRTNLTASGPRPNPQGSYHYGQINVSRTIRLANSAGLVDKKQRYAVNGVSFIPADTPL  385

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+KI GVF +GSIPD P     +L T+VM A+YRSFVEIVF+N E+ +QSWH+DGY
Sbjct  386   KLADYYKIKGVFEVGSIPDQPTGRHIHLNTAVMGADYRSFVEIVFENRENIMQSWHLDGY  445

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMD G+W+ AS+ +YNL D V+RCT QVYPRSWTAIY+ LDNVGMWN+R++ WAR
Sbjct  446   SFFVVGMDEGRWSHASKNQYNLIDAVSRCTTQVYPRSWTAIYIPLDNVGMWNLRTQFWAR  505

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT   S+RDE PIPKNAL CGRARGR  R L
Sbjct  506   QYLGQQFYLRVYTPVQSFRDEYPIPKNALHCGRARGRAIRAL  547



>ref|XP_009803721.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=558

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/518 (68%), Positives = 422/518 (81%), Gaps = 1/518 (0%)
 Frame = +2

Query  251   NPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPFLLSW  430
             +PYR+Y + +TYG I PLGVKQ+ ILINGQFPGP I  VTNDN+IINV+NYL+EPFL+SW
Sbjct  42    SPYRFYEFNVTYGTISPLGVKQKGILINGQFPGPDIYSVTNDNVIINVFNYLDEPFLISW  101

Query  431   NGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYGAIRI  610
             NG+Q RRNS+QDGV+GTTCPIPP KNFTY+LQ KDQIGS++YFPS   HKAAGG+G  RI
Sbjct  102   NGIQNRRNSFQDGVWGTTCPIPPGKNFTYVLQVKDQIGSFYYFPSTAFHKAAGGFGGFRI  161

Query  611   YSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWNGYTF  790
              SRP IPVPF  PA DFTVL GDW K ++  L+ ILD  H LP  DG+LING+G NG +F
Sbjct  162   LSRPGIPVPFPEPAGDFTVLIGDWYKSNHTYLKSILDRNHKLPFVDGILINGQGRNGASF  221

Query  791   TVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSYSVLV  970
             TV+ G+TYR RI NVG+  S+NFRIQ HK+ LVEVEG+HT+Q  +++LD+H+GQ YSVL 
Sbjct  222   TVEQGKTYRLRICNVGLEHSLNFRIQDHKMTLVEVEGTHTMQEIYSSLDVHVGQCYSVLF  281

Query  971   TADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQGRSLR  1150
             TADQ PKD+Y+V S+RF+S ++ TTAVLHYSNS  +VSG PPGGPT +I WSL Q RS+R
Sbjct  282   TADQAPKDFYIVASNRFSSILIDTTAVLHYSNSNQQVSGFPPGGPTIEIGWSLNQARSIR  341

Query  1151  RNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPLKLAD  1330
              NLSASGPRPNPQGSYHYGMI   RTI LANSA  +NGKQRYAVN VSFV  DTPLKL D
Sbjct  342   TNLSASGPRPNPQGSYHYGMINTTRTIRLANSAGQVNGKQRYAVNSVSFVPTDTPLKLVD  401

Query  1331  YFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGYSFFV  1510
             YFKIGG F +G+IPD+P  G  +L TSV+  +YR+F+EIVF+N E  +QSWH++GY+F+V
Sbjct  402   YFKIGG-FTVGNIPDAPPGGGIHLDTSVLQTDYRTFIEIVFENKEGIMQSWHLNGYAFWV  460

Query  1511  VGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWARQYLG  1690
             VGMDGG+WT ASR +YNLRD V+R T QVYP+SWTAIY+ALDNVG+WN+RSE WARQYLG
Sbjct  461   VGMDGGKWTPASRNQYNLRDAVSRSTTQVYPKSWTAIYIALDNVGLWNLRSEFWARQYLG  520

Query  1691  QQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QQ Y+ VYT + S RD  PIP NALLCG+  GRH RPL
Sbjct  521   QQLYMNVYTESTSLRDVYPIPINALLCGKVAGRHKRPL  558



>ref|XP_009758924.1| PREDICTED: L-ascorbate oxidase homolog [Nicotiana sylvestris]
Length=548

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/522 (69%), Positives = 433/522 (83%), Gaps = 0/522 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PYRY+ W+I+YGDIYPLGV+Q+ ILINGQFPGP I  VTNDNLIINV+N L +PF
Sbjct  27    VVAEDPYRYFDWRISYGDIYPLGVRQQGILINGQFPGPDIYSVTNDNLIINVHNDLPDPF  86

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             LL+WNGLQQR+NS++DGVYGTTCPIPP KNFTY++Q KDQIGS+FYFPSL+ HKAAGG+G
Sbjct  87    LLTWNGLQQRKNSFEDGVYGTTCPIPPGKNFTYIMQVKDQIGSFFYFPSLKFHKAAGGFG  146

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
              IRI SRP IPVPF  PA DFT+L GDW K  ++ L+ IL+ G  L  PDG+ ING G +
Sbjct  147   GIRILSRPRIPVPFPEPAGDFTLLIGDWYKTDHKILQTILNHGKMLKFPDGIQINGLGPD  206

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G  FTV+PG+TYR RISNVG+  ++NFRIQGH++KLVEVEG+HT+Q+T ++LD+H+GQSY
Sbjct  207   GAKFTVEPGKTYRLRISNVGLQNTLNFRIQGHQMKLVEVEGTHTIQTTLSSLDVHVGQSY  266

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVLVTADQ  +DYY+ VSSRFT+++L +TA+LHYSNS   VSGPPP GPTT I+WSL Q 
Sbjct  267   SVLVTADQPAQDYYIAVSSRFTTQILNSTAILHYSNSKKPVSGPPPPGPTTDISWSLNQA  326

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             RS+R NL+ASGPRPNPQGSYHYG I   RTI LANSA  ++ KQRYAVNGVSF+  DTPL
Sbjct  327   RSIRTNLTASGPRPNPQGSYHYGQINVTRTIRLANSAGLVDRKQRYAVNGVSFIPADTPL  386

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADY+ I GVF +GSIPD P     +L T+VM A+YR+FVEIVF+N E+ +QSWH+DGY
Sbjct  387   KLADYYNIKGVFEVGSIPDQPTGRHIHLDTAVMGADYRAFVEIVFENRENIMQSWHLDGY  446

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGMDGG+W+ AS+ +YNL D V+RCT QVYPRSWTAIY+ LDNVGMWN+R++ WAR
Sbjct  447   SFFVVGMDGGRWSPASKKQYNLIDAVSRCTTQVYPRSWTAIYIPLDNVGMWNLRTQFWAR  506

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHTRPL  1804
             QYLGQQFYLRVYT   S+RDE PIPKNAL CGRARGR  R L
Sbjct  507   QYLGQQFYLRVYTPVQSFRDEYPIPKNALHCGRARGRAIRAL  548



>ref|NP_173603.1| SKU5 similar 8 protein [Arabidopsis thaliana]
 gb|AAF16544.1|AC013482_18 T26F17.6 [Arabidopsis thaliana]
 gb|ABE65639.1| multi-copper oxidase type I family protein [Arabidopsis thaliana]
 gb|AEE30162.1| SKU5 similar 8 protein [Arabidopsis thaliana]
Length=551

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/519 (68%), Positives = 421/519 (81%), Gaps = 2/519 (0%)
 Frame = +2

Query  239   VYGGNPYRYYTWKITYGDIYPLGVKQRAILINGQFPGPQIDCVTNDNLIINVYNYLNEPF  418
             V   +PY+++ W +TYG+I PL V Q+ ILING+FPGP I  VTNDNLIINV+N+L+EPF
Sbjct  22    VAAEDPYKFFEWHVTYGNISPLKVAQQGILINGKFPGPDIAAVTNDNLIINVFNHLDEPF  81

Query  419   LLSWNGLQQRRNSWQDGVYGTTCPIPPRKNFTYMLQAKDQIGSYFYFPSLRMHKAAGGYG  598
             L+SW+G++  RNS+QDGVYGTTCPIPP KN+TY LQ KDQIGS++YFPSL  HKAAGG+G
Sbjct  82    LISWSGIRNWRNSYQDGVYGTTCPIPPGKNYTYALQVKDQIGSFYYFPSLGFHKAAGGFG  141

Query  599   AIRIYSRPLIPVPFAPPARDFTVLAGDWSKRSYRQLEYILDSGHNLPLPDGLLINGRGWN  778
             AIRI SRP IPVPF  PA D+TVL GDW K +++ L   LD+G  LP PDG+LINGRG +
Sbjct  142   AIRISSRPRIPVPFPAPAGDYTVLIGDWYKTNHKDLRAQLDNGGKLPFPDGILINGRG-S  200

Query  779   GYTFTVDPGRTYRFRISNVGIATSINFRIQGHKLKLVEVEGSHTVQSTFTNLDIHLGQSY  958
             G T  ++PG+TYR RISNVG+  S+NFRIQ HK+KLVEVEG+HT+Q+ F++LD+H+GQSY
Sbjct  201   GATLNIEPGKTYRLRISNVGLQNSLNFRIQNHKMKLVEVEGTHTIQTPFSSLDVHVGQSY  260

Query  959   SVLVTADQQPKDYYVVVSSRFTSRVLTTTAVLHYSNSFTRVSGPPPGGPTTQINWSLFQG  1138
             SVL+TADQ  KDYY+VVSSRFTS++L T  VLHYSNS   VSGP P  P  Q+ WS  Q 
Sbjct  261   SVLITADQPAKDYYIVVSSRFTSKILITAGVLHYSNSAGPVSGPIPEAPI-QLRWSFDQA  319

Query  1139  RSLRRNLSASGPRPNPQGSYHYGMIKPARTIMLANSAPYINGKQRYAVNGVSFVNPDTPL  1318
             R+++ NL+ASGPRPNPQG+YHYG IK  RTI LA+SA  INGKQRYAVN  SF   DTPL
Sbjct  320   RAIKTNLAASGPRPNPQGTYHYGKIKVTRTIKLASSAGNINGKQRYAVNSASFYPTDTPL  379

Query  1319  KLADYFKIGGVFNLGSIPDSPRWGSAYLATSVMDANYRSFVEIVFQNWEDTVQSWHIDGY  1498
             KLADYFKI GV+N GSIPD P  G+ Y  TSVM  +Y++FVEIVF+NWED VQ+WH+DGY
Sbjct  380   KLADYFKIAGVYNPGSIPDQPTHGAIYPVTSVMQTDYKAFVEIVFENWEDIVQTWHLDGY  439

Query  1499  SFFVVGMDGGQWTEASRTRYNLRDTVARCTVQVYPRSWTAIYMALDNVGMWNIRSEDWAR  1678
             SFFVVGM+ G+W+ ASR  YNL D V+RCTVQVYPRSWTAIY++LDNVGMWN+RSE W R
Sbjct  440   SFFVVGMELGKWSAASRKVYNLNDAVSRCTVQVYPRSWTAIYVSLDNVGMWNLRSELWER  499

Query  1679  QYLGQQFYLRVYTSTNSYRDELPIPKNALLCGRARGRHT  1795
             QYLGQQFY+RVYT + S RDE  IPKNALLCGRA G HT
Sbjct  500   QYLGQQFYMRVYTPSTSLRDEYLIPKNALLCGRATGHHT  538



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6306561668116